International Nuclear Information System (INIS)
Lal, Siddhartha
2007-09-01
Motivated by surprises in recent experimental findings, we study transport in a model of a quantum Hall edge system with a gate-voltage controlled constriction. A finite backscattered current at finite edge-bias is explained as arising from the splitting of edge current caused by the difference in the filling fractions of the bulk (ν 1 ) and constriction (ν 2 ) quantum Hall fluid regions. We develop a hydrodynamic theory for bosonic edge modes inspired by this model. The constriction region splits the incident long-wavelength chiral edge density-wave excitations among the transmitting and reflecting edge states encircling it. The competition between two interedge tunneling processes taking place inside the constriction, related by a quasiparticle-quasihole (qp-qh) symmetry, is accounted for by computing the boundary theories of the system. This competition is found to determine the strong coupling configuration of the system. A separatrix of qp-qh symmetric gapless critical states is found to lie between the relevant RG flows to a metallic and an insulating configuration of the constriction system. This constitutes an interesting generalisation of the Kane-Fisher quantum impurity model. The features of the RG phase diagram are also confirmed by computing various correlators and chiral linear conductances of the system. In this way, our results find excellent agreement with many recent puzzling experimental results for the cases of ν 1 = 1/3, 1. We also discuss and make predictions for the case of a constriction system with ν 2 = 5/2. (author)
Type QH-200 conveyor-belt nuclear scale
International Nuclear Information System (INIS)
Li Shuming; Dong Shiyuan; Li Furong; Wan Zemin
1991-01-01
Type QH-200 conveyor-belt nuclear scale is a reliable and on-line device that weighs solids mass flow continuously by γ-ray absorption and scattering. The operation principle and measuring method are described. And some factors influencing the accuracy are discussed. The full scale total weight of type QH-200 nuclear scale is 10 6 t. The result of calibration in the industrial field shows that the accuracy of QH-200 is better than ±1.0% for typical belt loading
Sequence Data: QH06665 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH06665 KG_XK2747 c/t tggttgaatgaaaaacaaacaaaaaaaagaaattgcaaatcaataygtagactatggtcttatttatgtaaa...tataatattaatgatgacaatctgctctaaagatgaaattgtctggttataacatggtcctgctgccttaggattgataagggaaggggaaaaagagagtgacaaaaggggaagaaaatgaaaaagggaggagaaggtaataaaaa
Sequence Data: QH13367 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH13367 KG00D1960 c/t tgccttcaaagtaaaaccacaagtactttaggataatttttcaagagtgtacaaaaagacaaaaattaaaaacttctaaa...tgaggacagtctagtttaygaattatttaaaacttctaaattttaatgattcataagtgtgtagaaaacaggcaacaaatttcttcaa
Sequence Data: QH12765 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH12765 KG00D1789 a/g aagaggtatttgcacctctgaaagggcacaaaaaaaragagagagagagaaagagaaagaaagaaaaaagaaataaagaaagaaa...aagagagaaagtggtacaagcagttcttataaaaaataaaactatgtgtcactatttcaacttgtctttattgaaactgca
Sequence Data: QH06556 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH06556 KG11K2604 c/t cacaaaaataagtccttgtccagcaaaaatcacctttacacaggtttgcaagacagaccacagataaaa...cattttcaatgcatttaagaaaagggttgatgtccctaataaactaaaaatgaataacytacctactaatcaatataaaaagagtacttttcagaatcgttttagatttttacaacgacatgtgccattaaaaaca
Sequence Data: QH12123 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH12123 KG00D1694 a/g tcccatagaaaggacccaaaaaaggggtggggcaaagggtgataaagacatggtatcaccatagaaaaa...tgrcatcaccatagaaaaaataaaaatcctatgaagagtaactggaaactctctttggaaattagttatccatgtggtcagataacagtgggga
Sequence Data: QH12843 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH12843 KG00D1861 c/t aaacaaaagttaaaaccaaacaaacccatgggagtaaataagyctgtagagggaacagaaaatatacagagtaaagatgaaa...gtctaaggcagaattctaagaaacaaccatagatgttaaaatgtaaaccaacaaaatggcagaaatatgattga
Sequence Data: QH01692 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH01692 KG00B1408 a/g aagtgggggctgggattgttacatatggccaaaaatttaagcttctttcaatagtattagtattgaaataatacatctttaaaa...cgcttgagggattagatagggaaagaaaaggcacgtacaaaaaaatccaaccgatgccgatcctgtgatttacgtaacaccacaaacttgcaaaaggcaaaaaa...tcagaagcaaaaatccataaaccatcaaaatrcagaaaccaaaaatcccaagccaccacaccagaaagaaaaaaacccagaacaacagcaaaaacccctgtcctaaataaaaataaagcaaatgaacccaccgaaaa
Sequence Data: QH04613 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH04613 KG00M1523 c/t tgttttcactgtttaaagaaagtttgataaaaaattggcttaaattaaaaattaaaatacttaataattttttaaaa...tgtagaacaagtgtgcagaatactggccgtcaatggaagagggyactcgggcttttggagatgttgttgtaaagatcaaccagcacaaaagatgtccagattacatcattcagaaa...ttgaacattgtaaatgtgagtttgctttttacataatttttgttttgatacttttttataaaaatataattatggaatattaaaagtgagaaaa
Sequence Data: QH15563 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH15563 KG07K6447 c/g tgctgtctcatcttcaagacagtcaatttaaagtgaaggactsagaaatagagcttctaagggctgaaaa...cattttggtctaatttagacattaaaacgtcaattttaaatattatacaaaaaaactgccttatgtttttccccgttttaattttcagaattattgaagtaaatcaaaatcaaaa...gcaggtggaacaggatattaaagttgctatatttacactgatggtagaaataaataaaaaaggaaaagctctactgcatcagttagaggtaagtgactgcccatgggatagtata
Sequence Data: QH12621 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH12621 KG00G2325 a/g ctcaaccacacacacacacccctcaaacaccacacacccacctcaaacaccacacacacatatccctcaaacactacaaaaacac...acacacacacctcaaacaccacacatgcacacacacctgaaacaccacacacctgcctcaaacactccacacacaccacacacagacacgtacaca...gccccccgcacccagccacagcttacacgcacacagacacgcgtacgcaggagaaagggtgtcaaagcttttgctagtcgtgaaggaaragcccgcagtccatggggctgcacggttttc
Sequence Data: QH04051 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH04051 KG00K1394 at/-- ttattcctactgccctgatagttggtctggctcctagaaattcagatnntttcttccctccaggtgagawtatgcgaagaaa...ggaacactggcaaaattatttccctgattttcttctctcaggctgtctttccctcccctttaagattgtgtactccgtctcaaaaaaaaaagaaaaaaaaaa...gattgtagacccagcctataaattcataggatcaagaattcttactaacactttttctaacaaccttaaatctctgatagtagcacccac...ttgacttcgttttgtatggatagatttattctaatctctctgtagattgttttaatcccaagcaaatgcgagagcataaaa...tagtgtatttgccctccctccaggcttttctggtagtattttgtctgtgaaactaaaaggctctagctgcttttaaaaaagggaaggagtaaggatgagcttttgaaaaaaaaaaaaaaaaaaaaaccccggggggaaa
Sequence Data: QH05435 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH05435 KG00T2450 a/g tgtcacccaaaatgtacatccaaagtacaaaaagttaaaggtaaatcacgaagtattaaaaaa...tcttgttgtgcagattttgagtgtttggaaaacagtaaaaaagatgtggcattctgttattcatgccagttgttctgccaaaaatattttagctgtggaagagrg...tcatttgcaacccacggaacttctaattggaaaaaaaccctggaaaaattcagaaagcatgaaaaaagtgaaatgcatttgaagtcattggaattttggagagaatac...caattttgtgatggagctgtcagtgacgatttatctattcattcgaaacagattgagggaaataaaaagtacctaaagcttataattgaaaatattttatttcttggaaagcagtgtttaccc
Sequence Data: QH11734 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH11734 KG00K5232 c/t aaataatgagtgaccagcggtttagacgggttgcaaaggacccgagattttgggaaatgccagaaaaggatcgaaaagtcaaaa...ttgacaagagatttcgagccatgtttcatgacaagaagttcaagttgaactatgccgtggataaaagagggcgccccattagcc...ayagcactacagaggatttgaagcgtttttacgacctttcagattctgattccaatctctctggtgaagatagcaaagcattgagtcaaaagaaaataaagaagaaaaaaacccagactaaaaaagaaa...tcgattcaaaaaatctagttgagaaaaagaaagaaaccaagaaggctaatcacaagggttctgaaaataaaa...ctgatttagataattctataggaattaaaaaaatgaaaacctcatgtaaatttaagatagattcaaacataagtccgaagaaggatagcaaagaatttacacaaaaaaataagaaa
Sequence Data: QH10971 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH10971 KG06G1920 a/g ggccccaataccatcccggttaaaattgaataaaaggaaacttgcaggtcatcaggagacttctaccaaaa...gtagtgagactggatccacaaaagataattttatacaaaataatccttgtaatagtaatcctgagaaggataatgcattggctagtgatttaactaaaaccactcgtggagcttttgaaaa...taaaacacccacagatggttttatagactgtcactttggagatggracgttagaaactgagcagtcctttggactatatggaaataaatacacacttagagccaaa...cgcaaggtaaattatgagactgaagacagtgagtcaagttttgtaactcacaactcaaaaa...ttagtctacctcatcccatggaaattggtgaaagtttagatggaactctcaaatcccgaaaacgaagaaaaatgtctaaaaagctgccccctgtcatcataaagta
Sequence Data: QH03807 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH03807 KG00K1582 c/t ctctaagtatacatttttatgtagccttgacagttgaatcattttaatattttacatttccaaaaaataagtatgaggagataaa...cctaaaaataaatataaataaaaccaataaatctaatgatatattacattgattcaatgcctacaaagaattaaaaaactctcagtggtgtatattctaaggaaaaaa...gtaagatattggaaaaaattagatattgaacttaagttaatttggtatagcttacaaaacctgtatgttgatatttgggggtg...ctagtgttccatttgtggaagacaggaaatataaacatgggatggaggtgttgcagtcttgttgtctgaggtattaccygagctctttgtctaatgaccaagaaaa...ttaaggaccatggacaccaaaggtgaagctggggcaaaggtttaataagcaaaataggaaagctctttgcagtagaaggggga
Sequence Data: QH09606 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH09606 KG07G1736 a/t cctttctaaagatggaaggaaggtacaaggttgatacctgagtgcatgtaaattattgtgtttaaaatgcaccaaagaaaaaa...gtaagctagcatatgcaagtataaaaatgcttttctcaatgcaaaaaatgtttttggaaatttgttaaagtgttaagaaaacaaaaatgcattagaaaatatgaaaa...ttgttgacagtgatagctcaataaaaatttwaaaaattatgcaagttctatctgataaaagtgatatttaataaacttttagtttcttgtcattagctcttttgaaaa...tgatttttttgtattcagaacacagactccagtttagaaactaatacaaattttacctattcaagtgcttaattttacagcaaa...atggaaagtaaattttgttttgcctttatttctacagaagccactggtctcccccagacagtagtctgttataacccagaccagattcctccagaaaa
Sequence Data: QH13192 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available QH13192 KG00G2416 c/t aaatgttttgtgaccttctctatgagtatcaaataaatagctcaaaaytgaaatatttaaaatgagactagaaaa...gtatttcttaaatatggtaaagagaatataaaataaaaaattaacattacctgtaacagaaaaacattagagaaacccttcttaaaaacaagatcaaaa...tatgggcgcacattgttaccacaggtaatgctgtcctgggtattcttatatgaaaatgaaataacaagactagtaatttaaagataaaaatgttattacactgtttaaataccaggaaaaatcaaa...tactaagaaatctgaaaaataaaaattatctagaaatttcactaacaaaggtaaccaggaatagataaacaattaaa...gatcaacttcattcaagttaattaaaacctctaaatagaaattataacacttctgcagaaatgattaaataaaaaggaggtatctcagggaggtggacctgaaagaaagattaattatatattttattagatagcacattcattcttaattatcagcagaa
Zhang, Zaiqin; Ma, Hui; Liu, Zhiyuan; Geng, Yingsan; Wang, Jianhua
2018-04-01
The influence of the applied axial magnetic field on the current density distribution in the arc column and electrodes is intensively studied. However, the previous results only provide a qualitative explanation, which cannot quantitatively explain a recent experimental data on anode current density. The objective of this paper is to quantitatively determine the current constriction subjected to an axial magnetic field in high-current vacuum arcs according to the recent experimental data. A magnetohydrodynamic model is adopted to describe the high current vacuum arcs. The vacuum arc is in a diffuse arc mode with an arc current ranged from 6 kArms to 14 kArms and an axial magnetic field ranged from 20 mT to 110 mT. By a comparison of the recent experimental work of current density distribution on the anode, the modelling results show that there are two types of current constriction. On one hand, the current on the cathode shows a constriction, and this constriction is termed as the cathode-constriction. On the other hand, the current constricts in the arc column region, and this constriction is termed as the column-constriction. The cathode boundary is of vital importance in a quantitative model. An improved cathode constriction boundary is proposed. Under the improved boundary, the simulation results are in good agreement with the recent experimental data on the anode current density distribution. It is demonstrated that the current density distribution at the anode is sensitive to that at the cathode, so that measurements of the anode current density can be used, in combination with the vacuum arc model, to infer the cathode current density distribution.
Zhou, Fei; Sun, Tian-Hu; Zhao, Lei; Pan, Xi-Wu; Lu, Shan
2015-01-01
The Artemisia annua L. β-pinene synthase QH6 was previously determined to be circadian-regulated at the transcriptional level, showing a rhythmic fluctuation of steady-state transcript abundances. Here we isolated both the genomic sequence and upstream promoter region of QH6. Different regulatory elements, such as G-box (TGACACGTGGCA, -421 bp from the translation initiation site) which might have effects on rhythmic gene expression, were found. Using the yeast one-hybrid and electrophoretic mobility shift assay (EMSA), we confirmed that the bZIP transcription factor HY5 binds to this motif of QH6. Studies with promoter truncations before and after this motif suggested that this G-box was important for the diurnal fluctuation of the transgenic β-glucuronidase gene (GUS) transcript abundance in Arabidopsis thaliana. GUS gene driven by the promoter region immediately after G-box showed an arrhythmic expression in both light/dark (LD) and constant dark (DD) conditions, whereas the control with G-box retained its fluctuation in both LD and DD. We further transformed A. thaliana with the luciferase gene (LUC) driven by an 1400 bp fragment upstream QH6 with its G-box intact or mutated, respectively. The luciferase activity assay showed that a peak in the early morning disappeared in the mutant. Gene expression analysis also demonstrated that the rhythmic expression of LUC was abolished in the hy5-1 mutant.
Advances towards QH-mode viability for ELM-stable operation in ITER
International Nuclear Information System (INIS)
Garofalo, A.M.; Burrell, K.H.; DeBoo, J.C.; Schaffer, M.J.; Snyder, P.B.; Solomon, W.M.; Park, J.-K.; Lanctot, M.J.; Reimerdes, H.; McKee, G.R.; Schmitz, L.
2011-01-01
The application of static, non-axisymmetric, nonresonant magnetic fields (NRMFs) to high beta DIII-D plasmas has allowed sustained operation with a quiescent H-mode (QH-mode) edge and both toroidal rotation and neutral beam injected torque near zero. Previous studies have shown that QH-mode operation can be accessed only if sufficient radial shear in the plasma flow is produced near the plasma edge. In past experiments, this flow shear was produced using neutral beam injection (NBI) to provide toroidal torque. In recent experiments, this torque was nearly completely replaced by the torque from applied NRMFs. The application of the NRMFs does not degrade the global energy confinement of the plasma. Conversely, the experiments show that the energy confinement quality increases with lower plasma rotation. Furthermore, the NRMF torque increases plasma resilience to locked modes at low rotation. These results open a path towards QH-mode utilization as an edge-localized mode (ELM)-stable H-mode in the self-heated burning plasma scenario, where toroidal momentum input from NBI may be small or absent.
Directory of Open Access Journals (Sweden)
Fei eZhou
2015-04-01
Full Text Available The Artemisia annua L. β-pinene synthase QH6 was previously determined to be circadian-regulated at the transcriptional level, showing a rhythmic fluctuation of steady-state transcript abundances. Here we isolated both the genomic sequence and upstream promoter region of QH6. Different regulatory elements, such as G-box (TGACACGTGGCA, -421 bp from the translation initiation site which might have effects on rhythmic gene expression, were found. Using the yeast one-hybrid and electrophoretic mobility shift assay (EMSA, we confirmed that the bZIP transcription factor HY5 binds to this motif of QH6. Studies with promoter truncations before and after this motif suggested that this G-box was important for the diurnal fluctuation of the transgenic β-glucuronidase gene (GUS transcript abundance in Arabidopsis thaliana. GUS gene driven by the promoter region immediately after G-box showed an arrhythmic expression in both light/dark (LD and constant dark (DD conditions, whereas the control with G-box retained its fluctuation in both LD and DD. We further transformed A. thaliana with the luciferase gene (LUC driven by an 1400 bp fragment upstream QH6 with its G-box intact or mutated, respectively. The luciferase activity assay showed that a peak in the early morning disappeared in the mutant. Gene expression analysis also demonstrated that the rhythmic expression of LUC was abolished in the hy5-1 mutant.
Directory of Open Access Journals (Sweden)
Salin Moyses Jorge
1976-12-01
Full Text Available Os autores registram um caso de retardo neuromotor em paciente com cromossomo 1qh+. A análise cromossômica do paciente e três familiares revelou igualmente em todos, aumento do braço longo do cromossomo n.° 1. Entretanto, é considerada a possibilidade de que o quadro clínico do paciente seja subordinado também a outros fatores, não genéticos.A case of neuromotor retardation in association with chromosome 1qh+ is reported. Chromosomes analysis of the patient and three relatives showed increased long arm of the n.° 1 chromosome, in all of them. However it is emphasized that the clinical feature could be secondary to various non genetics factors, also.
Constrictive pericarditis in a contemporary Danish cohort
DEFF Research Database (Denmark)
Landex, Nadia Lander; Ihlemann, Nikolaj; Olsen, Peter Skov
2015-01-01
OBJECTIVES: The aetiology and outcome of constrictive pericarditis vary between geographic regions and has changed over time. We describe the diagnostic work-up and outcome in a contemporary cohort of Danish patients with constrictive pericarditis. DESIGN: Hospital databases were searched...... and inflammatory disease were the most prevalent underlying conditions. Diagnosis was made primarily by echocardiography and right- and left-sided cardiac catheterisation. Echocardiography was particularly notable for dilated inferior caval vein, increased E/A ratio, and high septal tissue velocity in addition...... to the presence of septal bounce. Pericardiectomy was performed in 47 patients with a 30-day mortality of 8.5%. Clinical improvement was noted in 69% of cases. Several echocardiographic parameters normalised with time, including markers of diastolic function. CONCLUSIONS: Long-term outcome after pericardiectomy...
Diffuse and constricted modes of a dc discharge in neon: Simulation of the hysteresis transition
International Nuclear Information System (INIS)
Shkurenkov, I. A.; Mankelevich, Yu. A.; Rakhimova, T. V.
2008-01-01
Results are presented from theoretical studies of high-pressure (∼100 Torr) dc discharges in neon. The diffuse and constricted discharge modes are studied using a model including the equation of balance for charged and excited particles, heat conduction equations for the neutral gas and plasma electrons, and Poisson's equation for the radial electric field at a fixed total discharge current. A specific feature of the constricted mode in the investigated range of low fields and high degrees of ionization is that the excitation and ionization rates in the center of the discharge tube and at the periphery differ by several orders of magnitude. This implies that, in the constricted mode, the region where the electron energy distribution function is Maxwellian due to electron-electron collisions may adjoin the region (beyond the constriction zone) where the high-energy part of the distribution function is depleted. The hysteresis transition between the diffuse and constricted modes is analyzed. A transition from the constricted to the diffuse mode can be regarded as a manifestation of the nonlocal character of the formation of the electron distribution function, specifically, the diffusion of high-energy electrons capable of producing gas ionization from the central (constricted) region toward the periphery. The nonlocal formation of the distribution function is described by a nonlocal kinetic equation accounting for electron-electron collisions and electron transport along the radius of the discharge tube. Since only high-energy electrons produce gas ionization, the effect of the nonlocal formation of the electron distribution function is taken into account by introducing the effective temperature of the high-energy part of the distribution function and solving the equation for the radial profile of the high-energy part of the distribution function. This approach allows one to approximately take into account the nonlocal character of the electron distribution
Congenital constriction of the foramen of Monro
International Nuclear Information System (INIS)
Marions, O.; Boethius, J.
1986-01-01
We report two cases of hydrocephalus in adults. The radiological investigations and direct inspection during surgery in one of the cases indicate that the hydrocephalus is caused in both cases by a benign stricture in the region of the foramen of Monro and that this constriction is congenital. This origin of hydrocephalus has not been reported previously in adults. (orig.)
Sung, C.; Rhodes, T. L.; Staebler, G. M.; Yan, Z.; McKee, G. R.; Smith, S. P.; Osborne, T. H.; Peebles, W. A.
2018-05-01
For the first time, we report increased edge electron temperature and density turbulence levels ( T˜ e and n˜ e) in Edge Localized Mode free Quiescent H-mode (ELM-free QH-mode) plasmas as compared to the ELMing time period. ELMs can severely damage plasma facing components in fusion plasma devices due to their large transient energy transport, making ELM-free operation a highly sought after goal. The QH-mode is a candidate for this goal as it is ELM-free for times limited only by hardware constraints. It is found that the driving gradients decrease during the QH-mode compared to the ELMing phase, however, a significant decrease in the ExB shearing rate is also observed that taken together is consistent with the increased turbulence. These results are significant as the prediction and control of ELM-free H-mode regimes are crucial for the operation of future fusion devices such as ITER. The changes in the linear growth rates calculated by CGYRO [Candy et al., J. Comput. Phys. 324, 73 (2016)] and the measured ExB shearing rate between ELMing and QH-mode phases are qualitatively consistent with these turbulence changes. Comparison with ELMing and 3D fields ELM suppressed H-mode finds a similar increase in T˜ e and n˜ e, however, with distinctly different origins, the increased driving gradients rather than the changes in the ExB shearing rate in 3D fields ELM suppressed the H-mode. However, linear gyrokinetic calculation results are generally consistent with the increased turbulence in both ELM-controlled discharges.
Electrophysiology of Axonal Constrictions
Johnson, Christopher; Jung, Peter; Brown, Anthony
2013-03-01
Axons of myelinated neurons are constricted at the nodes of Ranvier, where they are directly exposed to the extracellular space and where the vast majority of the ion channels are located. These constrictions are generated by local regulation of the kinetics of neurofilaments the most important cytoskeletal elements of the axon. In this paper we discuss how this shape affects the electrophysiological function of the neuron. Specifically, although the nodes are short (about 1 μm) in comparison to the distance between nodes (hundreds of μm) they have a substantial influence on the conduction velocity of neurons. We show through computational modeling that nodal constrictions (all other features such as numbers of ion channels left constant) reduce the required fiber diameter for a given target conduction velocity by up to 50% in comparison to an unconstricted axon. We further show that the predicted optimal fiber morphologies closely match reported fiber morphologies. Supported by The National Science Foundation (IOS 1146789)
Echocardiography: pericardial thickening and constrictive pericarditis.
Schnittger, I; Bowden, R E; Abrams, J; Popp, R L
1978-09-01
A total of 167 patients with pericardial thickening noted on M node echocardiography were studied retrospectively. After the echocardiogram, 72 patients underwent cardiac surgery, cardiac catheterization or autopsy for various heart diseases; 96 patients had none of these procedures. In 49 patients the pericardium was directly visualized at surgery or autopsy; 76 percent of these had pericardial thickening or adhesions. In another 8 percent, pericardial adhesions were absent, but no comment had been made about the appearance of the pericardium itself. In the remaining 16 percent, no comment had been made about the pericardium or percardial space. Cardiac catheterization in 64 patients revealed 24 with hemodynamic findings of constrictive pericarditis or effusive constrictive disease. Seven echocardiographic patterns consistent with pericardial adhesions or pericardial thickening are described and related when possible to the subsequent findings at heart surgery or autopsy. The clinical diagnoses of 167 patients with pericardial thickening are presented. The hemodynamic diagnosis of constrictive pericardial disease was associated with the echocardiographic finding of pericardial thickening, but there were no consistent echocardiographic patterns of pericardial thickening diagnostic of constriction. However, certain other echocardiographic abnormalities of left ventricular posterior wall motion and interventricular septal motion and a high E-Fo slope were suggestive of constriction.
Toward Defining "Vocal Constriction": Practitioner Perspectives.
Lemon-McMahon, Belinda; Hughes, Diane
2018-01-01
This research investigated the terminology used in relation to constriction of the singing voice from a range of practitioner perspectives. It focused on the locality, causes, consequences, management, trends, identification, and vocabulary of constriction. The research aimed to develop a holistic understanding of the term "vocal constriction" from participant experiences and perceptions (N = 10). Data collection occurred through in-depth, semi-structured interviews with a range of voice care professionals. Participants included three professional groups: (1) Ear, Nose, and Throat medical specialists or laryngologists, (2) speech pathologists or speech therapists, and (3) singing teachers. Purposive sampling was used to ensure that the participants from groups 1 and 2 had extensive experience with singers in their practice. The singing teachers were experienced in either classical or contemporary styles, or both. Participant responses highlighted a discrepancy in preferred terminology, with "constriction" being less favored overall. Several anatomical locations were identified including postural, supraglottic (anteroposterior and false fold), articulatory, and in the intrinsic and extrinsic laryngeal musculature; psychological issues were also identified. Primary causes, secondary causes, and influencing factors were identified. Inefficient technique and poor posture or alignment were considered primary causes; similarly, emotion and anxiety or stress were identified as influencing factors by the majority of participants. There was less uniformity in responses regarding other causes. The major findings of this research are the respective participant group distinctions, an uncertainty regarding anteroposterior constriction, and that the location and effects of constriction are individual to the singer and must be considered contextually. A definition is offered, and areas for further research are identified. Copyright © 2018 The Voice Foundation. Published by
Transport in constricted quantum Hall systems: beyond the Kane-Fisher paradigm
International Nuclear Information System (INIS)
Lal, Siddhartha
2007-08-01
A simple model of edge transport in a constricted quantum Hall system with a lowered local fi lling factor is studied. The current backscattered from the constriction is explained from a matching of the properties of the edge-current excitations in the constriction (ν 2 ) and bulk (ν 1 ) regions. We develop a hydrodynamic theory for bosonic edge modes inspired by this model, stressing the importance of boundary conditions in elucidating the nature of current transport. By invoking a generalised quasiparticle-quasihole symmetry of the quantum Hall circuit system, we fi nd that a competition between two tunneling process determines the fate of the low-bias transmission conductance. A novel generalisation of the Kane-Fisher quantum impurity model is found, describing transitions from a weak-coupling theory at partial transmission to strong- coupling theories for perfect transmission and reflection as well as a new symmetry dictated fixed point. These results provide satisfactory explanations for recent experimental results at fi lling-factors of 1/3 and 1. (author)
A constricted quantum Hall system as a beam-splitter: understanding ballistic transport on the edge
International Nuclear Information System (INIS)
Lal, Siddhartha
2007-09-01
We study transport in a model of a quantum Hall edge system with a gate-voltage controlled constriction. A finite backscattered current at finite edge-bias is explained from a Landauer- Buttiker analysis as arising from the splitting of edge current caused by the difference in the filling fractions of the bulk (ν 1 ) and constriction(ν 2 ) quantum Hall fluid regions. We develop a hydrodynamic theory for bosonic edge modes inspired by this model. The constriction region splits the incident long-wavelength chiral edge density-wave excitations among the transmitting and reflecting edge states encircling it. These findings provide satisfactory explanations for several puzzling recent experimental results. These results are confirmed by computing various correlators and chiral linear conductances of the system. In this way, our results find excellent agreement with some of the recent puzzling experimental results for the cases of ν 1 = 1/3, 1. (author)
Changes of the eye optics after iris constriction
Directory of Open Access Journals (Sweden)
Robert Montés-Micó
2010-10-01
Conclusion: Iris constriction slightly modifies the optics of the eye. The small hyperopic shift of the best image plane after iris constriction may be explained by a change in the lens shape and/or position.
A pressure-gradient mechanism for vortex shedding in constricted channels
Boghosian, M. E.; Cassel, K. W.
2013-01-01
Numerical simulations of the unsteady, two-dimensional, incompressible Navier–Stokes equations are performed for a Newtonian fluid in a channel having a symmetric constriction modeled by a two-parameter Gaussian distribution on both channel walls. The Reynolds number based on inlet half-channel height and mean inlet velocity ranges from 1 to 3000. Constriction ratios based on the half-channel height of 0.25, 0.5, and 0.75 are considered. The results show that both the Reynolds number and constriction geometry have a significant effect on the behavior of the post-constriction flow field. The Navier–Stokes solutions are observed to experience a number of bifurcations: steady attached flow, steady separated flow (symmetric and asymmetric), and unsteady vortex shedding downstream of the constriction depending on the Reynolds number and constriction ratio. A sequence of events is described showing how a sustained spatially growing flow instability, reminiscent of a convective instability, leads to the vortex shedding phenomenon via a proposed streamwise pressure-gradient mechanism. PMID:24399860
[Permanent constrictions of the jaws (author's transl)].
Dupuis, A; Michaud, J
1981-01-01
Permanent constrictions of the jaws are of various types depending on the site of the lesion: temporomaxillary ankylosis, extra-articular constrictions of bone, skin, muscle, or mucosal origin, and those arising from tumors. The commonest cause is injury, those due to infection being currently less frequently observed, which cannot be said for those of tumoral origin. The consequences are difficulty in taking foud and poor buccodental hygiene, while temporomaxillary ankylosis in children provokes mandibular growth disturbances. Surgical treatment is aimed at removing the constriction. Total resection of the ankylosed block is essential to avoid recurrences, while reeducation of buccal opening must be started early and continued for long periods in all cases.
Congenital Constriction Band Syndrome
Rajesh Gupta, Fareed Malik, Rishabh Gupta, M.A.Basit, Dara Singh
2008-01-01
Congenital constriction bands are anomalous bands that encircle a digit or an extremity. Congenitalconstriction band syndrome is rare condition and is mostly associated with other musculoskeletaldisorders.We report such a rare experience.
Propionibacterium acnes: A Treatable Cause of Constrictive Pericarditis
Directory of Open Access Journals (Sweden)
Daniel Cruz
2015-01-01
Full Text Available In this case report we share a case of infective Pericarditis caused by Propionibacterium acnes (P. acnes in an immune-competent, nonsurgical patient. This case and review will illustrate the importance of considering P. acnes as a cause of idiopathic pericardial effusion and effusive constrictive disease. The patient was a 61-year-old male with history of osteoarthritis of the knee. He received an intra-articular steroid injection in July 2013. Two months later, he presented with atrial fibrillation and heart failure. He was found to have pericardial and bilateral pleural effusions which grew P. acnes. This organism was initially considered to be contaminant; however, as P. acnes was isolated from both pleural and pericardial fluids, he was started on oral amoxicillin. He was noted to have recurrence of effusions within 2 weeks with evidence of constrictive physiology by echocardiography. Treatment was subsequently changed to intravenous Penicillin G with marked symptomatic improvement, resolution of pericardial/pleural effusions, and no echocardiographic evidence of constrictive pericarditis at 10 weeks follow-up. Pursuit and treatment of P. acnes could lead to prevention of constrictive pericarditis. We believe that further studies are needed to assess prevalence of P. acnes and response to intravenous Penicillin G in patients presenting with effusive constrictive disease.
Molecular analysis of Hb Q-H disease and Hb Q-Hb E in a Singaporean family.
Tan, J; Tay, J S; Wong, Y C; Kham, S K; Bte Abd Aziz, N; Teo, S H; Wong, H B
1995-01-01
Hb Q (alpha 74Asp-His) results from a mutation in the alpha-gene such that abnormal alpha Q-chains are synthesized. The alpha Q-chains combine with the normal Beta A-chains to form abnormal Hb alpha 2Q beta 2A (Hb Q). Hb Q-H disease is rare, and has been reported only in the Chinese. We report here a Chinese family, were the mother diagnosed with Hb Q-H disease and the father with Hb E heterozygosity and a child with Hb Q-E-thalassemia. Thalassemia screening of the mother's blood revealed a Hb level of 6.8g/dl with low MCV and MCH. Her blood film was indicative of thalassemia. Cellulose acetate electrophoresis showed Hb H and Hb Q with the absence of Hb A. Globin chain biosynthesis was carried out and alpha Q- and beta-chains were detected. Normal alpha- chains were absent. Digestion of the mother's DNA with Bam HI and Bgl II followed by hybridization with the 1.5 kb alpha-Pst probe showed a two alpha-gene deletion on one chromosome and the -alpha Q chain mutant with the -alpha 4.2 defect on the other chromosome. DNA amplification studies indicated the two-gene deletion to be of the -SEA/ defect. The patient was concluded to possess Hb Q-H disease (--SEA/-alpha 4.2Q). Cellulose acetate electrophoresis of the father's blood showed the presence of Hb A, F and E. Molecular analysis of the father's DNA confirmed an intact set of alpha-genes (alpha alpha/alpha alpha). Globin chain biosynthesis of fetal blood of their child showed gamma, beta A, beta E, alpha A and alpha Q-chains. Molecular analysis of the child's DNA showed one alpha-gene deletion, thus giving a genotype of alpha alpha/-alpha 4.2Q beta beta E.
Poor outcome in radiation-induced constrictive pericarditis
International Nuclear Information System (INIS)
Karram, T.; Rinkevitch, D.; Markiewicz, W.
1993-01-01
The purpose was to compare the outcome of patients with radiation-induced constrictive pericarditis versus patients with constiction due to another etiology. Twenty patients with constrictive pericarditis were seen during 1975-1986 at a single medical center. Six had radiation-induced constrictive pericarditis (Group A). The etiology was idiopathic in ten subjects and secondary to carcinomatous encasement, chronic renal failure, purulent infection and tuberculosis in one patient each (Group B, N = 14). Meang age was 53.4 ± 15.5 years. Extensive pericardiectomy was performed in 3/6 Group A and 13/14 Group B patients. All Group A patients died, 4 weeks - 11 years post-diagnosis (median = 10 months). Two Group A patients died suddenly, one died post-operatively of respiratory failure, another of pneumonia and two of recurrent carcinoma. Thirteen Group B patients are alive (median follow-up = 72 months). The only death in this group was due to metastatic cancer. The poor outcome with radiation-induced constriction is probably multi-factorial. Poor surgical outcome is to be expected in patients with evidence of recurrent tumor, high-dose irradiation, pulmonary fibrosis or associated radiation-induced myocardinal, valvular or coronary damage
Poor outcome in radiation-induced constrictive pericarditis
Energy Technology Data Exchange (ETDEWEB)
Karram, T.; Rinkevitch, D.; Markiewicz, W. (Technion Medical School, Haifa (Israel))
1993-01-15
The purpose was to compare the outcome of patients with radiation-induced constrictive pericarditis versus patients with constiction due to another etiology. Twenty patients with constrictive pericarditis were seen during 1975-1986 at a single medical center. Six had radiation-induced constrictive pericarditis (Group A). The etiology was idiopathic in ten subjects and secondary to carcinomatous encasement, chronic renal failure, purulent infection and tuberculosis in one patient each (Group B, N = 14). Meang age was 53.4 [+-] 15.5 years. Extensive pericardiectomy was performed in 3/6 Group A and 13/14 Group B patients. All Group A patients died, 4 weeks - 11 years post-diagnosis (median = 10 months). Two Group A patients died suddenly, one died post-operatively of respiratory failure, another of pneumonia and two of recurrent carcinoma. Thirteen Group B patients are alive (median follow-up = 72 months). The only death in this group was due to metastatic cancer. The poor outcome with radiation-induced constriction is probably multi-factorial. Poor surgical outcome is to be expected in patients with evidence of recurrent tumor, high-dose irradiation, pulmonary fibrosis or associated radiation-induced myocardinal, valvular or coronary damage.
Penile constriction injury: An experience of four cases
Directory of Open Access Journals (Sweden)
Ajit Somaji Sawant
2016-01-01
Full Text Available Penile injury due to constriction by a foreign object is a rare known complication, commonly seen in pediatric age group. We report four cases of penile constriction injury in adults due to various foreign objects and different indications. Between October 2014 and March 2016, four patients (mean age 42.5 years presented with penile constriction injury with duration at presentation ranging from 18 h to 2 months. One patient had complete transection of the corpus and penile urethra. Three patients were managed successfully with daily dressings followed by split-skin grafting in one patient. One patient required delayed primary suturing after the resolution of local edema. The outcome was satisfactory in all patients with retained erectile function. Early medical attention and management is the key to success in penile constriction injury cases and to avoid complications and morbidity. Prompt removal can be challenging in cases of metal foreign bodies.
Aad, Georges; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arnold, Hannah; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bannoura, Arwa A E; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernard, Clare; Bernat, Pauline; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Boddy, Christopher Richard; Boehler, Michael; Boek, Jennifer; Boek, Thorsten Tobias; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Bohm, Jan; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Borri, Marcello; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boutouil, Sara; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozovic-Jelisavcic, Ivanka; Bracinik, Juraj; Branchini, Paolo; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Brelier, Bertrand; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Richard; Bressler, Shikma; Bristow, Kieran; Bristow, Timothy Michael; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Gareth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bundock, Aaron Colin; Burckhart, Helfried; Burdin, Sergey; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Buszello, Claus-Peter; Butler, Bart; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Byszewski, Marcin; Cabrera Urbán, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarda, Stefano; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Antony; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caughron, Seth; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chan, Kevin; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Charfeddine, Driss; Charlton, Dave; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Yujiao; Cheng, Hok Chuen; Cheng, Yangyang; Cheplakov, Alexander; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiefari, Giovanni; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Chouridou, Sofia; Chow, Bonnie Kar Bo; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciocio, Alessandra; Cirkovic, Predrag; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clemens, Jean-Claude; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Cogan, Joshua Godfrey; Coggeshall, James; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collins-Tooth, Christopher; Collot, Johann; Colombo, Tommaso; Colon, German; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Connell, Simon Henry; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cooper-Smith, Neil; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Côté, David; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cuciuc, Constantin-Mihai; Cuenca Almenar, Cristóbal; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Daniells, Andrew Christopher; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darlea, Georgiana Lavinia; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davignon, Olivier; Davison, Adam; Davison, Peter; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; De Zorzi, Guido; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dechenaux, Benjamin; Dedovich, Dmitri; Degenhardt, James; Deigaard, Ingrid; Del Peso, Jose; Del Prete, Tarcisio; Deliot, Frederic; Delitzsch, Chris Malena; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Barros do Vale, Maria Aline; Do Valle Wemans, André; Doan, Thi Kieu Oanh; Dobos, Daniel; Dobson, Ellie; Doglioni, Caterina; Doherty, Tom; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dos Anjos, Andre; Dova, Maria-Teresa; Doyle, Tony; Dris, Manolis; Dubbert, Jörg; Dube, Sourabh; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Dudziak, Fanny; Duflot, Laurent; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Dwuznik, Michal; Dyndal, Mateusz; Ebke, Johannes; Edson, William; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Engelmann, Roderich; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Fehling-Kaschek, Mirjam; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Fernandez Perez, Sonia; Ferrag, Samir; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Julia; Fisher, Wade Cameron; Fitzgerald, Eric Andrew; Flechl, Martin; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Florez Bustos, Andres Carlos; Flowerdew, Michael; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Franchino, Silvia; Francis, David; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; French, Sky; Friedrich, Conrad; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gandrajula, Reddy Pratap; Gao, Jun; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giugni, Danilo; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkialas, Ioannis; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Glonti, George; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godfrey, Jennifer; Godlewski, Jan; Goeringer, Christian; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez Silva, Laura; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorfine, Grant; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Graziani, Enrico; Grebenyuk, Oleg; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grigalashvili, Nugzar; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Groth-Jensen, Jacob; Grout, Zara Jane; Grybel, Kai; Guan, Liang; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guicheney, Christophe; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Gunther, Jaroslav; Guo, Jun; Gupta, Shaun; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guttman, Nir; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Haefner, Petra; Hageboeck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Hall, David; Halladjian, Garabed; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hanna, Remie; Hansen, John Renner; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Harrison, Paul Fraser; Hartjes, Fred; Hasegawa, Satoshi; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Lukas; Heisterkamp, Simon; Hejbal, Jiri; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Hengler, Christopher; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Hensel, Carsten; Herbert, Geoffrey Henry; Hernández Jiménez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoffman, Julia; Hoffmann, Dirk; Hofmann, Julia Isabell; Hohlfeld, Marc; Holmes, Tova Ray; Hong, Tae Min; Hooft van Huysduynen, Loek; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Hurwitz, Martina; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Idarraga, John; Ideal, Emma; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Iliadis, Dimitrios; Ilic, Nikolina; Inamaru, Yuki; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Iturbe Ponce, Julia Mariana; Ivarsson, Jenny; Ivashin, Anton; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, John; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansen, Hendrik; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanty, Laura; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Ji, Weina; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Johansson, Erik; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kajomovitz, Enrique; Kama, Sami; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kanno, Takayuki; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karastathis, Nikolaos; Karnevskiy, Mikhail; Karpov, Sergey; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Keener, Paul; Kehoe, Robert; Keil, Markus; Keller, John; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Khodinov, Alexander; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hee Yeun; Kim, Hyeon Jin; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kitamura, Takumi; Kittelmann, Thomas; Kiuchi, Kenji; Kladiva, Eduard; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Klok, Peter; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Koll, James; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; König, Sebastian; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotov, Sergey; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kurumida, Rie; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; La Rosa, Alessandro; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laier, Heiko; Lambourne, Luke; Lammers, Sabine; Lampen, Caleb; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, Clemens; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Le, Bao Tran; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmacher, Marc; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzen, Georg; Lenzi, Bruno; Leone, Robert; Leonhardt, Kathrin; Leontsinis, Stefanos; Leroy, Claude; Lester, Christopher; Lester, Christopher Michael; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Bo; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Shu; Li, Yichen; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Lin, Simon; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loddenkoetter, Thomas; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Loh, Chang Wei; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Lombardo, Vincenzo Paolo; Long, Brian Alexander; Long, Jonathan; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Lungwitz, Matthias; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Machado Miguens, Joana; Macina, Daniela; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeno, Mayuko; Maeno, Tadashi; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Mahmoud, Sara; Maiani, Camilla; Maidantchik, Carmen; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany Andreina; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marjanovic, Marija; Marques, Carlos; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian; Martin, Brian Thomas; Martin, Jean-Pierre; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Homero; Martinez, Mario; Martin-Haugh, Stewart; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Matricon, Pierre; Matsushita, Takashi; Mättig, Peter; Mättig, Stefan; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazzaferro, Luca; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Meade, Andrew; Mechnich, Joerg; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Meric, Nicolas; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Middleton, Robin; Migas, Sylwia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Minaenko, Andrey; Miñano Moya, Mercedes; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Mitsui, Shingo; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Moeller, Victoria; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Mönig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Moraes, Arthur; Morange, Nicolas; Morel, Julien; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Morvaj, Ljiljana; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Thibaut; Mueller, Timo; Muenstermann, Daniel; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Nanava, Gizo; Narayan, Rohin; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negri, Guido; Negrini, Matteo; Nektarijevic, Snezana; Nelson, Andrew; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newcomer, Mitchel; Newman, Paul; Nguyen, Duong Hai; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Norberg, Scarlet; Nordberg, Markus; Novakova, Jana; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; Nuti, Francesco; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Ohshima, Takayoshi; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panduro Vazquez, William; Pani, Priscilla; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pearce, James; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrino, Roberto; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Jorgen; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Petteni, Michele; Pettersson, Nora Emilia; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pires, Sylvestre; Pitt, Michael; Pizio, Caterina; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Poddar, Sahill; Podlyski, Fabrice; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Pohl, Martin; Polesello, Giacomo; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Pospelov, Guennady; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Price, Darren; Price, Joe; Price, Lawrence; Prieur, Damien; Primavera, Margherita; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Przysiezniak, Helenka; Ptacek, Elizabeth; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quarrie, David; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Qureshi, Anum; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Randle-Conde, Aidan Sean; Rangel-Smith, Camila; Rao, Kanury; Rauscher, Felix; Rave, Tobias Christian; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reisin, Hernan; Relich, Matthew; Rembser, Christoph; Ren, Huan; Ren, Zhongliang; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Resende, Bernardo; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Ridel, Melissa; Rieck, Patrick; Rieger, Julia; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Rodrigues, Luis; Roe, Shaun; Røhne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romeo, Gaston; Romero Adam, Elena; Rompotis, Nikolaos; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Matthew; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sacerdoti, Sabrina; Saddique, Asif; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvachua Ferrando, Belén; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sartisohn, Georg; Sasaki, Osamu; Sasaki, Yuichi; Satsounkevitch, Igor; Sauvage, Gilles; Sauvan, Emmanuel; Savard, Pierre; Savu, Dan Octavian; Sawyer, Craig; Sawyer, Lee; Saxon, David; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaefer, Ralph; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R. Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Christopher; Schmitt, Sebastian; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schram, Malachi; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwegler, Philipp; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scott, Bill; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekula, Stephen; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellers, Graham; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Seuster, Rolf; Severini, Horst; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shank, James; Shao, Qi Tao; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Sherwood, Peter; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shin, Taeksu; Shiyakova, Mariya; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simoniello, Rosa; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snow, Joel; Snyder, Scott; Sobie, Randall; Socher, Felix; Sodomka, Jaromir; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solfaroli Camillocci, Elena; Solodkov, Alexander; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Song, Hong Ye; Soni, Nitesh; Sood, Alexander; Sopczak, Andre; Sopko, Vit; Sopko, Bruno; Sorin, Veronica; Sosebee, Mark; Soualah, Rachik; Soueid, Paul; Soukharev, Andrey; South, David; Spagnolo, Stefania; Spanò, Francesco; Spearman, William Robert; Spighi, Roberto; Spigo, Giancarlo; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Staerz, Steffen; Stahlman, Jonathan; Stamen, Rainer; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steele, Genevieve; Steinberg, Peter; Stekl, Ivan; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramania, Halasya Siva; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takahashi, Yuta; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tamsett, Matthew; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanasijczuk, Andres Jorge; Tani, Kazutoshi; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thoma, Sascha; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thong, Wai Meng; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Topilin, Nikolai; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Tran, Huong Lan; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Triplett, Nathan; Trischuk, William; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turk Cakir, Ilkay; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Urbaniec, Dustin; Urquijo, Phillip; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Berg, Richard; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Virzi, Joseph; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Adrian; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Wolfgang; Wagner, Peter; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Walsh, Brian; Wang, Chao; Wang, Chiho; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watanabe, Ippei; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weigell, Philipp; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wendland, Dennis; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, John; Wilson, Alan; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winter, Benedict Tobias; Wittgen, Matthias; Wittig, Tobias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wright, Michael; Wu, Mengqing; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yamada, Miho; Yamaguchi, Hiroshi; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Un-Ki; Yang, Yi; Yanush, Serguei; Yao, Liwen; Yao, Weiming; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yen, Andy L; Yildirim, Eda; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zaytsev, Alexander; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Lei; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Lei; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Zinonos, Zinonas; Ziolkowski, Michael; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zutshi, Vishnu; Zwalinski, Lukasz
2014-01-01
A search is performed for flavour-changing neutral currents in the decay of a top quark to an up-type ($c, u$) quark and a Higgs boson, where the Higgs boson decays to two photons. The proton-proton collision data set used corresponds to 4.7 fb$^{-1}$ at $\\sqrt{s}$ = 7 TeV and 20.3 fb$^{-1}$ at $\\sqrt{s}$ = 8 TeV collected by the ATLAS experiment at the LHC. Top quark pair events are searched for in which one top quark decays to $qH$ and the other decays to $bW$. Both the hadronic and the leptonic decay modes of the $W$ boson are used. No significant signal is observed and an upper limit is set on the $t\\rightarrow qH$ branching ratio of 0.79% at the 95% confidence level. The corresponding limit on the $tqH$ coupling combination $\\sqrt{\\lambda_{tcH}^{2} + \\lambda_{tuH}^{2}}$ is 0.17.
Hydralazine-induced constrictive pericarditis
Franssen, CFC; ElGamal, MIH; Gans, ROB; Hoorntje, SJ
A 59-year-old man was diagnosed as having constrictive pericarditis 17 months after a typical hydralazine-induced autoimmune syndrome, This late complication of hydralazine has been reported only once. Ten years later the patient was found to have anti-neutrophil cytoplasmic antibodies directed
Congenital constriction ring syndrome of the limbs: A prospective ...
African Journals Online (AJOL)
In the upper limb malformations involved 42 digits; in the lower limb malformations involved 33 toes, one foot and fi ve legs. Four main types of lesions were found: constriction rings, intrauterine amputations, acrosyndactyly, and simple syndactyly. Conclusion: Congenital constriction ring syndrome is of uncertain aetiology ...
Associação de retardo neuromotor e cromossomo 1qh +: registro de um caso
Directory of Open Access Journals (Sweden)
Salin Moyses Jorge
1976-12-01
Full Text Available Os autores registram um caso de retardo neuromotor em paciente com cromossomo 1qh+. A análise cromossômica do paciente e três familiares revelou igualmente em todos, aumento do braço longo do cromossomo n.° 1. Entretanto, é considerada a possibilidade de que o quadro clínico do paciente seja subordinado também a outros fatores, não genéticos.
Penning, David A; Dartez, Schuyler F
2016-03-01
Constriction is a prey-immobilization technique used by many snakes and is hypothesized to have been important to the evolution and diversification of snakes. However, very few studies have examined the factors that affect constriction performance. We investigated constriction performance in ball pythons (Python regius) by evaluating how peak constriction pressure is affected by snake size, sex, and experience. In one experiment, we tested the ontogenetic scaling of constriction performance and found that snake diameter was the only significant factor determining peak constriction pressure. The number of loops applied in a coil and its interaction with snake diameter did not significantly affect constriction performance. Constriction performance in ball pythons scaled differently than in other snakes that have been studied, and medium to large ball pythons are capable of exerting significantly higher pressures than those shown to cause circulatory arrest in prey. In a second experiment, we tested the effects of experience on constriction performance in hatchling ball pythons over 10 feeding events. By allowing snakes in one test group to gain constriction experience, and manually feeding snakes under sedation in another test group, we showed that experience did not affect constriction performance. During their final (10th) feedings, all pythons constricted similarly and with sufficiently high pressures to kill prey rapidly. At the end of the 10 feeding trials, snakes that were allowed to constrict were significantly smaller than their non-constricting counterparts. © 2016 Wiley Periodicals, Inc.
Stenting of major airway constriction
International Nuclear Information System (INIS)
Wu Xiaomei
2002-01-01
Objective: To investigate the correlated issues in the stenting treatment of major airway constriction. Methods: Nineteen cases of major airway stenting procedure were studied retrospectively. The clinical choice of stents of different advantages or deficiencies were discussed. The importance of intravenous anesthesia supporting, life-parameters monitoring during the procedures and the prevention of complications were analysed. Results: Under intravenous and local anesthesia, 19 Wallstents had been successively placed and relieved 19 cases of major airway constrictions due to malignant or benign diseases (15 of tumors, 3 of tuberculosis, 1 of tracheomalacia). Intravenous anesthesia and life-parameters monitoring had made the procedures more safe and precise. Conclusions: Major airway stenting is an reliable method for relieving tracheobronchial stenosis; and intravenous anesthesia supporting and life-parameters monitoring guarantee the satisfactions of procedures
Active elastohydrodynamics of vesicles in narrow blind constrictions
Fai, T. G.; Kusters, R.; Harting, J.; Rycroft, C. H.; Mahadevan, L.
2017-11-01
Fluid-resistance limited transport of vesicles through narrow constrictions is a recurring theme in many biological and engineering applications. Inspired by the motor-driven movement of soft membrane-bound vesicles into closed neuronal dendritic spines, here we study this problem using a combination of passive three-dimensional simulations and a simplified semianalytical theory for the active transport of vesicles forced through constrictions by molecular motors. We show that the motion of these objects is characterized by two dimensionless quantities related to the geometry and to the strength of forcing relative to the vesicle elasticity. We use numerical simulations to characterize the transit time for a vesicle forced by fluid pressure through a constriction in a channel and find that relative to an open channel, transport into a blind end leads to the formation of a smaller forward-flowing lubrication layer that strongly impedes motion. When the fluid pressure forcing is complemented by forces due to molecular motors that are responsible for vesicle trafficking into dendritic spines, we find that the competition between motor forcing and fluid drag results in multistable dynamics reminiscent of the real system. Our study highlights the role of nonlocal hydrodynamic effects in determining the kinetics of vesicular transport in constricted geometries.
Atypical Presentation of Constrictive Pericarditis in a Holstein Heifer
Directory of Open Access Journals (Sweden)
Mohamed M. Elhanafy
2012-01-01
Full Text Available The field diagnosis of constrictive pericardial effusion is often established on the pertinent pathognomonic physical examination findings, but the condition cannot be ruled out based on absence of these cardinal signs. Constrictive pericardial effusion is not always manifested by bilateral jugular venous distention and pulsation, brisket edema, and muffled heart sounds, all of which are considered the key points in the field diagnosis of pericardial effusion and hardware disease. This case will also document that the outcomes of hematology, serum biochemistry panels, and blood gas analysis can be totally inconsistent with passive venous congestion and constrictive pericardial effusion in cattle. Chest radiographic findings revealed radio dense, wire-like objects; the findings were suggestive but not conclusive for pericardial or pleural effusions, due to indistinguishable diaphragmatic outline and cardiopulmonary silhouette. Cardiac ultrasonography was found to be an excellent paraclinical diagnostic procedure for cases that potentially have traumatic pericarditis and constrictive pericardial effusion. Ultrasound-guided pericardiocentesis was also a valuable diagnostic aid in establishing a definitive diagnosis.
Katis, Ioannis N; He, Peijun J W; Eason, Robert W; Sones, Collin L
2018-05-03
We report on the use of a laser-direct write (LDW) technique that allows the fabrication of lateral flow devices with enhanced sensitivity and limit of detection. This manufacturing technique comprises the dispensing of a liquid photopolymer at specific regions of a nitrocellulose membrane and its subsequent photopolymerisation to create impermeable walls inside the volume of the membrane. These polymerised structures are intentionally designed to create fluidic channels which are constricted over a specific length that spans the test zone within which the sample interacts with pre-deposited reagents. Experiments were conducted to show how these constrictions alter the fluid flow rate and the test zone area within the constricted channel geometries. The slower flow rate and smaller test zone area result in the increased sensitivity and lowered limit of detection for these devices. We have quantified these via the improved performance of a C-Reactive Protein (CRP) sandwich assay on our lateral flow devices with constricted flow paths which demonstrate an improvement in its sensitivity by 62x and in its limit of detection by 30x when compared to a standard lateral flow CRP device. Crown Copyright © 2018. Published by Elsevier B.V. All rights reserved.
Akhtar, Naveed; Khalid, Ayesha; Ahmed, Waqas; Rasheed, Khalid
2010-04-01
Effusive-constrictive pericarditis is a clinical syndrome characterized by concurrent pericardial effusion and pericardial constriction, where constrictive hemodynamics are persistent after effusion is drained. It may present at any point along the clinical course, from the occurrence of an effusion to the development of chronic pericardial constriction. We refer an unusual case of effusive constrictive pericarditis developing rapidly within days, following purulent pericarditis secondary to chest trauma.
Schröder, Daniel; Burhenn, Sebastian; Kirchheim, Dennis; Schulz-von der Gathen, Volker
2013-11-01
We report on the propagation of a constricted discharge feature in a repetitively self-pulsing microplasma jet operated in helium with a 0.075 vol% molecular oxygen admixture in ambient air environment. The constricted discharge is about 1 mm in width and repetitively ignites at the point of smallest electrode distance in a wedge-shaped electrode configuration, propagates through the discharge channel towards the nozzle, extinguishes, and re-ignites at the inlet at frequencies in the kHz range. It co-exists with a homogeneous, volume-dominated low temperature (T ⋍ 300 K) α-mode glow. Time-resolved measurements of nitrogen molecule C-state and nitrogen molecule ion B-state emission bands reveal an increase of the rotational temperature within the constricted discharge to about 600 K within 50 µs. Its propagation velocity was determined by phase-resolved diagnostics to be similar to the gas velocity, in the order of 40 m s-1. Two-photon absorption laser-induced fluorescence spectroscopy synchronized to the self-pulsing reveals spatial regions of increased oxygen atom densities co-propagating with the constricted discharge feature. The generated oxygen pulse density is about ten times higher than in the co-existing homogeneous α-mode. Densities reach about 1.5 × 1016 cm-3 at average temperatures of 450 K at the nozzle. This enhanced dissociation of about 80% is attributed to the continuous interaction of the constricted discharge to the co-propagating gas volume.
Shooting quasiparticles from Andreev bound states in a superconducting constriction
Energy Technology Data Exchange (ETDEWEB)
Riwar, R.-P.; Houzet, M.; Meyer, J. S. [University of Grenoble Alpes, INAC-SPSMS (France); Nazarov, Y. V., E-mail: Y.V.Nazarov@tudelft.nl [Delft University of Technology, Kavli Institute of NanoScience (Netherlands)
2014-12-15
A few-channel superconducting constriction provides a set of discrete Andreev bound states that may be populated with quasiparticles. Motivated by recent experimental research, we study the processes in an a.c. driven constriction whereby a quasiparticle is promoted to the delocalized states outside the superconducting gap and flies away. We distinguish two processes of this kind. In the process of ionization, a quasiparticle present in the Andreev bound state is transferred to the delocalized states leaving the constriction. The refill process involves two quasiparticles: one flies away while another one appears in the Andreev bound state. We notice an interesting asymmetry of these processes. The electron-like quasiparticles are predominantly emitted to one side of the constriction while the hole-like ones are emitted to the other side. This produces a charge imbalance of accumulated quasiparticles, that is opposite on opposite sides of the junction. The imbalance may be detected with a tunnel contact to a normal metal lead.
Oil-in-water emulsions flow through constricted micro-capillarities
Energy Technology Data Exchange (ETDEWEB)
Castillo, Oswaldo Robles; Carvalho, Marcio da Silveira [Pontificia Universidade Catolica do Rio de Janeiro (PUC-Rio), RJ (Brazil). Dept. of Mechanical Engineering
2010-07-01
The effect of the oil concentration and the drop size distribution on the characteristics of the flow of an emulsion through a constricted capillary was experimentally analyzed and quantified by the ratio of the pressure drop of the continuous phase flow to the pressure drop of the emulsion flow, at the same flow rate. The results confirm that the ratio between the capillary constriction diameter and the oil drop size is one of the most important parameters for this flow. For large oil drop size emulsions, the deformation of the drop as it flows through the constriction leads to a high extra pressure drop at low capillary numbers. For small oil drop size emulsions, the extra pressure drop is a function of the viscosity ratio and the disperse phase concentration. (author)
Nanoscale constrictions in superconducting coplanar waveguide resonators
Energy Technology Data Exchange (ETDEWEB)
Jenkins, Mark David; Naether, Uta; Ciria, Miguel; Zueco, David; Luis, Fernando, E-mail: fluis@unizar.es [Instituto de Ciencia de Materiales de Aragón, CSIC—Universidad de Zaragoza, 50009 Zaragoza (Spain); Departamento de Física de la Materia Condensada, Universidad de Zaragoza, 50009 Zaragoza (Spain); Sesé, Javier [Instituto de Nanociencia de Aragón, Universidad de Zaragoza, E-50009 Zaragoza (Spain); Departamento de Física de la Materia Condensada, Universidad de Zaragoza, 50009 Zaragoza (Spain); Atkinson, James; Barco, Enrique del [Department of Physics, University of Central Florida, Orlando, Florida 32816 (United States); Sánchez-Azqueta, Carlos [Dpto. de Ingeniería Electrónica y Telecomunicaciones, Universidad de Zaragoza, 50009 Zaragoza (Spain); Majer, Johannes [Vienna Center for Quantum Science and Technology, Atominstitut, TU Wien, 1020 Vienna (Austria)
2014-10-20
We report on the design, fabrication, and characterization of superconducting coplanar waveguide resonators with nanoscopic constrictions. By reducing the size of the center line down to 50 nm, the radio frequency currents are concentrated and the magnetic field in its vicinity is increased. The device characteristics are only slightly modified by the constrictions, with changes in resonance frequency lower than 1% and internal quality factors of the same order of magnitude as the original ones. These devices could enable the achievement of higher couplings to small magnetic samples or even to single molecular spins and have applications in circuit quantum electrodynamics, quantum computing, and electron paramagnetic resonance.
Mast cell mediators in citric acid-induced airway constriction of guinea pigs
International Nuclear Information System (INIS)
Lin, C.-H.; Lai, Y.-L.
2005-01-01
We demonstrated previously that mast cells play an important role in citric acid (CA)-induced airway constriction. In this study, we further investigated the underlying mediator(s) for this type of airway constriction. At first, to examine effects caused by blocking agents, 67 young Hartley guinea pigs were divided into 7 groups: saline + CA; methysergide (serotonin receptor antagonist) + CA; MK-886 (leukotriene synthesis inhibitor) + CA; mepyramine (histamine H 1 receptor antagonist) + CA; indomethacin (cyclooxygenase inhibitor) + CA; cromolyn sodium (mast cell stabilizer) + CA; and compound 48/80 (mast cell degranulating agent) + CA. Then, we tested whether leukotriene C 4 (LTC 4 ) or histamine enhances CA-induced airway constriction in compound 48/80-pretreated guinea pigs. We measured dynamic respiratory compliance (Crs) and forced expiratory volume in 0.1 s (FEV 0.1 ) during either baseline or recovery period. In addition, we detected histamine level, an index of pulmonary mast cell degranulation, in bronchoalveolar lavage (BAL) samples. Citric acid aerosol inhalation caused decreases in Crs and FEV 0.1 , indicating airway constriction in the control group. This airway constriction was significantly attenuated by MK-886, mepyramine, cromolyn sodium, and compound 48/80, but not by either methysergide or indomethacin. Both LTC 4 and histamine infusion significantly increased the magnitude of CA-induced airway constriction in compound 48/80-pretreated guinea pigs. Citric acid inhalation caused significant increase in histamine level in the BAL sample, which was significantly suppressed by compound 48/80. These results suggest that leukotrienes and histamine originating from mast cells play an important role in CA inhalation-induced noncholinergic airway constriction
Droplet squeezing through a narrow constriction: Minimum impulse and critical velocity
Zhang, Zhifeng; Drapaca, Corina; Chen, Xiaolin; Xu, Jie
2017-07-01
Models of a droplet passing through narrow constrictions have wide applications in science and engineering. In this paper, we report our findings on the minimum impulse (momentum change) of pushing a droplet through a narrow circular constriction. The existence of this minimum impulse is mathematically derived and numerically verified. The minimum impulse happens at a critical velocity when the time-averaged Young-Laplace pressure balances the total minor pressure loss in the constriction. Finally, numerical simulations are conducted to verify these concepts. These results could be relevant to problems of energy optimization and studies of chemical and biomedical systems.
Relationship between conductive hearing loss and maxillary constriction.
Peyvandi, A A; Jamilian, A; Moradi, E
2014-09-01
To evaluate the relationship between conductive hearing loss and maxillary constriction. A total of 120 people, aged from 7 to 40 years, who were referred to an audiologist when taking out health insurance or for school pre-registration check-up, were selected for this study. A total of 60 participants who had hearing threshold levels greater than 15 dB in both ears were chosen as the conductive hearing loss group. The remaining 60, with normal hearing thresholds of less than 15 dB, were used as the control group. All participants were referred to an orthodontic clinic. Participants who had a posterior crossbite and high palatal vault were considered to suffer from maxillary constriction. There were no significant differences between the sex ratios and mean ages of the groups. However, participants with conductive hearing loss were 3.5 times more likely than controls to suffer from maxillary constriction. Patients who suffer from conductive hearing loss are likely to show a maxillary abnormality when examined by an orthodontist.
Power, John A; Thompson, Diane V; Rayarao, Geetha; Doyle, Mark; Biederman, Robert W W
2016-05-01
Invasive cardiac catheterization is the venerable "gold standard" for diagnosing constrictive pericarditis. However, its sensitivity and specificity vary dramatically from center to center. Given the ability to unequivocally define segments of the pericardium with the heart via radiofrequency tissue tagging, we hypothesize that cardiac magnetic resonance has the capability to be the new gold standard. All patients who were referred for cardiac magnetic resonance evaluation of constrictive pericarditis underwent cardiac magnetic resonance radiofrequency tissue tagging to define visceral-parietal pericardial adherence to determine constriction. This was then compared with intraoperative surgical findings. Likewise, all preoperative cardiac catheterization testing was reviewed in a blinded manner. A total of 120 patients were referred for clinical suspicion of constrictive pericarditis. Thirty-nine patients were defined as constrictive pericarditis positive solely via radiofrequency tissue-tagging cardiac magnetic resonance, of whom 21 were positive, 4 were negative, and 1 was equivocal for constrictive pericarditis, as defined by cardiac catheterization. Of these patients, 16 underwent pericardiectomy and were surgically confirmed. There was 100% agreement between cardiac magnetic resonance-defined constrictive pericarditis positivity and postsurgical findings. No patients were misclassified by cardiac magnetic resonance. In regard to the remaining constrictive pericarditis-positive patients defined by cardiac magnetic resonance, 10 were treated medically, declined, were ineligible for surgery, or were lost to follow-up. Long-term follow-up of those who were constrictive pericarditis negative by cardiac magnetic resonance showed no early or late crossover to the surgery arm. Cardiac magnetic resonance via radiofrequency tissue tagging offers a unique, efficient, and effective manner of defining clinically and surgically relevant constrictive pericarditis
Transpalatal distraction for the management of maxillary constriction in pediatric patients
Adolphs, Nicolai; Ernst, Nicole; Hoffmeister, Bodo; Raguse, Jan-Dirk
2015-01-01
Context: The management of severe maxillary constriction can be challenging. For that purpose surgically assisted maxillary expansion by transpalatal distraction (TPD) can typically be recommended after skeletal maturity. However in selected cases bone borne transpalatal distraction devices can contribute to improve maxillary constriction considerably earlier already during mixed dentition. Aims: To assess the possibility of bone borne transpalatal distraction in pediatric patients. Settings ...
Pregnancy complicating irradiation-induced constrictive pericarditis
Energy Technology Data Exchange (ETDEWEB)
Bakri, Younes N.; Martan, Ahmed; Amri, Aladin (King Faisal Specialist Hospital and Research Centre, Riyadh (Saudi Arabia). Dept. of Obstetrics and Gynecology); Amri, M. (King Faisal Specialist Hospital and Research Centre, Riyadh (Saudi Arabia). Dept. of Cardiovascular Diseases)
1992-01-01
A case is reported of a 24 year-old primigravida who had severe effusive constrictive pericarditis secondary to mediastinal irradiation following chemotherapy for Hodgkins disease. Pregnancy was threatened by serious maternal cardiovascular complications and a non-viable fetus was born spontaneously and prematurely. Patient was completely asymptomatic before pregnancy. (au).
Transpalatal distraction for the management of maxillary constriction in pediatric patients.
Adolphs, Nicolai; Ernst, Nicole; Hoffmeister, Bodo; Raguse, Jan-Dirk
2015-01-01
The management of severe maxillary constriction can be challenging. For that purpose surgically assisted maxillary expansion by transpalatal distraction (TPD) can typically be recommended after skeletal maturity. However in selected cases bone borne transpalatal distraction devices can contribute to improve maxillary constriction considerably earlier already during mixed dentition. To assess the possibility of bone borne transpalatal distraction in pediatric patients. Clinical paper. Since 2010 TPD has been applied to six pediatric patients during mixed dentition when severe maxillary constriction was present and conventional orthodontic widening has already failed. Individually selected devices (Surgitec, Belgium) were inserted in general anaesthesia and distraction was performed according to well known parameters. Maxillary constriction could be improved in all six patients without any drawbacks by bone borne devices during mixed dentition. Skeletal conditions were obviously improved for subsequent orthodontic or orthognathic therapy without functional impairment. Follow-up is up to 36 months after device removal. Transpalatal Distraction is recommendable in selected pediatric patients if massive growth disturbance is present or has to be expected. TPD allows for individually adapted maxillary expansion by selection and positioning of appropriate devices in combination with intraoperative testing of maxillary movements and controlled bone removal.
Modulation of apical constriction by Wnt signaling is required for lung epithelial shape transition.
Fumoto, Katsumi; Takigawa-Imamura, Hisako; Sumiyama, Kenta; Kaneiwa, Tomoyuki; Kikuchi, Akira
2017-01-01
In lung development, the apically constricted columnar epithelium forms numerous buds during the pseudoglandular stage. Subsequently, these epithelial cells change shape into the flat or cuboidal pneumocytes that form the air sacs during the canalicular and saccular (canalicular-saccular) stages, yet the impact of cell shape on tissue morphogenesis remains unclear. Here, we show that the expression of Wnt components is decreased in the canalicular-saccular stages, and that genetically constitutive activation of Wnt signaling impairs air sac formation by inducing apical constriction in the epithelium as seen in the pseudoglandular stage. Organ culture models also demonstrate that Wnt signaling induces apical constriction through apical actomyosin cytoskeletal organization. Mathematical modeling reveals that apical constriction induces bud formation and that loss of apical constriction is required for the formation of an air sac-like structure. We identify MAP/microtubule affinity-regulating kinase 1 (Mark1) as a downstream molecule of Wnt signaling and show that it is required for apical cytoskeletal organization and bud formation. These results suggest that Wnt signaling is required for bud formation by inducing apical constriction during the pseudoglandular stage, whereas loss of Wnt signaling is necessary for air sac formation in the canalicular-saccular stages. © 2017. Published by The Company of Biologists Ltd.
Brothers with constrictive pericarditis – A novel mutation in a rare disease
Directory of Open Access Journals (Sweden)
Devendra V. Patil
2016-09-01
Full Text Available Familial constrictive pericarditis is extremely rare. We report a case of two brothers both suffering constrictive pericarditis along with having multiple painless joint deformities. Genetic workup confirmed the clinical diagnosis of camptodactyly-arthropathy-coxa vara-pericarditis (CACP syndrome CACP syndrome and also revealed a rare mutation in the causative gene.
Roles of oxygen radicals and elastase in citric acid-induced airway constriction of guinea-pigs
Lai, Y -L; Chiou, W -Y; Lu, F J; Chiang, L Y
1999-01-01
Antioxidants attenuate noncholinergic airway constriction. To further investigate the relationship between tachykinin-mediated airway constriction and oxygen radicals, we explored citric acid-induced bronchial constriction in 48 young Hartley strain guinea-pigs, divided into six groups: control; citric acid; hexa(sulphobutyl)fullerenes+citric acid; hexa(sulphobutyl)fullerenes+phosphoramidon+citric acid; dimethylthiourea (DMTU)+citric acid; and DMTU+phosphoramidon+citric acid. Hexa(sulphobutyl...
Study on Characteristics of Constricted DC Plasma Using Particle-In-Cell Simulator
International Nuclear Information System (INIS)
Jo, Jong Gap; Park, Yeong Shin; Hwang, Yong Seok
2010-01-01
In dc glow discharge, when anode size is smaller than cathode, very small and bright plasma ball occurs in front of anode. This plasma is called constricted dc plasma and characterized by a high plasma density in positive glow, so called plasma ball, compared to the conventional dc plasma. For the reason, this plasma is utilized to ion or electron beam sources since the beam currents are enhanced by the dense anode glow. However, correlations between characteristics of the plasma (plasma density, electron temperature and space potential) and discharge conditions (anode size, discharge voltage, discharge current, pressure) have been a little investigated definitely clear in previous study because of the trouble of a diagnosis. The plasma ball which is the most essential part of the constricted plasma is too small to diagnose precisely without disturbing plasma. Therefore, we tried to analyze the constricted plasma through computer simulation with Particle-In-Cell (PIC) code. In this study, simulation result of constricted dc plasma as well as conventional dc glow discharge will be addressed and compared with each others
Directory of Open Access Journals (Sweden)
Mohsen Mir Mohammad Sadeghi
2013-01-01
Full Text Available The usage of Implantable Cardiac Defibrillator (ICD since 1980s is becoming more popular these days. The rate of both, endocarditis and constrictive pericarditis are low but it still needs attention. We are reporting a rare case of ICD endocarditis as a result of toe infection in a diabetic patient. This was followed by infectious pericarditis after device removal by open heart surgery and then delayed constrictive pericarditis.
Multidisciplinary emergent removal of a metal penoscrotal constriction device
LENUS (Irish Health Repository)
Nason, GJ
2017-03-01
Strangulation of the genital organs is a rare presentation to the emergency department which requires urgent intervention to avoid long term complications. Penoscrotal constriction devices are either used for autoerotic stimulus or to increase sexual performance by maintaining an erection for a longer period. We report a case of a man who presented with penile strangulation following the application of a titanium penoscrotal constriction ring during sexual intercourse seven hours previously. The Fire Brigade department attended with an electric operated angle grinder to facilitate removal of the ring as standard medical equipment (orthopaedic saws, bolt and bone cutters) were insufficient. Fully functional recovery was achieved.
A non-equilibrium simulation of thermal constriction in a cascaded arc hydrogen plasma
International Nuclear Information System (INIS)
Peerenboom, K S C; Goedheer, W J; Van Dijk, J; Kroesen, G M W
2014-01-01
The cascaded arc hydrogen plasma of Pilot-PSI is studied in a non-LTE model. We demonstrate that the effect of vibrationally excited molecules on the heavy-particle-assisted dissociation is crucial for obtaining thermal constriction. To the best of our knowledge, thermal constriction has not been obtained before in a non-LTE simulation. Probably, realistic numerical studies of this type of plasma were hindered by numerical problems, preventing the non-LTE simulations to show characteristic physical mechanisms such as thermal constriction. In this paper we show that with the help of appropriate numerical strategies thermal constriction can be obtained in a non-LTE simulation. To this end, a new source term linearization technique is developed, which ensures physical solutions even near chemical equilibrium where the composition is dominated by chemical source terms. Results of the model are compared with experiments on Pilot-PSI and show good agreement with pressure and voltage measurements in the source. (paper)
Directory of Open Access Journals (Sweden)
Tahmina Akhter
2014-01-01
Full Text Available The flow of a compressible fluid with slip through a cylinder with an asymmetric local constriction has been considered both numerically, as well as analytically. For the numerical work, a particle-based method whose dynamics is governed by the multiparticle collision (MPC rule has been used together with a generalized boundary condition that allows for slip at the wall. Since it is well known that an MPC system corresponds to an ideal gas and behaves like a compressible, viscous flow on average, an approximate analytical solution has been derived from the compressible Navier–Stokes equations of motion coupled to an ideal gas equation of state using the Karman–Pohlhausen method. The constriction is assumed to have a polynomial form, and the location of maximum constriction is varied throughout the constricted portion of the cylinder. Results for centerline densities and centerline velocities have been compared for various Reynolds numbers, Mach numbers, wall slip values and flow geometries.
A Study on Water Surface Profiles of Rivers with Constriction
Qian, Chaochao; Yamada, Tadashi
2013-04-01
Water surface profile of rivers with constrictions is precious in both classic hydraulics and river management practice. This study was conducted to clarify the essences of the water surface profiles. 3 cases of experiments and 1D numerical calculations with different discharges were made in the study and analysis solutions of the non-linear basic equation of surface profile in varied flow without considering friction were derived. The manning's number was kept in the same in each case by using crosspiece roughness. We found a new type of water surface profile of varied flow from the results of 1D numerical calculation and that of experiments and named it as Mc curve because of its mild condition with constriction segment. This kind of curves appears as a nature phenomenon ubiquitously. The process of water surface forming is dynamic and bore occurs at the upper side of constriction during increasing discharge before the surface profile formed. As a theoretical work, 3 analysis solutions were derived included 2 physical-meaning solutions in the study by using Man-Machine system. One of the derived physical-meaning solutions was confirmed that it is validity by comparing to the results of 1D numerical calculation and that of experiments. The solution represents a flow profile from under critical condition at the upper side to super critical condition at the down side of constriction segment. The other derived physical-meaning solution represents a flow profile from super critical condition at the upper side to under critical condition at the down side of constriction segment. These two kinds of flow profiles exist in the nature but no theoretical solution can express the phenomenon. We find the depth distribution only concerned with unit width discharge distribution and critical depth under a constant discharge from the derived solutions. Therefor, the profile can be gained simply and precisely by using the theoretical solutions instead of numerical calculation even
International Nuclear Information System (INIS)
Hales, R.; Waalkens, H.
2009-01-01
We study the quantum transport through entropic barriers induced by hardwall constrictions of hyperboloidal shape in two and three spatial dimensions. Using the separability of the Schroedinger equation and the classical equations of motion for these geometries, we study in detail the quantum transmission probabilities and the associated quantum resonances, and relate them to the classical phase structures which govern the transport through the constrictions. These classical phase structures are compared to the analogous structures which, as has been shown only recently, govern reaction type dynamics in smooth systems. Although the systems studied in this paper are special due their separability they can be taken as a guide to study entropic barriers resulting from constriction geometries that lead to non-separable dynamics.
Recurrent tongue tip constriction in a captive giant anteater (Myrmecophaga tridactyla).
Steinmetz, Hanspeter W; Clauss, Marcus; Feige, Karsten; Thio, Tanja; Isenbügel, Ewald; Hatt, Jean-Michel
2007-03-01
A male giant anteater (Myrmecophage tridactyla) was treated twice for tongue tip constrictions. Clinical signs were partial anorexia, soft stool, bleeding from the mouth, and intermittent lingual discomfort. In the first presentation, wood fibers constricting the distal part of the tongue were detected by endoscopy and were removed. In the second presentation, bands of collagenous fibers were identified and resected. Dietary elements were responsible for both cases: elongated wood fibers were present in peat, which was included as a supplement to improve stool consistency, and collagenous fibers originated from fascias of lean meat, which served as a protein source in this diet. Preventive measures included sieving of the peat to eliminate long fibers and grinding of the meat, respectively, prior to diet presentation. A homogenous diet, utilizing cellulose rather than peat and dry cat food rather than meat, will avoid tongue tip constriction as described in these cases.
Wang, Rongyang; Wei, Yikun; Wu, Chuanyu; Sun, Liang; Zheng, Wenguang
2018-01-01
The immersed boundary-lattice Boltzmann method (IB-LBM) was used to examine the motion and deformation of three elastic red blood cells (RBCs) during Poiseuille flow through constricted microchannels. The objective was to determine the effects of the degree of constriction and the Reynolds (Re) number of the flow on the physical characteristics of the RBCs. It was found that, with decreasing constriction ratio, the RBCs experienced greater forced deformation as they squeezed through the constriction area compared to at other parts of the microchannel. It was also observed that a longer time was required for the RBCs to squeeze through a narrower constriction. The RBCs subsequently regained a stable shape and gradually migrated toward the centerline of the flow beyond the constriction area. However, a sick RBC was observed to be incapable of passing through a constricted vessel with a constriction ratio ≤1/3 for Re numbers below 0.40.
Diastolic Pressure in Congestive Cardiomyopathy and Constrictive ...
African Journals Online (AJOL)
1974-03-16
Mar 16, 1974 ... tive pericarditis was studied before pericardiectomy. The constriction was of tuberculous origin in 27 patients, amoebic in one and post-traumatic in two. All patients had rested in bed for 2-3 weeks before the study and were receiving digitalis and diuretics at the time of cardiac catheterisation. Their disability ...
Bacterial growth and motility in sub-micron constrictions
Männik, J.; Driessen, R.; Galajda, P.; Keymer, J.E.; Dekker, C.
2009-01-01
In many naturally occurring habitats, bacteria live in micrometer-size confined spaces. Although bacterial growth and motility in such constrictions is of great interest to fields as varied as soil microbiology, water purification, and biomedical research, quantitative studies of the effects of
Chronic calcific constrictive pericarditis complicating Churg-Strauss syndrome: first reported case.
Aboukhoudir, Falah; Pansieri, Michel; Rekik, Sofiene
2014-10-01
Churg-Strauss syndrome is a necrotizing systemic vasculitis characterized by extravascular granulomas and eosinophilic infiltrates of small vessels. Although cardiac complications are considered to be relatively common, no case of constrictive calcified pericarditis has ever been previously described in this setting. In this report, we present the case of a 46-year-old man with Churg-Strauss syndrome, in whom we were able to document the development of symptomatic calcific constrictive pericarditis during a 10-year period despite long-term corticosteroid therapy. Georg Thieme Verlag KG Stuttgart · New York.
Improving the Q:H strength ratio in women using plyometric exercises.
Tsang, Kavin K W; DiPasquale, Angela A
2011-10-01
Plyometric training programs have been implemented in anterior cruciate ligament injury prevention programs. Plyometric exercises are designed to aid in the improvement of muscle strength and neuromuscular control. Our purpose was to examine the effects of plyometric training on lower leg strength in women. Thirty (age = 20.3 ± 1.9 years) recreationally active women were divided into control and experimental groups. The experimental group performed a plyometric training program for 6 weeks, 3 d·wk(-1). All subjects attended 4 testing sessions: before the start of the training program and after weeks 2, 4, and 6. Concentric quadriceps and hamstring strength (dominant leg) was assessed using an isokinetic dynamometer at speeds of 60 and 120°·s(-1). Peak torque, average peak torque, and average power (AvgPower) were measured. The results revealed a significant (p plyometric group than in the control group at testing session 4 and that AvgPower was greater in the plyometric group than in the control group in testing sessions 2-4. Our results indicate that the plyometric training program increased hamstring strength while maintaining quadriceps strength, thereby improving the Q:H strength ratio.
Penning, David A; Dartez, Schuyler F; Moon, Brad R
2015-11-01
Snakes are important predators that have radiated throughout many ecosystems, and constriction was important in their radiation. Constrictors immobilize and kill prey by using body loops to exert pressure on their prey. Despite its importance, little is known about constriction performance or its full effects on prey. We studied the scaling of constriction performance in two species of giant pythons (Python reticulatus and Python molurus bivittatus) and propose a new mechanism of prey death by constriction. In both species, peak constriction pressure increased significantly with snake diameter. These and other constrictors can exert pressures dramatically higher than their prey's blood pressure, suggesting that constriction can stop circulatory function and perhaps kill prey rapidly by over-pressurizing the brain and disrupting neural function. We propose the latter 'red-out effect' as another possible mechanism of prey death from constriction. These effects may be important to recognize and treat properly in rare cases when constrictors injure humans. © 2015. Published by The Company of Biologists Ltd.
Occupational (? constrictive bronchiolitis with normal physical, functional and image findings
Directory of Open Access Journals (Sweden)
Sandra Figueiredo
2009-07-01
Full Text Available Constrictive bronchiolitis is characterized by alterations in the walls of membranous and respiratory bronchioles. These changes lead to concentric narrowing or complete obliteration of the airway lumen. Suspicion of possible bronchiolar disorders may arise from clinical, funcional, and radiologic findings. However, constrictive bronchiolitis may be present even with normal physical, functional and image findings, which turns the diagnosis difficult. A high index of suspicion is necessary to justify invasive tests that lead to pulmonary biopsy. In this report, we describe a patient with cough and dyspnoea, with normal physical, functional and image findings, whose work-up leaded to the diagnosis of constrictive bronchiolitis. Resumo: A bronquiolite constritiva é caracterizada por alterações das paredes dos bronquíolos membranosos e respiratórios. Estas alterações incluem um espectro de alterações que podem variar, desde a inflamação à fibrose concêntrica progressiva, com obstrução completa do lúmen bronquiolar. O diagnóstico pode ser sugerido pela história clínica e por alterações radiológicas e funcionais. No entanto, o exame físico e os exames complementares de diagnóstico podem ser normais, o que dificulta o diagnóstico, sendo necessário um elevado índice de suspeita para se sujeitar o doente a exames invasivos, tal como a biópsia pulmonar cirúrgica. Os autores apresentam um caso clínico de uma doente com quadro arrastado de tosse e dispneia, com exame físico, funcional e imagiológico normais, cujo estudo exaustivo veio a revelar o diagnóstico de bronquiolite constritiva. Key-words: Constrictive bronchiolitis, iron oxide, Palavras-chave: Bronquiolite constritiva, óxido de ferro
Lu, Hou Tee; Ramsamy, Gunasekaran; Lee, Chuey Yan; Syed Hamid, Syed Rasul G.; Kan, Foong Kee; Nordin, Rusli Bin
2018-01-01
Patient: Male, 38 Final Diagnosis: Constrictive pericarditis Symptoms: Shortness of breath Medication: — Clinical Procedure: Pericardiocentesis • pericardiectomy Specialty: Cardiology Objective: Unusual clinical course Background: Melioidosis is a rare tropical bacterial infection caused by the Gram-negative soil saprophyte, Burkholderia pseudomallei. Melioidosis can mimic a variety of diseases due to its varied presentation, and unless it is treated rapidly, it can be fatal. A rare case of melioidosis, with pericarditis and pericardial effusion, is described, which demonstrates the value of early diagnosis with echocardiography and pericardiocentesis. Case Report: A 38-year-old native (Iban) East Malaysian man presented with shortness of breath and tachycardia. Transthoracic echocardiography (TTE) showed cardiac tamponade. Urgent pericardiocentesis drained a large amount of purulent pericardial fluid that grew Burkholderia pseudomallei. Despite appropriate dose and duration of intravenous treatment with ceftazidime followed by meropenem, the patient developed recurrent pericardial effusion and right heart failure due to constrictive pericarditis. The diagnosis of constrictive pericarditis was confirmed by computed tomography (CT) and surgical exploration. Following pericardiectomy, his symptoms resolved, but patient follow-up was recommended for possible sequelae of constrictive pericarditis. Conclusions: After the onset of melioidosis pericarditis, the authors recommend follow-up and surveillance for possible complication of constrictive pericarditis. PMID:29551765
A rare combination of amniotic constriction band with osteogenesis imperfecta.
Shah, Krupa Hitesh; Shah, Hitesh
2015-11-11
Amniotic constriction bands and osteogenesis imperfecta are disorders arising from a collagen defect. We report a rare association of amniotic bands with osteogenesis imperfecta in a child. The child was born with multiple amniotic bands involving the right leg, both hands and both feet. Multiple fractures of long bones of lower limbs occurred in childhood due to trivial trauma. Deformities of the femur and tibia due to malunion with osteopenia and blue sclerae were present. The patient was treated with z plasty of constriction band of the right tibia and bisphosphonate for osteogenesis imperfecta. This rare association of both collagen diseases may provide further insight for the pathogenesis of these diseases. 2015 BMJ Publishing Group Ltd.
Shirai, Atsushi; Masuda, Sunao
2013-01-01
The authors have previously presented a mathematical model to predict transit time of a neutrophil through an alveolar capillary segment which was modeled as an axisymmetric arc-shaped constriction settled in a cylindrical straight pipe to investigate the influence of entrance curvature of a capillary on passage of the cell. The axially asymmetric cross section of a capillary also influences the transit time because it requires three-dimensional deformation of a cell when it passes through the capillary and could lead to plasma leakage between the cell surface and the capillary wall. In this study, a rectangular channel was introduced, the side walls of which were moderately constricted, as a representative of axially asymmetric capillaries. Dependence of transit time of a neutrophil passing through the constriction on the constriction geometry, i.e., channel height, throat width and curvature radius of the constriction, was numerically investigated, the transit time being compared with that through the axisymmetric model. It was found that the transit time is dominated by the throat hydraulic diameter and curvature radius of the constriction and that the throat aspect ratio little affects the transit time with a certain limitation, indicating that if an appropriate curvature radius is chosen, such a rectangular channel model can be substituted for an axisymmetric capillary model having the same throat hydraulic diameter in terms of the transit time by choosing an appropriate curvature radius. Thus, microchannels fabricated by the photolithography technique, whose cross section is generally rectangular, are expected to be applicable to in vitro model experiments of neutrophil retention and passage in the alveolar capillaries. PMID:23527190
A case report of umbilical ring constriction with application of amnioinfusion.
Tokunaka, Mayumi; Hasegawa, Junichi; Nakamura, Masamitsu; Hamada, Shoko; Matsuoka, Ryu; Ichizuka, Kiyotake; Sekizawa, Akihiko; Okai, Takashi
2013-07-01
This is a case report of a pregnant 38-year-old primigravida woman. Due to severe fetal growth restriction and oligohydramnios, she was referred to our tertiary perinatal center at 24 weeks' gestation. To rule out chromosomal abnormalities and facilitate ultrasound evaluation of fetal morphology, we performed amniocentesis and subsequent amnioinfusion. Thereafter, a precise ultrasound examination revealed no obvious fetal morphological abnormalities except for a hyper-coiled cord and marginal placenta previa. During expectant management, the amount of amniotic fluid was maintained at 20-26 mm for a few days; however, the pregnancy resulted in intrauterine fetal death after 26 weeks + 5 days of gestation. The stillborn infant weighed 530 g (-3.3 SD) and had no obvious external abnormalities apart from umbilical ring constriction. Although a postmortem autopsy was not performed, it is suspected that the fetal growth restriction and the intrauterine fetal death were associated with the hyper-coiled cord and the umbilical ring constriction. It is thought that umbilical ring constriction might therefore be an irreversible fatal condition in cases with a hyper-coiled cord.
Comparison of turbulent models in the case of a constricted tube
Directory of Open Access Journals (Sweden)
Elcner Jakub
2017-01-01
Full Text Available The validation of a proper solution is an indispensable phase of every numerical simulation. Nowadays, many turbulent models are available, whose application leads to slightly different solution of flow behaviour depending on the boundary conditions of a specific problem. It is essential to select the proper turbulence model appropriate for the given situation. The aim of this study is to select the most suitable two-equation eddy-viscosity model, which can be further used during calculations of airflow in human airways. For this purpose, geometry of a constricted tube with well-documented experimental measurements was chosen. The flow in the constricted tube was calculated using Spallart-Almaras, k-omega, k-epsilon and SST model approach using commercial software. The outcome of the comparison is a choice of the suitable model which is capable of simulating the transition of the boundary layer from laminar to turbulent flow. This transition typically arises in the upper part of the respiratory system, where the airways are constricted, specifically in the area, where the oral cavity continues through the glottis to trachea. The simulations were performed in a commercial solver Star-CCM+.
Singh, Amrit Pal; Singh, Randhir; Krishan, Pawan
2015-04-01
Fibrates are peroxisome proliferator-activated receptor-α agonists and are clinically used for treatment of dyslipidemia and hypertriglyceridemia. Fenofibrate is reported as a cardioprotective agent in various models of cardiac dysfunction; however, limited literature is available regarding the role of gemfibrozil as a possible cardioprotective agent, especially in a non-obese model of cardiac remodelling. The present study investigated the role of gemfibrozil against partial abdominal aortic constriction-induced cardiac hypertrophy in rats. Cardiac hypertrophy was induced by partial abdominal aortic constriction in rats and they survived for 4 weeks. The cardiac hypertrophy was assessed by measuring left ventricular weight to body weight ratio, left ventricular wall thickness, and protein and collagen content. The oxidative stress in the cardiac tissues was assessed by measuring thiobarbituric acid-reactive substances, superoxide anion generation, and reduced glutathione level. The haematoxylin-eosin and picrosirius red staining was used to observe cardiomyocyte diameter and collagen deposition, respectively. Moreover, serum levels of cholesterol, high-density lipoproteins, triglycerides, and glucose were also measured. Gemfibrozil (30 mg/kg, p.o.) was administered since the first day of partial abdominal aortic constriction and continued for 4 weeks. The partial abdominal aortic constriction-induced cardiac oxidative stress and hypertrophy are indicated by significant change in various parameters used in the present study that were ameliorated with gemfibrozil treatment in rats. No significant change in serum parameters was observed between various groups used in the present study. It is concluded that gemfibrozil ameliorates partial abdominal aortic constriction-induced cardiac oxidative stress and hypertrophy and in rats.
One-stage release of congenital constriction band in lower limb from new born to 3 years
Directory of Open Access Journals (Sweden)
Das Sakti
2010-01-01
Full Text Available Background: Congenital constriction band is the most common cause of terminal congenital malformation of a limb and lymphoedema. Superficial bands do not need any treatment, but deeper bands are managed with excision and Z-plasty. The circumferential bands are released in two to three stages to prevent vascular compromise. The purpose of this study was to present the outcome of one-stage release. Materials and Methods: Nineteen children, 12 boys and 7 girls, with 24 congenital constriction bands constituted the clinical material. The mean age at presentation was 57 days (range 12 hours to 3 years Band was unilateral in 14 and bilateral in five limbs. In unilateral cases, right side was involved in nine cases and left side in five. The constriction band is seen at the junction of middle and distal third. The patients having constriction bands in lower limbs and age less than 3 years were included in the study. One stage circumferential release of congenital constriction band was performed. Our youngest patient was operated at the age of six months. Club feet, (n=8 and lymphedema (n=7 were associated anomalies. Club feet and band were released in one stage in three limbs. The results were evaluated by criteria described by Joseph Upton and Cissy Tan. Results: There were 18 excellent, six satisfactory results. No wound problem occurred. No vascular compromise was noted during or after the procedure. On follow-up, distal swelling reduced. Conclusion: One-stage circumferential release of congenital constriction band in lower limbs with or without lymphodema is a safe and easy procedure.
Directory of Open Access Journals (Sweden)
Alireza Farhad
2017-12-01
Full Text Available Introduction: Precise knowledge of the location of the apical constriction is essential to root canal treatment and long-term prognosis. Considering the differences in the apical constriction and size of the roots in single- and multiple-root teeth in various races, examination and comparison of the location of the apical constriction in single-root and multiple-root teeth are of paramount importance. The present studies aimed to measure and compare the distance of the apical constriction from the apical foramen and anatomical apex in single-root and multiple-root teeth. Materials and Methods: In this cross-sectional study, 60 roots of single-rooted teeth and 60 roots of multiple-rooted teeth were collected from the patients referring to the health centers in Isfahan, Iran. After cleansing and disinfecting the surface of the roots, the surface of the teeth was washed with hypochlorite. Based on the direction of the apical foramen, a longitudinal cut was made in the same direction, and the roots were examined microscopically at the magnification of 25. Following that, the distance of the apical constriction from the apical foramen and anatomical apex was measured using a digital camera. In addition, mean and standard deviation of the obtained distance values were determined. Distances in the single-root and multiple-root teeth were compared using independent t-test, at the significance level of Results: Mean distance between the apical constriction and apical foramen was 0.86±0.33 mm in the single-root teeth and 0.072±0.27 mm in the multiple-root teeth. Mean distance between the apical constriction and anatomical apex was 1.14±0.36 mm in the single-root teeth and 1.03±0.36 mm in the multiple-root teeth. Moreover, the results of independent t-test showed the distance of the apical constriction from the apical foramen to be significant between single-root and multiple-rooted teeth (P=0.013. However, the distance between the apical constriction
Quantum transport through MoS2 constrictions defined by photodoping
Epping, Alexander; Banszerus, Luca; Güttinger, Johannes; Krückeberg, Luisa; Watanabe, Kenji; Taniguchi, Takashi; Hassler, Fabian; Beschoten, Bernd; Stampfer, Christoph
2018-05-01
We present a device scheme to explore mesoscopic transport through molybdenum disulfide (MoS2) constrictions using photodoping. The devices are based on van-der-Waals heterostructures where few-layer MoS2 flakes are partially encapsulated by hexagonal boron nitride (hBN) and covered by a few-layer graphene flake to fabricate electrical contacts. Since the as-fabricated devices are insulating at low temperatures, we use photo-induced remote doping in the hBN substrate to create free charge carriers in the MoS2 layer. On top of the device, we place additional metal structures, which define the shape of the constriction and act as shadow masks during photodoping of the underlying MoS2/hBN heterostructure. Low temperature two- and four-terminal transport measurements show evidence of quantum confinement effects.
Directory of Open Access Journals (Sweden)
Vilaiwan M. Fernandes
2014-12-01
Full Text Available During morphogenesis, extracellular signals trigger actomyosin contractility in subpopulations of cells to coordinate changes in cell shape. To illuminate the link between signaling-mediated tissue patterning and cytoskeletal remodeling, we study the progression of the morphogenetic furrow (MF, the wave of apical constriction that traverses the Drosophila eye imaginal disc preceding photoreceptor neurogenesis. Apical constriction depends on actomyosin contractility downstream of the Hedgehog (Hh and bone morphogenetic protein (BMP pathways. We identify a role for integrin adhesion receptors in MF progression. We show that Hh and BMP regulate integrin expression, the loss of which disrupts apical constriction and slows furrow progression; conversely, elevated integrins accelerate furrow progression. We present evidence that integrins regulate MF progression by promoting microtubule stabilization, since reducing microtubule stability rescues integrin-mediated furrow acceleration. Thus, integrins act as a genetic link between tissue-level signaling events and morphological change at the cellular level, leading to morphogenesis and neurogenesis in the eye.
Chirality dependent pinning and depinning of magnetic vortex domain walls at nano-constrictions
Energy Technology Data Exchange (ETDEWEB)
Mohanan P, Vineeth; Kumar, P.S. Anil, E-mail: anil@physics.iisc.ernet.in
2017-01-15
The implementation of magnetic domain wall (DW) based memory and logic devices critically depend on the control over DW assisted magnetization reversal processes. Here we investigate the magnetization reversal by DW injection, pinning and depinning at a geometrical constriction in permalloy nanowire (NW) driven by external in-plane magnetic field, using local electrical probes. The observations of two distinct depinning field values are identified with the help of micromagnetic simulations, as being due to vortex DWs of different chiralities. Statistical analysis gave an estimate of chirality dependent pinning probability of DWs at this constriction. The stochastic nature of the DW based reversal driven by magnetic field is revealed here. The asymmetry in the depinning field of the DWs to move to either side of constriction indicates the asymmetric nature of the barrier potential seen by the DWs. The results demonstrate the difficulties in achieving deterministic switching behavior of DW assisted reversal, and provide a platform to understand the main bottlenecks in the technological implementation of DWs.
The role of Rho-kinase and calcium ions in constriction triggered by ET-1.
Wiciński, Michał; Szadujkis-Szadurska, Katarzyna; Węclewicz, Mateusz M; Malinowski, Bartosz; Matusiak, Grzegorz; Walczak, Maciej; Wódkiewicz, Eryk; Grześk, Grzegorz; Pawlak-Osińska, Katarzyna
2018-05-05
Endothelin-1 (ET-1) is one of the key factors regulating tension of smooth muscles in blood vessels. It is believed that ET-1 plays an important role in pathogenesis of hypertension, and cardiovascular diseases; therefore, research in order to limit ET-1-mediated action is still in progress. The main objective of this paper was to evaluate the role of Rho-kinase in the ET-1-induced constriction of arteries. The analysis also included significance of intra- and extracellular pool of calcium ions in constriction triggered by ET-1. The studies were performed on perfused Wistar rat tail arteries. Concentration response curve (CRC) was determined for ET-1 in the presence of increased concentrations of Rho-kinase inhibitor (Y-27632) and IP3-receptor antagonist (2APB), both in reference to constriction triggered by solely ET-1. Afterwards, the influence of calcium ions present in the perfusion fluid was evaluated in terms of the effect triggered by 2APB and occurring in arteries constricted by ET-1. ET-1, in concentration dependent manner, leads to increase in perfusion pressure. Y-27632 and 2APB lead to shift of the concentration response curve for ET-1 to the right with simultaneously lowered maximum effect. There was no difference in reaction of the artery constricted by ET-1 and treated with 2APB in solution containing calcium and in calcium-free solution. Vasoconstrictive action of endothelin is not significantly dependent on the inflow of extracellular calcium, but it is proportional to inflow of Ca 2+ related to activation of IP3 receptors and to Rho-kinase activity. Copyright © 2018. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
GURPREET KAUR
2015-03-01
Full Text Available The present study was designed to investigate the ameliorative potential of Ocimumsanctum and its saponin rich fraction in chronic constriction injury-induced neuropathic pain in rats. The chronic constriction injury was induced by placing four loose ligatures around the sciatic nerve, proximal to its trifurcation. The mechanical hyperalgesia, cold allodynia, paw heat hyperalgesia and cold tail hyperalgesia were assessed by performing the pinprick, acetone, hot plate and cold tail immersion tests, respectively. Biochemically, the tissue thio-barbituric acid reactive species, super-oxide anion content (markers of oxidative stress and total calcium levels were measured. Chronic constriction injury was associated with the development of mechanical hyperalgesia, cold allodynia, heat and cold hyperalgesia along with an increase in oxidative stress and calcium levels. However, administration of Ocimumsanctum (100 and 200 mg/kg p.o. and its saponin rich fraction (100 and 200 mg/kg p.o. for 14 days significantly attenuated chronic constriction injury-induced neuropathic pain as well as decrease the oxidative stress and calcium levels. It may be concluded that saponin rich fraction of Ocimum sanctum has ameliorative potential in attenuating painful neuropathic state, which may be attributed to a decrease in oxidative stress and calcium levels.
Vavrinec, Peter; Henning, Robert H.; Goris, Maaike; Landheer, Sjoerd W.; Buikema, Hendrik; van Dokkum, Richard P. E.
Introduction:Intact myogenic constriction plays a role in renal blood flow autoregulation and protection against pressure-related (renal) injury. However, to what extent alterations in renal artery myogenic constriction are involved in development of renal damage during aging is unknown. Therefore,
Satiety and eating patterns in two species of constricting snakes
DEFF Research Database (Denmark)
Nielsen, Torben P; Jacobsen, Magnus W.; Wang, Tobias
2011-01-01
Satiety has been studied extensively in mammals, birds and fish but very little information exists on reptiles. Here we investigate time-dependent satiation in two species of constricting snakes, ball pythons (Python regius) and yellow anacondas (Eunectes notaeus). Satiation was shown to depend...
From diffusive to ballistic transport in etched graphene constrictions and nanoribbons
Energy Technology Data Exchange (ETDEWEB)
Somanchi, Sowmya; Peiro, Julian; Staggenborg, Maximilian; Beschoten, Bernd [JARA-FIT and 2nd Institute of Physics, RWTH Aachen University (Germany); Terres, Bernat; Stampfer, Christoph [JARA-FIT and 2nd Institute of Physics, RWTH Aachen University (Germany); Peter Gruenberg Institute (PGI-9), Forschungszentrum Juelich (Germany); Watanabe, Kenji; Taniguchi, Takashi [National Institute for Materials Science, Tsukuba (Japan)
2017-11-15
Graphene nanoribbons and constrictions are envisaged as fundamental components of future carbon-based nanoelectronic and spintronic devices. At nanoscale, electronic effects in these devices depend heavily on the dimensions of the active channel and the nature of edges. Hence, controlling both these parameters is crucial to understand the physics in such systems. This review is about the recent progress in the fabrication of graphene nanoribbons and constrictions in terms of low temperature quantum transport. In particular, recent advancements using encapsulated graphene allowing for quantized conductance and future experiments towards exploring spin effects in these devices are presented. The influence of charge carrier inhomogeneity and the important length scales which play a crucial role for transport in high quality samples are also discussed. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Sheath formation and extraction of ions from a constricted R.F ion source
Energy Technology Data Exchange (ETDEWEB)
Abdel-Salam, F W; Helal, A G; El-Khabeary, H; El-Merai, N T [Accelerators Dept., Nuclear Research Center, Atomic Energy Authority, Cairo, (Egypt)
1997-12-31
The present work investigates the plasma characteristics in a constricted R. F. ion source. The extraction of ions from the plasma boundary and sheath formation were studied. The ion source physical parameters are discussed in order to understand the physical processes occurring within the discharge region up to the extraction system. Electron temperature and density were determined using Langmuir probe. The probe current-voltage characteristics were measured for different extraction voltages (ext.) = 0,500,1000, and 1250 volt at various constant R.F. powers. The effect of R.F. power on electron temperature was deduced for a beam = plasma discharge. This revealed that for a quasi-neutral (plasma) region the electron temperature increased linearly with the R.F. Power which leads to substantial electron heating and efficient electron energy transport in this region. Applying extraction voltage, the electron temperature drops as the ionization rate increases. The sheath thickness was obtained at constant extraction voltages. The curves show that if the ion current density increased, the sheath thickness decreased while it increases by increasing extraction voltage, and it is negligible in the plasma region. 13 figs.
Dearworth, James R; Brenner, J E; Blaum, J F; Littlefield, T E; Fink, D A; Romano, J M; Jones, M S
2009-01-01
The pond turtle (Trachemys scripta elegans) exhibits a notably sluggish pupillary light reflex (PLR), with pupil constriction developing over several minutes following light onset. In the present study, we examined the dynamics of the efferent branch of the reflex in vitro using preparations consisting of either the isolated head or the enucleated eye. Stimulation of the oculomotor nerve (nIII) using 100-Hz current trains resulted in a maximal pupil constriction of 17.4% compared to 27.1% observed in the intact animal in response to light. When current amplitude was systematically increased from 1 to 400 microA, mean response latency decreased from 64 to 45 ms, but this change was not statistically significant. Hill equations fitted to these responses indicated a current threshold of 3.8 microA. Stimulation using single pulses evoked a smaller constriction (3.8%) with response latencies and threshold similar to that obtained using train stimulation. The response evoked by postganglionic stimulation of the ciliary nerve using 100-Hz trains was largely indistinguishable from that of train stimulation of nIII. However, application of single-pulse stimulation postganglionically resulted in smaller pupil constriction at all current levels relative to that of nIII stimulation, suggesting that there is amplification of efferent drive at the ganglion. Time constants for constrictions ranged from 88 to 154 ms with relaxations occurring more slowly at 174-361 ms. These values for timing from in vitro are much faster than the time constant 1.66 min obtained for the light response in the intact animal. The rapid dynamics of pupil constriction observed here suggest that the slow PLR of the turtle observed in vivo is not due to limitations of the efferent pathway. Rather, the sluggish response probably results from photoreceptive mechanisms or central processing.
Bone-borne palatal distraction to correct the constricted cleft maxilla.
Vyas, Raj M; Jarrahy, Reza; Sisodia, Manisha; Jourabchi, Natanel; Wasson, Kristy L; Bradley, James P
2009-05-01
Transverse maxillary hypoplasia, with or without cleft deformity, is typically treated with orthodontic expansion. However, the management of those patients who present later in life with severe uncorrected deformities or who have failed prior orthodontic care remains controversial. Tooth-borne palatal expanders have limitations in this subset of patients with scarred, constricted cleft palate. In this study, we assess the efficacy and safety of using a bone-borne palatal distraction device as an alternative treatment for this difficult subset of patients. Older children with a constricted maxilla who previously had unilateral or bilateral cleft lip and palate repairs and failed orthodontic expansion were included in the study (n = 15). Patients underwent Le Fort I corticotomy with placement of the bone-borne distraction device, expansion at a rate of 0.5 mm/d, and subsequent alveolar bone grafting. Preoperative and follow-up maxillary impressions were compared with assessed improvements in intermolar distance, intercanine distance, alveolar cleft width, and total palatal area. In addition, a small group of noncleft patients with constricted maxillas was treated with bone-borne palatal distraction without a corticotomy (n = 4). The mean amount of distraction in all patients was 14.1 mm, with a follow-up period of 19 months (range, 8-30 months). The average increase in intermolar distance was 8.4 mm, intercanine distance increased by an average of 9.5 mm, and palate surface areas were increased by a mean of 28.9 mm2. Relapse was between 4% and 7%, and all patients underwent subsequent alveolar bone grafting. In addition, the noncleft patients successfully underwent bone-borne palatal distraction without a corticotomy, with a 4% to 5% relapse. Rapid palatal expansion using a bone-borne distraction device in cleft patients with transverse maxillary hypoplasia who have failed nonsurgical orthodontic expansion provides adequate expansion necessary for alveolar bone
Directory of Open Access Journals (Sweden)
Summachiwakij Sarawut
2012-06-01
Full Text Available Abstract Introduction Chylothorax and chylous ascites are uncommon and usually associated with trauma or neoplasms. To the best of our knowledge, constrictive pericarditis leading to chylothorax and chylous ascites in a person infected with HIV has never previously been described. Case presentation A 39-year-old Thai man was referred to our institute with progressive dyspnea, edema and abdominal distension. His medical history included HIV infection and pulmonary tuberculosis that was complicated by tuberculous pericarditis and cardiac tamponade. Upon further investigation, we found constrictive pericarditis, chylothorax and chylous ascites. A pericardiectomy was performed which resulted in gradual resolution of the ascites and chylous effusion. Conclusions Although constrictive pericarditis is an exceptionally rare cause of chylothorax and chylous ascites, it should nonetheless be considered in the differential diagnosis as a potentially reversible cause.
One-stage release of congenital constriction band in lower limb from new born to 3 years
Das, Sakti Prasad; Sahoo, PK; Mohanty, RN; Das, SK
2010-01-01
Background: Congenital constriction band is the most common cause of terminal congenital malformation of a limb and lymphoedema. Superficial bands do not need any treatment, but deeper bands are managed with excision and Z-plasty. The circumferential bands are released in two to three stages to prevent vascular compromise. The purpose of this study was to present the outcome of one-stage release. Materials and Methods: Nineteen children, 12 boys and 7 girls, with 24 congenital constriction...
Clogging in constricted suspension flows
Marin, Alvaro; Lhuissier, Henri; Rossi, Massimiliano; Kähler, Christian J.
2018-02-01
The flow of a charged-stabilized suspension through a single constricted channel is studied experimentally by tracking the particles individually. Surprisingly, the behavior is found to be qualitatively similar to that of inertial dry granular systems: For small values of the neck-to-particle size ratio (D /d reported for granular systems and agree for moderate particle volume fraction (ϕ ≈20 % ) with a simple stochastic model for the number of particles at the neck. For larger neck sizes (D /d >3 ), even at the largest ϕ (≈60 %) achievable in the experiments, an uninterrupted particle flow is observed, which resembles that of an hourglass. This particularly small value of D /d (≃3 ) at the transition to a practically uninterrupted flow is attributed to the low effective friction between the particles, achieved by the particle's functionalization and lubrication.
Atrial flutter ablation in a case of diuretic resistant constrictive pericarditis
Directory of Open Access Journals (Sweden)
James F. Pittaway
2015-07-01
This is the first reported case of symptomatic improvement in a patient with constrictive pericarditis and persistent atrial flutter with targeted treatment of the dysrhythmia. This offers a possible short-term palliation option in a group of patients where definitive surgical management carries too high a risk.
International Nuclear Information System (INIS)
Shi Zongqian; Liu Zhigang; Jia Shenli; Song Xiaochuan; Wang Lijun
2009-01-01
Effect of the axial magnetic field (AMF) on resisting the constriction of a high-current vacuum arc is studied in this paper. Two typical AMF distributions were investigated, i.e., the traditional bell-shaped AMF, and the saddle-shaped AMF. Experiments were conducted in a detachable vacuum chamber with a rms arc current in the range of 10 kA to 25 kA. The arc column was photographed by a high-speed digital camera with an exposure time of 2 microseconds. The constriction of the vacuum arc was compared by processing the images of the arc column under the two different field configurations and numerically determining the dimensions of the arc column near the electrodes. It was also confirmed that the AMF distribution had a significant influence on its effectiveness in resisting arc constriction. Furthermore, the AMF strength near the periphery of the arc is more influential than that at the centre of the electrodes in resisting arc constriction.
Institute of Scientific and Technical Information of China (English)
王立军; 贾申利; 史宗谦; 荣命哲
2005-01-01
Based on magnetohydrodynamic (MHD) model of vacuum arc, the computer simulation of vacuum arc was carried out in this paper. In the MHD model, mass conservation equation,momentum conservation equations, energy conservation equations, generalized ohm's law and Maxwell equation were considered. MHD equations were calculated by numerical method, and the distribution of vacuum arc plasma parameters and current density were obtained. Simulation results showed that the magnetic constriction effect of vacuum arc is primarily caused by the Hall effect. In addition, the inhibition of axial magnetic field (AMF) on constriction of vacuum arc was calculated and analyzed.
Flux nucleation in the current-induced resistive state of a constricted type I superconductor
International Nuclear Information System (INIS)
Selig, K.P.; Huebener, R.P.
1981-01-01
The current-induced resistive state in a constricted type I superconductor is characterized by a train of flux tubes traversing the sample perpendicular to the direction of the applied current following its nucleation at the sample edge. The temporal structure of the nucleation process can be investigated by attempting to synchronize this process with small periodic current pulses superimposed on the direct bias current. The resistive dc voltage is then to be measured as a function of the pulse parameters such as frequency and width. We have performed such experiments at 4.2 K on constricted Pb films of 6--8 μm thickness and 100 μm width. Simultaneously with the electrical measurements the dynamic behavior of the flux tubes was directly observed using a stroboscopic magnetooptical method for magnetic flux detection. Our electrical measurements clearly show how the size of the nucleated flux tubes varies with the direct bias current and the nucleation frequency. The positive wall energy in the Pb films results in a lower limit for this size as expected. The influence of the preceding flux tubes still existing within the constriction upon the flux nucleation process is revealed in detail. All observations can be understood from a consideration of the energy balance during the flux nucleation process
Zhang, Peng; Liu, Yuxin
2017-09-01
Sample enrichment or molecules concentration is considered an essential step in sample processing of miniaturized devices aimed at biosensing and bioanalysis. Among all the means involved to achieve this aim, dielectrophoresis (DEP) is increasingly employed in molecules manipulation and concentration because it is non-destructive and high efficiency. This paper presents a methodology to achieve protein concentration utilizing the combination effects of electrokinetics and low frequency insulating dielectrophoresis (iDEP) generated within a microfluidic device, in which a submicron constricted channel was fabricated using DNA molecular combing and replica molding. This fabrication technique avoids using e-beam lithography or other complicated nanochannel fabrication methods, and provides an easy and low cost approach with the flexibility of controlling channel dimensions to create highly constricted channels embedded in a microfluidic device. With theoretical analysis and experiments, we demonstrated that fluorescein isothiocyanate conjugated bovine serum albumin (FITC-BSA) protein molecules can be significantly concentrated to form an arc-shaped band near the constricted channel under the effects of a negative dielectrophoretic force and DC electrokinetic forces within a short period of time. It was also observed that the amplitudes of the applied DC and AC electric fields, the AC frequencies as well as the suspending medium conductivities had strong effects on the concentration responses of the FITC-BSA molecules, including the concentrated area and position, intensities of the focused molecules, and concentration speed. Our method provides a simple and flexible approach for quickly concentrating protein molecules by controlling the applied electric field parameters. The iDEP device reported in this paper can be used as a stand-alone sensor or worked as a pre-concentration module integrated with biosensors for protein biomarker detection. Furthermore, low
Energy Technology Data Exchange (ETDEWEB)
Stepniewski, M; Janik, A [Akademia Medyczna, Krakow (Poland)
1980-01-01
In 12 newborns with hypertrophic constriction of the pylorus the coefficient of the leucine - /sup 14/C distribution in the erythrocyte intracellular twice: the first time during day prior the operation corresponding to advanced malnutrition of the newborns, and the second time seven days after pylorotomy. During the second period the effects of hyponutrition were partially balanced. The obtained data were compared with that noted in 12 healthy newborns and additionally with data of examination done with samples of conserved blood. In newborns with hypertrophic constriction of the pylorus the coefficient of leucine distribution prior the operation was significantly lower than that in the control group and conserved blood. After seven days from operation a significant increase of above coefficient is compared with the control group and erythrocytes in conserved blood has been noted. Above results suggest that disturbances in penetration of leucine through cell membranes of erythrocytes are in association with malnutrition caused by constriction of the pylorus.
Directory of Open Access Journals (Sweden)
Fábio Fernandes
2017-10-01
Full Text Available Abstract Background: International studies have reported the value of the clinical profile and laboratory findings in the diagnosis of constrictive pericarditis. However, Brazilian population data are scarce. Objective: To assess the clinical characteristics, sensitivity of imaging tests and factors related to the death of patients with constrictive pericarditis undergoing pericardiectomy. Methods: Patients with constrictive pericarditis surgically confirmed were retrospectively assessed regarding their clinical and laboratory variables. Two methods were used: transthoracic echocardiography and cardiac magnetic resonance imaging. Mortality predictors were determined by use of univariate analysis with Cox proportional hazards model and hazard ratio. All tests were two-tailed, and an alpha error ≤ 5% was considered statically significant. Results: We studied 84 patients (mean age, 44 ± 17.9 years; 67% male. Signs and symptoms of predominantly right heart failure were present with jugular venous distention, edema and ascites in 89%, 89% and 62% of the cases, respectively. Idiopathic etiology was present in 69.1%, followed by tuberculosis (21%. Despite the advanced heart failure degree, low BNP levels (median, 157 pg/mL were found. The diagnostic sensitivities for constriction of echocardiography and magnetic resonance imaging were 53.6% and 95.9%, respectively. There were 9 deaths (10.7%, and the risk factors were: anemia, BNP and C reactive protein levels, pulmonary hypertension >55 mm Hg, and atrial fibrillation. Conclusions: Magnetic resonance imaging had better diagnostic sensitivity. Clinical, laboratory and imaging markers were associated with death.
Silvestre, Odilson Marcos; Adam, Eduardo Leal; de Melo, Dirceu Thiago Pessoa; Dias, Ricardo Ribeiro; Ramires, Felix J. A.; Mady, Charles
2013-01-01
ABSTRACT The association of anomalous right coronary artery originating from the pulmonary artery and constrictive pericarditis has never been showed in the literature. We present the first case of this unusual association in a patient with right heart failure. After diagnosis, the patient was referred to surgery and underwent phrenic-to-phrenic pericardiectomy; graft implant of right internal thoracic artery to right coronary artery; and ligation of the anomalous origin of the right coronary artery from the pulmonary artery. Such procedures solved the potential risk of sudden death related to anomalous right coronary artery originating from the pulmonary artery and alleviated the symptoms of heart failure caused by constrictive pericarditis. PMID:24136766
Foam flows through a local constriction
Chevalier, T.; Koivisto, J.; Shmakova, N.; Alava, M. J.; Puisto, A.; Raufaste, C.; Santucci, S.
2017-11-01
We present an experimental study of the flow of a liquid foam, composed of a monolayer of millimetric bubbles, forced to invade an inhomogeneous medium at a constant flow rate. To model the simplest heterogeneous fracture medium, we use a Hele-Shaw cell consisting of two glass plates separated by a millimetric gap, with a local constriction. This single defect localized in the middle of the cell reduces locally its gap thickness, and thus its local permeability. We investigate here the influence of the geometrical property of the defect, specifically its height, on the average steady-state flow of the foam. In the frame of the flowing foam, we can observe a clear recirculation around the obstacle, characterized by a quadrupolar velocity field with a negative wake downstream the obstacle, which intensity evolves systematically with the obstacle height.
International Nuclear Information System (INIS)
Hara, Youichi; Kuroda, Hiroaki; Ishiguro, Shingo; Hamasaki, Takafumi; Ashida, Yasushi; Tonomoto, Nagahisa; Miyasaka, Shigeto; Mori, Tohru
1997-01-01
A case of constrictive pericarditis developing 2 years after radiation therapy for esophageal carcinoma is reported. A man of 48 years old was diagnosed as early esophageal carcinoma and treated with radiation theraphy of 60 Gy. After 12 months, he developed acute pericarditis, which remitted spontaneously. After 18 months, he developed constrictive pericarditis, which did response to medical treatment, and became NYHA grade 4. After 25 months, pericardial sac and epicardium were resected. But dilatation of right ventricular dimension was not enough and hemodynamics did not recover. However, subjective symptom was extremely improved, and he left the hospital by walk at 29 days after the surgery. (K.H.)
Šmidrkalová, Nina
2012-01-01
Tato diplomová práce se zabývá problematikou měřících systémů, především užívajících metody Q/H charakteristiky. Popisuje ostrohranné přelivy a zmiňuje se i o měrných žlabech. Uvádí možnosti monitorování průtoků v napevno nainstalovaných profilech s volnou hladinou. Součástí práce je i experiment, který je zaměřen na simulaci nestandardních přítokových proudových poměrů před instalovaným přelivem pro stanovení jejich vlivu na Q/H charakteristiku. Experiment je proveden na pravoúhlém ostrohran...
Hong, Haifa; Ye, Lincai; Chen, Huiwen; Xia, Yu; Liu, Yue; Liu, Jinfen; Lu, Yanan; Zhang, Haibo
2015-08-01
We aimed to evaluate global changes in protein expression associated with patency by undertaking proteomic analysis of human constricted and patent ductus arteriosus (DA). Ten constricted and 10 patent human DAs were excised from infants with ductal-dependent heart disease during surgery. Using isobaric tags for relative and absolute quantitation-based quantitative proteomics, 132 differentially expressed proteins were identified. Of 132 proteins, voltage-gated sodium channel 1.3 (SCN3A), myosin 1d (Myo1d), Rho GTPase activating protein 26 (ARHGAP26), and retinitis pigmentosa 1 (RP1) were selected for validation by Western blot and quantitative real-time polymerase chain reaction analyses. Significant upregulation of SCN3A, Myo1d, and RP1 messenger RNA, and protein levels was observed in the patent DA group (all P ≤ 0.048). ARHGAP26 messenger RNA and protein levels were decreased in patent DA tissue (both P ≤ 0.018). Immunohistochemistry analysis revealed that Myo1d, ARHGAP26, and RP1 were specifically expressed in the subendothelial region of constricted DAs; however, diffuse expression of these proteins was noted in the patent group. Proteomic analysis revealed global changes in the expression of proteins that regulate oxygen sensing, ion channels, smooth muscle cell migration, nervous system, immune system, and metabolism, suggesting a basis for the systemic regulation of DA patency by diverse signaling pathways, which will be confirmed in further studies.
Congenital Constriction Ring of Limbs in Subjects with History of Maternal Substance Use
International Nuclear Information System (INIS)
Malik, S.; Lal, K.; Fatima, N. G.; Haque, S.; Samo, A.
2015-01-01
Congenital Constriction Ring (CCR) is a rare malformation which manifests itself in the form of ring-like constrictive bands. Due to its heterogeneous nature, its etiology remains unclear. Here, we present a series of seven independent individuals afflicted with CCR, which primarily involved the digits. The phenotypic manifestations included terminal phalangeal reduction, anonychia, digit hypoplasia, and acrosyndactyly. Mesoaxial digits in hands and preaxial digits in feet were most frequently affected. Camptodactyly and clubfoot were witnessed in four and one subject, respectively. Curiously, mothers of six of these subjects revealed that they consumed copious amounts of Multani mitti(Fuller's clay) and/or Naswar(nonsmoke-tobacco), during their respective pregnancies. Maternal substance use during pregnancy is not an unusual practice, however, its relationship with CCR as pregnancy outcome remains unexplored. Case-control studies are warranted to elucidate the relationship between the exposure to these substances and the etiology of CCR and/or other limb defects in the offspring. (author)
DEFF Research Database (Denmark)
Nielsen, Jimmi; Jørgensen, Peter Stanley
2017-01-01
In the present study, the methodology for accurate estimations of the current constriction resistance in solid state electrochemical devices via 3D tomography reconstructions is developed. The methodology is used to determine the current constriction resistances at the Ni:YSZ anode/YSZ electrolyte...... of the electrolyte thickness. The obtained results on current constriction resistances from numerical calculations on a 3D reconstruction of a Ni:YSZ anode/YSZ electrolyte assembly is compared with existing models with analytical expressions. The comparison shows, that the assumptions of existing models are by far...
Directory of Open Access Journals (Sweden)
Töz E
2015-06-01
Full Text Available Emrah Töz, Aykut Özcan, Nesin Apaydin, İbrahim Uyar, Betül Kocakaya, Gülin Okay Department of Gynecology and Obstetrics, Tepecik Education and Research Hospital, İzmir, Turkey Objectives: We performed constricting anterior and posterior colporrhaphy, levator myorrhaphy, and high perineorrhaphy with concurrent hysterectomy, and investigated the intraoperative complications, and short-term outcomes of these constricting procedures in patients aged 75 years or older.Methods: We searched our hospital database for cases, between January 2011 and January 2014, of women aged over 75 years who underwent surgery for pelvic organ prolapse of stage 2 or higher, via vaginal hysterectomy, constricting anterior and posterior colporrhaphy, levator myorrhaphy, and high perineorrhaphy, with or without treatment of urinary incontinence. All volunteers were evaluated via pelvic examination using the pelvic organ prolapse quantification system, the modified Decision Regret Scale–Pelvic Floor Disorders form, the Satisfaction Decision Scale–Pelvic Floor Disorders form, and the Pelvic Floor Distress Inventory form.Results: Fifty-four patients were included in the study. The mean follow-up time was 24.4 months after constricting surgery (range: 8–44 months. There were four cases (7% of de novo urge incontinence (the symptoms resolved upon prescription of anticholinergic medication. Two patients developed de novo stress urinary incontinence after the procedure and were treated via transobturator sling surgery using Safyre T® polypropylene monofilament slings. No anatomical or subjective recurrence of prolapse was noted during the follow-up period. No patient required additional surgery for recurrence of prolapse.Conclusion: Constricting anterior and posterior colporrhaphy, levator myorrhaphy, and high perineorrhaphy with concurrent hysterectomy is a feasible, safe, and effective surgical option in elderly patients at low anesthesiological risk. The decision
Theory of vibratory mobilization and break-up of non-wetting fluids entrapped in pore constrictions
Beresnev, I.; Li, W.; Vigil, D.
2006-12-01
Quantitative dynamics of a non-wetting (e. g., NAPL) ganglion entrapped in a pore constriction and subjected to vibrations can be approximated by the equation of motion of an oscillator moving under the effect of the external pressure gradient, inertial oscillatory force, and restoring capillary force. The solution of the equation provides the conditions under which the droplet experiences forced oscillations without being mobilized or is liberated upon the acceleration of the wall exceeding an "unplugging" threshold. This solution provides a quantitative tool for the estimation of the parameters of vibratory fields needed to liberate entrapped non-wetting fluids. For typical pore sizes encountered in reservoirs and aquifers, wall accelerations must exceed at least several m/sec2 and even higher levels to mobilize the droplets of NAPL; however, in the populations of ganglia entrapped in natural porous environments, many may reside very near their mobilization thresholds and may be mobilized by extremely low accelerations as well. For given acceleration, lower seismic frequencies are more efficient. The ganglia may also break up into smaller pieces when passing through pore constrictions. The snap-off is governed by the geometry only; for constrictions with sinusoidal profile (spatial wavelength of L and maximum and minimum radii of rmax and rmin, the break-up occurs if L > 2π(rmin rmax)1/2. Computational fluid dynamics shows the details of the break-up process.
Abnormal portal vein waveform as an indicator of constrictive pericarditis – a case report
Directory of Open Access Journals (Sweden)
Joanna Ścieszka
2015-06-01
Full Text Available We report a case of a 17-year-old patient referred to our outpatient Doppler Department due to clinical suspicion of liver cirrhosis. The patient presented with non-specifi c symptoms, such as malaise, pain in the right subcostal region, peripheral oedema. Until then, diagnostic imaging, including echocardiography was inconclusive. We performed the Doppler sonography of the portal system, which revealed normal diameter of the portal vein with abnormal, phasic and markedly pulsatile waveform. Hepatic veins distention with pathological reverse fl ow during systole was reported. Additionally, inferior vena cava was dilated and remained unchanged through the respiratory cycle. Basing on the above image a heart disease, which had not been taken into differential diagnosis before, was suggested. The following echocardiography, together with computed tomography, enabled a diagnosis of constrictive pericarditis. Successful pericardiotomy was performed. Such a complicated diagnostics happened to demonstrate an uncommon example of the use of portal vein waveform in making the proper cardiologic diagnosis.
Pediatric constrictive asphyxia a rare form of child abuse: A report of two cases.
Vester, M E M; Bilo, R A C; Nijs, H G T; van Rijn, R R
2018-04-01
We present two cases of infants who died under suspicious circumstances. After clinical and legal investigations, non-accidental constrictive asphyxia inflicted by one of the parents was established. The first case presents a to date not yet reported, unique mechanism of trauma. In order to stop his daughter from crying, the father admitted that he sometimes sat on his baby while she was lying on the bed. Occasionally increasing his force by pulling with his hands on the bottom of the bed. In the second case tight swaddling and encircling chest compression was the causative mechanism. In both cases the father was sentenced to imprisonment with mandate psychiatric care. Only two previous reports of this uncommon and relatively unknown cause of child abuse, called constrictive asphyxia, are known. In all reported cases static loading of the chest resulted in rib fractures and demise of the child. This rare abusive mechanism should be known to pediatric radiologists and pathologists. Copyright © 2018 Elsevier B.V. All rights reserved.
Park, Yoon-Hee; Park, Sumin; Baek, Seung-Hak
2018-03-01
The purpose of this study was to compare the alignment pattern of the constricted maxillary dental arch by fixed orthodontic treatment (FOT) in the well-aligned and constricted arches of unilateral cleft lip and palate (UCLP) patients. 19 UCLP patients were divided into Group 1 (well-aligned arch, n = 9) and Group 2 (constricted arch, n = 10). After the cephalometric and maxillary dental arch variables before (T1) and after FOT (T2) were measured, statistical analysis was performed. There were no significant differences in the surgical timing of cheiloplasty, palatoplasty, and secondary alveolar bone grafting and in the surgical method of cheiloplasty between the 2 groups. However, Group 2 had a higher percentage of palatoplasty method, which could leave the denuded bone for secondary healing than Group 1 (P dental arch compared to Group 1 at the T1 stage (inter-second premolar width, greater segment angle [GSA], and lesser segment angle [LSA], all P dental arch shape, different strategy is necessary to obtain proper alignment by FOT.
International Nuclear Information System (INIS)
Zahnd, G.; Pham, V.T.; Marty, A.; Jamet, M.; Beigné, C.; Notin, L.; Vergnaud, C.; Rortais, F.; Vila, L.; Attané, J.-P.
2016-01-01
We study domain wall injection in 100 nm wide NiFe nanowires, followed by domain wall propagation and pinning on 50 nm wide constrictions. The injection is performed using local and external magnetic fields. Using several nucleation pad geometries, we show that at these small dimensions the use of an external field only does not allow obtaining a reproducible injection/pinning process. However, the use of an additional local field, created by an Oersted line, allows to nucleate a reversed domain at zero external applied field. Then, an external field of 5 mT enables the domain wall to propagate far from the Oersted line, and the pinning occurs reproducibly. We also show that notwithstanding the reproducibility of the pinning process, the depinning field is found to be stochastic, following a bimodal distribution. Using micromagnetic simulation we link two different DW configurations, vortex and transverse, to the two typical depinning fields. - Highlights: • Magnetic domain wall introduction and pinning in Permalloy nanowires with 50 nm wide constrictions. • Magnetic domain nucleation at zero external applied field. • Bimodal distribution of the domain wall configuration in the constriction.
Rolie-Poly fluid flowing through constrictions: Two distinct instabilities
Reis, T.; Wilson, H.J.
2013-01-01
Elastic instabilities of entangled polymer melts are common in industrial processes but the physics responsible is not well understood. We present a numerical linear stability study of a molecular based constitutive model which grants us physical insight into the underlying mechanics involved. Two constriction flows are considered - one shear dominated, the other extension dominated - and two distinct instabilities are found. The influence of the molecular structure and the behaviour of the polymer dynamics are investigated and in both cases chain relaxation and orientation play a crucial role. This suggests a molecular-based physical interpretation of the underlying mechanisms responsible for flow instabilities. © 2013 Elsevier B.V.
Rolie-Poly fluid flowing through constrictions: Two distinct instabilities
Reis, T.
2013-05-01
Elastic instabilities of entangled polymer melts are common in industrial processes but the physics responsible is not well understood. We present a numerical linear stability study of a molecular based constitutive model which grants us physical insight into the underlying mechanics involved. Two constriction flows are considered - one shear dominated, the other extension dominated - and two distinct instabilities are found. The influence of the molecular structure and the behaviour of the polymer dynamics are investigated and in both cases chain relaxation and orientation play a crucial role. This suggests a molecular-based physical interpretation of the underlying mechanisms responsible for flow instabilities. © 2013 Elsevier B.V.
A Rare Case of Pneumopericardium in the Setting of Tuberculous Constrictive Pericarditis
Directory of Open Access Journals (Sweden)
Lauro L. Abrahan IV
2017-01-01
Full Text Available A 28-year-old Filipino male was admitted due to high-grade fevers and dyspnea on a background of chronic cough and weight loss. Due to clinical and echocardiographic signs of cardiac tamponade, emergency pericardiocentesis was performed on his first hospital day. Five days after, chest radiographs showed new pockets of radiolucency within the cardiac shadow, indicative of pneumopericardium. On repeat echo, air microbubbles admixed with loculated effusion were visualized in the anterior pericardial space. Constrictive physiology was also supported by a thickened pericardium, septal bounce, exaggerated respiratory variation in AV valve inflow, and IVC plethora. A chest CT scan confirmed the presence of an air-fluid level within the pericardial sac. The patient was started on a quadruple antituberculosis regimen and IV piperacillin-tazobactam to cover for superimposed acute bacterial pericarditis. Pericardiectomy was performed as definitive management, with stripped pericardium measuring 5–7 mm thick and caseous material extracted from the pericardial sac. Histopathology was consistent with tuberculosis. This report highlights pneumopericardium as a rare complication of pericardiocentesis. We focused on the utility of echocardiography for diagnosing and monitoring this condition on a background of tuberculous constrictive pericarditis, ultimately convincing us that pericardiectomy was necessary, instead of the usual conservative measures for pneumopericardium.
Directory of Open Access Journals (Sweden)
Dotreppe Delphine
2011-11-01
Full Text Available Abstract Background Brucella abortus is the etiological agent of a worldwide zoonosis called brucellosis. This alpha-proteobacterium is dividing asymmetrically, and PdhS, an essential histidine kinase, was reported to be an old pole marker. Results We were interested to identify functions that could be recruited to bacterial poles. The Brucella ORFeome, a collection of cloned predicted coding sequences, was placed in fusion with yellow fluorescent protein (YFP coding sequence and screened for polar localizations in B. abortus. We report that AidB-YFP was systematically localized to the new poles and at constrictions sites in B. abortus, either in culture or inside infected HeLa cells or RAW264.7 macrophages. AidB is an acyl-CoA dehydrogenase (ACAD homolog, similar to E. coli AidB, an enzyme putatively involved in destroying alkylating agents. Accordingly, a B. abortus aidB mutant is more sensitive than the wild-type strain to the lethality induced by methanesulphonic acid ethyl ester (EMS. The exposure to EMS led to a very low frequency of constriction events, suggesting that cell cycle is blocked during alkylation damage. The localization of AidB-YFP at the new poles and at constriction sites seems to be specific for this ACAD homolog since two other ACAD homologs fused to YFP did not show specific localization. The overexpression of aidB, but not the two other ACAD coding sequences, leads to multiple morphological defects. Conclusions Data reported here suggest that AidB is a marker of new poles and constriction sites, that could be considered as sites of preparation of new poles in the sibling cells originating from cell division. The possible role of AidB in the generation or the function of new poles needs further investigation.
Artificially lengthened and constricted vocal tract in vocal training methods.
Bele, Irene Velsvik
2005-01-01
It is common practice in vocal training to make use of vocal exercise techniques that involve partial occlusion of the vocal tract. Various techniques are used; some of them form an occlusion within the front part of the oral cavity or at the lips. Another vocal exercise technique involves lengthening the vocal tract; for example, the method of phonation into small tubes. This essay presents some studies made on the effects of various vocal training methods that involve an artificially lengthened and constricted vocal tract. The influence of sufficient acoustic impedance on vocal fold vibration and economical voice production is presented.
Energy Technology Data Exchange (ETDEWEB)
Cortes-Huerto, R; Ballone, P [Atomistic Simulation Centre, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom)
2010-07-28
An idealized jellium model of conducting nanowires with a geometric constriction is investigated by density functional theory (DFT) in the local spin density (LSD) approximation. The results reveal a fascinating variety of spin and charge patterns arising in wires of sufficiently low (r{sub s} {>=} 15) average electron density, pinned at the indentation by an apparent attractive interaction with the constriction. The spin-resolved frequency-dependent conductivity shows a marked asymmetry in the two spin channels, reflecting the spontaneous spin polarization around the wire neck. The relevance of the computational results is discussed in relation to the so-called 0.7 anomaly found by experiments in the low-frequency conductivity of nanowires at near-breaking conditions (see 2008 J. Phys.: Condens Matter 20, special issue on the 0.7 anomaly). Although our mean-field approach cannot account for the intrinsic many-body effects underlying the 0.7 anomaly, it still provides a diagnostic tool to predict impending transitions in the electronic structure.
Hoque, Sazid Zamal; Anand, D. Vijay; Patnaik, B. S. V.
2017-11-01
The state of the red blood cell (either healthy or infected RBC) will influence its deformation dynamics. Since the pathological condition related to RBC, primarily originates from a single cell infection, therefore, it is important to relate the deformation dynamics to the mechanical properties (such as, bending rigidity and membrane elasticity). In the present study, numerical simulation of a healthy and malaria infected RBC in a constricted channel is analyzed. The flow simulations are carried out using finite sized dissipative particle dynamics (FDPD) method in conjunction with a discrete model that represents the membrane of the RBC. The numerical equivalent of optical tweezers test is validated against the experimental studies. Two different types of constrictions, viz., a converging-diverging type tapered channel and a stenosed microchannel are considered for the simulation. The effect of degree of constriction and the flow rate effect on the RBC is investigated. It was observed that, as the flow rate decreases, the infected RBC completely blocks the micro vessel. The transit time for infected cell drastically increases compared to healthy RBC. Our simulations indicate that, there is a critical flow rate below which infected RBC cannot pass through the micro capillary.
Feng, Le; Lu, Xinxin; Yu, Yonghui; Wang, Tao; Luo, Shengdong; Sun, Zhihui; Duan, Qing; Wang, Ningli; Song, Lihua
2016-01-01
Trachoma, the leading infectious cause of blindness worldwide, is an ancient human disease. Its existence in China can be traced back to as early as the twenty-seventh century BC. In modern China, the overall prevalence of trachoma has dramatically reduced, but trachoma is still endemic in many areas of the country. Here, we report that 26 (8%) of 322 students from two rural boarding schools of Qinghai province, west China, were identified as having ocular C. trachomatis infection; and 15 ocular C. trachomatis strains were isolated from these trachoma patients. Chlamydiae in 37 clinical samples were genotyped as type B based on ompA gene analyses. Three ompA variants with one or two in-between SNP differences in the second or fourth variable domain were found. C. trachomatis strains QH111L and QH111R were from the same patient's left and right conjunctival swabs, respectively, but their ompA genes have a non-synonymous base difference in the second variable domain. Moreover, this SNP only exists in this single sample, suggesting QH111L is a newly emerged ompA variant. Interestingly, chromosomal phylogeny analysis found QH111L clusters between a branch of two type B strains and a branch of both A and C strains, but is significantly divergent from both branches. Comparative chromosome analysis found that compared to sequences of reference B/TZ1A828/OT strain, 12 of 22 QH111L's chromosomal genes exhibiting more than nine SNPs have the best homology with reciprocal genes of UGT strains while 9 of 22 genes are closest to those of type C strains. Consistent with findings of UGT-type genetic features in the chromosome, the QH111L plasmid appears to be intermediate between UGT and classical ocular plasmids due to the existence of UGT-type SNPs in the QH111L plasmid. Moreover, the QH111L strain has a unique evolutionarily older cytotoxin region compared to cytotoxin regions of other C. trachomatis strains. The genome analyses suggest that the QH111L strain is derived from
Differentiation of Constriction and Restriction: Complex Cardiovascular Hemodynamics.
Geske, Jeffrey B; Anavekar, Nandan S; Nishimura, Rick A; Oh, Jae K; Gersh, Bernard J
2016-11-29
Differentiation of constrictive pericarditis (CP) from restrictive cardiomyopathy (RCM) is a complex and often challenging process. Because CP is a potentially curable cause of heart failure and therapeutic options for RCM are limited, distinction of these 2 conditions is critical. Although different in regard to etiology, prognosis, and treatment, CP and RCM share a common clinical presentation of predominantly right-sided heart failure, in the absence of significant left ventricular systolic dysfunction or valve disease, due to impaired ventricular diastolic filling. Fundamental to the diagnosis of either condition is a clear understanding of the underlying hemodynamic principles and pathophysiology. We present a contemporary review of the pathophysiology, hemodynamics, diagnostic assessment, and therapeutic approach to patients presenting with CP and RCM. Copyright © 2016 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.
Datta, Sukdeb; Chatterjee, Koel; Kline, Robert H; Wiley, Ronald G
2010-01-01
Abstract Background Unilateral constrictive sciatic nerve injury (uCCI) is a common neuropathic pain model. However, the bilateral constrictive injury (bCCI) model is less well studied, and shows unique characteristics. In the present study, we sought to correlate effects of bCCI on nocifensive responses to cold and mechanical stimuli with selected dorsal horn anatomic markers. bCCI or sham ligation of both rat sciatic nerves were followed up to 90 days of behavioural testing. Additional rats...
Okokhere, Peter O.; Iruolagbe, Christopher Ojemiega; Odike, Angela; Owobu, Clifford; Akhigbe, Theophilus
2016-01-01
Background. The diagnosis and treatment of massive pericardial effusion and cardiac tamponade have evolved over the years with a tendency towards a more comprehensive diagnostic workup and less traumatic intervention. Method. We reviewed and analysed the data of 32 consecutive patients who underwent surgery on account of massive pericardial effusion and cardiac tamponade in a semiurban university hospital in Nigeria from February 2010 to February 2016. Results. The majority of patients (34.4%) were between 31 and 40 years. Fourteen patients (43.8%) presented with clinical and echocardiographic feature of cardiac tamponade. The majority of patients (59.4%) presented with haemorrhagic pericardial effusion and the average volume of fluid drained intraoperatively was 846 mL ± 67 mL. Pericardium was thickened in 50% of cases. Subxiphoid pericardiostomy was performed under local anaesthesia in 28 cases. No postoperative recurrence was observed; however 5 patients developed features of constrictive pericarditis. The relationship between pericardial thickness and development of pericardial constriction was statistically significant (p = 0.004). Conclusion. Subxiphoid pericardiostomy is a very effective way of treating massive pericardial effusion. Removing tube after adequate drainage (50 mL/day) and treatment of primary pathology are key to preventing recurrence. There is also a need to follow up patients to detect pericardial constriction especially those with thickened pericardium. PMID:27517082
Blood pressure is the major driving force for plaque formation in aortic-constricted ApoE-/- mice
DEFF Research Database (Denmark)
Johansson, Maria E.; Wickman, Anna; Skøtt, Ole
2006-01-01
OBJECTIVE: Using an aortic constriction model in mice, we studied whether the increase in pressure or the activation of the renin-angiotensin system (RAS) and its main receptors is the main driving force for plaque progression. METHODS: Male ApoE mice underwent sham surgery or placement of a supr...
Energy Technology Data Exchange (ETDEWEB)
Garofalo, A. M., E-mail: garofalo@fusion.gat.com; Burrell, K. H.; Meneghini, O.; Osborne, T. H.; Paz-Soldan, C.; Smith, S. P.; Snyder, P. B.; Turnbull, A. D. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Eldon, D.; Grierson, B. A.; Solomon, W. M. [Princeton Plasma Physics Laboratory, P.O. Box 451, Princeton, New Jersey 08543-0451 (United States); Hanson, J. M. [Columbia University, 2960 Broadway, New York, New York 10027-6900 (United States); Holland, C. [University of California San Diego, 9500 Gilman Dr., La Jolla, California 92093-0417 (United States); Huijsmans, G. T. A.; Liu, F.; Loarte, A. [ITER Organization, Route de Vinon sur Verdon, 13067 St Paul Lez Durance (France); Zeng, L. [University of California Los Angeles, P.O. Box 957099, Los Angeles, California 90095-7099 (United States)
2015-05-15
For the first time, DIII-D experiments have achieved stationary quiescent H-mode (QH-mode) operation for many energy confinement times at simultaneous ITER-relevant values of beta, confinement, and safety factor, in an ITER-like shape. QH-mode provides excellent energy confinement, even at very low plasma rotation, while operating without edge localized modes (ELMs) and with strong impurity transport via the benign edge harmonic oscillation (EHO). By tailoring the plasma shape to improve the edge stability, the QH-mode operating space has also been extended to densities exceeding 80% of the Greenwald limit, overcoming the long-standing low-density limit of QH-mode operation. In the theory, the density range over which the plasma encounters the kink-peeling boundary widens as the plasma cross-section shaping is increased, thus increasing the QH-mode density threshold. The DIII-D results are in excellent agreement with these predictions, and nonlinear magnetohydrodynamic analysis of reconstructed QH-mode equilibria shows unstable low n kink-peeling modes growing to a saturated level, consistent with the theoretical picture of the EHO. Furthermore, high density operation in the QH-mode regime has opened a path to a new, previously predicted region of parameter space, named “Super H-mode” because it is characterized by very high pedestals that can be more than a factor of two above the peeling-ballooning stability limit for similar ELMing H-mode discharges at the same density.
Directory of Open Access Journals (Sweden)
Zhi MJ
2017-09-01
Full Text Available Mu-Jun Zhi,1,2,* Kun Liu,1,* Zhou-Li Zheng,1,3 Xun He,1 Tie Li,2 Guang Sun,1,2 Meng Zhang,4 Fu-Chun Wang,2 Xin-Yan Gao,1 Bing Zhu1 1Department of Physiology, Institute of Acupuncture and Moxibustion, China Academy of Chinese Medical Sciences, Beijing, People’s Republic of China; 2College of Acupuncture and Moxibustion, Changchun University of Chinese Medicine, Changchun, People’s Republic of China; 3College of Acupuncture and Moxibution, Shaanxi University of Chinese Medicine, People’s Republic of China; 4Department of Chinese Medicine, Dongli Hospital of Traditional Chinese Medicine, Tianjin, People’s Republic of China *These authors contributed equally to this work Purpose: To validate and explore the application of a rat model of chronic constriction injury to the partial sciatic nerve in investigation of acupuncture analgesia.Methods: Chronic constriction injury of the sciatic nerve (CCI and chronic constriction injury of the partial sciatic nerve (CCIp models were generated by ligating either the sciatic nerve trunk or its branches in rats. Both models were evaluated via paw mechanical withdrawal latency (PMWL, paw mechanical withdrawal threshold (PMWT, nociceptive reflex-induced electromyogram (C-fiber reflex EMG, and dorsal root ganglion immunohistochemistry. Electroacupuncture (EA was performed at GB30 to study the analgesic effects on neuropathic pain and the underlying mechanisms.Results: Following ligation of the common peroneal and tibial nerves, CCIp rats exhibited hindlimb dysfunction, hind paw shrinkage and lameness, mirroring those of CCI rats (generated by ligating the sciatic nerve trunk. Compared to presurgery measurements, CCIp and CCI modeling significantly decreased the PMWL and PMWT. EA at GB30 increased the PMWL and PMWT in both CCI and CCIp rats. Calcitonin gene-related polypeptide and substance P expressions were apparently increased in both CCI and CCIp groups, but were not different from each other. The C
Bubble propagation in Hele-Shaw channels with centred constrictions
Franco-Gómez, Andrés; Thompson, Alice B.; Hazel, Andrew L.; Juel, Anne
2018-04-01
We study the propagation of finite bubbles in a Hele-Shaw channel, where a centred occlusion (termed a rail) is introduced to provide a small axially uniform depth constriction. For bubbles wide enough to span the channel, the system’s behaviour is similar to that of semi-infinite fingers and a symmetric static solution is stable. Here, we focus on smaller bubbles, in which case the symmetric static solution is unstable and the static bubble is displaced towards one of the deeper regions of the channel on either side of the rail. Using a combination of experiments and numerical simulations of a depth-averaged model, we show that a bubble propagating axially due to a small imposed flow rate can be stabilised in a steady symmetric mode centred on the rail through a subtle interaction between stabilising viscous forces and destabilising surface tension forces. However, for sufficiently large capillary numbers Ca, the ratio of viscous to surface tension forces, viscous forces in turn become destabilising thus returning the bubble to an off-centred propagation regime. With decreasing bubble size, the range of Ca for which steady centred propagation is stable decreases, and eventually vanishes through the coalescence of two supercritical pitchfork bifurcations. The depth-averaged model is found to accurately predict all the steady modes of propagation observed experimentally, and provides a comprehensive picture of the underlying steady bifurcation structure. However, for sufficiently large imposed flow rates, we find that initially centred bubbles do not converge onto a steady mode of propagation. Instead they transiently explore weakly unstable steady modes, an evolution which results in their break-up and eventual settling into a steady propagating state of changed topology.
Selvaraj, Loganathan
2016-01-01
This technical report describes a simple and innovative surgical technique for supra-alar sidewall region constriction and supra-alar crease attenuation by cinching technique through intraoral approach.
Selvaraj, Loganathan
2016-01-01
This technical report describes a simple and innovative surgical technique for supra-alar sidewall region constriction and supra-alar crease attenuation by cinching technique through intraoral approach.
Equivalence ratio and constriction effects on RBCC thrust augmentation
Koupriyanov, M.; Etele, J.
2011-06-01
A theoretical analysis of a variable area rocket based combined cycle engine with and without simultaneous mixing and combustion is presented. The flowfield is solved using a steady, quasi-one-dimensional, inviscid control volume formulation with combustion effects included via a generalized equilibrium calculation. Compression augmentation is shown to be sensitive to the equivalence ratio within the primary rocket chamber, where ejector section performance is greatest at both low and high equivalence ratios but near a minimum at stoichiometric conditions. The thrust generated by the RBCC engine compared to that generated by the same rocket in isolation can be increased by as much as 12% at constriction ratios of between 45% and 50%. Thrust augmentation is also shown to vary with equivalence ratio, where for a fixed geometry the maximum thrust is generated at equivalence ratios slightly below unity.
Goten, Chiaki; Murai, Hisayoshi; Takashima, Shin-Ichiro; Kato, Takeshi; Usui, Soichiro; Furusho, Hiroshi; Saeki, Takahiro; Sakagami, Satoru; Takemura, Hirofumi; Kaneko, Shuichi; Takamura, Masayuki
2018-05-31
The main etiology of constrictive pericarditis (CP) has changed from tuberculosis to therapeutic mediastinal radiation and cardiac surgery. Occult constrictive pericardial disease (OCPD) is a covert disease in which CP is manifested in a condition of volume overload. A 60-year-old patient with a history of thoracic radiation therapy for non-Hodgkin's lymphoma (40 years earlier) was transferred to our hospital for treatment of repeated congestive heart failure. For a preoperative hemodynamic study, pre-hydration with intravenous normal saline (50 mL/hour) was used to manifest the pericardial disease and prevent contrast-induced nephropathy. The hemodynamic study showed a right ventricular dip-plateau pattern and discordance of right and left ventricular systolic pressures during inspiration, which was not seen in the volume-controlled state. These responses were concordant with OCPD. A pericardiectomy, aortic valve replacement, and mitral and tricuspid valve repair were performed. Postoperatively, the heart failure was controlled with standard medication. This case revealed a volume-induced change in hemodynamics in OCPD with severe combined valvular heart disease, which suggests the importance of considering OCPD in patients who had undergone radiation therapy 40 years before.
Directory of Open Access Journals (Sweden)
Hiroshi Ito
2010-05-01
Full Text Available Hiroshi Ito1, Hiroyoshi Kawaai1, Shinya Yamazaki1, Yosuke Suzuki21Division of Systemic Management, Department of Oral Function, 2Division of Radiology and Diagnosis, Department of Medical Sciences, Ohu University, Post Graduate School of Dentistry, Koriyama City, Fukushima Prefecture, JapanAbstract: From a retrospective evaluation of data on accidents and deaths during dental procedures, it has been shown that several patients who refused dental treatment died of asphyxia during dental procedures. We speculated that forcible maximum opening of the mouth by using a mouth prop triggers this asphyxia by affecting the upper airway. Therefore, we assessed the morphological changes of the upper airway following maximal opening of the mouth. In 13 healthy adult volunteers, the sagittal diameter of the upper airway on lateral cephalogram was measured between the two conditions; closed mouth and maximally open mouth. The dyspnea in each state was evaluated by a visual analog scale. In one subject, a computed tomograph (CT was taken to assess the three-dimensional changes in the upper airway. A significant difference was detected in the mean sagittal diameter of the upper airway following use of the prop (closed mouth: 18.5 ± 3.8 mm, maximally open mouth: 10.4 ± 3.0 mm. All subjects indicated upper airway constriction and significant dyspnea when their mouth was maximally open. Although a CT scan indicated upper airway constriction when the mouth was maximally open, muscular compensation was admitted. Our results further indicate that the maximal opening of the mouth narrows the upper airway diameter and leads to dyspnea. The use of a prop for the patient who has communication problems or poor neuromuscular function can lead to asphyxia. When the prop is used for patient refusal in dentistry, the respiratory condition should be monitored strictly, and it should be kept in mind that the “sniffing position” is effective for avoiding upper airway
Sengupta, Partho P; Huang, Yen-Min; Bansal, Manish; Ashrafi, Ali; Fisher, Matt; Shameer, Khader; Gall, Walt; Dudley, Joel T
2016-06-01
Associating a patient's profile with the memories of prototypical patients built through previous repeat clinical experience is a key process in clinical judgment. We hypothesized that a similar process using a cognitive computing tool would be well suited for learning and recalling multidimensional attributes of speckle tracking echocardiography data sets derived from patients with known constrictive pericarditis and restrictive cardiomyopathy. Clinical and echocardiographic data of 50 patients with constrictive pericarditis and 44 with restrictive cardiomyopathy were used for developing an associative memory classifier-based machine-learning algorithm. The speckle tracking echocardiography data were normalized in reference to 47 controls with no structural heart disease, and the diagnostic area under the receiver operating characteristic curve of the associative memory classifier was evaluated for differentiating constrictive pericarditis from restrictive cardiomyopathy. Using only speckle tracking echocardiography variables, associative memory classifier achieved a diagnostic area under the curve of 89.2%, which improved to 96.2% with addition of 4 echocardiographic variables. In comparison, the area under the curve of early diastolic mitral annular velocity and left ventricular longitudinal strain were 82.1% and 63.7%, respectively. Furthermore, the associative memory classifier demonstrated greater accuracy and shorter learning curves than other machine-learning approaches, with accuracy asymptotically approaching 90% after a training fraction of 0.3 and remaining flat at higher training fractions. This study demonstrates feasibility of a cognitive machine-learning approach for learning and recalling patterns observed during echocardiographic evaluations. Incorporation of machine-learning algorithms in cardiac imaging may aid standardized assessments and support the quality of interpretations, particularly for novice readers with limited experience. © 2016
International Nuclear Information System (INIS)
Burrell, K.H.; Osborne, T.H.; Snyder, P.B.; West, W.P.; Chu, M.S.; Fenstermacher, M.E.; Gohil, P.; Solomon, W.M.
2008-01-01
We have made two significant discoveries in our recent studies of quiescent H-mode (QH-mode) plasmas in DIII-D. First, we have found that we can control the edge pedestal density and pressure by altering the edge particle transport through changes in the edge toroidal rotation. This allows us to adjust the edge operating point to be close to, but below the ELM stability boundary, maintaining the ELM-free state while allowing up to a factor of two increase in edge pressure. The ELM boundary is significantly higher in more strongly shaped plasmas, which broadens the operating space available for QH-mode and leads to improved core performance. Second, for the first time on any tokamak, we have created QH-mode plasmas with strong edge co-rotation; previous QH-modes in all tokamaks had edge counter rotation. This result demonstrates that counter NBI and edge counter rotation are not essential conditions for QH-mode. Both these investigations benefited from the edge stability predictions based on peeling-ballooning mode theory. The broadening of the ELM-stable region with plasma shaping is predicted by that theory. The theory has also been extended to provide a model for the edge harmonic oscillation (EHO) that regulates edge transport in the QH-mode. Many of the features of that theory agree with the experimental results reported either previously or in the present paper. One notable example is the prediction that co-rotating QH-mode is possible provided sufficient shear in the edge rotation can be created
Vissers, K.C.P.; Geenen, F.; Biermans, R.; Meert, T.F.
2006-01-01
Research on mechanisms of drug action, and preclinical screening of molecules with a potential activity on neuropathic pain requires extensive animal work. The chronic constriction injury model is one of the best-characterized models of neuropathic pain behavior in rats, but requires extensive time
Electronic conductance model in constricted MoS{sub 2} with nanopores
Energy Technology Data Exchange (ETDEWEB)
Sarathy, Aditya [Beckman Institute for Advanced Science and Technology, University of Illinois, Urbana, Illinois 61801 (United States); Department of Electrical and Computer Engineering, University of Illinois, Urbana, Illinois 61801 (United States); Leburton, Jean-Pierre, E-mail: jleburto@illinois.edu [Beckman Institute for Advanced Science and Technology, University of Illinois, Urbana, Illinois 61801 (United States); Department of Electrical and Computer Engineering, University of Illinois, Urbana, Illinois 61801 (United States); Department of Physics, University of Illinois, Urbana, Illinois 61801 (United States)
2016-02-01
We describe a self-consistent model for electronic transport in a molybdenum di-sulphide (MoS{sub 2}) layer containing a nanopore in a constricted geometry. Our approach is based on a semi-classical thermionic Poisson-Boltzmann technique using a two-valley model within the effective mass approximation to investigate perturbations caused by the nanopore on the electronic current. In particular, we show that the effect of the nanopore on the conductance is reduced as the nanopore is moved from the center to the layer edges. Our model is applied to the detection of DNA translocating through the nanopore, which reveals current features similar to those as predicted in nanopore graphene layers.
Directory of Open Access Journals (Sweden)
Alrijadjis .
2014-12-01
Full Text Available The proportional integral derivative (PID controllers have been widely used in most process control systems for a long time. However, it is a very important problem how to choose PID parameters, because these parameters give a great influence on the control performance. Especially, it is difficult to tune these parameters for nonlinear systems. In this paper, a new modified particle swarm optimization (PSO is presented to search for optimal PID parameters for such system. The proposed algorithm is to modify constriction coefficient which is nonlinearly decreased time-varying for improving the final accuracy and the convergence speed of PSO. To validate the control performance of the proposed method, a typical nonlinear system control, a continuous stirred tank reactor (CSTR process, is illustrated. The results testify that a new modified PSO algorithm can perform well in the nonlinear PID control system design in term of lesser overshoot, rise-time, settling-time, IAE and ISE. Keywords: PID controller, Particle Swarm Optimization (PSO,constriction factor, nonlinear system.
Chang, Pei-Yeh; Zeng, Qi; Wong, Kin-Sun; Wang, Chao-Jan; Chang, Chee-Jen
2016-01-01
This study radiographically examined the changes in the chest walls of patients with pectus excavatum (PE) after Nuss bar removal, to define the deformation caused by the bar and stabilizer. In the first part of the study, we compared the changes in chest radiographs of patients with PE to a preoperation PE control group. In the second part, we used multislice computed tomography (CT) scans to provide three-dimensional reconstructions with which to evaluate the changes to the thoracic wall. Part 1 From June 2006 to August 2011, 1,125 patients with PE who had posteroanterior chest radiographs taken before undergoing the Nuss procedure at four hospitals were enrolled as a preoperative control group. At the same time, 203 patients who had the bar removed were enrolled as the study group. The maximum dimensions of the outer boundary of the first to ninth rib pairs (R1-R9, rib pair width), chest height, and chest width were measured. Part 2 Thirty-one consecutive patients with PE (20 males and 11 females) who underwent Nuss bar removal were evaluated 7 to 30 days after operation. During this period, a further 34 patients with PE who had undergone CT imaging before bar insertion were evaluated and compared with the postoperative group. Part 1 The width of the lower ribs (R4-R9) after bar removal was significantly less than in the age-matched controls. The ribs adjacent to the bar (R5-R7) showed the greatest restriction. The width of the upper ribs (R1-R3) 2 to 3 years after bar placement did not differ significantly from the controls. Patients who were operated on after 10 years of age had less of a restrictive effect. Three years of bar placement resulted in more restriction than a 2-year period, particularly in patients younger than 10 years old. Part 2: A significant constriction of the chest wall was observed in 13 patients after removal of the Nuss bar. Constriction at ribs 5 to 8 was found to be present adjacent to the site of bar insertion. However
Gnanachandrasamy, G.; Ramkumar, T.; Venkatramanan, S.; Chung, S. Y.; Vasudevan, S.
2016-06-01
We use electrical resistivity data arrayed in a 2715 km2 region with 30 locations to identify the saline water intrusion zone in part of Cauvery deltaic region, offshore Eastern India. From this dataset we are able to derive information on groundwater quality, thickness of aquifer zone, structural and stratigraphic conditions relevant to groundwater conditions, and permeability of aquifer systems. A total of 30 vertical electrode soundings (VES) were carried out by Schlumberger electrode arrangement to indicate complete lithology of this region using curve matching techniques. The electrical soundings exhibited that H and HK type curves were suitable for 16 shallow locations, and QH, KQ, K, KH, QQ, and HA curves were fit for other location. Low resistivity values suggested that saline water intrusion occurred in this region. According to final GIS map, most of the region was severely affected by seawater intrusion due to the use of over-exploitation of groundwater.The deteriorated groundwater resources in this coastal region should raise environmental and health concerns.
Surgical treatment of 2 cases of irradiation induced constrictive pericarditis
Energy Technology Data Exchange (ETDEWEB)
Osawa, Hiroshi; Takahashi, Wataru; Yoshii, Shinpei [Yamanashi Medical Univ., Tamaho (Japan)] (and others)
1999-11-01
A 72-years-old man underwent radiation therapy (62 Gy) for esophageal carcinoma. Twelve months later, symptoms of heart failure such as syncope, cough and hepatomegaly manifested. On catheter study, a dip and plateau pattern of right ventricular pressure curve was evident. Pericardiectomy without extracorporeal circulation was performed. Operative findings and pathological results were compatible with radiation-induced constrictive pericarditis. He recovered from the heart failure, and has been doing well 3 months after the surgery. A 54-years-old man underwent thymectomy for malignant thymoma. He underwent a radiation therapy (52 Gy) postoperatively. After 12 months from the irradiation, syncope and dyspnea manifested. On catheter study, a dip and plateau pattern of right ventricular pressure curve was observed. Pericardiectomy with extracorporeal circulation was performed. He recovered from the heart failure after pericardiectomy, however he died of radiation-induced pneumonitis 6 months later. (author)
Constriction of juxta-ductal aorta and rapid progression of obstruction in a newborn
International Nuclear Information System (INIS)
Awasthy, Neeraj; Tomar, Munesh; Radhakrishnan, Sitaraman; Iyer, Krishna Subramoney
2010-01-01
A 13-day-old baby girl presenting with features of congestive cardiac failure was found to have coarctation of the aorta (CoA) and patent ductus arteriosus (PDA) by echocardiography. Doppler spectral display revealed moderate CoA. Echocardiogram, 12 hours later, showed severe juxtaductal aortic coarctation with spontaneous closure of PDA. This case emphasises the need to keep a close watch on the progress of CoA in the neonatal period, even if the duct has narrowed to a small size thus demonstrating the role of constriction of juxtaductal aorta in pathogenesis of coaractation. Closure of even asmall PDA can cause acute progression CoA in the presence of posterior shelf
Udagawa, Sachiko; Iwase, Aiko; Susuki, Yuto; Kunimatsu-Sanuki, Shiho; Fukuchi, Takeo; Matsumoto, Chota; Ohno, Yuko; Ono, Hiroshi; Sugiyama, Kazuhisa; Araie, Makoto
2018-01-01
Purpose Traffic accidents are associated with the visual function of drivers, as well as many other factors. Driving simulator systems have the advantage of controlling for traffic- and automobile-related conditions, and using pinhole glasses can control the degree of concentric concentration of the visual field. We evaluated the effect of concentric constriction of the visual field on automobile driving, using driving simulator tests. Methods Subjects meeting criteria for normal eyesight were included in the study. Pinhole glasses with variable aperture sizes were adjusted to mimic the conditions of concentric visual field constrictions of 10° and 15°, using a CLOCK CHART®. The test contained 8 scenarios (2 oncoming right-turning cars and 6 jump-out events from the side). Results Eighty-eight subjects were included in the study; 37 (mean age = 52.9±15.8 years) subjects were assigned to the 15° group, and 51 (mean = 48.6±15.5 years) were assigned to the 10° group. For all 8 scenarios, the number of accidents was significantly higher among pinhole wearing subjects. The average number of all types of accidents per person was significantly higher in the pinhole 10° group (4.59±1.81) than the pinhole 15° group (3.68±1.49) (P = 0.032). The number of accidents associated with jump-out scenarios, in which a vehicle approaches from the side on a straight road with a good view, was significantly higher in the pinhole 10° group than in the pinhole 15° group. Conclusions Concentric constriction of the visual field was associated with increased number of traffic accidents. The simulation findings indicated that a visual field of 10° to 15° may be important for avoiding collisions in places where there is a straight road with a good view. PMID:29538425
Constriction of juxta-ductal aorta and rapid progression of obstruction in a newborn
Directory of Open Access Journals (Sweden)
Awasthy Neeraj
2010-01-01
Full Text Available A 13-day-old baby girl presenting with features of congestive cardiac failure was found to have coarctation of the aorta (CoA and patent ductus arteriosus (PDA by echocardiography. Doppler spectral display revealed moderate CoA. Echocardiogram, 12 hours later, showed severe juxtaductal aortic coarctation with spontaneous closure of PDA. This case emphasises the need to keep a close watch on the progress of CoA in the neonatal period, even if the duct has narrowed to a small size thus demonstrating the role of constriction of juxtaductal aorta in pathogenesis of coaractation. Closure of even asmall PDA can cause acute progression CoA in the presence of posterior shelf.
Evaluating GPS biologging technology for studying spatial ecology of large constricting snakes
Smith, Brian; Hart, Kristen M.; Mazzotti, Frank J.; Basille, Mathieu; Romagosa, Christina M.
2018-01-01
Background: GPS telemetry has revolutionized the study of animal spatial ecology in the last two decades. Until recently, it has mainly been deployed on large mammals and birds, but the technology is rapidly becoming miniaturized, and applications in diverse taxa are becoming possible. Large constricting snakes are top predators in their ecosystems, and accordingly they are often a management priority, whether their populations are threatened or invasive. Fine-scale GPS tracking datasets could greatly improve our ability to understand and manage these snakes, but the ability of this new technology to deliver high-quality data in this system is unproven. In order to evaluate GPS technology in large constrictors, we GPS-tagged 13 Burmese pythons (Python bivittatus) in Everglades National Park and deployed an additional 7 GPS tags on stationary platforms to evaluate habitat-driven biases in GPS locations. Both python and test platform GPS tags were programmed to attempt a GPS fix every 90 min.Results: While overall fix rates for the tagged pythons were low (18.1%), we were still able to obtain an average of 14.5 locations/animal/week, a large improvement over once-weekly VHF tracking. We found overall accuracy and precision to be very good (mean accuracy = 7.3 m, mean precision = 12.9 m), but a very few imprecise locations were still recorded (0.2% of locations with precision > 1.0 km). We found that dense vegetation did decrease fix rate, but we concluded that the low observed fix rate was also due to python microhabitat selection underground or underwater. Half of our recovered pythons were either missing their tag or the tag had malfunctioned, resulting in no data being recovered.Conclusions: GPS biologging technology is a promising tool for obtaining frequent, accurate, and precise locations of large constricting snakes. We recommend future studies couple GPS telemetry with frequent VHF locations in order to reduce bias and limit the impact of catastrophic
Eid, A H; Maiti, K; Mitra, S; Chotani, M A; Flavahan, S; Bailey, S R; Thompson-Torgerson, C S; Flavahan, N A
2007-09-01
Raynaud's phenomenon, which is characterized by intense cold-induced constriction of cutaneous arteries, is more common in women compared with men. Cold-induced constriction is mediated in part by enhanced activity of alpha(2C)-adrenoceptors (alpha(2C)-ARs) located on vascular smooth muscle cells (VSMs). Experiments were therefore performed to determine whether 17beta-estradiol regulates alpha(2C)-AR expression and function in cutaneous VSMs. 17beta-Estradiol (0.01-10 nmol/l) increased expression of the alpha(2C)-AR protein and the activity of the alpha(2C)-AR gene promoter in human cultured dermal VSMs, which was assessed following transient transfection of the cells with a promoter-reporter construct. The effect of 17beta-estradiol was associated with increased accumulation of cAMP and activation of the cAMP-responsive Rap2 GTP-binding protein. Transient transfection of VSMs with a dominant-negative mutant of Rap2 inhibited the 17beta-estradiol-induced activation of the alpha(2C)-AR gene promoter, whereas a constitutively active mutant of Rap2 increased alpha(2C)-AR promoter activity. The effects of 17beta-estradiol were inhibited by the estrogen receptor (ER) antagonist, ICI-182780 (1 micromol/l), and were mimicked by a cell-impermeable form of the hormone (estrogen:BSA) or by the selective ER-alpha receptor agonist 4,4',4'''-(4-propyl-[(1)H]-pyrazole-1,3,5-triyl)tris-phenol (PPT; 10 nmol/l) or the selective ER-beta receptor agonist 2,3-bis(4-hydroxyphenyl)-propionitrile (DPN; 10 nmol/l). Therefore, 17beta-estradiol increased expression of alpha(2C)-ARs by interacting with cell surface receptors to cause a cAMP/Rap2-dependent increase in alpha(2C)-AR transcription. In mouse tail arteries, 17beta-estradiol (10 nmol/l) increased alpha(2C)-AR expression and selectively increased the cold-induced amplification of alpha(2)-AR constriction, which is mediated by alpha(2C)-ARs. An estrogen-dependent increase in expression of cold-sensitive alpha(2C)-ARs may contribute
High-temperature CW and pulsed operation in constricted double-heterojunction AlGaAs diode lasers
Botez, D.; Connolly, J. C.; Gilbert, D. B.
1981-01-01
The behavior of constricted double-heterojunction (CDH) diode lasers has been investigated up to 170 C CW and 270 C pulsed. It is found that the temperature-dependent current concentration effect responsible for low threshold-current sensitivity and temperature-invariant external differential quantum efficiency in CDH lasers saturates at about 100 C. It is also found that over a wide temperature interval (180-280 C) the threshold current density has a To value of 40-50 C and that the spontaneous emission becomes increasingly sublinear above 220 C. Both effects are believed to reflect Auger recombination.
Peroral endoscopic cardial constriction in gastroesophageal reflux disease.
Hu, Hai-Qing; Li, Hui-Kai; Xiong, Ying; Zhang, Xiao-Bin; Zhi, Jun-Li; Wang, Xiao-Xiao; Ling-Hu, En-Qiang
2018-04-01
Gastroesophageal reflux disease (GERD) is a major digestive health problem with a high and increasing incidence worldwide. Peroral endoscopic cardial constriction (PECC) was developed by our group to provide a less invasive treatment for GERD.In this preliminary follow-up study, 16 patients were enrolled and 13 patients with GERD were targeted for analysis according to the Los Angeles classification of reflux esophagitis. The GERD health-related quality of life (GERD-HRQL) scale and esophageal pH monitoring were applied to assess clinical efficiency at 3 and 6 months after PECC treatment, respectively.All GERD patients successively received PECC, and no severe treatment-related complication was reported. Before PECC treatment, the GERD-HRQL scale was 19.92 ± 7.89. At 3 and 6 months after treatment, the GERD-HRQL scale was 4.46 ± 4.31 and 5.69 ± 5.07, respectively. DeMeester score was 125.50 ± 89.64 before PECC treatment, and 16.97 ± 12.76 and 20.32 ± 15.22 at 3 and 6 months after PECC treatment. Furthermore, the fraction time of a pH below 4 significantly decreased at 3 and 6 months after PECC treatment. Fraction time at pH reflux of stomach contents.
A case of post-radiation constrictive pericarditis developing 12 years after radiation therapy
Energy Technology Data Exchange (ETDEWEB)
Sakuraba, Motoki; Tanaka, Jun-ichi; Ikeda, Shingo; Kigawa, Ikutaro; Fukuda, Sachito; Wanibuchi, Yasuhiko [Mitsui Memorial Hospital, Tokyo (Japan)
1997-11-01
A 70-year-old woman underwent radical mastectomy for carcinoma of the left breast in 1982. Postoperative radiation therapy was given in a total dose of 50 Gy for parasternal and left subclavian nodes. Symptoms of heart failure such as exertional dyspnea, facial edema, and hepatomegaly manifested in 1992. Cardiac catheterization revealed marked elevation of mean right atrial pressure and right ventricular end-diastolic pressure. The pressure wave form of the right ventricle showed the so called ``dip and plateau`` feature. Pericardiectomy without using extracorporeal circulation was performed in 1994. Operative findings and pathological study results were compatible with radiation-induced constrictive pericarditis. She rapidly recovered from heart failure after this operation, and has done very well to date. (author)
Density-Imbalance Stability Diagram of the νT = 1 Bilayer Electron System at Full Spin Polarization
International Nuclear Information System (INIS)
Takase, Keiko; Muraki, Koji
2011-01-01
We investigate the evolution of the total Landau level filling factor ν T = 1 bilayer quantum Hall (QH) state versus density imbalance at full spin polarization under a tilted magnetic field. When the system is well below the compressible-incompressible transition point at the balanced density, the ν T = 1 QH state extends widely versus density imbalance, continuously merging into the single-layer ν = 1 QH state. In the vicinity of the transition point, the ν T = 1 QH state is only weakly developed at small imbalance but increases in strength toward ν T = 1/3 + 2/3, where it is clearly separated from the single-layer ν = 1 QH state. These results suggest that the system at the imbalance of Δν = 1/3 undergoes a transition from the correlated ν T = 1 QH state to single-layer fractional QH states with increasing density.
The Causes of Quasi-homologous CMEs
Energy Technology Data Exchange (ETDEWEB)
Liu, Lijuan; Wang, Yuming; Liu, Rui; Zhou, Zhenjun; Liu, Jiajia; Liu, Kai; Shen, Chenglong; Zhang, Quanhao [CAS Key Laboratory of Geospace Environment, Department of Geophysics and Planetary Sciences, University of Science and Technology of China, Hefei, Anhui, 230026 (China); Temmer, M.; Thalmann, J. K.; Veronig, A. M., E-mail: ymwang@ustc.edu.cn, E-mail: ljliu@mail.ustc.edu.cn [Institute of Physics/IGAM, University of Graz, Universitätsplatz 5/II, A-8010 Graz (Austria)
2017-08-01
In this paper, we identified the magnetic source locations of 142 quasi-homologous (QH) coronal mass ejections (CMEs), of which 121 are from solar cycle (SC) 23 and 21 from SC 24. Among those CMEs, 63% originated from the same source location as their predecessor (defined as S-type), while 37% originated from a different location within the same active region as their predecessor (defined as D-type). Their distinctly different waiting time distributions, peaking around 7.5 and 1.5 hr for S- and D-type CMEs, suggest that they might involve different physical mechanisms with different characteristic timescales. Through detailed analysis based on nonlinear force-free coronal magnetic field modeling of two exemplary cases, we propose that the S-type QH CMES might involve a recurring energy release process from the same source location (by magnetic free energy replenishment), whereas the D-type QH CMEs can happen when a flux tube system is disturbed by a nearby CME.
Satiety and eating patterns in two species of constricting snakes.
Nielsen, Torben P; Jacobsen, Magnus W; Wang, Tobias
2011-01-10
Satiety has been studied extensively in mammals, birds and fish but very little information exists on reptiles. Here we investigate time-dependent satiation in two species of constricting snakes, ball pythons (Python regius) and yellow anacondas (Eunectes notaeus). Satiation was shown to depend on both fasting time and prey size. In the ball pythons fed with mice of a relative prey mass RPM (mass of the prey/mass of the snake×100) of 15%, we observed a satiety response that developed between 6 and 12h after feeding, but after 24h pythons regained their appetite. With an RPM of 10% the pythons kept eating throughout the experiment. The anacondas showed a non-significant tendency for satiety to develop between 6 and 12h after ingesting a prey of 20% RPM. Unlike pythons, anacondas remained satiated after 24h. Handling time (from strike until prey swallowed) increased with RPM. We also found a significant decrease in handling time between the first and the second prey and a positive correlation between handling time and the mass of the snake. 2010 Elsevier Inc. All rights reserved.
Qin, Jianqi; Celestin, Sebastien; Pasko, Victor P.
2013-05-01
Carrot sprites, exhibiting both upward and downward propagating streamers, and columniform sprites, characterized by predominantly vertical downward streamers, represent two distinct morphological classes of lightning-driven transient luminous events in the upper atmosphere. It is found that positive cloud-to-ground lightning discharges (+CGs) associated with large charge moment changes (QhQ) tend to produce carrot sprites with the presence of a mesospheric region where the electric field exceeds the value 0.8Ek and persists for >˜2 ms, whereas those associated with small QhQ are only able to produce columniform sprites. Columniform sprites may also appear in the periphery of a sprite halo produced by +CGs associated with large QhQ. For a sufficiently large QhQ, the time dynamics of the QhQ determines the specific shape of the carrot sprites. In the case when the sufficiently large QhQ is produced mainly by an impulsive return stroke, strong electric field is produced at high altitudes and manifests as a bright halo, and the corresponding conductivity enhancement lowers/enhances the probability of streamer initiation inside/below the sprite halo. A more impulsive return stroke leads to a more significant conductivity enhancement (i.e., a brighter halo). This conductivity enhancement also leads to fast decay and termination of the upper diffuse region of carrot sprites because it effectively screens out the electric field at high altitudes. On the contrary, if the sufficiently large QhQ is produced by a weak return stroke (i.e., a dim halo) accompanied by intense continuing current, the lightning-induced electric field at high altitudes persists at a level that is comparable to Ek, and therefore an extensive upper diffuse region can develop. Furthermore, we demonstrate that `negative sprites' (produced by -CGs) should be necessarily carrot sprites and most likely accompanied by a detectable halo, since the initiation of upward positive streamers is always easier
Edge radial electric field structure in quiescent H-mode plasmas in the DIII-D tokamak
Energy Technology Data Exchange (ETDEWEB)
Burrell, K H [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); West, W P [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Doyle, E J [University of California, Los Angeles, CA 90095-1597 (United States); Austin, M E [University of Texas at Austin, Austin, TX 78712 (United States); DeGrassie, J S [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Gohil, P [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Greenfield, C M [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Groebner, R J [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Jayakumar, R [Lawrence Livermore National Laboratory, Livermore, CA 94551-9900 (United States); Kaplan, D H [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Lao, L L [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Leonard, A W [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Makowski, M A [Lawrence Livermore National Laboratory, Livermore, CA 94551-9900 (United States); McKee, G R [University of Wisconsin, Madison, WI 53706-1687 (United States); Solomon, W M [Princeton Plasma Physics Laboratory, Princeton, NJ 08543-0451 (United States); Thomas, D M [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Rhodes, T L [University of California, Los Angeles, CA 90095-1597 (United States); Wade, M R [Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Wang, G [University of California, Los Angeles, CA 90095-1597 (United States); Watkins, J G [Sandia National Laboratories, Albuquerque, NM 87185 (United States); Zeng, L [University of California, Los Angeles, CA 90095-1597 (United States)
2004-05-01
H-mode operation is the choice for next step tokamak devices based on either conventional or advanced tokamak physics. This choice, however, comes at a significant cost for both the conventional and advanced tokamaks because of the effects of edge localized modes (ELMs). ELMs can produce significant erosion in the divertor and can affect the {beta} limit and reduced core transport regions needed for advanced tokamak operation. Experimental results from DIII-D over the past four years have demonstrated a new operating regime, the quiescent H-mode (QH-mode) regime, that solves these problems. QH-mode plasmas have now been run for over 4 s (>30 energy confinement times). Utilizing the steady-state nature of the QH-mode edge allows us to obtain unprecedented spatial resolution of the edge ion profiles and the edge radial electric field, E{sub r}, by sweeping the edge plasma slowly past the view points of the charge exchange spectroscopy system. We have investigated the effects of direct edge ion orbit loss on the creation and sustainment of the QH-mode. Direct loss of ions injected into the velocity-space loss cone at the plasma edge is not necessary for creation or sustainment of the QH-mode. The direct ion orbit loss has little effect on the edge E{sub r} well. The E{sub r} at the bottom of the well in these cases is about -100 kV m{sup -1} compared with -20 to -30 kV m{sup -1} in the standard H-mode. The well is about 1 cm wide, which is close to the diameter of the deuteron gyro-orbit. We also have investigated the effect of changing edge triangularity by changing the plasma shape from upwardly biased single null to magnetically balanced double null. We have now achieved the QH-mode in these double-null plasmas. The increased triangularity allows us to increase pedestal density in QH-mode plasmas by a factor of about 2.5 and overall pedestal pressure by a factor of 2. Pedestal {beta} and {nu}{sup *} values matching the values desired for ITER have been achieved. In
Annexin A4 and A6 induce membrane curvature and constriction during cell membrane repair
DEFF Research Database (Denmark)
Boye, Theresa Louise; Maeda, Kenji; Pezeshkian, Weria
2017-01-01
Efficient cell membrane repair mechanisms are essential for maintaining membrane integrity and thus for cell life. Here we show that the Ca2+- and phospholipid-binding proteins annexin A4 and A6 are involved in plasma membrane repair and needed for rapid closure of micron-size holes. We demonstrate...... that annexin A4 binds to artificial membranes and generates curvature force initiated from free edges, whereas annexin A6 induces constriction force. In cells, plasma membrane injury and Ca2+ influx recruit annexin A4 to the vicinity of membrane wound edges where its homo-trimerization leads to membrane...... that induction of curvature force around wound edges is an early key event in cell membrane repair....
Li, Haixia; Shen, Le; Ma, Chao; Huang, Yuguang
2013-07-01
Chronic neuropathic pain is associated with global changes in gene expression in different areas of the nociceptive pathway. MicroRNAs (miRNAs) are small (~22 nt long) non-coding RNAs, which are able to regulate hundreds of different genes post-transcriptionally. The aim of this study was to determine the miRNA expression patterns in the different regions of the pain transmission pathway using a rat model of human neuropathic pain induced by bilateral sciatic nerve chronic constriction injury (bCCI). Using microarray analysis and quantitative reverse transcriptase-PCR, we observed a significant upregulation in miR-341 expression in the dorsal root ganglion (DRG), but not in the spinal dorsal horn (SDH), hippocampus or anterior cingulate cortex (ACC), in the rats with neuropathic pain compared to rats in the naïve and sham-operated groups. By contrast, the expression of miR-203, miR-181a-1* and miR-541* was significantly reduced in the SDH of rats with neuropathic pain. Our data indicate that miR-341 is upregulated in the DRG, whereas miR-203, miR-181a-1* and miR-541* are downregulated in the SDH under neuropathic pain conditions. Thus, the differential expression of miRNAs in the nervous system may play a role in the development of chronic pain. These observations may aid in the development of novel treatment methods for neuropathic pain, which may involve miRNA gene therapy in local regions.
Arc Shape Characteristics with Ultra-High-Frequency Pulsed Arc Welding
Directory of Open Access Journals (Sweden)
Mingxuan Yang
2017-01-01
Full Text Available Arc plasma possesses a constriction phenomenon with a pulsed current. The constriction is created by the Lorentz force, the radial electromagnetic force during arc welding, which determines the energy distribution of the arc plasma. Welding experiments were carried out with ultra-high-frequency pulsed arc welding (UHFP-AW. Ultra-high-speed camera observations were produced for arc surveillance. Hue-saturation-intensity (HSI image analysis was used to distinguish the regions of the arc plasma that represented the heat energy distribution. The measurement of arc regions indicated that, with an ultra-high-frequency pulsed arc, the constriction was not only within the decreased arc geometry, but also within the constricted arc core region. This can be checked by the ratio of the core region to the total area. The arc core region expanded significantly at 40 kHz at 60 A. A current level of 80 A caused a decrease in the total region of the arc. Meanwhile, the ratio of the core region to the total increased. It can be concluded that arc constriction depends on the increased area of the core region with the pulsed current (>20 kHz.
Amniotic Constriction Bands: Secondary Deformities and Their Treatments.
Drury, Benjamin T; Rayan, Ghazi M
2018-01-01
The purpose of this study was to report the surgical treatment experience of patients with amniotic constriction bands (ACB) over a 35-year interval and detail consequential limb deformities with emphasis on hands and upper extremities, along with the nature and frequency of their surgical treatment methods. Fifty-one patients were identified; 26 were males and 25 females. The total number of deformities was listed. The total number of operations, individual procedures, and operations plus procedures that were done for each patient and their frequency were recorded. The total number of operations was 117, and total number of procedures was 341. More procedures were performed on the upper extremity (85%) than the lower extremity (15%). Including the primary deformity ACB, 16 different hand deformities secondary to ACB were encountered. Sixteen different surgical methods for the upper extremity were utilized; a primary procedure for ACB and secondary reconstructions for all secondary deformities. Average age at the time of the first procedure was 9.3 months. The most common procedures performed, in order of frequency, were excision of ACB plus Z-plasty, release of partial syndactyly, release of fenestrated syndactyly, full-thickness skin grafts, resection of digital bony overgrowth from amputation stumps, and deepening of first and other digital web spaces. Many hand and upper extremity deformities secondary to ACB are encountered. Children with ACB may require more than one operation including multiple procedures. Numerous surgical methods of reconstruction for these children's secondary deformities are necessary in addition to the customary primary procedure of excision of ACB and Z-plasty.
Pasakarnis, Laurynas; Frei, Erich; Caussinus, Emmanuel; Affolter, Markus; Brunner, Damian
2016-11-01
Tissue morphogenesis requires coordination of multiple force-producing components. During dorsal closure in fly embryogenesis, an epidermis opening closes. A tensioned epidermal actin/MyosinII cable, which surrounds the opening, produces a force that is thought to combine with another MyosinII force mediating apical constriction of the amnioserosa cells that fill the opening. A model proposing that each force could autonomously drive dorsal closure was recently challenged by a model in which the two forces combine in a ratchet mechanism. Acute force elimination via selective MyosinII depletion in one or the other tissue shows that the amnioserosa tissue autonomously drives dorsal closure while the actin/MyosinII cable cannot. These findings exclude both previous models, although a contribution of the ratchet mechanism at dorsal closure onset remains likely. This shifts the current view of dorsal closure being a combinatorial force-component system to a single tissue-driven closure event.
Clogging arches in grains, colloids, and pedestrians flowing through constrictions
Zuriguel, Iker
When a group of particles pass through a narrow orifice, the flow might become intermittent due to the development of clogs that obstruct the constriction. This effect has been observed in many different fields such as mining transport, microbial growing, crowd dynamics, colloids, granular and active matter. In this work we introduce a general framework in which research in some of such scenarios can be encompassed. In particular, we analyze the statistical properties of the bottleneck flow in different experiments and simulations: granular media within vibrated silos, colloids, a flock of sheep and pedestrian evacuations. We reveal a common phenomenology that allows us to rigorously define a transition to a clogged state. Using this definition we explore the main variables involved, which are then grouped into three generic parameters. In addition, we will present results of the geometrical characteristics that the clogging arches have which are related with their stability against perturbations. We experimentally analyse the temporal evolution of the arches evidencing important differences among the structures that are easily destroyed and those that seem to resist forever (longer than the temporal window employed in our measurements). Ministerio de Economía y Competitividad (Spanish Government). Project No. FIS2014-57325.
Temtamy, Samia A; Aglan, Mona S; Ashour, Adel M; El-Badry, Tarek H
2010-01-01
In this report, we describe two unrelated Egyptian male infants with limb malformations and constriction rings. The first case is developing normally but has severe limb anomalies, congenital constriction rings, scoliosis because of vertebral anomalies, a left accessory nipple, a small tumor-like swelling on his lower back with tiny skin tubular appendages, a hypoplastic scrotum, and an anchored penis. The second case is developmentally delayed with limb malformations, congenital constriction rings, a lumbar myelomeningeocele, hemangioma, and tiny tubular skin appendages on the back. The patient also had bilateral optic atrophy. The constellation of features in our patients cannot be fully explained by the amniotic disruption complex. The first patient may represent an additional case of the human homolog of the mouse disorganization mutant. The presence of bilateral optic atrophy in the second case, although without an absent septum pellucidum nor other brain anomalies resembles the infrequently reported disorder of septo-optic dysplasia with limb anomalies. Both cases were sporadic and could be caused by a new dominant mutation because of the high paternal age of case 1 and the history of paternal occupational exposure to heat for both fathers. We draw attention to the phenotypic overlap between the disorganization-like syndrome and septo-optic dysplasia with limb anomalies.
2014-01-01
Background Nematode-trapping fungi are a unique group of organisms that can capture nematodes using sophisticated trapping structures. The genome of Drechslerella stenobrocha, a constricting-ring-forming fungus, has been sequenced and reported, and provided new insights into the evolutionary origins of nematode predation in fungi, the trapping mechanisms, and the dual lifestyles of saprophagy and predation. Results The genome of the fungus Drechslerella stenobrocha, which mechanically traps nematodes using a constricting ring, was sequenced. The genome was 29.02 Mb in size and was found rare instances of transposons and repeat induced point mutations, than that of Arthrobotrys oligospora. The functional proteins involved in nematode-infection, such as chitinases, subtilisins, and adhesive proteins, underwent a significant expansion in the A. oligospora genome, while there were fewer lectin genes that mediate fungus-nematode recognition in the D. stenobrocha genome. The carbohydrate-degrading enzyme catalogs in both species were similar to those of efficient cellulolytic fungi, suggesting a saprophytic origin of nematode-trapping fungi. In D. stenobrocha, the down-regulation of saprophytic enzyme genes and the up-regulation of infection-related genes during the capture of nematodes indicated a transition between dual life strategies of saprophagy and predation. The transcriptional profiles also indicated that trap formation was related to the protein kinase C (PKC) signal pathway and regulated by Zn(2)–C6 type transcription factors. Conclusions The genome of D. stenobrocha provides support for the hypothesis that nematode trapping fungi evolved from saprophytic fungi in a high carbon and low nitrogen environment. It reveals the transition between saprophagy and predation of these fungi and also proves new insights into the mechanisms of mechanical trapping. PMID:24507587
Lynch, Georgina T F; James, Stephen M; VanDam, Mark
2018-02-01
Brain imaging data describe differences in the ASD brain, including amygdala overgrowth, neural interconnectivity, and a three-phase model of neuroanatomical changes from early post-natal development through late adolescence. The pupil reflex test (PRT), a noninvasive measure of brain function, may help improve early diagnosis and elucidate underlying physiology in expression of ASD endophenotype. Commonly observed characteristics of ASD include normal visual acuity but difficulty with eye gaze and photosensitivity, suggesting deficient neuromodulation of cranial nerves. Aims of this study were to confirm sensitivity of the PRT for identifying adolescents with ASD, determine if a phenotype for a subtype of ASD marked by pupil response is present in adolescence, and determine whether differences could be observed on a neurologic exam testing cranial nerves II and III (CNII; CNIII). Using pupillometry, constriction latency was measured serving as a proxy for recording neuromodulation of cranial nerves underlying the pupillary reflex. The swinging flashlight method, used to perform the PRT for measuring constriction latency and return to baseline, discriminated ASD participants from typically developing adolescents on 72.2% of trials. Results further confirmed this measure's sensitivity within a subtype of ASD in later stages of development, serving as a correlate of neural activity within the locus-coeruleus norepinephrine (LC-NE) system. A brainstem model of atypical PRT in ASD is examined in relation to modulation of cranial nerves and atypical arousal levels subserving the atypical pupillary reflex. Autism Res 2018, 11: 364-375. © 2017 International Society for Autism Research, Wiley Periodicals, Inc. Milder forms of autism spectrum disorder (ASD) can be difficult to diagnose based on behavioral testing alone. This study used eye-tracking equipment and a hand-held penlight to measure the pupil reflex in adolescents with "high functioning" ASD and in adolescents
Tunneling Spectroscopy of Quantum Hall States in Bilayer Graphene
Wang, Ke; Harzheim, Achim; Watanabe, Kenji; Taniguchi, Takashi; Kim, Philip
In the quantum Hall (QH) regime, ballistic conducting paths along the physical edges of a sample appear, leading to quantized Hall conductance and vanishing longitudinal magnetoconductance. These QH edge states are often described as ballistic compressible strips separated by insulating incompressible strips, the spatial profiles of which can be crucial in understanding the stability and emergence of interaction driven QH states. In this work, we present tunneling transport between two QH edge states in bilayer graphene. Employing locally gated device structure, we guide and control the separation between the QH edge states in bilayer graphene. Using resonant Landau level tunneling as a spectroscopy tool, we measure the energy gap in bilayer graphene as a function of displacement field and probe the emergence and evolution of incompressible strips.
Quiescent H-mode plasmas with strong edge rotation in the cocurrent direction.
Burrell, K H; Osborne, T H; Snyder, P B; West, W P; Fenstermacher, M E; Groebner, R J; Gohil, P; Leonard, A W; Solomon, W M
2009-04-17
For the first time in any tokamak, quiescent H-mode (QH-mode) plasmas have been created with strong edge rotation in the direction of the plasma current. This confirms the theoretical prediction that the QH mode should exist with either sign of the edge rotation provided the magnitude of the shear in the edge rotation is sufficiently large and demonstrates that counterinjection and counteredge rotation are not essential for the QH mode. Accordingly, the present work demonstrates a substantial broadening of the QH-mode operating space and represents a significant confirmation of the theory.
Propagation of superconducting coherence via chiral quantum-Hall edge channels.
Park, Geon-Hyoung; Kim, Minsoo; Watanabe, Kenji; Taniguchi, Takashi; Lee, Hu-Jong
2017-09-08
Recently, there has been significant interest in superconducting coherence via chiral quantum-Hall (QH) edge channels at an interface between a two-dimensional normal conductor and a superconductor (N-S) in a strong transverse magnetic field. In the field range where the superconductivity and the QH state coexist, the coherent confinement of electron- and hole-like quasiparticles by the interplay of Andreev reflection and the QH effect leads to the formation of Andreev edge states (AES) along the N-S interface. Here, we report the electrical conductance characteristics via the AES formed in graphene-superconductor hybrid systems in a three-terminal configuration. This measurement configuration, involving the QH edge states outside a graphene-S interface, allows the detection of the longitudinal and QH conductance separately, excluding the bulk contribution. Convincing evidence for the superconducting coherence and its propagation via the chiral QH edge channels is provided by the conductance enhancement on both the upstream and the downstream sides of the superconducting electrode as well as in bias spectroscopy results below the superconducting critical temperature. Propagation of superconducting coherence via QH edge states was more evident as more edge channels participate in the Andreev process for high filling factors with reduced valley-mixing scattering.
DEFF Research Database (Denmark)
Friberg, L; Olsen, T S; Roland, P E
1987-01-01
During the course of hemiplegic migraine in 3 patients, changes in regional cerebral blood flow (rCBF) were recorded by the intracarotid 133Xe method and a 254 multidetector camera covering one hemisphere. The rCBF measurements were performed in conjunction with cerebral angiography. During...... the patients developed transient motor and/or sensory deficits and subsequently severe headache. No signs of arterial occlusion were found. In the over and underperfused regions blood flow fluctuated rapidly because of instability of cerebrovascular tone, defined as transient constriction of the smallest...
International Nuclear Information System (INIS)
Wendling, W.W.; Harakal, C.
1987-01-01
The purpose of this study was to determine the mechanisms by which organic calcium channel blockers inhibit cerebral vasoconstriction. Isolated bovine middle cerebral arteries were cut into rings to measure contractility or into strips to measure radioactive calcium ( 45 Ca) influx and efflux. Calcium channel blockers (10(-5) M verapamil or 3.3 X 10(-7) M nifedipine) and calcium-deficient solutions all produced near-maximal inhibition of both potassium- and serotonin-induced constriction. In calcium-deficient solutions containing potassium or serotonin, verapamil and nifedipine each blocked subsequent calcium-induced constriction in a competitive manner. Potassium and serotonin significantly increased 45 Ca uptake into cerebral artery strips during 5 minutes of 45 Ca loading; for potassium 45 Ca uptake increased from 62 to 188 nmol/g, and for serotonin from 65 to 102 nmol/g. Verapamil or nifedipine had no effect on basal 45 Ca uptake but significantly blocked the increase in 45 Ca uptake induced by potassium or serotonin. Potassium, and to a lesser extent serotonin, each induced a brief increase in the rate of 45 Ca efflux into calcium-deficient solutions. Verapamil or nifedipine had no effect on basal or potassium-stimulated 45 Ca efflux. The results demonstrate that verapamil and nifedipine block 45 Ca uptake through both potential-operated (potassium) and receptor-operated (serotonin) channels in bovine middle cerebral arteries
International Nuclear Information System (INIS)
Bellamy-McIntyre, Anna K.; Baer, Severine; Ludlow, Louise; Drummer, Heidi E.; Poumbourios, Pantelis
2010-01-01
The conserved disulfide-bonded region (DSR) of the human immunodeficiency virus type 1 (HIV-1) fusion glycoprotein, gp41, mediates association with the receptor-binding glycoprotein, gp120. Interactions between gp120, CD4 and chemokine receptors activate the fusion activity of gp41. The introduction of W596L and W610F mutations to the DSR of HIV-1 QH1549.13 blocked viral entry and hemifusion without affecting gp120-gp41 association. The fusion defect correlated with inhibition of CD4-triggered gp41 pre-hairpin formation, consistent with the DSR mutations having decoupled receptor-induced conformational changes in gp120 from gp41 activation. Our data implicate the DSR in sensing conformational changes in the gp120-gp41 complex that lead to fusion activation.
Kobayashi, S; Uchida, K; Takeno, K; Baba, H; Suzuki, Y; Hayakawa, K; Yoshizawa, H
2006-02-01
It has been reported that disturbance of blood flow arising from circumferential compression of the cauda equina by surrounding tissue plays a major role in the appearance of neurogenic intermittent claudication (NIC) associated with lumbar spinal canal stenosis (LSCS). We created a model of LSCS to clarify the mechanism of enhancement within the cauda equina on gadolinium-enhanced MR images from patients with LSCS. In 20 dogs, a lumbar laminectomy was performed by applying circumferential constriction to the cauda equina by using a silicon tube, to produce 30% stenosis of the circumferential diameter of the dural tube. After 1 and 3 weeks, gadolinium and Evans blue albumin were injected intravenously at the same time. The sections were used to investigate the status of the blood-nerve barrier function under a fluorescence microscope and we compared gadolinium-enhanced MR images with Evans blue albumin distribution in the nerve. The other sections were used for light and transmission electron microscopic study. In this model, histologic examination showed congestion and dilation in many of the intraradicular veins, as well as inflammatory cell infiltration. The intraradicular edema caused by venous congestion and Wallerian degeneration can also occur at sites that are not subject to mechanical compression. Enhanced MR imaging showed enhancement of the cauda equina at the stenosed region, demonstrating the presence of edema. Gadolinium-enhanced MR imaging may be a useful tool for the diagnosis of microcirculatory disorders of the cauda equina associated with LSCS.
Directory of Open Access Journals (Sweden)
Zhiyong Wang
2017-01-01
Full Text Available Neuropathic pain is common in clinical practice. Exploration of new drug therapeutics has always been carried out for more satisfactory effects and fewer side-effects. In the present study, we aimed to investigate effects of Tongluo Zhitong Prescription (TZP, a compounded Chinese medicine description, on neuropathic pain model of rats with chronic constriction injury (CCI. The CCI model was established by loosely ligating sciatic nerve with catgut suture, proximal to its trifurcation. The static and dynamic allodynia, heat hyperalgesia, mechanical allodynia, cold allodynia, and gait were assessed. Our results showed that TZP alleviated CCI-induced static and dynamic allodynia, suppressed heat hyperalgesia and cold and mechanical allodynia, and improved gait function. These results suggest that TZP could alleviate neuropathic pain. Further experiments are needed to explore its mechanisms.
Bibliography on Cold Regions Science and Technology. Volume 39, Part 1, 1985,
1985-12-01
Hteiberg Station with an inventory as of Priangar’iat, ties, Marine deposits, Theories. June 1983. Bugakova, T.M., et al, Mikrobnye sotaiatsii v les- 39.99...determination of ir ples and techaiques. remote sensing system used for sea ice resistance to a skier and the coefficieat of friction of P analysis...several aspects pro- Solifluction. ography p. 139-162. vide convenient groupings for describing present knowledge of DLC QH84.2.A58 1984 the bottom
Norris, Brian J.; Doloc-Mihu, Anca; Calabrese, Ronald L.
2011-01-01
Central pattern generators (CPGs) pace and pattern many rhythmic activities. We have uncovered a new module in the heartbeat CPG of leeches that creates a regional difference in this segmentally distributed motor pattern. The core CPG consists of seven identified pairs and one unidentified pair of heart interneurons of which 5 pairs are premotor and inhibit 16 pairs of heart motor neurons. The heartbeat CPG produces a side-to-side asymmetric pattern of activity of the premotor heart interneurons corresponding to an asymmetric fictive motor pattern and an asymmetric constriction pattern of the hearts with regular switches between the two sides. The premotor pattern progresses from rear to front on one side and nearly synchronously on the other; the motor pattern shows corresponding intersegmental coordination, but only from segment 15 forward. In the rearmost segments the fictive motor pattern and the constriction pattern progress from front to rear on both sides and converge in phase. Modeling studies suggested that the known inhibitory inputs to the rearmost heart motor neurons were insufficient to account for this activity. We therefore reexamined the constriction pattern of intact leeches. We also identified electrophysiologically two additional pairs of heart interneurons in the rear. These new heart interneurons make inhibitory connections with the rear heart motor neurons, are coordinated with the core heartbeat CPG, and are dye-coupled to their contralateral homologs. Their strong inhibitory connections with the rearmost heart motor neurons and the small side-to-side phase difference of their bursting contribute to the different motor and beating pattern observed in the animal's rear. PMID:21775711
Confinement properties of tokamak plasmas with extended regions of low magnetic shear
Graves, J. P.; Cooper, W. A.; Kleiner, A.; Raghunathan, M.; Neto, E.; Nicolas, T.; Lanthaler, S.; Patten, H.; Pfefferle, D.; Brunetti, D.; Lutjens, H.
2017-10-01
Extended regions of low magnetic shear can be advantageous to tokamak plasmas. But the core and edge can be susceptible to non-resonant ideal fluctuations due to the weakened restoring force associated with magnetic field line bending. This contribution shows how saturated non-linear phenomenology, such as 1 / 1 Long Lived Modes, and Edge Harmonic Oscillations associated with QH-modes, can be modelled accurately using the non-linear stability code XTOR, the free boundary 3D equilibrium code VMEC, and non-linear analytic theory. That the equilibrium approach is valid is particularly valuable because it enables advanced particle confinement studies to be undertaken in the ordinarily difficult environment of strongly 3D magnetic fields. The VENUS-LEVIS code exploits the Fourier description of the VMEC equilibrium fields, such that full Lorenzian and guiding centre approximated differential operators in curvilinear angular coordinates can be evaluated analytically. Consequently, the confinement properties of minority ions such as energetic particles and high Z impurities can be calculated accurately over slowing down timescales in experimentally relevant 3D plasmas.
Sha, ZhanJiang; Wang, Qiugui; Wang, Jinlong; Du, Jinzhou; Hu, Jufang; Ma, Yujun; Kong, Fancui; Wang, Zhuan
2017-04-01
Environmental change and human activity can be recorded in sediment cores in aquatic systems such as lakes. Information from such records may be useful for environmental governance in the future. Six sediment cores were collected from Lake Qinghai, China and its sublakes during 2012 and 2013. Measurements of sediment grain-size fractions indicate that sedimentation in the north and southwest of Lake Qinghai is dominated by river input, whereas that in Lake Gahai and Lake Erhai is dominated by dunes. The sedimentation rates in Lake Qinghai were calculated to be 0.101-0.159 cm/y, similar to the rates in other lakes on the Qinghai-Tibetan Plateau. Using these data and sedimentation rates from the literature, we compiled the spatial distribution of sedimentation rates. Higher values were obtained in the three main areas of Lake Qinghai: two in river estuaries and one close to sand dunes. Lower values were measured in the center and south of the lake. Measurements of total organic carbon (TOC), total nitrogen (TN), phosphorus concentrations, and TOC/TN ratios in three cores (QH01, QH02, and Z04) revealed four horizons corresponding to times of increased human activity. These anthropogenic events were (1) the development of large areas of cropland in the Lake Qinghai watershed in 1960, (2) the beginning of nationwide fertilizer use and increases in cropland area in the lake watershed after 1970, (3) the implementation of the national program "Grain to Green," and (4) the rapid increase in the tourism industry from 2000. Profiles of Rb, Sr concentrations, the Rb/Sr ratio, and grain-size fraction in core Z04 indicate that the climate has become drier over the past 100 years. Therefore, we suggest that lake sediments such as those in Lake Qinghai are useful media for high-resolution studies of regional environmental change and human activity.
Ho Mien, Ivan; Chua, Eric Chern-Pin; Lau, Pauline; Tan, Luuan-Chin; Lee, Ivan Tian-Guang; Yeo, Sing-Chen; Tan, Sara Shuhui; Gooley, Joshua J
2014-01-01
Exposure to light is a major determinant of sleep timing and hormonal rhythms. The role of retinal cones in regulating circadian physiology remains unclear, however, as most studies have used light exposures that also activate the photopigment melanopsin. Here, we tested the hypothesis that exposure to alternating red light and darkness can enhance circadian resetting responses in humans by repeatedly activating cone photoreceptors. In a between-subjects study, healthy volunteers (n = 24, 21-28 yr) lived individually in a laboratory for 6 consecutive days. Circadian rhythms of melatonin, cortisol, body temperature, and heart rate were assessed before and after exposure to 6 h of continuous red light (631 nm, 13 log photons cm(-2) s(-1)), intermittent red light (1 min on/off), or bright white light (2,500 lux) near the onset of nocturnal melatonin secretion (n = 8 in each group). Melatonin suppression and pupillary constriction were also assessed during light exposure. We found that circadian resetting responses were similar for exposure to continuous versus intermittent red light (P = 0.69), with an average phase delay shift of almost an hour. Surprisingly, 2 subjects who were exposed to red light exhibited circadian responses similar in magnitude to those who were exposed to bright white light. Red light also elicited prolonged pupillary constriction, but did not suppress melatonin levels. These findings suggest that, for red light stimuli outside the range of sensitivity for melanopsin, cone photoreceptors can mediate circadian phase resetting of physiologic rhythms in some individuals. Our results also show that sensitivity thresholds differ across non-visual light responses, suggesting that cones may contribute differentially to circadian resetting, melatonin suppression, and the pupillary light reflex during exposure to continuous light.
Directory of Open Access Journals (Sweden)
Ivan Ho Mien
Full Text Available Exposure to light is a major determinant of sleep timing and hormonal rhythms. The role of retinal cones in regulating circadian physiology remains unclear, however, as most studies have used light exposures that also activate the photopigment melanopsin. Here, we tested the hypothesis that exposure to alternating red light and darkness can enhance circadian resetting responses in humans by repeatedly activating cone photoreceptors. In a between-subjects study, healthy volunteers (n = 24, 21-28 yr lived individually in a laboratory for 6 consecutive days. Circadian rhythms of melatonin, cortisol, body temperature, and heart rate were assessed before and after exposure to 6 h of continuous red light (631 nm, 13 log photons cm(-2 s(-1, intermittent red light (1 min on/off, or bright white light (2,500 lux near the onset of nocturnal melatonin secretion (n = 8 in each group. Melatonin suppression and pupillary constriction were also assessed during light exposure. We found that circadian resetting responses were similar for exposure to continuous versus intermittent red light (P = 0.69, with an average phase delay shift of almost an hour. Surprisingly, 2 subjects who were exposed to red light exhibited circadian responses similar in magnitude to those who were exposed to bright white light. Red light also elicited prolonged pupillary constriction, but did not suppress melatonin levels. These findings suggest that, for red light stimuli outside the range of sensitivity for melanopsin, cone photoreceptors can mediate circadian phase resetting of physiologic rhythms in some individuals. Our results also show that sensitivity thresholds differ across non-visual light responses, suggesting that cones may contribute differentially to circadian resetting, melatonin suppression, and the pupillary light reflex during exposure to continuous light.
Directory of Open Access Journals (Sweden)
Yasuyuki Suzuki
2012-01-01
Full Text Available Yokukansan, one of the traditional Japanese herbal medicines, ameliorated neuropathic pain symptoms in patients. In this study, we investigated the effects of yokukansan on neuropathic pain in chronic constriction injury (CCI model. Oral administration of yokukansan significantly inhibited mechanical and cold allodynia in the von Frey hair or acetone test, respectively. In comparison, amitriptyline, a tricyclic antidepressant, demonstrated moderate, but not significant, antiallodynic effects in the mechanical and cold tests. Yokukansan significantly inhibited the cerebrospinal fluid dialysate level of glutamate that had increased by the stimulation of brush or acetone. Glutamate transporter inhibitors, DL-threo-beta-hydroxy aspartate and dihydrokainate, decreased the yokukansan-induced antiallodynic actions in CCI rats. Our results suggest that yokukansan was confirmed to have antiallodynic effects in CCI rats, which are related to a blockade of glutamatergic neurotransmission via activation of glutamate transporters in the spinal cord.
Shinoda, Yasuharu; Tagashira, Hideaki; Bhuiyan, Md Shenuarin; Hasegawa, Hideyuki; Kanai, Hiroshi; Fukunaga, Kohji
2016-07-01
Haloperidol is an antipsychotic drug that inhibits the dopamine D2 receptor among others. Haloperidol also binds the sigma-1 receptor (σ1R) and inhibits it irreversibly. A serious outcome of haloperidol treatment of schizophrenia patients is death due to sudden cardiac failure. Although the cause remains unclear, we hypothesized that these effects were mediated by chronic haloperidol inhibition of cardiac σ1R. To test this, we treated neonatal rat cardiomyocytes with haloperidol, exposed them to angiotensin II and assessed hypertrophy, σ1R expression, mitochondrial Ca(2+) transport and ATP levels. In this context, haloperidol treatment altered mitochondrial Ca(2+) transport resulting in decreased ATP content by inactivating cardiac σ1R and/or reducing its expression. We also performed transverse aortic constriction (TAC) and then treated mice with haloperidol. After two weeks, haloperidol-treated mice showed enhanced heart failure marked by deteriorated cardiac function, reduced ATP production and increasing mortality relative to TAC only mice. ATP supplementation via sodium pyruvate rescued phenotypes seen in haloperidol-treated TAC mice. We conclude that σ1R inactivation or downregulation in response to haloperidol treatment impairs mitochondrial Ca(2+) mobilization, depleting ATP depletion from cardiomyocytes. These findings suggest a novel approach to mitigate haloperidol-related adverse effects in schizophrenia patients by ATP supplementation. Copyright © 2016 The Authors. Production and hosting by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Yasuharu Shinoda
2016-07-01
Full Text Available Haloperidol is an antipsychotic drug that inhibits the dopamine D2 receptor among others. Haloperidol also binds the sigma-1 receptor (σ1R and inhibits it irreversibly. A serious outcome of haloperidol treatment of schizophrenia patients is death due to sudden cardiac failure. Although the cause remains unclear, we hypothesized that these effects were mediated by chronic haloperidol inhibition of cardiac σ1R. To test this, we treated neonatal rat cardiomyocytes with haloperidol, exposed them to angiotensin II and assessed hypertrophy, σ1R expression, mitochondrial Ca2+ transport and ATP levels. In this context, haloperidol treatment altered mitochondrial Ca2+ transport resulting in decreased ATP content by inactivating cardiac σ1R and/or reducing its expression. We also performed transverse aortic constriction (TAC and then treated mice with haloperidol. After two weeks, haloperidol-treated mice showed enhanced heart failure marked by deteriorated cardiac function, reduced ATP production and increasing mortality relative to TAC only mice. ATP supplementation via sodium pyruvate rescued phenotypes seen in haloperidol-treated TAC mice. We conclude that σ1R inactivation or downregulation in response to haloperidol treatment impairs mitochondrial Ca2+ mobilization, depleting ATP depletion from cardiomyocytes. These findings suggest a novel approach to mitigate haloperidol-related adverse effects in schizophrenia patients by ATP supplementation.
Vasopressin-induced constriction of the isolated rat occipital artery is segment-dependent
Chelko, Stephen P.; Schmiedt, Chad W.; Lewis, Tristan H.; Lewis, Stephen J.; Robertson, Tom P.
2014-01-01
Background Circulating factors delivered to the nodose ganglion (NG) by the occipital artery (OA) have shown to affect vagal afferent activity, and thus the contractile state of the OA may influence blood flow to the NG. Methods OA were isolated and bisected into proximal and distal segments, relative to the external carotid artery. Results Bisection, highlighted stark differences between maximal contractile responses and OA sensitivity. Specifically, maximum responses to vasopressin and the V1 receptor agonist, were significantly higher in distal than proximal segments. Distal segments were significantly more sensitive to 5-HT and the 5-HT2 receptor agonist than proximal segments. AT2, V2 and 5-HT1B/1D receptor agonists did not elicit vascular responses. Additionally, AT1 receptor agonists elicited mild, yet not significantly different maximal responses between segments. Conclusion The results of this study are consistent with contractile properties of rat OA being mediated via AT1, V1 and 5-HT2 receptors, and are dependent upon the OA segment. Furthermore, vasopressin-induced constriction of the OA, regardless of a bolus dose or a first and second concentration response curve retained this unique segmental difference and therefore we hypothesize this may be a pathophysiological response in the regulation of blood flow through the OA. PMID:24192548
Energy Technology Data Exchange (ETDEWEB)
WEST,WP; BURRELL,KH; deGRASSIE,JS; DOYLE,EJ; GREENFIELD,CM; LASNIER,CJ; SNYDER,PB; ZENG,L
2003-08-01
OAK-B135 The quiescent H-mode (QH-mode) is an ELM-free and stationary state mode of operation discovered on DIII-D. This mode achieves H-mode levels of confinement and pedestal pressure while maintaining constant density and radiated power. The elimination of edge localized modes (ELMs) and their large divertor loads while maintaining good confinement and good density control is of interest to next generation tokamaks. This paper reports on the correlations found between selected parameters in a QH-mode database developed from several hundred DIII-D counter injected discharges. Time traces of key plasma parameters from a QH-mode discharge are shown. On DIII-D the negative going plasma current (a) indicates that the beam injection direction is counter to the plasma current direction, a common feature of all QH-modes. The D{sub {alpha}} time behavior (c) shows that soon after high powered beam heating (b) is applied, the discharge makes a transition to ELMing H-mode, then the ELMs disappear, indicating the start of the QH period that lasts for the remainder of the high power beam heating (3.5 s). Previously published work showing density and temperature profiles indicates that long-pulse, high-triangularity QH discharges develop an internal transport barrier in combination with the QH edge barrier. These discharges are known as quiescent, double-barrier discharges (QDB). The H-factor (d) and stored energy (c) rise then saturate at a constant level and the measured axial and minimum safety factors remain above 1.0 for the entire QH duration. During QDB operation the performance of the plasma can be very good, with {beta}{sub N}*H{sub 89L} product reaching 7 for > 10 energy confinement times. These discharges show promise that a stationary state can be achieved.
International Nuclear Information System (INIS)
WEST, WP; BURRELL, KH; DeGRASSIE, JS; DOYLE, EJ; GREENFIELD, CM; LASNIER, CJ; SNYDER, PB; ZENG, L.
2003-01-01
OAK-B135 The quiescent H-mode (QH-mode) is an ELM-free and stationary state mode of operation discovered on DIII-D. This mode achieves H-mode levels of confinement and pedestal pressure while maintaining constant density and radiated power. The elimination of edge localized modes (ELMs) and their large divertor loads while maintaining good confinement and good density control is of interest to next generation tokamaks. This paper reports on the correlations found between selected parameters in a QH-mode database developed from several hundred DIII-D counter injected discharges. Time traces of key plasma parameters from a QH-mode discharge are shown. On DIII-D the negative going plasma current (a) indicates that the beam injection direction is counter to the plasma current direction, a common feature of all QH-modes. The D α time behavior (c) shows that soon after high powered beam heating (b) is applied, the discharge makes a transition to ELMing H-mode, then the ELMs disappear, indicating the start of the QH period that lasts for the remainder of the high power beam heating (3.5 s). Previously published work showing density and temperature profiles indicates that long-pulse, high-triangularity QH discharges develop an internal transport barrier in combination with the QH edge barrier. These discharges are known as quiescent, double-barrier discharges (QDB). The H-factor (d) and stored energy (c) rise then saturate at a constant level and the measured axial and minimum safety factors remain above 1.0 for the entire QH duration. During QDB operation the performance of the plasma can be very good, with β N *H 89L product reaching 7 for > 10 energy confinement times. These discharges show promise that a stationary state can be achieved
Shahid, M; Subhan, F; Ahmad, N; Ali, G; Akbar, S; Fawad, K; Sewell, R D E
2017-04-01
Systemic gabapentin is a mainstay treatment for neuropathic pain though there are side-effects. Localized therapy may curtail such side-effects so a topical gabapentin dermal application was examined in the chronic constriction injury (CCI) model of neuropathic pain. Partial denervation CCI was achieved by rat sciatic nerve ligation. Gabapentin gel (10% w/w) was applied three times daily on the ipsilateral or contralateral plantar surface of the hind-paw, whereas in a concurrent systemic study, gabapentin was intraperitoneally administered daily (75 mg/kg) for 30 days. Tests for static- and dynamic-mechano-allodynia [paw withdrawal threshold (PWT) to von Frey filament application and latency (PWL) to light brushing], cold-allodynia [paw withdrawal duration (PWD) to acetone], heat- (PWL and PWD) and mechano-hyperalgesia (PWD to pin prick) were utilized to assess pain, whereas effects on locomotion (open field) and motor balance (rotarod and footprint analysis) were measured on days 5-30 post surgery. Topical application of gabapentin gel ipsilaterally but not contralaterally alleviated CCI-induced static- (days 10-30) and dynamic-allodynia (days 15-30), suppressed cold-allodynia (days 10-30), heat- (days 15-30) and mechano-hyperalgesia (days 5-30) indicating a local action. Systemic gabapentin exhibited similar pain profiles but was associated with motor impairment. The gabapentin gel formulation afforded desirable neuropathic pain alleviating effects devoid of unwanted systemic side-effects. These outcomes disclose an expedient pharmacological validation of the effectiveness of topical gabapentin gel against an extensive range of nociceptive stimulus modalities utilizing the CCI-induced neuropathic pain model. They also advocate further clinical studies on topical gabapentin with regard to certain neuropathic pain syndromes. Systemic gabapentin neuropathic pain management carries side-effects ostensibly preventable by localized therapy. This study validates the
Dataset of red light induced pupil constriction superimposed on post-illumination pupil response
Directory of Open Access Journals (Sweden)
Shaobo Lei
2016-09-01
Full Text Available We collected and analyzed pupil diameter data from of 7 visually normal participants to compare the maximum pupil constriction (MPC induced by “Red Only” vs. “Blue+Red” visual stimulation conditions.The “Red Only” condition consisted of red light (640±10 nm stimuli of variable intensity and duration presented to dark-adapted eyes with pupils at resting state. This condition stimulates the cone-driven activity of the intrinsically photosensitive retinal ganglion cells (ipRGC. The “Blue+Red” condition consisted of the same red light stimulus presented during ongoing blue (470±17 nm light-induced post-illumination pupil response (PIPR, representing the cone-driven ipRGC activity superimposed on the melanopsin-driven intrinsic activity of the ipRGCs (“The Absence of Attenuating Effect of Red light Exposure on Pre-existing Melanopsin-Driven Post-illumination Pupil Response” Lei et al. (2016 [1].MPC induced by the “Red Only” condition was compared with the MPC induced by the “Blue+Red” condition by multiple paired sample t-tests with Bonferroni correction. Keywords: Pupil light reflex, Chromatic pupillometry, Melanopsin, Post-illumination pupil response
Constriction of the buccal branch of the facial nerve produces unilateral craniofacial allodynia.
Lewis, Susannah S; Grace, Peter M; Hutchinson, Mark R; Maier, Steven F; Watkins, Linda R
2017-08-01
Despite pain being a sensory experience, studies of spinal cord ventral root damage have demonstrated that motor neuron injury can induce neuropathic pain. Whether injury of cranial motor nerves can also produce nociceptive hypersensitivity has not been addressed. Herein, we demonstrate that chronic constriction injury (CCI) of the buccal branch of the facial nerve results in long-lasting, unilateral allodynia in the rat. An anterograde and retrograde tracer (3000MW tetramethylrhodamine-conjugated dextran) was not transported to the trigeminal ganglion when applied to the injury site, but was transported to the facial nucleus, indicating that this nerve branch is not composed of trigeminal sensory neurons. Finally, intracisterna magna injection of interleukin-1 (IL-1) receptor antagonist reversed allodynia, implicating the pro-inflammatory cytokine IL-1 in the maintenance of neuropathic pain induced by facial nerve CCI. These data extend the prior evidence that selective injury to motor axons can enhance pain to supraspinal circuits by demonstrating that injury of a facial nerve with predominantly motor axons is sufficient for neuropathic pain, and that the resultant pain has a neuroimmune component. Copyright © 2016 Elsevier Inc. All rights reserved.
E3 Ubiquitin Ligase c-cbl Inhibits Microglia Activation After Chronic Constriction Injury.
Xue, Pengfei; Liu, Xiaojuan; Shen, Yiming; Ju, Yuanyuan; Lu, Xiongsong; Zhang, Jinlong; Xu, Guanhua; Sun, Yuyu; Chen, Jiajia; Gu, Haiyan; Cui, Zhiming; Bao, Guofeng
2018-06-22
E3 ubiquitin ligase c-Caritas B cell lymphoma (c-cbl) is associated with negative regulation of receptor tyrosine kinases, signal transduction of antigens and cytokine receptors, and immune response. However, the expression and function of c-cbl in the regulation of neuropathic pain after chronic constriction injury (CCI) are unknown. In rat CCI model, c-cbl inhibited the activation of spinal cord microglia and the release of pro-inflammatory factors including tumor necrosis factor alpha (TNF-α), interleukin 1 beta (IL-1β) and interleukin 6 (IL-6), which alleviated mechanical and heat pain through down-regulating extracellular signal-regulated kinase (ERK) pathway. Additionally, exogenous TNF-α inhibited c-cbl protein level vice versa. In the primary microglia transfected with c-cbl siRNA, when treated with TNF-α or TNF-α inhibitor, the corresponding secretion of IL-1β and IL-6 did not change. In summary, CCI down-regulated c-cbl expression and induced the activation of microglia, then activated microglia released inflammatory factors via ERK signaling to cause pain. Our data might supply a novel molecular target for the therapy of CCI-induced neuropathic pain.
Directory of Open Access Journals (Sweden)
Xian-Ming Qi
2015-12-01
Full Text Available Utilization of hemicelluloses from biomass energy is an important approach to explore renewable resources. A convenient, quick, and inexpensive method for the preparation of blended films from quaternized hemicelluloses (QH and carboxymethyl cellulose (CMC was introduced into this study. QH and CMC solution were first mixed to form homogeneous suspension, and then were dried under vacuum to fabricate the blended films. The FT-IR and XRD results indicated that the linkage between QH and CMC was due to the hydrogen bonding and electrostatic interaction. From the results of mechanical properties and water vapor permeability (WVP, the tensile strength of the blended films increased with the QH/CMC content ratio increasing in appropriate range, and the WVP of the blended films decreased. The maximum value of tensile strength of blend film achieved was 27.4 MPa. In addition, the transmittances of the blended films increased with the decreasing of QH/CMC content ratio. When the weight ratio (QH: CMC was 1:1.5, the blend film showed the best light transmittance (45%. All the results suggested that the blended films could be used in areas of application in the coating and packaging fields from the good tensile strength, transmittance, and low WVP.
Qi, Xian-Ming; Liu, Shi-Yun; Chu, Fang-Bing; Pang, Shuai; Liang, Yan-Ru; Guan, Ying; Peng, Feng; Sun, Run-Cang
2015-01-01
Utilization of hemicelluloses from biomass energy is an important approach to explore renewable resources. A convenient, quick, and inexpensive method for the preparation of blended films from quaternized hemicelluloses (QH) and carboxymethyl cellulose (CMC) was introduced into this study. QH and CMC solution were first mixed to form homogeneous suspension, and then were dried under vacuum to fabricate the blended films. The FT-IR and XRD results indicated that the linkage between QH and CMC was due to the hydrogen bonding and electrostatic interaction. From the results of mechanical properties and water vapor permeability (WVP), the tensile strength of the blended films increased with the QH/CMC content ratio increasing in appropriate range, and the WVP of the blended films decreased. The maximum value of tensile strength of blend film achieved was 27.4 MPa. In addition, the transmittances of the blended films increased with the decreasing of QH/CMC content ratio. When the weight ratio (QH: CMC) was 1:1.5, the blend film showed the best light transmittance (45%). All the results suggested that the blended films could be used in areas of application in the coating and packaging fields from the good tensile strength, transmittance, and low WVP. PMID:28787804
Investigation of Supercurrent in the Quantum Hall Regime in Graphene Josephson Junctions
Draelos, Anne W.; Wei, Ming Tso; Seredinski, Andrew; Ke, Chung Ting; Mehta, Yash; Chamberlain, Russell; Watanabe, Kenji; Taniguchi, Takashi; Yamamoto, Michihisa; Tarucha, Seigo; Borzenets, Ivan V.; Amet, François; Finkelstein, Gleb
2018-06-01
In this study, we examine multiple encapsulated graphene Josephson junctions to determine which mechanisms may be responsible for the supercurrent observed in the quantum Hall (QH) regime. Rectangular junctions with various widths and lengths were studied to identify which parameters affect the occurrence of QH supercurrent. We also studied additional samples where the graphene region is extended beyond the contacts on one side, making that edge of the mesa significantly longer than the opposite edge. This is done in order to distinguish two potential mechanisms: (a) supercurrents independently flowing along both non-contacted edges of graphene mesa, and (b) opposite sides of the mesa being coupled by hybrid electron-hole modes flowing along the superconductor/graphene boundary. The supercurrent appears suppressed in extended junctions, suggesting the latter mechanism.
Lifescience Database Archive (English)
Full Text Available ity*ptrkcyrnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin ...rnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin t*ywsicldrke**wy*rir*tiitrcfsfivltkwn
Vasopressin-induced constriction of the isolated rat occipital artery is segment dependent.
Chelko, Stephen P; Schmiedt, Chad W; Lewis, Tristan H; Lewis, Stephen J; Robertson, Tom P
2013-01-01
Circulating factors delivered to the nodose ganglion (NG) by the occipital artery (OA) have been shown to affect vagal afferent activity, and thus the contractile state of the OA may influence blood flow to the NG. OA were isolated and bisected into proximal and distal segments relative to the external carotid artery. Bisection highlighted stark differences between maximal contractile responses and OA sensitivity. Specifically, maximum responses to vasopressin and the V1 receptor agonist were significantly higher in distal than proximal segments. Distal segments were significantly more sensitive to 5-hydroxytryptamine (5-HT) and the 5-HT2 receptor agonist than proximal segments. Angiotensin II (AT)2, V2 and 5-HT(1B/1D) receptor agonists did not elicit vascular responses. Additionally, AT1 receptor agonists elicited mild, yet not significantly different maximal responses between segments. The results of this study are consistent with contractile properties of rat OA being mediated via AT1, V1 and 5-HT2 receptors and dependent upon the OA segment. Furthermore, vasopressin-induced constriction of the OA, regardless of a bolus dose or a first and second concentration-response curve, retained this unique segmental difference. We hypothesize that these segmental differences may be important in the regulation of blood flow through the OA in health and disease. © 2013 S. Karger AG, Basel.
Energy Technology Data Exchange (ETDEWEB)
Young, Steven; Montakhab, Mohammad; Nouri, Hassan
2011-07-15
Economic dispatch (ED) is one of the most important problems to be solved in power generation as fractional percentage fuel reductions represent significant cost savings. ED wishes to optimise the power generated by each generating unit in a system in order to find the minimum operating cost at a required load demand, whilst ensuring both equality and inequality constraints are met. For the process of optimisation, a model must be created for each generating unit. The particle swarm optimisation technique is an evolutionary computation technique with one of the most powerful methods for solving global optimisation problems. The aim of this paper is to add in a constriction factor to the particle swarm optimisation algorithm (CFBPSO). Results show that the algorithm is very good at solving the ED problem and that CFBPSO must be able to work in a practical environment and so a valve point effect with transmission losses should be included in future work.
Directory of Open Access Journals (Sweden)
Zhan-Li Shi
2018-01-01
Full Text Available Background. EPZ005687 is a selective inhibiter of methyltransferase EZH2. In this article, we investigated the protective role and mechanism of EPZ005687 in transverse aortic constriction-induced pulmonary arterial hypertension in mice. Methods. We assigned 15 (6–8 weeks old male balb/c mice to 3 groups randomly: Sham control + DMSO group, TAC + DMSO group, and TAC + EPZ005687 group (10 mg kg−1, once a week for 4 weeks. On day 28 following TAC operation, the right ventricular systolic blood pressure (RVSBP was measured, and lung tissues were collected for laboratory examinations (DHE, Western blot, real-time PCR, and ChIP. Results. Murine PAH model was successfully created by TAC operation as evidenced by increased RVSBP and hypertrophic right ventricle. Compared with the sham control, TAC-induced PAH markedly upregulated the expression of EZH2 and ROS deposition in lungs in PAH mice. The inhibiter of methyltransferase EZH2, EPZ005687 significantly inhibits the development of TAC-induced PAH in an EZH2-SOD1-ROS dependent manner. Conclusion. Our data identified that EZH2 serves a fundamental role in TAC-induced PAH, and administration of EPZ005687 might represent a novel therapeutic target for the treatment of TAC-induced PAH.
1993-12-21
Latent(Lower Solid), Net Infrared (Dashed), and Net viii Heat Loss (Upper Solid - the Other 3 Surmmed) are Plotted, with Positive Values :ndicating...gained from solar insolation, Qs, and the heat lost from the surface due to latent, Qe, sensible, Qh, and net infrared radiation, Qb is positive...five empirically derived dimensionless constants in the model. With the introduction of two new unknowns, <E> and < ww2 >, the prediction of the upper
Directory of Open Access Journals (Sweden)
Xue Lin
2016-01-01
Full Text Available Background: To determine the influence of right ventricular function in patients with constrictive pericarditis (CP undergoing surgery and to compare the outcomes of patients who received surgery with those managed medically. Methods: Patients with the diagnosis of CP and healthy volunteers were recruited from January 2006 to November 2011. Patients with CP chose to either receive pericardiectomy or medical management. Echocardiographic measurements were performed to evaluate heart function, and survival was recorded. Results: A total of 58 patients with CP (36 received pericardiectomy, 22 managed medically, and 43 healthy volunteers were included. CP patients who received surgery had a higher survival rate than those managed medically (P = 0.003, and higher survival was also seen in the subgroup of CP patients with severely impaired right systolic function. Albumin level, left ventricular end-diastolic dimension, and tricuspid regurgitation velocity were associated with survival in CP patients who received surgery. Conclusions: Preoperative right heart function does not affect surgical outcomes. Patients with severely impaired preoperative right systolic function obtain a greater survival advantage with surgery than with medical treatment.
A Novel Imaging Analysis Method for Capturing Pharyngeal Constriction During Swallowing.
Schwertner, Ryan W; Garand, Kendrea L; Pearson, William G
2016-01-01
Videofluoroscopic imaging of swallowing known as the Modified Barium Study (MBS) is the standard of care for assessing swallowing difficulty. While the clinical purpose of this radiographic imaging is to primarily assess aspiration risk, valuable biomechanical data is embedded in these studies. Computational analysis of swallowing mechanics (CASM) is an established research methodology for assessing multiple interactions of swallowing mechanics based on coordinates mapping muscle function including hyolaryngeal movement, pharyngeal shortening, tongue base retraction, and extension of the head and neck, however coordinates characterizing pharyngeal constriction is undeveloped. The aim of this study was to establish a method for locating the superior and middle pharyngeal constrictors using hard landmarks as guides on MBS videofluoroscopic imaging, and to test the reliability of this new method. Twenty de-identified, normal, MBS videos were randomly selected from a database. Two raters annotated landmarks for the superior and middle pharyngeal constrictors frame-by-frame using a semi-automated MATLAB tracker tool at two time points. Intraclass correlation coefficients were used to assess test-retest reliability between two raters with an ICC = 0.99 or greater for all coordinates for the retest measurement. MorphoJ integrated software was used to perform a discriminate function analysis to visualize how all 12 coordinates interact with each other in normal swallowing. The addition of the superior and middle pharyngeal constrictor coordinates to CASM allows for a robust analysis of the multiple components of swallowing mechanics interacting with a wide range of variables in both patient specific and cohort studies derived from common use imaging data.
Mani, Arjun; Benjamin, Colin
2016-04-13
On the surface of 2D topological insulators, 1D quantum spin Hall (QSH) edge modes occur with Dirac-like dispersion. Unlike quantum Hall (QH) edge modes, which occur at high magnetic fields in 2D electron gases, the occurrence of QSH edge modes is due to spin-orbit scattering in the bulk of the material. These QSH edge modes are spin-dependent, and chiral-opposite spins move in opposing directions. Electronic spin has a larger decoherence and relaxation time than charge. In view of this, it is expected that QSH edge modes will be more robust to disorder and inelastic scattering than QH edge modes, which are charge-dependent and spin-unpolarized. However, we notice no such advantage accrues in QSH edge modes when subjected to the same degree of contact disorder and/or inelastic scattering in similar setups as QH edge modes. In fact we observe that QSH edge modes are more susceptible to inelastic scattering and contact disorder than QH edge modes. Furthermore, while a single disordered contact has no effect on QH edge modes, it leads to a finite charge Hall current in the case of QSH edge modes, and thus a vanishing of the pure QSH effect. For more than a single disordered contact while QH states continue to remain immune to disorder, QSH edge modes become more susceptible--the Hall resistance for the QSH effect changes sign with increasing disorder. In the case of many disordered contacts with inelastic scattering included, while quantization of Hall edge modes holds, for QSH edge modes a finite charge Hall current still flows. For QSH edge modes in the inelastic scattering regime we distinguish between two cases: with spin-flip and without spin-flip scattering. Finally, while asymmetry in sample geometry can have a deleterious effect in the QSH case, it has no impact in the QH case.
International Nuclear Information System (INIS)
Mani, Arjun; Benjamin, Colin
2016-01-01
On the surface of 2D topological insulators, 1D quantum spin Hall (QSH) edge modes occur with Dirac-like dispersion. Unlike quantum Hall (QH) edge modes, which occur at high magnetic fields in 2D electron gases, the occurrence of QSH edge modes is due to spin–orbit scattering in the bulk of the material. These QSH edge modes are spin-dependent, and chiral-opposite spins move in opposing directions. Electronic spin has a larger decoherence and relaxation time than charge. In view of this, it is expected that QSH edge modes will be more robust to disorder and inelastic scattering than QH edge modes, which are charge-dependent and spin-unpolarized. However, we notice no such advantage accrues in QSH edge modes when subjected to the same degree of contact disorder and/or inelastic scattering in similar setups as QH edge modes. In fact we observe that QSH edge modes are more susceptible to inelastic scattering and contact disorder than QH edge modes. Furthermore, while a single disordered contact has no effect on QH edge modes, it leads to a finite charge Hall current in the case of QSH edge modes, and thus a vanishing of the pure QSH effect. For more than a single disordered contact while QH states continue to remain immune to disorder, QSH edge modes become more susceptible—the Hall resistance for the QSH effect changes sign with increasing disorder. In the case of many disordered contacts with inelastic scattering included, while quantization of Hall edge modes holds, for QSH edge modes a finite charge Hall current still flows. For QSH edge modes in the inelastic scattering regime we distinguish between two cases: with spin-flip and without spin-flip scattering. Finally, while asymmetry in sample geometry can have a deleterious effect in the QSH case, it has no impact in the QH case. (paper)
International Nuclear Information System (INIS)
Ishiyama, Toshio
1975-01-01
The geometrical isomers, cis-dichloro-trans-(methanol)(hydroquinone)(2,2'-bipyridine)ruthenium(II) and cis-dichloro-cis-(methanol)(hydroquinone)(2,2'-bipyridine)ruthenium(II), [RuCl 2 (MeOH)(QH 2 )bipy] (complex I and II), were synthesized by reduction and substitution reactions of [RuO 4 bipy] and [RuO 2 (OH) 2 bipy] with hydroquinone in hydrochloric acid solution, and methanol. cis-Chloro(hydroquinonato)bis(2,2'-bipyridine)ruthenium(II), cis-[RuCl(QH)(bipy) 2 ], was obtained from the substitution reaction of complex I or II with 2,2'-bipyridine in methanol, and cis-chloro(hydroquinone)bis(2,2'-bipyridine)ruthenium(II) chloride, cis-[RuCl(QH 2 )(bipy) 2 ]Cl, was also obtained from the substitution of cis-trans-[RuCl 2 (MeOH)(QH 2 )bipy] in methanol containing hydrochloric acid. cis-Dihydroxobis(2,2'-bipyridine)ruthenium(II), cis-[Ru(OH) 2 (bipy) 2 ], was obtained by heating an aqueous solution of cis-[RuCl(QH)(bipy) 2 ]. Trihydroxoaquo(1,10-phenanthroline)ruthenium(III), [Ru(OH) 3 (H 2 O)phen] was also synthesized from [RuO 3 phen] 2 O and [Ru(OH) 3 phen] 2 O by reduction reactions similar to those used for [RuCl 2 (MeOH)(QH 2 )bipy]. These complexes were characterized by the infrared, visible and ultraviolet absorption spectra, and also by polarographic and magnetic measurements. The structures are discussed. (auth.)
Avoiding leakage flow-induced vibration by a tube-in-tube slip joint
International Nuclear Information System (INIS)
Mulcahy, T.M.
1985-01-01
Parameters and operating conditions (a stability map) were determined for which a specific slip-joint design did not cause self-excited lateral vibration of the two cantilevered, telescoping tubes forming the joint. The joint design featured a localized annular constriction. Flowrate, modal damping, tube engagement length, and eccentric positioning were among the parameters tested. Interestingly, all self-excited vibrations could be avoided by following a simple design rule: place constrictions only at the downstream end of the annular region between the tubes. Also, overall modal damping decreased with increased flowrate, at least initially, for upstream constrictions while the damping increased for downstream constrictions
Directory of Open Access Journals (Sweden)
Anand Ramchandra Rathi
2015-01-01
Full Text Available Class III malocclusion is very common malocclusion and can be due to maxillary retrusion, mandibular prognathism, or combination. Ellis and McNamara found a combination of maxillary retrusion and mandibular protrusion to be the most common skeletal relationship (30%. The treatment should be carried out as early as possible for permitting normal growth of the skeletal bases. Reverse pull head gear combined with maxillary expansion can effectively correct skeletal Class III malocclusion due to maxillary deficiency in growing patient. An eight-year-old female patient with chief complaint of prognathic mandible and anterior crossbite was successfully treated in duration of 5 months with facemask and expansion therapy based on Alternate Rapid Maxillary Expansion and Constriction (Alt-RAMEC protocol.
Seidu, Issaka; Zhekova, Hristina R; Seth, Michael; Ziegler, Tom
2012-03-08
The performance of the second-order spin-flip constricted variational density functional theory (SF-CV(2)-DFT) for the calculation of the exchange coupling constant (J) is assessed by application to a series of triply bridged Cu(II) dinuclear complexes. A comparison of the J values based on SF-CV(2)-DFT with those obtained by the broken symmetry (BS) DFT method and experiment is provided. It is demonstrated that our methodology constitutes a viable alternative to the BS-DFT method. The strong dependence of the calculated exchange coupling constants on the applied functionals is demonstrated. Both SF-CV(2)-DFT and BS-DFT affords the best agreement with experiment for hybrid functionals.
Faggi, S.; Villanueva, G. L.; Mumma, M. J.; Brucato, J.R.; Tozzi, G. P.; Oliva, E.; Massi, F.; Sanna, N.; Tozzi, A.
2016-01-01
We observed the Oort cloud comet C/2014 Q2 (Lovejoy) on 2015 January 31 and February 1 and 2 at a heliocentric distance of 1.3 au and geocentric distance of 0.8 au during its approach to the Sun. Comet Lovejoy was observed with GIANO, the near-infrared high-resolution spectrograph mounted at the Nasmyth-A focus of the TNG (Telescopio Nazionale Galileo) telescope in La Palma, Canary Islands, Spain. We detected strong emissions of radical CN and water, along with many emission features of unidentified origin, across the 1-2.5 micron region. Spectral lines from eight ro-vibrational bands of H2O were detected, six of them for the first time. We quantified the water production rate [Q(H2O), (3.11+/- 0.14) x 10(exp 29)/s] by comparing the calibrated line fluxes with the Goddard full non-resonance cascade fluorescence model for H2O. The production rates of ortho-water [Q(H2O)ORTHO, (2.33+/- 0.11) x 10(exp 29)/s] and para-water [Q(H2O)PARA, (0.87+/-0.21) x 10(exp 29)/s] provide a measure of the ortho-to-para ratio (2.70+/- 0.76)). The confidence limits are not small enough to provide a critical test of the nuclear spin temperature.
Optimization of the alcoholic fermentation of blueberry juice by AS ...
African Journals Online (AJOL)
AJL
2012-02-21
Feb 21, 2012 ... Kraft TFB, Schmidt BM, Yousef GG, Knight CTG, Cuendet M, Kang YH,. Pezzuto JM, Seigler D, ... Su MS, Silva JL (2006). Antioxidant activity ... 104: 182-187. Tian RR, Pan QH, Zhan JC, Li JM, Wan SB, Zhang QH, Huang WD.
The American Quarter Horse: Population Structure and Relationship to the Thoroughbred
2014-01-01
A breed known for its versatility, the American Quarter Horse (QH), is increasingly bred for performance in specific disciplines. The impact of selective breeding on the diversity and structure of the QH breed was evaluated using pedigree analysis and genome-wide SNP data from horses representing 6 performance groups (halter, western pleasure, reining, working cow, cutting, and racing). Genotype data (36 037 single nucleotide polymorphisms [SNPs]) from 36 Thoroughbreds were also evaluated with those from the 132 performing QHs to evaluate the Thoroughbred’s influence on QH diversity. Results showed significant population structure among all QH performance groups excepting the comparison between the cutting and working cow horses; divergence was greatest between the cutting and racing QHs, the latter of which had a large contribution of Thoroughbred ancestry. Significant coancestry and the potential for inbreeding exist within performance groups, especially when considering the elite performers. Relatedness within performance groups is increasing with popular sires contributing disproportionate levels of variation to each discipline. Expected heterozygosity, inbreeding, F ST, cluster, and haplotype analyses suggest these QHs can be broadly classified into 3 categories: stock, racing, and pleasure/halter. Although the QH breed as a whole contains substantial genetic diversity, current breeding practices have resulted in this variation being sequestered into subpopulations. PMID:24293614
Zhekova, Hristina R; Seth, Michael; Ziegler, Tom
2011-11-14
We have recently developed a methodology for the calculation of exchange coupling constants J in weakly interacting polynuclear metal clusters. The method is based on unrestricted and restricted second order spin-flip constricted variational density functional theory (SF-CV(2)-DFT) and is here applied to eight binuclear copper systems. Comparison of the SF-CV(2)-DFT results with experiment and with results obtained from other DFT and wave function based methods has been made. Restricted SF-CV(2)-DFT with the BH&HLYP functional yields consistently J values in excellent agreement with experiment. The results acquired from this scheme are comparable in quality to those obtained by accurate multi-reference wave function methodologies such as difference dedicated configuration interaction and the complete active space with second-order perturbation theory. © 2011 American Institute of Physics
Streamflow measurements in the oil sands region of northeastern Alberta[General Conference
Energy Technology Data Exchange (ETDEWEB)
Ashiq, M.; Ade, F. [Golder Associates Ltd., Calgary, AB (Canada). Water Resources Engineering Group
2006-07-01
Oil sands mining in the muskeg terrain of north-eastern Alberta will result in changes to the natural landscape, including changes to the morphology of receiving streams. The streams in the oil sands region are fed by constricted flows through the muskeg terrain. The roughness of the stream is attributed to sporadic cobbles and boulders, in-stream vegetation, over hanging vegetation and large quantities of wooden debris from beaver activities. This paper discussed stream roughness features in the oil sands region and compared the velocity profiles in these streams to the normal channel velocity profile. The study also included a comparison of computed discharges based on a simple method and a detailed method. The sources of errors in velocity measurements were then discussed. It was noted that before any oil sand mining project is approved, flows in receiving streams are monitored as part of the Environment Impact Assessment (EIA). The flows are then monitored again after project approval as part of project approval conditions.
Some applications of second sound in liquid helium
International Nuclear Information System (INIS)
Boog, A.G.M. van der.
1979-01-01
The creation of quantized vortices at a constriction between two parts of an apparatus filled with HeII is described. A number of experiments have been carried out, which were attemps (a) to observe the average rate at which vortices are created at the constriction, and (b) to observe vortex synchronisation (ac Josephson effect) by making use of second sound to modulate the flow in the constriction. The constriction was either a single orifice or a large number of parallel channels. The properties of dilute 3 He- 4 He mixtures in the temperature region 100 mK 3 He molar concentrations in the region 0.173 x 10 -2 -2 are dealt with. A dilute 3 He- 4 He mixture can be described in terms of models based on the assumption that the excitations of this system behave like a weakly interacting gas. These excitations are both the 3 He quasiparticles and, as in pure 4 He, phonons and rotons. (Auth.)
Narrowing sex differences in life expectancy: regional variations, 1971-1991
Directory of Open Access Journals (Sweden)
Frank Trovato
2001-12-01
Full Text Available A number of industrialized nations have recently experienced some degrees of constriction in their long-standing sex differentials in life expectancy at birth. In this study we examine this phenomenon in the context of Canada’s regions between 1971 and 1991: Atlantic (Newfoundland, Nova Scotia, New Brunswick, Prince Edward Island; Quebec, Ontario, and the West (Manitoba, Saskatchewan, Alberta, British Columbia, Yukon and Northwest Territories. Decomposition analysis based on multiple decrement life tables is applied to address three questions: (1 Are there regional differentials in the degree of narrowing in the sex gap in life expectancy? (2 What is the relative contribution of major causes of death to observed sex differences in average length of life within and across regions? (3 How do the contributions of cause-of-death components vary across regions to either widen or narrow the sex gap in survival? It is shown that the magnitude of the sex gap is not uniform across the regions, though the differences are not large. The most important contributors to a narrowing of the sex gap in life expectancy are heart disease and external types of mortality (i.e., accidents, violence, and suicide, followed by lung cancer and other types of chronic conditions. In substantive terms these results indicate that over time men have been making sufficient gains in these causes of death as to narrow some of the gender gap in overall survival. Regions show similarity in these effects.
International Nuclear Information System (INIS)
Cheng Guanghua; Dai Yunhai; Wu Kefang; Xu Quanfeng
2008-01-01
Objective: To observe 99 Tc m -MIBI uptake of ischemic myocardium at different times (1h, 4h) in dog models after left circumflex coronary artery constriction. Methods: 12 dog models of coronary artery stenosis were prepared by left circumflex coronary ligation, and were given injection of 99 Tc m -MIBI at the dosage of 185 MBq (5 mCi). Six models were sacrificed at one hour and four hours after the injection respectively. Radio-uptake in about 100 mg myocardium from both ischemic and non-ischemic sites were measured with r-counter. Results: No significant differences were found between ratios of radioactive count of ischemic over normal myocardial tissues at 1h and 4h after injection of 99 Tc m -MIBI (0.726±0.054 and 0.673±0.080, respective, t=1.3452, P >0.05). Conclusion: The extension of post-injection time would not increase 99 Tc m -MIBI uptake in ischemic myocardium. (authors)
Yu, Kexiang; Ma, Xiuli; Sheng, Zizhang; Qi, Lihong; Liu, Cunxia; Wang, Dan; Huang, Bing; Li, Feng; Song, Minxun
2016-08-01
A recent epizootic outbreak, in China, of duck beak atrophy and dwarfism syndrome (BADS) was investigated using electron microscopic, genetic, and virological studies, which identified a parvovirus with a greater similarity to goose parvovirus (GPV) (97% protein homology) than to Muscovy duck parvovirus (MDPV) (90% protein homology). The new virus, provisionally designated GPV-QH15, was found to be antigenically more closely related to GPV than to MDPV in a virus neutralization assay. These findings were further supported by phylogenetic analysis showing that GPV-QH15 evolved from goose lineage parvoviruses, rather than from Muscovy duck- or other duck species-related parvoviruses. In all, two genetic lineages (GPV I and GPV II) were identified from the GPV samples analyzed, and GPV-QH15 was found to be closely clustered with two known goose-origin parvoviruses (GPVa2006 and GPV1995), together forming a distinctive GPV IIa sublineage. Finally, structural modeling revealed that GPV-QH15 and the closely related viruses GPVa2006 and GPV1995 possessed identical clusters of receptor-interacting amino acid residues in the VP2 protein, a major determinant of viral receptor binding and host specificity. Significantly, these three viruses differed from MDPVs and other GPVs at these positions. Taken together, these results suggest that GPV-QH15 represents a new variant of goose-origin parvovirus that currently circulates in ducklings and causes BADS, a syndrome reported previously in Europe. This new finding highlights the need for future surveillance of GPV-QH15 in poultry in order to gain a better understanding of both the evolution and the biology of this emerging parvovirus. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Shen, Le; Li, Xu; Wang, Hai-tang; Yu, Xue-rong; Huang, Yu-guang
2013-12-01
To evaluate the pain-related behavioral changes in rats with bilateral chronic constriction injury(bCCI)and identify the expressions of neuropathic pain-related proteins. The bCCI models were established by ligating the sciatic nerves in female Sprague Dawley rats. Both mechanical hyperalgesia and cold hyperalgesia were evaluated through electronic von Frey and acetone method. Liquid chromatography-mass spectrometry/mass spectrometry was applied to characterize the differentially expressed proteins. Both mechanical withdrawal threshold and cold hyperalgesia threshold decreased significantly on the postoperative day 7 and 14, when compared with na ve or sham rats(P <0.05). Twenty five differentially expressed proteins associated with bilateral CCI were discovered, with eighteen of them were upregulated and seven of them downregulated. The bCCT rats have remarkably decreased mechanical and cold hyperalgesia thresholds. Twenty five neuropathic pain-related proteins are found in the spinal cord dorsal horn.
Khalili, N; Naguib, H E; Kwon, R H
2016-05-14
Human intervention can be replaced through the development of tools resulting from utilization of sensing devices possessing a wide range of applications including humanoid robots or remote and minimally invasive surgeries. Similar to the five human senses, sensors interface with their surroundings to stimulate a suitable response or action. The sense of touch which arises in human skin is among the most challenging senses to emulate due to its ultra high sensitivity. This has brought forth novel challenging issues to consider in the field of biomimetic robotics. In this work, using a multiphase reaction, a polypyrrole (PPy) based hydrogel is developed as a resistive type pressure sensor with an intrinsically elastic microstructure stemming from three dimensional hollow spheres. It is shown that the electrical conductivity of the fabricated PPy based piezoresistive sensors is enhanced as a result of adding conductive fillers and therefore, endowing the sensors with a higher sensitivity. A semi-analytical constriction resistance based model accounting for the real contact area between the PPy hydrogel sensors and the electrode along with the dependency of the contact resistance change on the applied load is developed. The model is then solved using a Monte Carlo technique and its corresponding sensitivity is obtained. Comparing the results with their experimental counterparts, the proposed modeling methodology offers a good tracking ability.
Czech Academy of Sciences Publication Activity Database
Máchová, J.; Prokeš, Miroslav; Kroupová, H.; Svobodová, Z.; Mácová, S.; Doleželová, P.; Velíšek, J.
2009-01-01
Roč. 78, č. 3 (2009), s. 505-512 ISSN 0001-7213 R&D Projects: GA MZe QH71305 Grant - others:GA MZe(CZ) QH82117 Institutional research plan: CEZ:AV0Z60930519 Keywords : auxiliary substance * toxicity * fish embryos * larvae Subject RIV: GL - Fishing Impact factor: 0.403, year: 2009
Levin, D L; Mills, L J; Weinberg, A G
1979-08-01
The prostaglandin synthetase inhibitor indomethacin was given orally or intravenously to pregnant ewes. This resulted in a significant rise in the fetal pulmonary-to-systemic arterial mean blood pressure difference across the ductus arteriosus, presumably secondary to constriction of the ductus arteriosus. In five experiments the pressure difference could be promptly but temporarily reversed by the administration of prostaglandin E1 (PGE1) into the fetal inferior vena cava. Fetal lungs from study and control animals were fixed by perfusion at measured pulmonary arterial mean blood pressure, and fifth-generation resistance vessels were studied. The medial width/external diameter ratio was significantly increased in the study vs the control lungs due to increased smooth muscle and decreased external diameter. In addition, study fetuses had acute degenerative myocardial changes in the tricuspid valve papillary muscles, the right ventricular free wall and the interventricular septum. Similar changes were not seen in control fetuses. Indomethacin administration during pregnancy causes constriction of the fetal ductus arteriosus, fetal pulmonary arterial hypertension, and right ventricular damage. If severe, this may cause rapid fetal death. If less severe, in the newborn infant, this mechanism may be one cause of persistent pulmonary hypertension due to vasoconstriction and increased pulmonary arterial smooth muscle and/or tricuspid insufficiency due to papillary muscle infarction.
Datta, Sukdeb; Chatterjee, Koel; Kline, Robert H; Wiley, Ronald G
2010-01-27
Unilateral constrictive sciatic nerve injury (uCCI) is a common neuropathic pain model. However, the bilateral constrictive injury (bCCI) model is less well studied, and shows unique characteristics. In the present study, we sought to correlate effects of bCCI on nocifensive responses to cold and mechanical stimuli with selected dorsal horn anatomic markers. bCCI or sham ligation of both rat sciatic nerves were followed up to 90 days of behavioural testing. Additional rats sacrificed at 15, 30 and 90 days were used for anatomic analyses. Behavioural tests included hindpaw withdrawal responses to topical acetone, cold plate testing, an operant thermal preference task and hindpaw withdrawal thresholds to mechanical probing. All nocifensive responses to cold increased and remained enhanced for >45 days. Mechanical withdrawal thresholds decreased for 25 days only. Densitometric analyses of immunoperoxidase staining in the superficial dorsal horn at L4-5 revealed decreased cholecystokinin (CCK) staining at all times after bCCI, decreased mu opiate receptor (MOR) staining, maximal at 15 days, increased neuropeptide Y (NPY) staining only at days 15 and 30, and increased neurokinin-1 receptor (NK-1R) staining at all time points, maximal at 15 days. Correlation analyses at 45 days post-bCCI, were significant for individual rat nocifensive responses in each cold test and CCK and NK-1R, but not for MOR or NPY. These results confirm the usefulness of cold testing in bCCI rats, a new approach using CCI to model neuropathic pain, and suggest a potential value of studying the roles of dorsal horn CCK and substance P in chronic neuropathic pain. Compared to human subjects with neuropathic pain, responses to cold stimuli in rats with bCCI may be a useful model of neuropathic pain.
Directory of Open Access Journals (Sweden)
Kline Robert H
2010-01-01
Full Text Available Abstract Background Unilateral constrictive sciatic nerve injury (uCCI is a common neuropathic pain model. However, the bilateral constrictive injury (bCCI model is less well studied, and shows unique characteristics. In the present study, we sought to correlate effects of bCCI on nocifensive responses to cold and mechanical stimuli with selected dorsal horn anatomic markers. bCCI or sham ligation of both rat sciatic nerves were followed up to 90 days of behavioural testing. Additional rats sacrificed at 15, 30 and 90 days were used for anatomic analyses. Behavioural tests included hindpaw withdrawal responses to topical acetone, cold plate testing, an operant thermal preference task and hindpaw withdrawal thresholds to mechanical probing. Results All nocifensive responses to cold increased and remained enhanced for >45 days. Mechanical withdrawal thresholds decreased for 25 days only. Densitometric analyses of immunoperoxidase staining in the superficial dorsal horn at L4-5 revealed decreased cholecystokinin (CCK staining at all times after bCCI, decreased mu opiate receptor (MOR staining, maximal at 15 days, increased neuropeptide Y (NPY staining only at days 15 and 30, and increased neurokinin-1 receptor (NK-1R staining at all time points, maximal at 15 days. Correlation analyses at 45 days post-bCCI, were significant for individual rat nocifensive responses in each cold test and CCK and NK-1R, but not for MOR or NPY. Conclusions These results confirm the usefulness of cold testing in bCCI rats, a new approach using CCI to model neuropathic pain, and suggest a potential value of studying the roles of dorsal horn CCK and substance P in chronic neuropathic pain. Compared to human subjects with neuropathic pain, responses to cold stimuli in rats with bCCI may be a useful model of neuropathic pain.
Directory of Open Access Journals (Sweden)
Qifeng Zhou
2015-01-01
Full Text Available Mutations in the giant sarcomeric protein titin (TTN are a major cause for inherited forms of dilated cardiomyopathy (DCM. We have previously developed a mouse model that imitates a TTN truncation mutation we found in a large pedigree with DCM. While heterozygous Ttn knock-in mice do not display signs of heart failure under sedentary conditions, they recapitulate the human phenotype when exposed to the pharmacological stressor angiotensin II or isoproterenol. In this study we investigated the effects of pressure overload by transverse aortic constriction (TAC in heterozygous (Het Ttn knock-in mice. Two weeks after TAC, Het mice developed marked impairment of left ventricular ejection fraction (p<0.05, while wild-type (WT TAC mice did not. Het mice also trended toward increased ventricular end diastolic pressure and volume compared to WT littermates. We found an increase in histologically diffuse cardiac fibrosis in Het compared to WT in TAC mice. This study shows that a pattern of DCM can be induced by TAC-mediated pressure overload in a TTN-truncated mouse model. This model enlarges our arsenal of cardiac disease models, adding a valuable tool to understand cardiac pathophysiological remodeling processes and to develop therapeutic approaches to combat heart failure.
Directory of Open Access Journals (Sweden)
Xiao-Bing Ji
2015-07-01
Full Text Available Background: Uncoupling protein 2 (UCP2 is critical in regulating energy metabolism. Due to the significant change in energy metabolism of myocardium upon pressure overload, we hypothesize that UCP2 could contribute to the etiology of cardiac hypertrophy. Methods: Adult male C57BL/6J mice were subjected to pressure overload by using transverse aortic constriction (TAC, and then received genipin (a UCP2 selective inhibitor; 25 mg/kg/d, ip or vehicle for three weeks prior to histologic assessment of myocardial hypertrophy. ATP concentration, ROS level, and myocardial apoptosis were also examined. A parallel set of experiments was also conducted in UCP2-/- mice. Results: TAC induced left ventricular hypertrophy, as reflected by increased ventricular weight/thickness and increased size of myocardial cell (vs. sham controls. ATP concentration was decreased; ROS level was increased. Apoptosis and fibrosis markers were increased. TAC increased mitochondrial UCP2 expression in the myocardium at both mRNA and protein levels. Genipin treatment attenuated cardiac hypertrophy and the histologic/biochemical changes described above. Hypertrophy and associated changes induced by TAC in UCP2-/- mice were much less pronounced than in WT mice. Conclusions: Blocking UCP2 expression attenuates cardiac hypertrophy induced by pressure overload.
Directory of Open Access Journals (Sweden)
Varsha J. Bansode
2014-01-01
Full Text Available Objective: The present study was designed to investigate the ameliorative effects of ethyl pyruvate (EP in chronic constriction injury (CCI-induced painful neuropathy in rats. Materials and Methods: EP 50 and 100 mg/kg was administered for 21 consecutive days starting from the day of surgery. The effects of EP in the paw pressure, acetone drop, and tail heat immersion tests were assessed, reflecting the degree of mechanical hyperalgesia, cold allodynia, and spinal thermal sensation, respectively. Axonal degeneration of the sciatic nerve was assessed histopathologically. The levels of thiobarbituric acid reactive species, reduced glutathione (GSH, catalase (CAT, and superoxide dismutase (SOD were determined to assess oxidative stress. Key Findings: Administration of 50 and 100 mg/kg EP attenuated the reduction of nociceptive threshold in the paw pressure, acetone drop, and tail heat immersion tests. EP 100 mg/kg significantly attenuated reactive changes in histopathology and increase in oxidative stress. Conclusion: EP 100 mg/kg showed beneficial activity against nerve trauma-induced neuropathy. Hence, it can be used as a better treatment option in neuropathic pain (NP. The observed antinociceptive effects of EP may possibly be attributed to its antioxidant and anti-inflammatory activity.
Testing neoclassical and turbulent effects on poloidal rotation in the core of DIII-D
Energy Technology Data Exchange (ETDEWEB)
Chrystal, C. [University of California San Diego, 9500 Gilman Dr., La Jolla, California 92093-0417 (United States); Burrell, K. H.; Staebler, G. M.; Kinsey, J. E.; Lao, L. L.; Grassie, J. S. de [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Grierson, B. A.; Solomon, W. M.; Wang, W. X. [Princeton Plasma Physics Laboratory, P.O. Box 451, Princeton, New Jersey 08543-0451 (United States); Rhodes, T. L.; Schmitz, L. [University of California Los Angeles, P.O. Box 957099, Los Angeles, California 90095-7099 (United States); Mordijck, S. [College of William and Mary, P.O. Box 8795, Williamsburg, Virginia 23187-8795 (United States); Meneghini, O. [Oak Ridge Associated Universities, 1299 Bethel Valley Rd, Bldg SC-200, Oak Ridge, Tennessee 37830 (United States)
2014-07-15
Experimental tests of ion poloidal rotation theories have been performed on DIII-D using a novel impurity poloidal rotation diagnostic. These tests show significant disagreements with theoretical predictions in various conditions, including L-mode plasmas with internal transport barriers (ITB), H-mode plasmas, and QH-mode plasmas. The theories tested include standard neoclassical theory, turbulence driven Reynolds stress, and fast-ion friction on the thermal ions. Poloidal rotation is observed to spin up at the formation of an ITB and makes a significant contribution to the measurement of the E{sup →}×B{sup →} shear that forms the ITB. In ITB cases, neoclassical theory agrees quantitatively with the experimental measurements only in the steep gradient region. Significant quantitative disagreement with neoclassical predictions is seen in the cores of ITB, QH-, and H-mode plasmas, demonstrating that neoclassical theory is an incomplete description of poloidal rotation. The addition of turbulence driven Reynolds stress does not remedy this disagreement; linear stability calculations and Doppler backscattering measurements show that disagreement increases as turbulence levels decline. Furthermore, the effect of fast-ion friction, by itself, does not lead to improved agreement; in QH-mode plasmas, neoclassical predictions are closest to experimental results in plasmas with the largest fast ion friction. Predictions from a new model that combines all three effects show somewhat better agreement in the H-mode case, but discrepancies well outside the experimental error bars remain.
Testing neoclassical and turbulent effects on poloidal rotation in the core of DIII-D
International Nuclear Information System (INIS)
Chrystal, C.; Burrell, K. H.; Staebler, G. M.; Kinsey, J. E.; Lao, L. L.; Grassie, J. S. de; Grierson, B. A.; Solomon, W. M.; Wang, W. X.; Rhodes, T. L.; Schmitz, L.; Mordijck, S.; Meneghini, O.
2014-01-01
Experimental tests of ion poloidal rotation theories have been performed on DIII-D using a novel impurity poloidal rotation diagnostic. These tests show significant disagreements with theoretical predictions in various conditions, including L-mode plasmas with internal transport barriers (ITB), H-mode plasmas, and QH-mode plasmas. The theories tested include standard neoclassical theory, turbulence driven Reynolds stress, and fast-ion friction on the thermal ions. Poloidal rotation is observed to spin up at the formation of an ITB and makes a significant contribution to the measurement of the E → ×B → shear that forms the ITB. In ITB cases, neoclassical theory agrees quantitatively with the experimental measurements only in the steep gradient region. Significant quantitative disagreement with neoclassical predictions is seen in the cores of ITB, QH-, and H-mode plasmas, demonstrating that neoclassical theory is an incomplete description of poloidal rotation. The addition of turbulence driven Reynolds stress does not remedy this disagreement; linear stability calculations and Doppler backscattering measurements show that disagreement increases as turbulence levels decline. Furthermore, the effect of fast-ion friction, by itself, does not lead to improved agreement; in QH-mode plasmas, neoclassical predictions are closest to experimental results in plasmas with the largest fast ion friction. Predictions from a new model that combines all three effects show somewhat better agreement in the H-mode case, but discrepancies well outside the experimental error bars remain
Lifescience Database Archive (English)
Full Text Available AAAATTCAAGACAAAGAAGGTATT C sequence update 2001. 6. 1 Translated Amino Acid sequence ---xxxixkvxprxtxxixggxxxxxwxxxx*xqxxkxxxxpxgxxxx...nshw*nhytrs*r**qh*ecknknsrqrry Translated Amino Acid sequence (All Frames) Frame A: ---xxxixkvxprxtxxixggxxxxxwxxxx*xqxxkxxxxpxgxxxx...shw*nhytrs*r**qh*ecknknsrqrry Frame B: ---xxr*xrfxxxxxvsfxxgxx*xxgxxxxdxxxqkxxtxxxvxrxxggxqxfvxtlxg ktixxexe...tlrmlkpksktkkvfhqinnvsfspvnnwrmv vlsxdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqdkegi Frame C: ---xxdxxgxpxxnxxhfxxvxxxxmvxxxx...xxxxkkxxlxxwsxx*xvvxkxlxkh*xv rpsxlxlrxsxnienvktkdxxqrrypxrptkinfxw*tirxwxysx*lqhsk
Constrição campimétrica causada por vigabatrin Visual field constriction caused by vigabatrin
Directory of Open Access Journals (Sweden)
Mário Luiz Ribeiro Monteiro
2000-10-01
Full Text Available Objetivo: Descrever dois pacientes que apresentaram constrição campimétrica importante e determinar a origem desta alteração visual causada pelo uso de vigabatrin, um anticonvulsivante que atua aumentando a concentração do ácido gama-aminobutírico no sistema nervoso central. Métodos: Os pacientes foram submetidos a exame e neuroftalmológico completo, avaliação cuidadosa da retina, campo visual com perímetro de Goldmann, tomografia computadorizada de crânio e órbitas, eletrorretinograma (ERG, imagem por ressonância magnética (1 paciente e potencial visual evocado (1 paciente. Resultados: A acuidade visual se mostrou preservada; o primeiro paciente apresentava campo visual restrito à área central de 20 a 30 graus centrais e o segundo uma constrição leve a moderada. Os exames de neuroimagem foram normais assim como o potencial visual evocado. Observou-se palidez discreta de papila em 3 olhos estudados e estreitamento arteriolar muito discreto dos vasos retinianos. O ERG revelou alterações importantes caracterizada por redução da onda b (caso 1 e dos potenciais oscilatórios (caso 2. Conclusões: As alterações visuais causadas pelo vigabatrin são devidas a uma alteração retiniana, envolvendo provavelmente as células amácrimas, bipolares e ganglionares mas não se acompanham de uma alteração significativa à fundoscopia. Pacientes recebendo esta medicação devem ser seguidos de perto especialmente através da avaliação do campo visual central e periférico.Purpose: To describe two patients who presented with severe campimetric constriction and to determine the source of visual symptoms caused by vigabatrin, an anticonvulsant medication that increases brain gamma-aminobutyric acid. Methods: Patients were submitted to a complete neuroophthalmologic evaluation as well as a careful retina examination, Goldmann perimetry, computerized tomography of the brain and orbits, electroretinograms (ERG, magnetic ressonance
International Nuclear Information System (INIS)
Maduekwe, A.A.L.; Chendo, M.A.C.
1994-06-01
Correlations for the city of Lagos (latitude 6.58 deg. N, longitude 3.33 deg. E) have been found between the records of bright sunshine hours and the daily and monthly components of the total hemispherical solar radiation. Four new models have been developed which include H/H 0 as a predictor in the Angstrom type models for the diffuse and beam fractions. They contain the quadratic term of the sunshine index, (n/N) and are given as follows: Q/H 0 =a+b(H/H 0 )+c(n/N)+d(n/N) 2 Q/H 0 =a+b(H/H 0 )+d(n/N) 2 ; Q/H 0 =a+b(H/H 0 )+c(n/N)+d(n/N) 2 ; Q/H 0 =a+b(H/H 0 )+d(n/N) 2 ; where Q is the diffuse or beam radiation on a horizontal plane. The statistical test carried out showed that the new equations generally improved the prediction of the beam or diffuse components from the Angstrom type equations by over 25%. (author). 21 refs, 3 tabs
CT screening of vertebrarterial circulatory disorder
Energy Technology Data Exchange (ETDEWEB)
Yoshida, Shigeru; Toyoda, Keiko; Moriyama, Hiroshi [Jikei Univ., Tokyo (Japan). School of Medicine
2001-09-01
The frequency of MR angiography (MRA) used to diagnose vertebrobasiliar insufficiency appears high. Findings of abnormality by MRA show cases with maldescription of hemivertebral artery. In such cases, it is unclear whether these are due to anaplasia of the vertebral artery or to the existence of morbid constriction, thus requiring confirmation by a vertebral arteriography (VAG). We observe the vascular morphology of vertebral artery by Computed tomography (CT) scanning for screening circulatory disorders. In photography and CT scan reading, the region was severally photographed between foramen magnum and aortic arch by plain CT and contrast CT at a slice of 5 mm. The constrictive region of the vertebral artery was estimated by comparing plain and contrast CT. Subjects were 34 clinical cases of vascular maldescription in the vertebrobasilar artery, nearly no blood vessel description, or blood vessel winding or inclination. We determined the constrictive morbid state of the vertebral or subclavian artery and cervical vertebra deformity. In findings of maldescription by MRA, it was suggested that discrimination is feasible to a certain degree, whether the vertebral artery has a morbid constrictive region or due to anaplasia. Our results suggest that screening by CT scanning may be more efficient than that by MRA. (author)
CT screening of vertebrarterial circulatory disorder
International Nuclear Information System (INIS)
Yoshida, Shigeru; Toyoda, Keiko; Moriyama, Hiroshi
2001-01-01
The frequency of MR angiography (MRA) used to diagnose vertebrobasiliar insufficiency appears high. Findings of abnormality by MRA show cases with maldescription of hemivertebral artery. In such cases, it is unclear whether these are due to anaplasia of the vertebral artery or to the existence of morbid constriction, thus requiring confirmation by a vertebral arteriography (VAG). We observe the vascular morphology of vertebral artery by Computed tomography (CT) scanning for screening circulatory disorders. In photography and CT scan reading, the region was severally photographed between foramen magnum and aortic arch by plain CT and contrast CT at a slice of 5 mm. The constrictive region of the vertebral artery was estimated by comparing plain and contrast CT. Subjects were 34 clinical cases of vascular maldescription in the vertebrobasilar artery, nearly no blood vessel description, or blood vessel winding or inclination. We determined the constrictive morbid state of the vertebral or subclavian artery and cervical vertebra deformity. In findings of maldescription by MRA, it was suggested that discrimination is feasible to a certain degree, whether the vertebral artery has a morbid constrictive region or due to anaplasia. Our results suggest that screening by CT scanning may be more efficient than that by MRA. (author)
International Nuclear Information System (INIS)
Steinberg, Bruce; Riel, Ryan; Armitage, Marshal; Berrey, Hudson
2011-01-01
The purpose of this project was to study the efficacy of quantitative muscle hardness (QH) curve analysis for noninvasive measurement of muscle compartment interstitial pressure (IMP), and to eliminate the need for a comparison normal QH measurement to determine a pathologic reading. Elevation of IMP may lead to limb compartment syndrome, which may result in irreversible dysfunction, chronic pain and contracture. Two studies were performed by two separate independent examiners on male volunteers, where IMP measurements and QH curves were obtained. QH curves were divided into three parts comparing the third part to the second part using the coefficient of determination (R 2 ). In 205 limb compartments, there were 1432 comparison readings of the IMP versus R 2 . Using receiver operator characteristic curve analysis for all data from both studies, an R 2 cutoff of 0.974 best corresponded to a pathologic IMP of 50 mmHg. For both sets of data and for each compartment tested, the mean IMP values were statistically different (t-test: P < 0.0001) for the group with R 2 values less than 0.974 compared to the group of R 2 values greater than or equal to 0.974. In addition, a pressure prediction model was formulated with a strong overall correlation coefficient of 0.78. The data of this study support that QH analysis is potentially useful for the monitoring of IMP elevation in compartment syndrome
Pain increases during sympathetic arousal in patients with complex regional pain syndrome.
Drummond, P D; Finch, P M; Skipworth, S; Blockey, P
2001-10-09
To investigate the effect of sympathetic arousal on pain and vasomotor responses in healthy control subjects and patients with complex regional pain syndrome (CRPS), and to determine whether pain increases in patients with particular symptoms. In experiments 1 and 2, capsaicin was applied to the forearm of 24 healthy subjects to induce thermal hyperalgesia. Vascular responses were monitored and subjects rated thermal hyperalgesia before and after being startled (experiment 1), and before, during, and after mental arithmetic, breath holding, forehead cooling, the Valsalva maneuver, and a cold pressor test in experiment 2. In a third experiment, sensitivity to heat, cold, and mechanical stimulation was investigated in 61 patients with CRPS. Pain ratings and vascular and electrodermal responses were recorded after patients were startled and during forehead cooling. In experiment 1, thermal hyperalgesia decreased in healthy control subjects after they were startled, and digital blood vessels constricted symmetrically. In experiment 2, thermal hyperalgesia decreased during and after other forms of sympathetic arousal. However, in experiment 3, ratings of clinical pain increased during forehead cooling or after being startled in over 70% of patients with CRPS. Pain increased most consistently during forehead cooling in patients with cold allodynia or punctate allodynia. Digital blood vessels constricted more intensely on the symptomatic than the nonsymptomatic side in patients with CRPS during sympathetic arousal. Normal inhibitory influences on pain during sympathetic arousal are compromised in the majority of patients with CRPS. The augmented vasoconstrictor response in the symptomatic limb during sympathetic arousal is consistent with adrenergic supersensitivity. An adrenergic sensitivity in nociceptive afferents might contribute to pain and hyperalgesia during sympathetic arousal in certain patients with CRPS.
International Nuclear Information System (INIS)
Poulsen, M.; Ramsay, R.; Gogna, K.; Middleton, M.; Martin, J.; Khoo, E.; Wong, W.; McQuitty, S.; Walpole, E.; Fairweather, R.
2010-01-01
The aim was to compare a private Commonwealth-initiated regional radiation oncology facility in Toowoomba with a Queensland Health facility (QHF) in Brisbane. The comparison concentrated on staffing, case mix and operational budgets, but was not able to look at changes in access to services. Data were collected from the two facilities from January 2008 to June 2008 inclusive. A number of factors were compared, including case mix, staffing levels, delay times for treatment, research, training and treatment costs. The case mix between the two areas was similar with curative treatments making up just over half the work load in both centres and two-thirds the work being made up of cancers of breast and prostate. Staffing levels were leaner in Toowoomba, especially in the areas of nursing, administration and trial coordinators. Research activity was slightly higher in Toowoomba. The average medicare cost per treatment course was similar in both centres ($5000 per course). Total costs of an average treatment including patient, State and Commonwealth costs, showed a 30% difference in costing favouring Toowoomba. This regional radiation oncology centre has provided state-of-the-art cancer care that is close to home for patients living in the Darling Downs region. Both public and private patients have been treated with modest costs to the patient and significant savings to QH. The case mix is similar to the QHF, and there has been significant activity in clinical research. A paperless working environment is one factor that has allowed staffing levels to be reduced. Ongoing support from Governments are required if private facilities are to participate in important ongoing staff training.
Directory of Open Access Journals (Sweden)
Duo-Yi Li
2015-01-01
Full Text Available Background: Pulsed radiofrequency (PRF application to the dorsal root ganglia can reduce neuropathic pain (NP in animal models, but the effect of PRF on damaged peripheral nerves has not been examined. We investigated the effect of PRF to the rat sciatic nerve (SN on pain-related behavior and SN ultrastructure following chronic constriction injury (CCI. Methods: The analgesic effect was measured by hindpaw mechanical withdrawal threshold (MWT and thermal withdrawal latency (TWL. Twenty rats with NP induced by ligating the common SN were then randomly divided into a PRF treatment group and a sham group. The contralateral SN served as a control. The MWT and TWL were determined again 2, 4, 6, 8, 10, 12, and 14 days after the PRF or sham treatment. On day 14, ipsilateral and contralateral common SNs were excised and examined by electron microscopy. Results: Ipsilateral MWT was significantly reduced and TWL significantly shorter compared to the contralateral side 14 days after CCI (both P = 0.000. In the PRF group, MWT was significantly higher and TWL significantly longer 14 days after the PRF treatment compared to before PRF treatment (both P = 0.000, while no such difference was observed in the sham group (P > 0.05. Electron microscopy revealed extensive demyelination and collagen fiber formation in the ipsilateral SN of sham-treated rats but sparse demyelination and some nerve fiber regrowth in the PRF treatment group. Conclusions: Hyperalgesia is relieved, and ultrastructural damage ameliorated after direct PRF treatment to the SN in the CCI rat model of NP.
Tian, Jie; Gu, Yiwen; Su, Diansan; Wu, Yichao; Wang, Xiangrui
2009-02-01
The present study investigated the effects of different doses of intrathecal lidocaine on established thermal hyperalgesia and tactile allodynia in the chronic constriction injury model of neuropathic pain, defined the effective drug dose range, the duration of pain-relief effects, and the influence of this treatment on the body and tissues. Male Sprague-Dawley rats were divided into five groups and received intrathecal saline or lidocaine (2, 6.5, 15, and 35 mg/kg) 7 days after loose sciatic ligation. Respiratory depression and hemodynamic instability were found to become more severe as doses of lidocaine increased during intrathecal therapy. Two animals in the group receiving 35 mg/kg lidocaine developed pulmonary oedema and died. Behavioral tests indicated that 6.5, 15, and 35 mg/kg intrathecal lidocaine showed different degrees of reversal of thermal hyperalgesia, and lasted for 2-8 days, while 2 mg/kg lidocaine did not. The inhibition of tactile allodynia was only observed in rats receiving 15 and 35 mg/kg lidocaine, and the anti-allodynic effects were identical in these two groups. Histopathologic examinations on the spinal cords revealed mild changes in rats receiving 2-15 mg/kg lidocaine. However, lesions were severe after administration of 35 mg/kg lidocaine. These findings indicate that intrathecal lidocaine has prolonged therapeutic effects on established neuropathic pain. The balance between sympathetic and parasympathetic nervous activities could be well preserved in most cases, except for 35 mg/kg. Considering the ratio between useful effects and side effects, doses of 15 mg/kg are suitable for intrathecal injection for relief of neuropathic pain.
Li, Duo-Yi; Meng, Lan; Ji, Nan; Luo, Fang
2015-01-01
Background: Pulsed radiofrequency (PRF) application to the dorsal root ganglia can reduce neuropathic pain (NP) in animal models, but the effect of PRF on damaged peripheral nerves has not been examined. We investigated the effect of PRF to the rat sciatic nerve (SN) on pain-related behavior and SN ultrastructure following chronic constriction injury (CCI). Methods: The analgesic effect was measured by hindpaw mechanical withdrawal threshold (MWT) and thermal withdrawal latency (TWL). Twenty rats with NP induced by ligating the common SN were then randomly divided into a PRF treatment group and a sham group. The contralateral SN served as a control. The MWT and TWL were determined again 2, 4, 6, 8, 10, 12, and 14 days after the PRF or sham treatment. On day 14, ipsilateral and contralateral common SNs were excised and examined by electron microscopy. Results: Ipsilateral MWT was significantly reduced and TWL significantly shorter compared to the contralateral side 14 days after CCI (both P = 0.000). In the PRF group, MWT was significantly higher and TWL significantly longer 14 days after the PRF treatment compared to before PRF treatment (both P = 0.000), while no such difference was observed in the sham group (P > 0.05). Electron microscopy revealed extensive demyelination and collagen fiber formation in the ipsilateral SN of sham-treated rats but sparse demyelination and some nerve fiber regrowth in the PRF treatment group. Conclusions: Hyperalgesia is relieved, and ultrastructural damage ameliorated after direct PRF treatment to the SN in the CCI rat model of NP. PMID:25673460
PERICARDITIS CONSTRICTIVA EN UNA MUJER DE 36 AÑOS / Constrictive Pericarditis in a 36 year-old woman
Directory of Open Access Journals (Sweden)
Tessa Negrín Valdés
2012-07-01
Full Text Available ResumenPaciente femenina, de 36 años de edad, con antecedentes de dos gestaciones, dos partos y ningún aborto, que en el año 2003 tras su segundo parto, distócico por cesárea, desarrolla una pericarditis de causa no precisada que produjo un derrame pericárdico grave con signos de taponamiento cardíaco, y requirió ingreso hospitalario y pericardiocentesis. Siete años después se identifican, en la consulta de Cardiología, síntomas clínicos de una pericarditis constrictiva, corroborada por ecocardiograma y cateterismo derecho; actualmente ingresa para pericardiectomía, evaluada como alto riesgo quirúrgico. / Abstract36 year-old female patient, with a history of two pregnancies, two births and no abortion, who in 2003 after her second delivery (cesarean for dystocia she developed pericarditis of undetermined cause that produced a severe pericardial effusion with signs of cardiac tamponade and required hospital admission and pericardiocentesis. Seven years later, in the Cardiology service, clinical symptoms of constrictive pericarditis are identified and confirmed by echocardiography and right heart catheterization. This patient has been recently admitted for pericardiectomy, and evaluated as high surgical risk.
Directory of Open Access Journals (Sweden)
Yoko Yamazaki
2012-01-01
Full Text Available This study aimed to examine the effect of AC iontophoresis on rats with the chronic constriction injury (CCI to the infraorbital nerve by animal experiments. CCI model rats were divided into four groups, namely, rats that received general anesthesia for 60 min except AC IOP (CCI: n=5, AC IOP with 0.9% physiological saline for 60 min (CCI + saline AC IOP: n=5, AC IOP with 4% lidocaine hydrochloride for 60 min (CCI + lidocaine AC IOP: n=5, and attachment of two electrodes soaked with 4% lidocaine hydrochloride to the facial skin for 60 min (CCI + attach lidocaine: n=5. In the CCI + lidocaine AC IOP group, an elevated withdrawal threshold was observed after AC IOP, and the duration of efficacy was longer compared with that in the CCI + saline AC IOP and CCI + attached lidocaine groups. A significant decrease in the number of Fos-like immunoreactive (LI cells was observed in the CCI + lidocaine AC IOP group compared with that in the CCI group. These findings suggest that the effect of CCI + lidocaine AC IOP group may be caused by active permeation of lidocaine into the facial skin and electrical stimulation of the trigeminal nucleus.
Directory of Open Access Journals (Sweden)
VENKATA R.K. THIAGARAJAN
2014-09-01
Full Text Available The aim of the present study is to investigate the ameliorative potential of ethanolic extract of whole plant of Vernonia cinerea in the chronic constriction injury (CCI of sciatic nerve induced neuropathic pain in rats. Behavioral parameters such as a hot plate, acetone drop, paw pressure, Von Frey hair and tail immersion tests were performed to assess the degree of thermal, chemical and mechanical hyperalgesia and allodynia. Biochemical changes in sciatic nerve tissue were ruled out by estimating thiobarbituric acid reactive substances (TBARS, reduced glutathione (GSH and total calcium levels. Ethanolic extract of Vernonia cinerea and pregabalin were administered for 14 consecutive days starting from the day of surgery. CCI of sciatic nerve has been shown to induce significant changes in behavioral, biochemical and histopathological assessments when compared to the sham control group. Vernonia cinerea attenuated in a dose dependent manner the above pathological changes induced by CCI of the sciatic nerve, which is similar to attenuation of the pregabalin pretreated group. The ameliorating effect of ethanolic extract of Vernonia cinerea against CCI of sciatic nerve induced neuropathic pain may be due to the presence of flavonoids and this effect is attributed to anti-oxidative, neuroprotective and calcium channel modulator actions of these compounds.
Directory of Open Access Journals (Sweden)
Sundaravadivel Balasubramanian
Full Text Available Reactive cardiac fibrosis resulting from chronic pressure overload (PO compromises ventricular function and contributes to congestive heart failure. We explored whether nonreceptor tyrosine kinases (NTKs play a key role in fibrosis by activating cardiac fibroblasts (CFb, and could potentially serve as a target to reduce PO-induced cardiac fibrosis. Our studies were carried out in PO mouse myocardium induced by transverse aortic constriction (TAC. Administration of a tyrosine kinase inhibitor, dasatinib, via an intraperitoneally implanted mini-osmotic pump at 0.44 mg/kg/day reduced PO-induced accumulation of extracellular matrix (ECM proteins and improved left ventricular geometry and function. Furthermore, dasatinib treatment inhibited NTK activation (primarily Pyk2 and Fak and reduced the level of FSP1 positive cells in the PO myocardium. In vitro studies using cultured mouse CFb showed that dasatinib treatment at 50 nM reduced: (i extracellular accumulation of both collagen and fibronectin, (ii both basal and PDGF-stimulated activation of Pyk2, (iii nuclear accumulation of Ki67, SKP2 and histone-H2B and (iv PDGF-stimulated CFb proliferation and migration. However, dasatinib did not affect cardiomyocyte morphologies in either the ventricular tissue after in vivo administration or in isolated cells after in vitro treatment. Mass spectrometric quantification of dasatinib in cultured cells indicated that the uptake of dasatinib by CFb was greater that that taken up by cardiomyocytes. Dasatinib treatment primarily suppressed PDGF but not insulin-stimulated signaling (Erk versus Akt activation in both CFb and cardiomyocytes. These data indicate that dasatinib treatment at lower doses than that used in chemotherapy has the capacity to reduce hypertrophy-associated fibrosis and improve ventricular function.
International Nuclear Information System (INIS)
Horimoto, Masashi; Funayama, Naoki; Takenaka, Takashi; Igarashi, Takeki; Sekiguchi, Morie.
1985-01-01
A 25-year-old female was admitted with shortness of breath and abdominal swelling. Six years before the admission, she had received resection of 7th to 9th left ribs and subsequent radiation of 5,000 rads to the thorax for the treatment of rib osteoblastoma. One year after the radiation, marked pericardial effusion associated with acute pericarditis was observed and was improved by digitalization and diuretic therapy. Since two years after the radiation, she had felt easy fatigability, swelling of face and foot, and transient faintness on more than 10 meters running. On admission, chest X-ray photograph showed increased pulmonary vascularity without cardiac enlargement. Electrocardiogram indicated systolic right ventricular strain, mitral P, and nonspecific S-T segment depression in left precordial leads. Two-dimensional echocardiography presented pericardial effusion with posterior pericardial thickening, while M-mode echocardiography showed diastolic posterior movement of interventricular septum and diastolic flattening of left ventricular posterior wall. Cardiac catheterization revealed marked elevation of mean right atrial pressure, pulmonary arterial diastolic pressure, right and left ventricular end-diastolic pressure, accompanied with their equalization. In addition, pressure waves of right and left ventricle showed diastolic dip and plateau. Phono-cardiogram and apexcardiogram presented pericardial knock sound and systolic retraction, respectively. Cardiac angiography showed diastolic restriction of left ventricle without any stenosis of coronary artery. Computed tomography (CT) of the chest revealed thickening of anterior and left lateral pericardium with expansion of inferior vena cava, and abdominal CT revealed ascites with slight enlargements of liver and spleen. From above obtained data, chronic effusive-constrictive pericarditis, which was attributed to radiation, was strongly suggested. (J.P.N.)
International Nuclear Information System (INIS)
Sabyasachi, Sk.; Patra, M.; Majumdar, S.; Giri, S.
2013-01-01
We investigate magnetic properties of nanocrystalline ferrites with composition La 1/3 Sr 2/3 Fe 1−x Cr x O 3 (LSFCO) for x=0, 0.02, 0.04 and 0.06. Thermal variation of zero field cooled magnetization displays a weak signature close to the charge (T CO ) as well as antiferromagnetic ordering for x=0, 0.02 and 0.04. In addition, another disordered glassy magnetic transition (T g ) is noticed for all the compositions. T g is predominantly observed, although signature of charge ordering almost disappears for x=0.06. Interestingly, a constricted double loop type magnetic hysteresis loop is observed for x=0.02. This structure in the hysteresis loop disappears with further increase in Cr substitution. A systematic shift in the magnetic hysteresis loop is observed for all the compositions, while samples are cooled in a static magnetic field, which is the manifestation of exchange bias (EB) effect. The EB field (H E ) and magnetization (M E ) decrease remarkably due to minor Cr substitution at x=0.02 and then it reveals a sluggish increase with increasing x. For x=0.04 the EB effect emerges below ∼T CO , increases sluggishly with lowering of temperature and below ∼T g , it increases rapidly. The cooling field dependence exhibits significant increase of H E and M E for x=0.04, which is associated with the considerable increase of coercivity. Possible origin of EB correlated with the magnetic phase coexistence has been argued for nanocrystalline LSFCO. - Highlights: • Constricted double loop structure is observed for minor Cr substitution. • Exchange bias decreases significantly due to Cr substitution. • Intricate magnetic phase coexistence leads to the exchange bias effect
Disorders in melanopsin effect of pupil constriction as a risk factor causing eye diseases
Directory of Open Access Journals (Sweden)
V.A. Kaptsov
2017-03-01
Full Text Available Risks of eye damage and eyesight deterioration to a great extent depend on how efficient a biomechanical eye system is under energy-saving lighting conditions. The system's efficiency is determined by its adequacy in managing pupils and ciliary muscle. We analyzed mathematical models describing changes in pupil's diameter which were determined by light-technical parameters of illumination environment (luminance level and brightness. We highlighted the importance of ganglionic cells and the role they play in managing pupil's diameter (miosis when they are exposed to blue light within 480 nm spectrum. Basing on the assessment of a pupil's constriction under exposure to various light stimuli (blue, red, and green ones we worked out a melanopsin effect concept of a pupil's retention at miosis and showed that it could be a diagnostic sign of some diseases (age-related direct retinopathy, pancreatic diabetes under exposure to a blue light impulse with a certain wave length. Under exposure to blue light within 480 nm spectrum ganglionic cells form a managing signal for a sphincter muscle of a pupil and ciliary muscle which provides accommodation (as per Helmholtz and regulates aqueous humor flow in ciliary channel. All modern energy-saving light sources have a low energy level at wave length equal to 480 nm due to gap in their spectrum in comparison with sunlight spectrum with the same light temperature and luminance level. Inadequate management of pupil's diameter under artificial lighting conditions leads to melanopsin effect disorders and causes disharmony in managing aqueous humor outflow. All the above-stated factors under long-term visual load cause eye diseases risks in modern illumination environment. We detected that contemporary mathematic models describing pupil's diameter fluctuations needed to be refined allowing for new knowledge on functional peculiarities of retina cells and energy-saving light sources spectrum.
Eddies in a bottleneck: an arbitrary Debye length theory for capillary electroosmosis.
Park, Stella Y; Russo, Christopher J; Branton, Daniel; Stone, Howard A
2006-05-15
Using an applied electrical field to drive fluid flows becomes desirable as channels become smaller. Although most discussions of electroosmosis treat the case of thin Debye layers, here electroosmotic flow (EOF) through a constricted cylinder is presented for arbitrary Debye lengths (kappa(-1)) using a long wavelength perturbation of the cylinder radius. The analysis uses the approximation of small potentials. The varying diameter of the cylinder produces radially and axially varying effective electric fields, as well as an induced pressure gradient. We predict the existence of eddies for certain constricted geometries and propose the possibility of electrokinetic trapping in these regions. We also present a leading-order criterion which predicts central eddies in very narrow constrictions at the scale of the Debye length. Eddies can be found both in the center of the channel and along the perimeter, and the presence of the eddies is a consequence of the induced pressure gradient that accompanies electrically driven flow into a narrow constriction.
Quiescent H-mode operation using torque from non-axisymmetric, non-resonant magnetic fields
International Nuclear Information System (INIS)
Burrell, K.H.; Garofalo, A.M.; Osborne, T.H.; Snyder, P.B.; Solomon, W.M.; Park, J.-K.; Fenstermacher, M.E.; Orlov, D.M.
2013-01-01
Quiescent H-mode (QH-mode) sustained by magnetic torque from non-axisymmetric magnetic fields is a promising operating mode for future burning plasmas including ITER. Using magnetic torque from n = 3 fields to replace counter-I p torque from neutral beam injection, we have achieved long duration, counter-rotating QH-mode operation with neutral beam injection (NBI) torque ranging continuously from counter-I p up to co-I p values of about 1 N m. This co-I p torque is about 3 times the scaled torque that ITER will have. This range also includes operation at zero net NBI torque, applicable to rf wave heated plasmas. These n = 3 fields have been created using coils either inside or, most recently, outside the toroidal coils. Experiments utilized an ITER-relevant lower single-null plasma shape and were done with ITER-relevant values ν ped * ∼0.08, β T ped ∼ 1%$ and β N = 2. Discharges have confinement quality H 98y2 = 1.3, exceeding the value required for ITER. Initial work with low q 95 = 3.4 QH-mode plasmas transiently reached fusion gain values of G = β N H 89 /q 95 2 =0.4, which is the desired value for ITER; the limits on G have not yet been established. This paper also includes the most recent results on QH-mode plasmas run without n = 3 fields and with co-I p NBI; these shots exhibit co-I p plasma rotation and require NBI torque ⩾2 N m. The QH-mode work to date has made significant contact with theory. The importance of edge rotational shear is consistent with peeling–ballooning mode theory. We have seen qualitative and quantitative agreement with the predicted torque from neoclassical toroidal viscosity. (paper)
AAV-mediated knock-down of HRC exacerbates transverse aorta constriction-induced heart failure.
Directory of Open Access Journals (Sweden)
Chang Sik Park
Full Text Available Histidine-rich calcium binding protein (HRC is located in the lumen of sarcoplasmic reticulum (SR that binds to both triadin (TRN and SERCA affecting Ca(2+ cycling in the SR. Chronic overexpression of HRC that may disrupt intracellular Ca(2+ homeostasis is implicated in pathogenesis of cardiac hypertrophy. Ablation of HRC showed relatively normal phenotypes under basal condition, but exhibited a significantly increased susceptibility to isoproterenol-induced cardiac hypertrophy. In the present study, we characterized the functions of HRC related to Ca(2+ cycling and pathogenesis of cardiac hypertrophy using the in vitro siRNA- and the in vivo adeno-associated virus (AAV-mediated HRC knock-down (KD systems, respectively.AAV-mediated HRC-KD system was used with or without C57BL/6 mouse model of transverse aortic constriction-induced failing heart (TAC-FH to examine whether HRC-KD could enhance cardiac function in failing heart (FH. Initially we expected that HRC-KD could elicit cardiac functional recovery in failing heart (FH, since predesigned siRNA-mediated HRC-KD enhanced Ca(2+ cycling and increased activities of RyR2 and SERCA2 without change in SR Ca(2+ load in neonatal rat ventricular cells (NRVCs and HL-1 cells. However, AAV9-mediated HRC-KD in TAC-FH was associated with decreased fractional shortening and increased cardiac fibrosis compared with control. We found that phospho-RyR2, phospho-CaMKII, phospho-p38 MAPK, and phospho-PLB were significantly upregulated by HRC-KD in TAC-FH. A significantly increased level of cleaved caspase-3, a cardiac cell death marker was also found, consistent with the result of TUNEL assay.Increased Ca(2+ leak and cytosolic Ca(2+ concentration due to a partial KD of HRC could enhance activity of CaMKII and phosphorylation of p38 MAPK, causing the mitochondrial death pathway observed in TAC-FH. Our results present evidence that down-regulation of HRC could deteriorate cardiac function in TAC-FH through
International Nuclear Information System (INIS)
West, W.P.; Burrell, K.H.; Snyder, P.B.; Gohil, P.; Lao, L.L.; Leonard, A.W.; Osborne, T.H.; Thomas, D.M.; Casper, T.A.; Lasnier, C.J.; Doyle, E.J.; Wang, G.; Zeng, L.; Nave, M.F.F.
2005-01-01
The quiescent H (QH) mode, an edge localized mode (ELM)-free, high-confinement mode, combines well with an internal transport barrier to form quiescent double barrier (QDB) stationary state, high performance plasmas. The QH-mode edge pedestal pressure is similar to that seen in ELMing phases of the same discharge, with similar global energy confinement. The pedestal density in early ELMing phases of strongly pumped counter injection discharges drops and a transition to QH-mode occurs, leading to lower calculated edge bootstrap current. Plasmas current ramp experiment and ELITE code modeling of edge stability suggest that QHmodes lie near an edge current stabilty boundary. At high triangularity, QH-mode discharges operate at higher pedestal density and pressure, and have achieved ITER level values of β PED and ν*. The QDB achieves performance of β N H 89 ∼ 7 in quasi-stationary conditions for a duration of 10 τ E , limited by hardware. Recently we demonstrated stationary state QDB discharges with little change in kinetic and q profiles (q 0 > 1) for 2 s, comparable to ELMing 'hybrid scenarios', yet without the debilitating effects of ELMs. Plasma profile control tools, including electron cyclotron heating and current drive and neutral beam heating, have been demonstrated to control simultaneously the q profile development, the density peaking, impurity accumulation and plasma beta. (author)
Tsamopoulos, John; Fraggedakis, Dimitris; Dimakopoulos, Yiannis
2015-11-01
We study the flow of two immiscible, Newtonian fluids in a periodically constricted tube driven by a constant pressure gradient. Our Volume-of-Fluid algorithm is used to solve the governing equations. First the code is validated by comparing its predictions to previously reported results for stratified and pulsing flow. Then it is used to capture accurately all the significant topological changes that take place. Initially, the fluids have a core-annular arrangement, which is found to either remain the same or change to a different arrangement depending on the fluid properties, the pressure driving the flow or the flow geometry. The flow-patterns that appear are the core-annular, segmented, churn, spray and segregated flow. The predicted scalings near pinching of the core fluid concur with similarity predictions and earlier numerical results (Cohen et al. (1999)). Flow-pattern maps are constructed in terms of the Reynolds and Weber numbers. Our results provide deeper insights in the mechanism of the pattern transitions and are in agreement with previous studies on core-annular flow (Kouris & Tsamopoulos (2001 & 2002)), segmented flow (Lac & Sherwood (2009)) and churn flow (Bai et al. (1992)). GSRT of Greece through the program ``Excellence'' (Grant No. 1918, entitled ``FilCoMicrA'').
Mehta, Ashish K; Bhati, Yogendra; Tripathi, Chakra D; Sharma, Krishna K
2014-08-01
Despite immense advances in the treatment strategies, management of neuropathic pain remains unsatisfactory. Piracetam is a prototype of nootropic drugs, used to improve cognitive impairment. The present study was designed to investigate the effect of piracetam on peripheral neuropathic pain in rats. Neuropathic pain was induced by the chronic constriction injury of the sciatic nerve. Following this, piracetam was intraperitoneally administered for 2 weeks in doses of 50, 100 and 200 mg/kg, and pain was assessed by employing the behavioural tests for thermal hyperalgesia (hot plate and tail flick tests) and cold allodynia (acetone test). After the induction of neuropathic pain, significant development of thermal hyperalgesia and cold allodynia was observed. The administration of piracetam (50 mg/kg) did not have any significant effect on all the behavioural tests. Further, piracetam (100 mg/kg) also had no effect on the hot plate and tail flick tests; however it significantly decreased the paw withdrawal duration in the acetone test. Piracetam in a dose of 200 mg/kg significantly modulated neuropathic pain as observed from the increased hot plate and tail flick latencies, and decreased paw withdrawal duration (in acetone test). Therefore, the present study suggests the potential use of piracetam in the treatment of neuropathic pain, which merits further clinical investigation.
Corona-Ramos, Janette Nallely; De la O-Arciniega, Minarda; Déciga-Campos, Myrna; Medina-López, José Raúl; Domínguez-Ramírez, Adriana Miriam; Jaramillo-Morales, Osmar Antonio; Espinosa-Juárez, Josué Vidal; López-Muñoz, Francisco Javier
2016-08-01
Preclinical Research The current work evaluates the interaction between two commonly used drugs, tramadol (Tra) and gabapentin (Gbp). Dose-response curves (DRC) and isobolographic analysis were used to confirm their synergistic antihyperalgesic and anti-allodynic responses in a rat neuropathic pain model involving chronic constriction injury of the sciatic nerve and in von Frey and acetone tests. Tra and Gbp produced dose-dependent antihyperalgesic and anti-allodynic effects. Dose-response studies of combinations of Tra and Gbp in combination showed the DRC was leftward-shifted compared to the DRCs for each compound alone. One combination demonstrated both antihyperalgesic and anti-allodynic effects greater than those observed after individual administration. The remaining combinations demonstrated an additive effect. The Tra+Gbp combination demonstrated a potentiative effect with smaller doses of Tra. Additionally, it was determined lethal dose 50 (LD50 ) of Tra alone and tramadol + Gbp 10 using mice to 48 h post administration. The DRC (death) were similar for Tra alone and in Tra in combination, despite the improved effectiveness of Tra in the presence of GBP, 10 mg/kg. A combination of these drugs could be effective in neuropathic pain therapy because they can produce potentiative (at a low dose) or additive effects. Drug Dev Res 77 : 217-226, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Rodríguez, Ana Eugenia; Hernández, Jose Ángel; Benito, Rocío; Gutiérrez, Norma C.; García, Juan Luis; Hernández-Sánchez, María; Risueño, Alberto; Sarasquete, M. Eugenia; Fermiñán, Encarna; Fisac, Rosa; de Coca, Alfonso García; Martín-Núñez, Guillermo; de las Heras, Natalia; Recio, Isabel; Gutiérrez, Oliver; De Las Rivas, Javier; González, Marcos; Hernández-Rivas, Jesús M.
2012-01-01
Background Patients with chronic lymphocytic leukemia and 13q deletion as their only FISH abnormality could have a different outcome depending on the number of cells displaying this aberration. Thus, cases with a high number of 13q- cells (13q-H) had both shorter overall survival and time to first therapy. The goal of the study was to analyze the genetic profile of 13q-H patients. Design and Methods: A total of 102 samples were studied, 32 of which served as a validation cohort and five were healthy donors. Results Chronic lymphocytic leukemia patients with higher percentages of 13q- cells (>80%) showed a different level of gene expression as compared to patients with lower percentages (<80%, 13q-L). This deregulation affected genes involved in apoptosis and proliferation (BCR and NFkB signaling), leading to increased proliferation and decreased apoptosis in 13q-H patients. Deregulation of several microRNAs, such as miR-15a, miR-155, miR-29a and miR-223, was also observed in these patients. In addition, our study also suggests that the gene expression pattern of 13q-H cases could be similar to the patients with 11q- or 17p-. Conclusions This study provides new evidence regarding the heterogeneity of 13q deletion in chronic lymphocytic leukemia patients, showing that apoptosis, proliferation as well as miRNA regulation are involved in cases with higher percentages of 13q- cells. PMID:23152777
MD#1826: Measurement of Quench Heater vertical kick
Valette, Matthieu; Wollmann, Daniel; Lindstrom, Bjorn Hans Filip; Bortot, Lorenzo; Fernandez Navarro, Alejandro; Schmidt, Rudiger; Verweij, Arjan
2018-01-01
Following the observation of vertical orbit oscillations of the LHC beam between the detection of a (beam induced) quench of an LHC main dipole and the beam dump, a study was started to verify that the orbit distortions are caused by the firing of the quench heaters (QH). Simulation of the magnetic field generated by the discharge of the QH and its effect on the beam confirmed it was the most likely cause. A dedicated experiment with 450 GeV proton beams was performed to validate the simulati...
Forgiveness in the intertestamental period
Directory of Open Access Journals (Sweden)
Sang-Mong Lee
2012-02-01
Full Text Available The article suggests answers to the following questions: what are the characteristics of God�s forgiveness in the intertestamental literature and what connection do these characteristics have with the Old Testament? Important passages in the late Second Temple period that expose the characteristics of God�s forgiveness, such as certain Qumran texts (1QH 12:35�37, 1QH 13:2 and the Damascus Document 14:18�19, the writings of Philo and Josephus, the Apocrypha and the Pseudepigrapha, are investigated for this purpose.
International Nuclear Information System (INIS)
Erden, Ayse; Yurdakul, Mehmet; Cumhur, Turhan
1999-01-01
Symptoms of chronic mesenteric ischemia develop when the celiac artery is constricted by the median arcuate ligament of the diaphragm. Lateral aortography is the primary modality for diagnosing ligamentous compression of the celiac artery. However, duplex Doppler sonography performed during deep expiration can cause a marked increase in flow velocities at the compressed region of the celiac artery and suggest the diagnosis of celiac arterial constriction due to the diaphragmatic ligament. RID='''' ID='''' Correspondence to: A. Erden, M.D., Hafta sokak. 23/6, Gaziosmanpasa, 06700 Ankara, Turkey
Block, D.
2013-12-01
Lateral migration of river meander systems is complex, particularly in drylands where fluvial processes are discontinuous. Analysis of aerial photography and GPS tracking of cutbank erosion can further empirical knowledge of meander development. Moreover, discharge records link landscape response to hydroclimatic variability. In the semiarid Little Colorado River valley, extreme erosive episodes typically result from snowmelt flow, or lately, rain-on-snow events. The 90-km reach of the Little Colorado River (LCR), from Winslow to Leupp, Arizona, meanders within a 5-km-wide valley. Near Winslow, however, the LCR is disconnected from its floodplain by a 12-km-long levee. The levee restricts the floodplain to only 450 m wide in one location. In this severely constricted river stretch, a flood event in January 2008 relocated a meander bend. Bend development followed a common sequence of migration phases long noted in the literature, but at a very rapid pace. During the flood event one meander limb migrated ~200 m, following the general northwesterly flow direction of the river. Movement vectors of meander inflection points, apex, and apical line characterize changes in bend morphology. Before the 2008 flood event the apical line of the meander bend had azimuth 50°; after the 2008 flood event the apical line of the meander bend had azimuth 345°. Since that event, the meander bend has migrated an additional ~200 m through a combination of translation, extension, and rotation. The data provide information on geomorphic response to bimodal precipitation patterns in a human-perturbed channel reach.
Caspani, Ombretta; Reitz, Marie-Céline; Ceci, Angelo; Kremer, Andreas; Treede, Rolf-Detlef
2014-09-01
Depression and anxiety are common comorbidities of neuropathic pain (NP). Pharmacological preclinical studies on NP have given abundant information on the effects of drugs on reflex measures of stimulus-evoked pain. However, few preclinical studies focus on relief of comorbidities evoked by NP. In this study, we investigated the effects of tramadol on nociceptive reflex, depression-associated and anxiety-related behaviors in a NP model in rats. We used chronic constriction injury (CCI) of the sciatic nerve as an animal model of neuropathic pain. We performed electronic von Frey tests (evF) to measure mechanical sensitivity, elevated plus maze tests (EPM) to record anxiety-related behaviors and forced swimming tests (FST) to evaluate depression-associated behaviors. In the evF, CCI rats showed a decrease of 82% of the paw withdrawal threshold (PWT) compared to sham (Ppain and its indirect consequences and comorbidities, and that this study also is a model for pharmacological studies seeking to investigate the effect of drugs on the major disabling symptoms of NP. Copyright © 2014 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Filas, Benjamen A; Oltean, Alina; Majidi, Shabnam; Bayly, Philip V; Taber, Larry A; Beebe, David C
2012-01-01
In the early embryo, the brain initially forms as a relatively straight, cylindrical epithelial tube composed of neural stem cells. The brain tube then divides into three primary vesicles (forebrain, midbrain, hindbrain), as well as a series of bulges (rhombomeres) in the hindbrain. The boundaries between these subdivisions have been well studied as regions of differential gene expression, but the morphogenetic mechanisms that generate these constrictions are not well understood. Here, we show that regional variations in actomyosin-based contractility play a major role in vesicle formation in the embryonic chicken brain. In particular, boundaries did not form in brains exposed to the nonmuscle myosin II inhibitor blebbistatin, whereas increasing contractile force using calyculin or ATP deepened boundaries considerably. Tissue staining showed that contraction likely occurs at the inner part of the wall, as F-actin and phosphorylated myosin are concentrated at the apical side. However, relatively little actin and myosin was found in rhombomere boundaries. To determine the specific physical mechanisms that drive vesicle formation, we developed a finite-element model for the brain tube. Regional apical contraction was simulated in the model, with contractile anisotropy and strength estimated from contractile protein distributions and measurements of cell shapes. The model shows that a combination of circumferential contraction in the boundary regions and relatively isotropic contraction between boundaries can generate realistic morphologies for the primary vesicles. In contrast, rhombomere formation likely involves longitudinal contraction between boundaries. Further simulations suggest that these different mechanisms are dictated by regional differences in initial morphology and the need to withstand cerebrospinal fluid pressure. This study provides a new understanding of early brain morphogenesis. (paper)
Lifescience Database Archive (English)
Full Text Available xlexggxxliqypkrinsplglqikrwxanxcxnik w*xpsxlklraqxilxnvktxiqxkxrvsxqtnkd*FSAGKQLE...anfcknshw*nhytrs*r**qh*ecknknsrqrr ypt Frame B: ---xrfkkkkvxhqenqgfixxgkxlexggxxliqypkrinsplglqikrwxanxcxnik
International Nuclear Information System (INIS)
Casper, T A; Burrell, K H; Doyle, E J; Gohil, P; Lasnier, C J; Leonard, A W; Moller, J M; Osborne, T H; Snyder, P B; Thomas, D M; Weiland, J; West, W P
2006-01-01
Quiescent double barrier (QDB) conditions often form when an internal transport barrier is created with high-power neutral-beam injection into a quiescent H-mode (QH) plasma. These QH-modes offer an attractive, high-performance operating scenario for burning plasma experiments due to their quasi-stationarity and lack of edge localized modes. Our initial experiments and modelling using ECH/ECCD in QDB shots were designed to control the current profile and, indeed, we have observed a strong dependence on the q-profile when EC-power is used inside the core transport barrier region. While strong electron heating is observed with EC power injection, we also observe a drop in the other core parameters, namely ion temperature and rotation, electron density and impurity concentration. At onset and termination of the EC pulse, dynamically changing conditions are induced that provide a rapid evolution of T e /T i profiles accessible with 0.3 e /T i ) axis e /T i ratio as the ion temperature and density profiles flatten with this change in transport. The change in transport is consistent with a destabilization of ITG turbulence as inferred from the reduction of the stability threshold due to the change in T e /T i
International Nuclear Information System (INIS)
Burrell, K. H.; Garofalo, A. M; Osborne, T. H.; Schaffer, M. J.; Snyder, P. B.; Solomon, W. M.; Park, J.-K.; Fenstermacher, M. E.
2012-01-01
Results from recent experiments demonstrate that quiescent H-mode (QH-mode) sustained by magnetic torque from non-axisymmetric magnetic fields is a promising operating mode for future burning plasmas. Using magnetic torque from n=3 fields to replace counter-I p torque from neutral beam injection (NBI), we have achieved long duration, counter-rotating QH-mode operation with NBI torque ranging from counter-I p to up to co-I p values of 1-1.3 Nm. This co-I p torque is 3 to 4 times the scaled torque that ITER will have. These experiments utilized an ITER-relevant lower single-null plasma shape and were done with ITER-relevant values of ν ped * and β N ped . These discharges exhibited confinement quality H 98y2 =1.3, in the range required for ITER. In preliminary experiments using n=3 fields only from a coil outside the toroidal coil, QH-mode plasmas with low q 95 =3.4 have reached fusion gain values of G=β N H 89 /q 95 2 =0.4, which is the desired value for ITER. Shots with the same coil configuration also operated with net zero NBI torque. The limits on G and co-I p torque have not yet been established for this coil configuration. QH-mode work to has made significant contact with theory. The importance of edge rotational shear is consistent with peeling-ballooning mode theory. Qualitative and quantitative agreements with the predicted neoclassical toroidal viscosity torque is seen.
DEFF Research Database (Denmark)
Postila, P. A.; Kaszuba, K.; Sarewicz, M.
2013-01-01
of the cyt bc(1) function have remained unclear especially regarding the substrate binding at the Q(o)-site. In this work we address this issue by performing extensive atomistic molecular dynamics simulations with the cyt bc(1) complex of Rhodobacter capsulatus embedded in a lipid bilayer. Based...... on the simulations we are able to show the atom-level binding modes of two substrate forms: quinol (QH(2)) and quinone (Q). The QH(2) binding at the Q(o)-site involves a coordinated water arrangement that produces an exceptionally close and stable interaction between the cyt b and iron sulfur protein subunits...
Akishev, Yu S.; Karalnik, V. B.; Medvedev, M. A.; Petryakov, A. V.; Trushkin, N. I.; Shafikov, A. G.
2017-11-01
So called “open discharges” in a narrow gap between the solid cathode and grid anode are widely used for generation of the pulsed high-current electron beams with energy up to 100 keV. The need to get high-energy e-beams leads to the necessity in using of strong overvoltage of the short gas gap with the reduced electric field of the order of 105 Td or higher. The discharge under strong overvoltage is unstable and tends to transit into high-current regime with low voltage. In the case of the open discharge in D2 at low pressure (about 0.5-2 Torr) and powered by stepwise voltage with amplitude up to 25 kV we revealed that this discharge exhibits two diffuse regimes which follow one by one and finally transits into the constricted mode with formation of high-current spots on the cathode. The physical properties of these gas discharge regimes have been explored in detail with the usage of the fast multi-frame camera synchronized with the current and voltage of discharge. Our findings promote more insight into physics of the overvoltage open discharge generating the e-beams with energy up to 25 keV.
Zhang, Juan; Lv, Chen; Wang, Hai-na; Cao, Yi
2013-04-01
Shaoyao Gancao Decoction (SGD), a famous herbal medicine, consists of two herbs (Paeoniae Radix and Glycyrrhizae Radix) and is traditionally used for the treatment of pain. To investigate the synergistic potential of total glucosides of Paeoniae Radix (TGP) and total flavonoids of Glycyrrhizae Radix (TFL). Oral administration of TGP and TFL alone at the doses of 60,120 and 240 mg/kg or in combination were given only one time to the neuropathic pain rat induced by chronic constriction injury. Paw pressure and heat immersion tests were performed to assess degrees of mechanical allodynia and thermal hyperalgesia, respectively. Synergistic interactions between TGP and TFL were characterized using isobolographic analysis. Expressions of Sirt1 protein were detected by immunohistochemistry. On day 14 after surgery, single oral administration of TGP and TFL both produced significant anti-allodynic and anti-hyperalgesic effects in dose-dependent and time-dependent manners. The ED(50) value of TGP was 249.4 ± 10.8 mg/kg while TFL was 871.4 ± 30.5 mg/kg. Isobolographic analysis revealed that the combination of TGP with TFL at the fixed ratios of 3:1 exerted the highest sub-additive (synergistic) interaction, of which the experimental ED(50) value was 95.1 ± 9.0 mg/kg. SGD could also downregulate Sirt1 protein expression, which was 4.2-fold higher than that of model rats in dorsal root ganglion. Analgesic effects of SGD may contribute to simultaneous inhibition of Sirt1 overexpression and could warrant further evaluation as a possible agent for the treatment of neuropathic pain.
Sengupta, Partho P.; Huang, Yen-Min; Bansal, Manish; Ashrafi, Ali; Fisher, Matt; Shameer, Khader; Gall, Walt; Dudley, Joel T
2016-01-01
Background Associating a patient’s profile with the memories of prototypical patients built through previous repeat clinical experience is a key process in clinical judgment. We hypothesized that a similar process using a cognitive computing tool would be well suited for learning and recalling multidimensional attributes of speckle tracking echocardiography (STE) data sets derived from patients with known constrictive pericarditis (CP) and restrictive cardiomyopathy (RCM). Methods and Results Clinical and echocardiographic data of 50 patients with CP and 44 with RCM were used for developing an associative memory classifier (AMC) based machine learning algorithm. The STE data was normalized in reference to 47 controls with no structural heart disease, and the diagnostic area under the receiver operating characteristic curve (AUC) of the AMC was evaluated for differentiating CP from RCM. Using only STE variables, AMC achieved a diagnostic AUC of 89·2%, which improved to 96·2% with addition of 4 echocardiographic variables. In comparison, the AUC of early diastolic mitral annular velocity and left ventricular longitudinal strain were 82.1% and 63·7%, respectively. Furthermore, AMC demonstrated greater accuracy and shorter learning curves than other machine learning approaches with accuracy asymptotically approaching 90% after a training fraction of 0·3 and remaining flat at higher training fractions. Conclusions This study demonstrates feasibility of a cognitive machine learning approach for learning and recalling patterns observed during echocardiographic evaluations. Incorporation of machine learning algorithms in cardiac imaging may aid standardized assessments and support the quality of interpretations, particularly for novice readers with limited experience. PMID:27266599
Liu, Liping; Yin, Yan; Li, Fei; Malhotra, Charvi; Cheng, Jianguo
2017-06-01
Cellular responses to nerve injury play a central role in the pathogenesis of neuropathic pain. However, the analysis of site specific cellular responses to nerve injury and neuropathic pain is limited to immunohistochemistry staining with numerous limitations. We proposed to apply flow cytometry to overcome some of the limitations and developed two protocols for isolation of cells from small specimens of the sciatic nerve and dorsal root ganglion (DRG) in mice. RESULTS AND COMPARASION WITH EXISTING: methods We found that both the non-enzymatic and enzymatic approaches were highly effective in harvesting a sufficient number of cells for flow cytometry analysis in normal and pathological conditions. The total number of cells in the injury site of the sciatic and its DRGs increased significantly 14days after chronic constriction injury (CCI) of the sciatic nerve, compared to sham surgery control or the contralateral control. The enzymatic approach yielded a significantly higher total number of cells and CD45 negative cells, suggesting that this approach allows for harvest of more resident cells, compared to the non-enzymatic method. The percentage of CD45 + /CD11b + cells was significantly increased in the sciatic nerve but not in the DRG. These results were consistent with both protocols. We thus offer two simple and effective protocols that allow for application of flow cytometry to the investigation of cellular and molecular mechanisms of neuropathic pain. Copyright © 2017 Elsevier B.V. All rights reserved.
Liu, Bing; Persons, Logan; Lee, Lynda; de Boer, Piet A J
2015-03-01
Escherichia coli FtsN is a bitopic membrane protein that is essential for triggering active cell constriction. A small periplasmic subdomain ((E) FtsN) is required and sufficient for function, but its mechanism of action is unclear. We isolated extragenic (E) FtsN*-suppressing mutations that restore division in cells producing otherwise non-functional variants of FtsN. These mapped to the IC domain of FtsA in the cytoplasm and to small subdomains of the FtsB and FtsL proteins in the periplasm. All FtsB and FtsL variants allowed survival without (E) FtsN, but many then imposed a new requirement for interaction between the cytoplasmic domain of FtsN ((N) FtsN) and FtsA. Alternatively, variants of FtsA, FtsB or FtsL acted synergistically to allow cell division in the complete absence of FtsN. Strikingly, moreover, substitution of a single residue in FtsB (E56) proved sufficient to rescue ΔftsN cells as well. In FtsN(+) cells, (E) FtsN*-suppressing mutations promoted cell fission at an abnormally small cell size, and caused cell shape and integrity defects under certain conditions. This and additional evidence support a model in which FtsN acts on either side of the membrane to induce a conformational switch in both FtsA and the FtsBLQ subcomplex to de-repress septal peptidoglycan synthesis and membrane invagination. © 2014 John Wiley & Sons Ltd.
Myocardial blood flow during induced aortic hypertension in dogs
International Nuclear Information System (INIS)
Thai, B.N.; Levesque, M.J.; Nerem, R.M.
1986-01-01
Myocardial blood flow was measured in anesthetized dogs during control conditions and under conditions where the aortic pressure was increased due to aortic constriction or during infusion. Blood flow was measured using the radioactive microsphere technique. Radioactive microspheres (15 m Ce-141, Sr-85, and Sc-46) were injected under control, aortic constriction and arterenol infusion in four dogs and under control conditions in two others. All microsphere injections were performed under stabilized conditions. It was found that coronary blood flow rose by 80% during aortic constriction and by 158% during arterenol infusion (P < 0.05). This increase in blood flow was not uniform throughout the heart, and higher increases were observed in the middle and apex regions of the left ventricle. Furthermore, under hypertension the increase in blood flow in LAD (left anterior descending) perfused territories was slightly higher than that in CFX (left circumflex) perfused territories
Gawuc, L.; Łobocki, L.; Kaminski, J. W.
2017-12-01
Land surface temperature (LST) is a key parameter in various applications for urban environments research. However, remotely-sensed radiative surface temperature is not equivalent to kinetic nor aerodynamic surface temperature (Becker and Li, 1995; Norman and Becker, 1995). Thermal satellite observations of urban areas are also prone to angular anisotropy which is directly connected with the urban structure and relative sun-satellite position (Hu et al., 2016). Sensible heat flux (Qh) is the main component of surface energy balance in urban areas. Retrieval of Qh, requires observations of, among others, a temperature gradient. The lower level of temperature measurement is commonly replaced by remotely-sensed radiative surface temperature (Chrysoulakis, 2003; Voogt and Grimmond, 2000; Xu et al., 2008). However, such replacement requires accounting for the differences between aerodynamic and radiative surface temperature (Chehbouni et al., 1996; Sun and Mahrt, 1995). Moreover, it is important to avoid micro-scale processes, which play a major role in the roughness sublayer. This is due to the fact that Monin-Obukhov similarity theory is valid only in dynamic sublayer. We will present results of the analyses of the impact of urban morphology and land cover on the seasonal changes of sensible heat flux (Qh). Qh will be retrieved by two approaches. First will be based on satellite observations of radiative surface temperature and second will be based on in-situ observations of kinetic road temperature. Both approaches will utilize wind velocity, and air temperature observed in-situ. We will utilize time series of MODIS LST observations for the period of 2005-2014 as well as simultaneous in-situ observations collected by road weather network (9 stations). Ground stations are located across the city of Warsaw, outside the city centre in low-rise urban structure. We will account for differences in urban morphology and land cover in the proximity of ground stations. We will
White, A.F.; Schulz, M.S.; Vivit, D.V.; Blum, A.E.; Stonestrom, David A.; Anderson, S.P.
2008-01-01
The spatial and temporal changes in element and mineral concentrations in regolith profiles in a chronosequence developed on marine terraces along coastal California are interpreted in terms of chemical weathering rates and processes. In regoliths up to 15 m deep and 226 kyrs old, quartz-normalized mass transfer coefficients indicate non-stoichiometric preferential release of Sr > Ca > Na from plagioclase along with lesser amounts of K, Rb and Ba derived from K-feldspar. Smectite weathering results in the loss of Mg and concurrent incorporation of Al and Fe into secondary kaolinite and Fe-oxides in shallow argillic horizons. Elemental losses from weathering of the Santa Cruz terraces fall within the range of those for other marine terraces along the Pacific Coast of North America. Residual amounts of plagioclase and K-feldspar decrease with terrace depth and increasing age. The gradient of the weathering profile bs is defined by the ratio of the weathering rate, R to the velocity at which the profile penetrates into the protolith. A spreadsheet calculator further refines profile geometries, demonstrating that the non-linear regions at low residual feldspar concentrations at shallow depth are dominated by exponential changes in mineral surface-to-volume ratios and at high residual feldspar concentrations, at greater depth, by the approach to thermodynamic saturation. These parameters are of secondary importance to the fluid flux qh, which in thermodynamically saturated pore water, controls the weathering velocity and mineral losses from the profiles. Long-term fluid fluxes required to reproduce the feldspar weathering profiles are in agreement with contemporary values based on solute Cl balances (qh = 0.025-0.17 m yr-1). During saturation-controlled and solute-limited weathering, the greater loss of plagioclase relative to K-feldspar is dependent on the large difference in their respective solubilities instead of the small difference between their respective
Sequence Data: QH00814 [dbQSNP[Archive
Lifescience Database Archive (English)
Full Text Available aagtcctttttctttaggatgatggtgatggggaactaaatggggaaatatggaaggtcacaggaaaagttaacacaagttagcaaaaagttaacataacacaaaaaggtcttgcaggaaaaaaaaaagaaaa...gaaaagaaagaaaaagtctccaaaaatggtttggacagccaaaatgaatacttatagtcacgtatacctgctcactcctgacgcttaa
Interactions, Disorder and Dephasing in Superconducting Films and Quantum Hall Systems
International Nuclear Information System (INIS)
Auerbach, A.
1999-01-01
It is shown that a large class of two dimensional Superconductor to Insulator (SC-I), and (Quantum Hall to Insulator (QH-I) transitions can be understood by assuming that the thermodynamic transition in the clean system is first order. The finite correlation lengths at that transition yield a natural separation of the disorder into short and long wavelengths which are then straightforward to incorporate perturbatively and semi classically respectively. This approach reduces problems of disorder+interactions to puddle network models, whose studies have already yielded insight into experiments of QH-I and SC-I. For the CQH-I, the difference between Landauer-Buttiker and Boltzman theories highlights effects of dephasing
Directory of Open Access Journals (Sweden)
Farinaz Nasirinezhad
2011-04-01
Full Text Available Introduction: Results: These findings revealed the exaggerated responses in the group which received CCI. The group which was treated by 1 μg/kg of 1,25 vit D3 showed a significant reduction in pain behavior. Injection of 1,25 vit D3 did not change the response of animals to the acetone drop and von frey filament. Discussion: Our results showed that antinoceptive effect of 1,25 vit D3 in a rodent neuropathic pain model is dose dependent and this vitamin may provide new approach for treatment of chronic pain.The presence of nuclear receptors of 1,25 dihydroxy vitamin D3 (1,25 vit D3, the biologically active metabolite of vitamin D, in neurons and glial cells indicates the biological effect of this vitamin in the nervous system. The present experiment was conducted to identify the effects of different doses of 1,25 vit D3 on mechanical and cold allodynia in rodent model of neuropatinc pain. Methods: A mononeuropathy was produced by chronic constrictive injury (CCI of the sciatic nerve. 1,25 vit D3 (0.3, 0.6 ,1 μg/Kg was administered by an i.p. injection every 2 days during a month after CCI. Mechanical and cold allodynia were evaluated by Von frey filament and acetone respectively.
CSIR Research Space (South Africa)
Taljaard, Susan
2009-11-01
Full Text Available the relatively constricted, microtidal estuaries located along wave dominated coasts in the region, specifically focusing on the limiting macronutrients nitrogen (N) and phosphorus (P) and on key processes, including physical (e.g. flushing, mixing...
Directory of Open Access Journals (Sweden)
Anne Kathrin Hett
Full Text Available This study reports the description of the karyotype of Mugil incilis from Venezuela. The chromosome complement is composed of 48 acrocentric chromosomes, which uniformly decrease in size. Therefore, the homologues can not be clearly identified, with the exception of one of the largest chromosome pairs, classified as number 1, whose homologues may show a subcentromeric secondary constriction, and of chromosome pair number 24, which is considerably smaller than the others. C-banding showed heterochromatic blocks at the centromeric/pericentromeric regions of all chromosomes, which were more conspicuous on chromosomes 1, given the C-positive signals include the secondary constrictions. AgNO3 and fluorescent in situ hybridization (FISH with 45S rDNA demonstrated that the nucleolus organizer regions are indeed located on the secondary constrictions of chromosome pair number 1. FISH with 5S rDNA revealed that the minor ribosomal genes are located on this same chromosome pair, near the NORs, though signals are closer to the centromeres and of smaller size, compared to those of the major ribosomal gene clusters. This is the first description of co-localization of major and minor ribosomal genes in the family. Data are discussed from a cytotaxonomic and phylogenetic perspective.
Karyological characterization of Mugil trichodon Poey, 1876 (Pisces: Mugilidae
Directory of Open Access Journals (Sweden)
Mauro Nirchio
2005-12-01
Full Text Available Cytogenetic studies were conducted on Mugil trichodon from Margarita Island, Venezuela. The species showed a karyotype 2n=48 with entirely acrocentric chromosomes (Arm number, NF=48. Chromosomes gradually decreased in size and did not allow a clear distinction of homologues, except for one marker pair, which showed a conspicuous secondary constriction. C-banding showed heterochromatic blocks restricted at the centromeric regions of all the chromosomes. Some were more obvious than others, with the exception of the chromosome pair that had a secondary constriction with entirely heterochromatic short arms. Sequential staining with Giemsa and AgNO3 demonstrated the conspicuous secondary constrictions corresponding to the NORs, and these had significant intraindividual size variations between both homologous chromosomes. The data obtained here support the contention that Mugilidae have a conservative chromosome macrostructure and reinforce the hypothesis that small structural chromosome rearrangements involving active NOR sites are the main cause of the karyotypic diversification seen in this group.
... the source of the problem, treatment may include antibiotics, medicines for tuberculosis, or other treatments. Diuretics ("water pills") are often used in small doses to help the body remove excess fluid. Pain medicines may be needed ...
Choi, Jiwoong; Leblanc, Lawrence; Choi, Sanghun; Haghighi, Babak; Hoffman, Eric; Lin, Ching-Long
2017-11-01
The goal of this study is to assess inter-subject variability in delivery of orally inhaled drug products to small airways in asthmatic lungs. A recent multiscale imaging-based cluster analysis (MICA) of computed tomography (CT) lung images in an asthmatic cohort identified four clusters with statistically distinct structural and functional phenotypes associating with unique clinical biomarkers. Thus, we aimed to address inter-subject variability via inter-cluster variability. We selected a representative subject from each of the 4 asthma clusters as well as 1 male and 1 female healthy controls, and performed computational fluid and particle simulations on CT-based airway models of these subjects. The results from one severe and one non-severe asthmatic cluster subjects characterized by segmental airway constriction had increased particle deposition efficiency, as compared with the other two cluster subjects (one non-severe and one severe asthmatics) without airway constriction. Constriction-induced jets impinging on distal bifurcations led to excessive particle deposition. The results emphasize the impact of airway constriction on regional particle deposition rather than disease severity, demonstrating the potential of using cluster membership to tailor drug delivery. NIH Grants U01HL114494 and S10-RR022421, and FDA Grant U01FD005837. XSEDE.
Concerted action of two cation filters in the aquaporin water channel
DEFF Research Database (Denmark)
Wu, Binghua; Steinbronn, Christina; Alsterfjord, Magnus
2009-01-01
Aquaporin (AQP) facilitated water transport is common to virtually all cell membranes and is marked by almost perfect specificity and high flux rates. Simultaneously, protons and cations are strictly excluded to maintain ionic transmembrane gradients. Yet, the AQP cation filters have not been...... identified experimentally. We report that three point mutations turned the water-specific AQP1 into a proton/alkali cation channel with reduced water permeability and the permeability sequence: H(+) >>K(+) >Rb(+) >Na(+) >Cs(+) >Li(+). Contrary to theoretical models, we found that electrostatic repulsion...... at the central asn-pro-ala (NPA) region does not suffice to exclude protons. Full proton exclusion is reached only in conjunction with the aromatic/arginine (ar/R) constriction at the pore mouth. In contrast, alkali cations are blocked by the NPA region but leak through the ar/R constriction. Expression...
Karyotype of Ophiopogon reversus (Convallariaceae from Taiwan and the Southern Ryukyus
Directory of Open Access Journals (Sweden)
Tetsuo Denda
2006-06-01
Full Text Available Karyotypes of Ophiopogon reversus (Convallariaceae collected from four localities in Taiwan and one locality on Yonaguni-jima Island in the southern Ryukyus of Japan were reported for the first time. Those of O. jaburan collected from three major islands (Amami-oshima, Tokuno-shima and Okinawa-jima of the central Ryukyus were also investigated for comparison. All plants of O. reversus and O. jaburan investigated were diploid (2n = 36 based on the basic chromosome number of x = 18. Among 36 chromosomes of O. reversus, one pair of short chromosomes with submedian centromeres had secondary constrictions at the proximal region of the long arms. Based on this character, O. reversus is cytologically distinguishable from O. jaburan, in which one pair of short metacentric chromosomes had secondary constrictions at the proximal region of the short arms.
Computer Simulations of Coronary Blood Flow Through a Constriction
2014-03-01
for clinical translation. Journal of the American College of Cardiology . 59(15): 1337–1349. Leimgruber, P., Roubin, G., Hollman, J., Cotsonis, G...the artery and increase blood flow. Generally a stent, or a mesh wire tube, is permanently inserted in order to scaffold open the artery wall...central regions of the channel, so the magnitude of the velocity has to be higher in the open area of the channel, overshooting the experimental results
Lifescience Database Archive (English)
Full Text Available mino Acid sequence (All Frames) Frame A: kfifiiqilnsyfiflyivtfhkkkkkkkx*kixffekk--- ---lxxxxxxxxxxxxxxtqnsnx...hspfssqikrwyanfcknshw*nhytrs*r **qh*ecknknsrqrryx Frame B: nsfllyky*ihilffyil*HFIKKKKKKKXKKSXFLKKK--- ---xxxxsxxxxxxx...kxxxkiqxxkgixxxkkxxxxxgnx*xmvxxxxxnxxkkstxxlv xrikrwyxkflsktlxgkxhhxxklraqdnienvktkdsxqkkvsppdqqrli
Khrabry, A.; Kaganovich, I. D.; Nemchinsky, V.; Khodak, A.
2018-01-01
The atmospheric pressure arcs have recently found application in the production of nanoparticles. The distinguishing features of such arcs are small length and hot ablating anode characterized by intensive electron emission and radiation from its surface. We performed a one-dimensional modeling of argon arc, which shows that near-electrode effects of thermal and ionization non-equilibrium play an important role in the operation of a short arc, because the non-equilibrium regions are up to several millimeters long and are comparable to the arc length. The near-anode region is typically longer than the near-cathode region and its length depends more strongly on the current density. The model was extensively verified and validated against previous simulation results and experimental data. The Volt-Ampere characteristic (VAC) of the near-anode region depends on the anode cooling mechanism. The anode voltage is negative. In the case of strong anode cooling (water-cooled anode) when the anode is cold, temperature and plasma density gradients increase with current density, resulting in a decrease of the anode voltage (the absolute value increases). Falling VAC of the near-anode region suggests the arc constriction near the anode. Without anode cooling, the anode temperature increases significantly with the current density, leading to a drastic increase in the thermionic emission current from the anode. Correspondingly, the anode voltage increases to suppress the emission, and the opposite trend in the VAC is observed. The results of simulations were found to be independent of sheath model used: collisional (fluid) or collisionless model gave the same plasma profiles for both near-anode and near-cathode regions.
Directory of Open Access Journals (Sweden)
Abolfazl Abbaszadeh
2018-02-01
Full Text Available Objective(s: Several lines of evidence showed that minocycline possesses antioxidant and anti-inflammatory properties. This study aimed to demonstrate the effects of minocycline in rats subjected to chronic constriction injury (CCI. Materials and Methods: In this study four groups (n = 6–8 of rats were used as follows: Sham, CCI, CCI + minocycline (MIN 10 mg/Kg (IP and CCI + MIN 30 mg/Kg (IP. On days 3, 7, 14, and 21 post-surgery hot-plate, acetone, and von Frey tests were carried out. Finally, Motor Nerve Conduction Velocity Evaluation (MNCV assessment was performed and spinal cords were harvested in order to measure tissue concentrations of TNF_α, IL-1β, Glutathione peroxidase (GPx, Superoxide dismutase (SOD and Malondialdehyde (MDA. Extent of perineural inflammation and damage around the sciatic nerve was histopathologically evaluated. Results: Our results demonstrated that CCI significantly caused hyperalgesia and allodynia twenty-one days after CCI. MIN attenuated heat hyperalgesia, cold and mechanical allodynia and MNCV in animals. MIN also decreased the levels of TNF_α and IL-1β. Antioxidative enzymes (SOD, MDA, and GPx were restored following MIN treatment. Our findings showed that MIN decreased perineural inflammation around the sciatic nerve. According to the results, the neuropathic pain reduced in the CCI hyperalgesia model using 30 mg/kg of minocycline. Conclusion: It is suggested that antinociceptive effects of minocycline might be mediated through the inhibition of inflammatory response and attenuation of oxidative stress.
Directory of Open Access Journals (Sweden)
Christoph Best
2015-01-01
Full Text Available Patients with somatoform vertigo and dizziness (SVD disorders often report instability of stance or gait and fear of falling. Posturographic measurements indeed indicated a pathological postural strategy. Our goal was to evaluate the effectiveness of a psychotherapeutic and psychoeducational short-term intervention (PTI using static posturography and psychometric examination. Seventeen SVD patients took part in the study. The effects of PTI on SVD were evaluated with quantitative static posturography. As primary endpoint a quotient characterizing the relation between horizontal and vertical sway was calculated (QH/V, reflecting the individual postural strategy. Results of static posturography were compared to those of age- and gender-matched healthy volunteers (n=28; baseline measurements were compared to results after PTI. The secondary endpoint was the participation-limiting consequences of SVD as measured by the Vertigo Handicap Questionnaire (VHQ. Compared to the healthy volunteers, the patients with SVD showed a postural strategy characterized by stiffening-up that resulted in a significantly reduced body sway quotient before PTI (patients: QH/V=0.31 versus controls: QH/V=0.38; p=0.022. After PTI the postural behavior normalized, and psychological distress was reduced. PTI therefore appears to modify pathological balance behaviour. The postural strategy of patients with SVD possibly results from anxious anticipatory cocontraction of the antigravity muscles.
Short-Term Summer Inundation as a Measure to Counteract Acidification in Rich Fens
Mettrop, I.S.; Cusell, C.; Kooijman, A.M.; Lamers, L.P.M.
2015-01-01
In regions with intensive agriculture, water level fluctuation in wetlands has generally become constricted within narrow limits. Water authorities are, however, considering the re-establishment of fluctuating water levels as a management tool in biodiverse, base-rich fens (‘rich fens’). This
Lifescience Database Archive (English)
Full Text Available h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanxcknldw*nyhlgsrrf*qh*kc*sqnpgqrrxxxxspx infrw*tirr...rystrstkinlcw*tirrwsxsf*lqhskgihspfssxik rxyanxcknxhw*nhhlxg*r*x*h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanx
Warne, A.G.; Meade, R.H.; White, W.A.; Guevara, E.H.; Gibeaut, J.; Smyth, R.C.; Aslan, A.; Tremblay, T.
2002-01-01
Interacting river discharge, tidal oscillation, and tropical rainfall across the 22,000 km2 Orinoco delta plain support diverse fresh and brackish water ecosystems. To develop environmental baseline information for this largely unpopulated region, we evaluate major coastal plain, shallow marine, and river systems of northeastern South America, which serves to identify principal sources and controls of water and sediment flow into, through, and out of the Orinoco Delta. The regional analysis includes a summary of the geology, hydrodynamics, sediment dynamics, and geomorphic characteristics of the Orinoco drainage basin, river, and delta system. Because the Amazon River is a major source of sediment deposited along the Orinoco coast, we summarize Amazon water and sediment input to the northeastern South American littoral zone. We investigate sediment dynamics and geomorphology of the Guiana coast, where marine processes and Holocene history are similar to the Orinoco coast. Major factors controlling Orinoco Delta water and sediment dynamics include the pronounced annual flood discharge; the uneven distribution of water and sediment discharge across the delta plain; discharge of large volumes of water with low sediment concentrations through the Rio Grande and Araguao distributaries; water and sediment dynamics associated with the Guayana littoral current along the northeastern South American coast; inflow of large volumes of Amazon sediment to the Orinoco coast; development of a fresh water plume seaward of Boca Grande; disruption of the Guayana Current by Trinidad, Boca de Serpientes, and Gulf of Paria; and the constriction at Boca de Serpientes. ?? 2002 Elsevier Science B.V. All rights reserved.
Lo, Wen-Ting; Vujičić Žagar, Andreja; Gerth, Fabian; Lehmann, Martin; Puchkov, Dymtro; Krylova, Oxana; Freund, Christian; Scapozza, Leonardo; Vadas, Oscar; Haucke, Volker
2017-11-20
Clathrin-mediated endocytosis occurs by bending and remodeling of the membrane underneath the coat. Bin-amphiphysin-rvs (BAR) domain proteins are crucial for endocytic membrane remodeling, but how their activity is spatiotemporally controlled is largely unknown. We demonstrate that the membrane remodeling activity of sorting nexin 9 (SNX9), a late-acting endocytic PX-BAR domain protein required for constriction of U-shaped endocytic intermediates, is controlled by an allosteric structural switch involving coincident detection of the clathrin adaptor AP2 and phosphatidylinositol-3,4-bisphosphate (PI(3,4)P 2 ) at endocytic sites. Structural, biochemical, and cell biological data show that SNX9 is autoinhibited in solution. Binding to PI(3,4)P 2 via its PX-BAR domain, and concomitant association with AP2 via sequences in the linker region, releases SNX9 autoinhibitory contacts to enable membrane constriction. Our results reveal a mechanism for restricting the latent membrane remodeling activity of BAR domain proteins to allow spatiotemporal coupling of membrane constriction to the progression of the endocytic pathway. Copyright © 2017 Elsevier Inc. All rights reserved.
Genetic variability of Italian Heavy Draught Horse
Directory of Open Access Journals (Sweden)
Fabio Maretto
2010-01-01
Full Text Available This study aimed to analyze the genetic variability of the Italian Heavy Draught Horse (IHDH breed using a panel of 23 microsatellite markers. We also compared the population structure of the IHDH to other two unrelated breeds (Italian Haflinger, IH and Quarter Horse, QH. The IHDH showed a genetic variability comparable with other European heavy draught horse breeds and with the IH and QH breeds analyzed. Clustering analyses using a posterior Bayesian approach clearly differentiated the three breeds; it also showed a fragmentation of the IHDH in three subpopulations that need to be further investigated. These findings are an indicator of the present situation of the IHDH and will contribute to the conservation and implementation of the selection programme for this breed.
Energy Technology Data Exchange (ETDEWEB)
Kamp, Derek van der [University of Victoria, Pacific Climate Impacts Consortium, Victoria, BC (Canada); University of Victoria, School of Earth and Ocean Sciences, Victoria, BC (Canada); Curry, Charles L. [Environment Canada University of Victoria, Canadian Centre for Climate Modelling and Analysis, Victoria, BC (Canada); University of Victoria, School of Earth and Ocean Sciences, Victoria, BC (Canada); Monahan, Adam H. [University of Victoria, School of Earth and Ocean Sciences, Victoria, BC (Canada)
2012-04-15
A regression-based downscaling technique was applied to monthly mean surface wind observations from stations throughout western Canada as well as from buoys in the Northeast Pacific Ocean over the period 1979-2006. A predictor set was developed from principal component analysis of the three wind components at 500 hPa and mean sea-level pressure taken from the NCEP Reanalysis II. Building on the results of a companion paper, Curry et al. (Clim Dyn 2011), the downscaling was applied to both wind speed and wind components, in an effort to evaluate the utility of each type of predictand. Cross-validated prediction skill varied strongly with season, with autumn and summer displaying the highest and lowest skill, respectively. In most cases wind components were predicted with better skill than wind speeds. The predictive ability of wind components was found to be strongly related to their orientation. Wind components with the best predictions were often oriented along topographically significant features such as constricted valleys, mountain ranges or ocean channels. This influence of directionality on predictive ability is most prominent during autumn and winter at inland sites with complex topography. Stations in regions with relatively flat terrain (where topographic steering is minimal) exhibit inter-station consistencies including region-wide seasonal shifts in the direction of the best predicted wind component. The conclusion that wind components can be skillfully predicted only over a limited range of directions at most stations limits the scope of statistically downscaled wind speed predictions. It seems likely that such limitations apply to other regions of complex terrain as well. (orig.)
Chen, Feng; Wang, LiQin; Chen, ShuJun; Li, ZhiGao; Chen, ZhouLin; Zhou, XinHua; Zhai, Dong
2014-01-01
The aim of the present study is to explore the impact of butorphanol in combination with ketamine via nasal inhalation (NI) on neuropathic pain induced by chronic constriction injury (CCI) to the sciatic nerve in a rat model. CCI rats (n = 12) were equally randomized to four groups based on the treatments received as follows: 100 μL of 0.9% normal saline via NI (NS/NI group); 100 μg of butorphanol plus 1 mg of ketamine via NI (B + K/NI group); 100 μg of butorphanol alone via NI (B/NI group); and 100 μg of butorphanol plus 1 mg of ketamine via subcutaneous injection (B + K/SC group). Mechanical pain threshold was measured at 10 min, 30 min, 2 h, 4 h, and 6 h after drug administration. The mechanical pain threshold in the B + K/NI group was improved significantly 4 h after drug administration as compared with that in the B/NI or B + K/SC group (P ketamine quickly elevates the mechanical pain threshold in a rat neuropathic pain model induced by CCI to the sciatic nerve. Copyright © 2014 Elsevier Inc. All rights reserved.
Ruan, Guoran; Ren, Haojin; Zhang, Chi; Zhu, Xiaogang; Xu, Chao; Wang, Liyue
2018-01-01
QiShenYiQi dripping pills (QSYQ), a traditional Chinese medicine, are commonly used to treat coronary heart disease, and QSYQ was recently approved as a complementary treatment for ischemic heart failure in China. However, only few studies reported on whether QSYQ exerts a protective effect on heart failure induced by pressure overload. In this study, we explored the role of QSYQ in a mouse model of heart failure induced by transverse aortic constriction (TAC). Twenty-eight C57BL/6J mice were divided into four groups: Sham + NS group, Sham + QSYQ group, TAC + NS group, and TAC + QSYQ group. QSYQ dissolved in normal saline (NS) was administered intragastrically (3.5 mg/100 g/day) in the Sham + QSYQ and TAC + QSYQ groups. In the Sham + NS and TAC + NS groups, NS was provided every day intragastrically. Eight weeks after TAC, echocardiography, and cardiac catheterization were performed to evaluate the cardiac function, and immunofluorescent staining with anti-actinin2 antibody was performed to determine the structure of the myocardial fibers. Moreover, TUNEL staining and Masson trichrome staining were employed to assess the effects of QSYQ on cardiac apoptosis and cardiac fibrosis. Western blots and real-time polymerase chain reaction (PCR) were used to measure the expression levels of vascular endothelial growth factor (VEGF) in the heart, and immunohistochemical staining with anti-CD31 antibody was performed to explore the role of QSYQ in cardiac angiogenesis. Results showed that TAC-induced cardiac dysfunction and disrupted structure of myocardial fibers significantly improved after QSYQ treatment. Moreover, QSYQ treatment also significantly improved cardiac apoptosis and cardiac fibrosis in TAC-induced heart failure, which was accompanied by an increase in VEGF expression levels and maintenance of microvessel density in the heart. In conclusion, QSYQ exerts a protective effect on TAC-induced heart failure, which could be attributed to enhanced cardiac angiogenesis
Vallance, S A; Case, J T; Entwistle, R C; Kinde, H; Barr, B C; Moore, J; Anderson, M L; Arthur, R M; Stover, S M
2012-07-01
To determine if scapular fractures occur in racehorses with distinctive characteristics. To test the hypothesis that Thoroughbred (TB) and Quarter Horse (QH) racehorses with a scapular fracture have similar characteristics that are different from those of their respective racetrack populations. Necropsy findings, case details, last race information and career earnings for TB and QH racehorses that had a scapular fracture in California between 1990 and 2008 were retrospectively compared between breeds. Horse signalment, career earnings, career starts and race characteristics were obtained for all California racehorses. Comparisons were made between affected horses, other racehorses that died, and all horses that raced, in California during the 19 year period. Seventy-three TB and 28 QH racehorses had a similar, complete comminuted scapular fracture with an articular component, and right forelimb predilection. The QHs had a higher incidence of scapular fracture incurred during racing than TBs (0.98 vs. 0.39/1000 starters). The TB and QH incident rates for musculoskeletal deaths incurred racing were 20.5 and 17.5/1000 starters, respectively; however, a greater proportion of TB musculoskeletal deaths occurred training (40% vs. 8%). Horses with a scapular fracture were more likely to be male and aged 2 or ≥ 5 years than the racetrack population. Most affected QHs (64%) were 2-year-olds; most TBs (74%) were aged ≥ 3 years. Scapular fractures occurred more commonly during racing in QHs (70%) than TBs (44%). Race-related scapular fracture was more likely to occur in a Maiden race than in a non-Maiden race. Horses with a scapular fracture had fewer career starts than the racetrack population. Despite breed differences for signalment and exercise distances, both breeds incur a complete scapular fracture that is more likely to occur in the right scapula of young and older, male racehorses, early in their race career or after few races. Quarter Horses sustain a
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Dhakal, Pashupati [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Gurevich, Alexander V. [Old Dominion University, Norfolk, VA (United States)
2014-03-03
Measurements of the quality factor, Q, of Nb superconducting microwave resonators often show that Q increases by {approx_equal} 10%–30% with increasing radio-frequency (rf) field, H, up to {approx} 15-20 mT. Recent high temperature heat treatments can amplify this rf field-induced increase of Q up to {approx_equal} 50%–100% and extend it to much higher fields, but the mechanisms of the enhancement of Q(H) remain unclear. Here, we suggest a method to reveal these mechanisms by measuring temperature dependencies of Q at different rf field amplitudes. We show that the increase of Q(H) does not come from a field dependent quasi-particles activation energy or residual resistance, but rather results from the smearing of the density of state by the rf field.
MD#1826: Measurement of Quench Heater vertical kick
Valette, Matthieu; Lindstrom, Bjorn Hans Filip; Bortot, Lorenzo; Fernandez Navarro, Alejandro; Schmidt, Rudiger; Verweij, Arjan
2018-01-01
Following the observation of vertical orbit oscillations of the LHC beam between the detection of a (beam induced) quench of an LHC main dipole and the beam dump, a study was started to verify that the orbit distortions are caused by the firing of the quench heaters (QH). Simulation of the magnetic field generated by the discharge of the QH and its effect on the beam confirmed it was the most likely cause. A dedicated experiment with 450 GeV proton beams was performed to validate the simulation results. The results are presented below and compared to the simulations. Furthermore, estimates on the effect of quench heater firing in superconducting magnets other than the studied LHC main dipoles on the circulating proton beams in LHC and the future HL-LHC are discussed.
Light-sensitive brain pathways and aging.
Daneault, V; Dumont, M; Massé, É; Vandewalle, G; Carrier, J
2016-03-15
Notwithstanding its effects on the classical visual system allowing image formation, light acts upon several non-image-forming (NIF) functions including body temperature, hormonal secretions, sleep-wake cycle, alertness, and cognitive performance. Studies have shown that NIF functions are maximally sensitive to blue wavelengths (460-480 nm), in comparison to longer light wavelengths. Higher blue light sensitivity has been reported for melatonin suppression, pupillary constriction, vigilance, and performance improvement but also for modulation of cognitive brain functions. Studies investigating acute stimulating effects of light on brain activity during the execution of cognitive tasks have suggested that brain activations progress from subcortical regions involved in alertness, such as the thalamus, the hypothalamus, and the brainstem, before reaching cortical regions associated with the ongoing task. In the course of aging, lower blue light sensitivity of some NIF functions has been reported. Here, we first describe neural pathways underlying effects of light on NIF functions and we discuss eye and cerebral mechanisms associated with aging which may affect NIF light sensitivity. Thereafter, we report results of investigations on pupillary constriction and cognitive brain sensitivity to light in the course of aging. Whereas the impact of light on cognitive brain responses appears to decrease substantially, pupillary constriction seems to remain more intact over the lifespan. Altogether, these results demonstrate that aging research should take into account the diversity of the pathways underlying the effects of light on specific NIF functions which may explain their differences in light sensitivity.
Directory of Open Access Journals (Sweden)
Feng Liang
2017-05-01
Full Text Available The effective treatment of patients suffering from neuropathic pain remains challenging. Dexmedetomidine (DEX possesses anti-inflammatory activity. However, the role of DEX in neuropathic pain is still unclear. The aim of the present study was to examine DEX an α2-adrenoceptor agonist could improve pain hypersensitivity and reduce inflammatory in a chronic constriction injury (CCI model of the sciatic nerve in Sprague-Dawley rats. Dex was intrathecally administrated 1-h after operation. The paw mechanical withdrawal threshold (MWT and paw withdrawal thermal latency (PWTL were measured on day 1 before operation and on days 1, 7, 14 and 21 after operation, respectively. On day 21, all the rats were decapitated to collect the L4-6 segments of the spinal cord to examine IL-1, TNF-α, IL-6, NR2B, NF-κB, and iNOS mRNA levels using RT-PCR. The postoperative MWT and PWTL were significantly decreased in CCI, and DEX groups as compared to those before surgery and Sham group (P < 0.05. And DEX reversed this trend (P < 0.05. Interleukin 1 (IL-1, tumor necrosis factor α (TNF-α, IL-6 mRNA expression significantly increased postsurgery in CCI group as compared to that of Sham group (P < 0.05; DEX blocked increased IL-1, TNF-α, IL-6, N-methyl-D-aspartate (NMDA receptor 2B (NR2B, nuclear factor κB (NF-κB, and inducible isoform of nitric oxide synthase (iNOS mRNA levels (P < 0.05. DEX may alleviate neuropathic hypersensitivity and inflammation partially by inhibiting NR2B, NF-κB, and iNOS expression in the spinal cord of rats with neuropathic pain resulting from CCI of the sciatic nerve.
Kopruszinski, Caroline M; Reis, Renata C; Bressan, Elisangela; Reeh, Peter W; Chichorro, Juliana G
2015-09-05
Vitamins of the B complex attenuate some neuropathic pain sensory aspects in various animal models and in patients, but the mechanisms underlying their effects remain to be elucidated. Herein it was investigated if the treatment with a vitamin B complex (VBC) reduces heat hyperalgesia in rats submitted to infraorbital nerve constriction and the possibility that TRPV1 receptors represent a target for B vitamins. In the present study, the VBC refers to a combination of vitamins B1, B6 and B12 at low- (18, 18 and 1.8mg/kg, respectively) or high- (180, 180 and 18mg/kg, respectively) doses. Acute treatment of rats with either the low- or the high-doses combination reduced heat hyperalgesia after nerve injury, but the high-doses combination resulted in a long-lasting effect. Repeated treatment with the low-dose combination reduced heat hyperalgesia on day four after nerve injury and showed a synergist effect with a single injection of carbamazepine (3 or 10mg/kg), which per se failed to modify the heat threshold. In naïve rats, acute treatment with the high-dose of VBC or B1 and B12 vitamins independently reduced heat hyperalgesia evoked by capsaicin (3µg into the upper lip). Moreover, the VBC, as well as, each one of the B vitamins independently reduced the capsaicin-induced calcium responses in HEK 293 cells transiently transfected with the human TRPV1 channels. Altogether, these results indicate that B vitamins can be useful to control heat hyperalgesia associated with trigeminal neuropathic pain and that modulation of TRPV1 receptors may contribute to their anti-hyperalgesic effects. Copyright © 2015. Published by Elsevier B.V.
Czech Academy of Sciences Publication Activity Database
Kroutil, M.; Hradecká, D.; Kohout, Ladislav; Lachman, J.
2010-01-01
Roč. 41, č. 2 (2010), s. 65-72 ISSN 1211-3174 Grant - others:GA MZe(CZ) QH92111 Institutional research plan: CEZ:AV0Z40550506 Keywords : brassinosteroids * carotenoids * chlorophylls * heterosis Subject RIV: GC - Agronomy
Czech Academy of Sciences Publication Activity Database
Pavela, R.; Vrchotová, Naděžda; Šerá, Božena
2009-01-01
Roč. 2009, - (2009), s. 48-51 ISSN 0974-391X R&D Projects: GA MZe(CZ) QH72117 Institutional research plan: CEZ:AV0Z60870520 Keywords : Impatiens * repellency * toxicity Subject RIV: EH - Ecology, Behaviour
Xu, Qiuling; Liu, Tao; Chen, Shuping; Gao, Yonghui; Wang, Junying; Qiao, Lina; Liu, Junling
2012-01-01
In the present study, we examined the analgesic effect of repeated electroacupuncture at bilateral Zusanli (ST36) and Yanglingquan (GB34) once a day for 14 consecutive days in a rat model of chronic sciatic nerve constriction injury-induced neuropathic pain. In addition, concomitant changes in calcium/calmodulin-dependent protein kinase II expression and synaptic ultrastructure of neurons in the hippocampal CA3 region were examined. The thermal pain threshold (paw withdrawal latency) was increased significantly in both groups at 2 weeks after electroacupuncture intervention compared with 2 days of electroacupuncture. In ovariectomized rats with chronic constriction injury, the analgesic effect was significantly reduced. Electroacupuncture for 2 weeks significantly diminished the injury-induced increase in synaptic cleft width and thinning of the postsynaptic density, and it significantly suppressed the down-regulation of intracellular calcium/calmodulin-dependent protein kinase II expression in the hippocampal CA3 region. Repeated electroacupuncture intervention had a cumulative analgesic effect on injury-induced neuropathic pain reactions, and it led to synaptic remodeling of hippocampal neurons and upregulated calcium/calmodulin-dependent protein kinase II expression in the hippocampal CA3 region. PMID:25657670
... Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Amniotic band sequence URL of this page: //medlineplus.gov/ency/ ... birth. The baby should be delivered in a medical center that has specialists experienced in caring for babies ... or partial loss of function of a body part. Congenital bands affecting large parts of the body cause the ...
Directory of Open Access Journals (Sweden)
Mayra Rodrigues Gomes
2008-11-01
Full Text Available O presente artigo traz reflexões sobre os resultados parciais do trabalho de pesquisa desenvolvido em relação às expressões censuradas em peças teatrais, a partir do arquivo Miroel Silveira, que contém os processos de censura ao teatro, de 1925 a 1968. No presente estágio da pesquisa, foi possível constatar que a censura privilegiou termos relacionados à condução do corpo — exposição, gestos, trajes, sexualidade —, de um ponto de vista moral. Tornou-se necessário, portanto, um esforço para abarcar motivos e implicações desse tipo de intervenção, esforço aqui apresentado. Censorship and the use of pleasures: communication under constriction — This paper ponders upon the partial results of a research work concerning censored expressions in stage plays, based on the Miroel Silveira Archives, which contain the theater censorship processes dating from 1925 to 1968. At this point in our investigation, we have found that censorship concentrated on expressions relating to body postures — exposure, gestures, costumes, sexuality —, in short, a moral point of view. This finding led to an endeavor to understand the motives and implications of this kind of intervention, an undertaking that is presented herein.
Obecná strupovitost brambor a možná ochrana v pěstitelské praxi
Czech Academy of Sciences Publication Activity Database
Krištůfek, Václav; Diviš, J.; Kopecký, J.; Ságová-Marečková, M.
2011-01-01
Roč. 59, č. 4 (2011), s. 67-68 ISSN 0139-6013 R&D Projects: GA MZe QH92151 Institutional research plan: CEZ:AV0Z60660521 Keywords : map files * disease prevention * soil Subject RIV: EH - Ecology, Behaviour
Czech Academy of Sciences Publication Activity Database
Tkadlec, Emil; Heroldová, Marta; Víšková, V.; Bednář, M.; Zejda, Jan
2012-01-01
Roč. 61, 3-4 (2012), s. 246-253 ISSN 0139-7893 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Cricetus cricetus * questionnaire * Rodentia Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012
Dynamics of nitrogenous substances content in the diet of the wood mouse (Apodemus sylvaticus)
Czech Academy of Sciences Publication Activity Database
Čepelka, L.; Heroldová, Marta; Jánová, E.; Suchomel, J.
2013-01-01
Roč. 61, č. 5 (2013), s. 1247-1253 ISSN 1211-8516 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Apodemus sylvaticus * wood mouse * diet quality * near-infrared spectroscopy * nitrogenous substances Subject RIV: EG - Zoology
Species-specific PCR primers for detection of Xanthomonas vesicatoria
Czech Academy of Sciences Publication Activity Database
Beran, P.; Mráz, Ivan
2013-01-01
Roč. 43, Jan (2013), s. 213-215 ISSN 0261-2194 R&D Projects: GA MZe QH71229 Institutional support: RVO:60077344 Keywords : Bacterial spot * Tomato * Pepper Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.539, year: 2013
Simakova, Maria N; Bisen, Shivantika; Dopico, Alex M; Bukiya, Anna N
2017-12-01
Statins constitute the most commonly prescribed drugs to decrease cholesterol (CLR). CLR is an important modulator of alcohol-induced cerebral artery constriction (AICAC). Using rats on a high CLR diet (2% CLR) we set to determine whether atorvastatin administration (10mg/kg daily for 18-23weeks) modified AICAC. Middle cerebral arteries were pressurized in vitro at 60mmHg and AICAC was evoked by 50mM ethanol, that is within the range of blood alcohol detected in humans following moderate-to-heavy drinking. AICAC was evident in high CLR+atorvastatin group but not in high CLR diet+placebo. Statin exacerbation of AICAC persisted in de-endothelialized arteries, and was blunted by CLR enrichment in vitro. Fluorescence imaging of filipin-stained arteries showed that atorvastatin decreased vascular smooth muscle (VSM) CLR when compared to placebo, this difference being reduced by CLR enrichment in vitro. Voltage- and calcium-gated potassium channels of large conductance (BK) are known VSM targets of ethanol, with their beta1 subunit being necessary for ethanol-induced channel inhibition and resulting AICAC. Ethanol-induced BK inhibition in excised membrane patches from freshly isolated myocytes was exacerbated in the high CLR diet+atorvastatin group when compared to high CLR diet+placebo. Unexpectedly, atorvastatin decreased the amount and function of BK beta1 subunit as documented by immunofluorescence imaging and functional patch-clamp studies. Atorvastatin exacerbation of ethanol-induced BK inhibition disappeared upon artery CLR enrichment in vitro. Our study demonstrates for the first time statin's ability to exacerbate the vascular effect of a widely consumed drug of abuse, this exacerbation being driven by statin modulation of ethanol-induced BK channel inhibition in the VSM via CLR-mediated mechanism. Copyright © 2017 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Jacobsen, Jens Christian Brings; Beierholm, Ulrik; Mikkelsen, Rene
2002-01-01
Vascular damage induced by acute hypertension is preceded by a peculiar pattern where blood vessels show alternating regions of constrictions and dilations ("sausages on a string"). The pattern occurs in the smaller blood vessels, and it plays a central role in causing the vascular damage. A rela...... phenomenon. Experimental data suggest that the structural changes induced by the instability may cause secondary damage to the wall of small arteries and arterioles in the form of endothelial hyperpermeability followed by local fibrinoid necrosis of the vascular wall.......Vascular damage induced by acute hypertension is preceded by a peculiar pattern where blood vessels show alternating regions of constrictions and dilations ("sausages on a string"). The pattern occurs in the smaller blood vessels, and it plays a central role in causing the vascular damage....... A related vascular pattern has been observed in larger vessels from several organs during angiography. In the larger vessels the occurrence of the pattern does not appear to be related to acute hypertension. A unifying feature between the phenomenon in large and small vessels seems to be an increase...
Shin, J.; Narayanaswamy, V.; Raja, L.; Clemens, N.
2006-10-01
A study of flow actuation phenomena of DC discharge will be presented. An array of pin-like electrodes is flush mounted on a co-planar ceramic actuator that is inserted in the test section. The different discharge structures -- diffuse, constricted, and mixed mode -- are observed in the presence of a flow. A discernable actuation, as visualized by schlieren imaging, is achieved by diffuse discharge, whereas the constricted discharge does not show detectable flow perturbation at the same current. The flow actuation in the form of an induced oblique shock occurs within one frame of laser schlieren imaging at 4.5 kHz. Rotational (gas) and vibrational temperatures are measured by fitting spectra of N2 and N2+ bands near 365-395 nm. Electronic temperatures are measured using Boltzmann plot of Fe (I) lines. Gas temperatures of diffuse discharges drop from ˜1500 K to ˜500 K in the presence of a flow while vibrational and electronic temperatures remain almost the same at ˜3000 K and ˜1.25 eV, respectively. Gas temperatures of constricted discharge are found to be similar with diffuse discharge whereas only diffuse discharge shows an actuation. An examination of spatial extent of the plasma reveals that the diffuse discharge occupies a larger region of the flow than the constricted discharge. This indicates that the flow actuation is dependent on flow dilatation which is governed by temperature rise as well as the spatial extent over which the temperature rise is observed.
Czech Academy of Sciences Publication Activity Database
Frouzová, Jaroslava; Porak, W. F.; Johnson, W. E.
2013-01-01
Roč. 29, č. 6 (2013), s. 1364-1366 ISSN 0175-8659 R&D Projects: GA MZe(CZ) QH81046 Institutional support: RVO:60077344 Keywords : largemouth bass * feeding behavior * novel prey Subject RIV: GL - Fishing Impact factor: 0.903, year: 2013
Lifescience Database Archive (English)
Full Text Available ted Amino Acid sequence ---xxxpxxxxxxxxxkvxxxxxxxxxxxxxxvfxxxxxxxxxw*XLXXGXXXXXXX...Translated Amino Acid sequence (All Frames) Frame A: ---fxxxxxvxxxxxxxgxxxfxxxxxxxxxxgxxxxxxxxfxxvxixxwxxx...xxxqxpk rxxxpxgxxikrwyanxcqnixw*dhhxxs*glr*y*kc*xkdsrqrryptrptkinfrw *tirrwsysl*lqh...rs*r**qh*ecknknsrqrryptrstts Frame B: ---xxxpxxxxxxxxxkvxxxxxxxxxxxxxxvfxxxxxxxxx...QDKEGIPPDQQRL Frame C: ---xxxxxgxxxxxxxrxxxxxnxxxxxxxxxxsxxxxxxixxgxxxxmvgxxxixxskk nxlsxwsxd*evvckxlskh*xvg
Stigter, E.C.A.; Jong, G.A.H. de; Jongejan, J.A.; Duine, J.A.; Lugt, J.P. van der; Somers, W.A.C.
1996-01-01
A quinohemoprotein alcohol dehydrogenase (QH-EDH) from Comamonas testosteroni was immobilized on an electrode in a redox polymer network consisting of a polyvinylpyridine partially N-complexed with osmiumbis-(bipyridine)chloride. The enzyme effectively transfers electrons to the electrode via the
Czech Academy of Sciences Publication Activity Database
Obdržálková, D.; Zapletal, M.; Zejda, J.; Heroldová, Marta
2008-01-01
Roč. 2008, č. 2 (2008), s. 13-14 ISSN 1211-3565 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : common vole * population densities Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection
Počty nor užívaných hrabošem polním na jaře 2008
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Obdržálková, D.; Zapletal, M.; Zejda, J.
2008-01-01
Roč. 2008, č. 6 (2008), s. 9-10 ISSN 1211-3565 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : common vole * population development Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection
Škody způsobené hraboši na lesní výsadbě v kontextu globálních změn klimatu
Czech Academy of Sciences Publication Activity Database
Homolka, Miloslav; Heroldová, Marta; Zejda, Jan
2013-01-01
Roč. 92, č. 1 (2013), s. 22-23 ISSN 0322-9254 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : forest regeneration * voles * bark damage * climate changes Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Suchomel, J.; Purchart, L.; Homolka, Miloslav
2008-01-01
Roč. 1, č. 1 (2008), s. 33-35 ISSN 1803-2451 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : artificial forest plantations * forest regeneration * herbivorous rodent species Subject RIV: EH - Ecology, Behaviour
Czech Academy of Sciences Publication Activity Database
Říha, Milan; Jůza, Tomáš; Prchalová, Marie; Mrkvička, Tomáš; Čech, Martin; Draštík, Vladislav; Muška, Milan; Kratochvíl, Michal; Peterka, Jiří; Tušer, Michal; Vašek, Mojmír; Kubečka, Jan
2012-01-01
Roč. 127, September (2012), s. 56-60 ISSN 0165-7836 R&D Projects: GA MZe(CZ) QH81046 Institutional support: RVO:60077344 Keywords : quantitative sampling * gear selectivity * trawl * reservoirs Subject RIV: GL - Fishing Impact factor: 1.695, year: 2012
Aerační a destratifikační technologie pro vodní nádrže
Czech Academy of Sciences Publication Activity Database
Maršálek, Blahoslav; Pochylý, F.; Maršálková, Eliška; Plotěný, Miroslav
2011-01-01
Roč. 61, č. 5 (2011), s. 188-190 ISSN 1211-0760 R&D Projects: GA MŠk 1M0571; GA MZe QH81012 Institutional research plan: CEZ:AV0Z60050516 Keywords : cyanobacteria * aeration * destratification Subject RIV: EF - Botanics
Czech Academy of Sciences Publication Activity Database
Sarkisova, Tatiana; Petrzik, Karel
2011-01-01
Roč. 156, č. 1 (2011), s. 167-169 ISSN 0304-8608 R&D Projects: GA MZe QH71145 Institutional research plan: CEZ:AV0Z50510513 Keywords : plants * virus * motif Subject RIV: EE - Microbiology, Virology Impact factor: 2.111, year: 2011
Eco-Friendly Alternative Refrigeration Systems -R-ES-O-N-A-N--CE ...
Indian Academy of Sciences (India)
An electrical signal may be converted to acoustical (i.e. ... Thermoacoustic Refrigeration System. In a simple ... Tc and rejecting Wclste heat power Qh to a heat sink at T h. •. In .... use where eco-friendliness, simplicity, reliability or low cost is.
Patterns of vole gnawing on saplings in managed clearings in Central European forests
Czech Academy of Sciences Publication Activity Database
Krojerová-Prokešová, Jarmila; Homolka, Miloslav; Heroldová, Marta; Barančeková, Miroslava; Baňař, P.; Kamler, Jiří; Modlinger, R.; Purchart, L.; Zejda, Jan; Suchomel, J.
2018-01-01
Roč. 408, January (2018), s. 137-147 ISSN 0378-1127 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Bark gnawing * Clear-cuts * Damage * Rodents * Saplings * Small mammals Subject RIV: GK - Forestry Impact factor: 3.064, year: 2016
Sequence Classification: 799288 [
Lifescience Database Archive (English)
Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|58269116|ref|XP_571714.1| electron... transporter, transferring electrons within CoQH2-cytochrome c reductase complex, putative || http://www.ncbi.nlm.nih.gov/protein/58269116 ...
Czech Academy of Sciences Publication Activity Database
Beran, P.; Mráz, Ivan; Kokošková, B.; Bohatá, A.
2015-01-01
Roč. 141, č. 3 (2015), s. 617-621 ISSN 0929-1873 R&D Projects: GA MZe QH71229 Institutional support: RVO:60077344 Keywords : Oligonucleotides * atpD * Xanthomonas euvesicatoria * Lycopersicon esculentum Subject RIV: EE - Microbiology, Virology Impact factor: 1.494, year: 2015
Pea Streak Virus Recorded in Europe
Czech Academy of Sciences Publication Activity Database
Sarkisova, Tatiana; Bečková, M.; Fránová, Jana; Petrzik, Karel
2016-01-01
Roč. 52, č. 3 (2016), s. 164-166 ISSN 1212-2580 R&D Projects: GA MZe QH71145 Institutional support: RVO:60077344 Keywords : Pea streak virus * alfalfa * carlavirus * partial sequence Subject RIV: EE - Microbiology, Virology Impact factor: 0.742, year: 2016
Monitoring a předpovídání populační početnosti hraboše polního
Czech Academy of Sciences Publication Activity Database
Tkadlec, Emil; Heroldová, Marta; Obdržálková, D.; Zejda, J.; Zapletal, M.
2010-01-01
Roč. 2010, č. 5 (2010), s. 15-17 ISSN 1211-3565 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : Microtus arvalis * forecasting * modelling * population dynamics Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection
Allelopathic activity of extracts from Impatiens species
Czech Academy of Sciences Publication Activity Database
Vrchotová, Naděžda; Šerá, Božena; Krejčová, J.
2011-01-01
Roč. 57, č. 2 (2011), s. 57-60 ISSN 1214-1178 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z60870520 Keywords : Impatiens * allelopathy * inhibitory effect Subject RIV: EH - Ecology, Behaviour Impact factor: 1.078, year: 2011
Solid-phase extraction NMR studies of chromatographic fractions of saponins from Quillaja saponaria.
Nyberg, Nils T; Baumann, Herbert; Kenne, Lennart
2003-01-15
The saponin mixture QH-B from the tree Quillaja saponaria var. Molina was fractionated by RP-HPLC in several steps. The fractions were analyzed by solid-phase extraction NMR (SPE-NMR), a technique combining the workup by solid-phase extraction with on-line coupling to an NMR flow probe. Together with MALDI-TOF mass spectrometry and comparison with chemical shifts of similar saponins, the structures of both major and minor components in QH-B could be obtained. The procedure described is a simple method to determine the structure of components in a complex mixture. The two major fractions of the mixture were found to contain at least 28 saponins, differing in the carbohydrate substructures. Eight of these have not previously been determined. The 28 saponins formed 14 equilibrium pairs by the migration of an O-acyl group between two adjacent positions on a fucosyl residue.
Robust gap repair in the contractile ring ensures timely completion of cytokinesis.
Silva, Ana M; Osório, Daniel S; Pereira, Antonio J; Maiato, Helder; Pinto, Inês Mendes; Rubinstein, Boris; Gassmann, Reto; Telley, Ivo Andreas; Carvalho, Ana Xavier
2016-12-19
Cytokinesis in animal cells requires the constriction of an actomyosin contractile ring, whose architecture and mechanism remain poorly understood. We use laser microsurgery to explore the biophysical properties of constricting rings in Caenorhabditis elegans embryos. Laser cutting causes rings to snap open. However, instead of disintegrating, ring topology recovers and constriction proceeds. In response to severing, a finite gap forms and is repaired by recruitment of new material in an actin polymerization-dependent manner. An open ring is able to constrict, and rings repair from successive cuts. After gap repair, an increase in constriction velocity allows cytokinesis to complete at the same time as controls. Our analysis demonstrates that tension in the ring increases while net cortical tension at the site of ingression decreases throughout constriction and suggests that cytokinesis is accomplished by contractile modules that assemble and contract autonomously, enabling local repair of the actomyosin network. Consequently, cytokinesis is a highly robust process impervious to discontinuities in contractile ring structure. © 2016 Silva et al.
All-Atom Molecular Dynamics Simulation of Protein Translocation through an α-Hemolysin Nanopore
Di Marino, Daniele
2015-08-06
© 2015 American Chemical Society. Nanopore sensing is attracting the attention of a large and varied scientific community. One of the main issues in nanopore sensing is how to associate the measured current signals to specific features of the molecule under investigation. This is particularly relevant when the translocating molecule is a protein and the pore is sufficiently narrow to necessarily involve unfolding of the translocating protein. Recent experimental results characterized the cotranslocational unfolding of Thioredoxin (Trx) passing through an α-hemolisin pore, providing evidence for the existence of a multistep process. In this study we report the results of all-atom molecular dynamics simulations of the same system. Our data indicate that Trx translocation involves two main barriers. The first one is an unfolding barrier associated with a translocation intermediate where the N-terminal region of Trx is stuck at the pore entrance in a conformation that strongly resembles the native one. After the abrupt unfolding of the N-terminal region, the Trx enters the α-hemolisin vestibule. During this stage, the constriction is occupied not only by the translocating residue but also by a hairpin-like structure forming a tangle in the constriction. The second barrier is associated with the disentangling of this region.
All-Atom Molecular Dynamics Simulation of Protein Translocation through an α-Hemolysin Nanopore
Di Marino, Daniele; Bonome, Emma Letizia; Tramontano, Anna; Chinappi, Mauro
2015-01-01
© 2015 American Chemical Society. Nanopore sensing is attracting the attention of a large and varied scientific community. One of the main issues in nanopore sensing is how to associate the measured current signals to specific features of the molecule under investigation. This is particularly relevant when the translocating molecule is a protein and the pore is sufficiently narrow to necessarily involve unfolding of the translocating protein. Recent experimental results characterized the cotranslocational unfolding of Thioredoxin (Trx) passing through an α-hemolisin pore, providing evidence for the existence of a multistep process. In this study we report the results of all-atom molecular dynamics simulations of the same system. Our data indicate that Trx translocation involves two main barriers. The first one is an unfolding barrier associated with a translocation intermediate where the N-terminal region of Trx is stuck at the pore entrance in a conformation that strongly resembles the native one. After the abrupt unfolding of the N-terminal region, the Trx enters the α-hemolisin vestibule. During this stage, the constriction is occupied not only by the translocating residue but also by a hairpin-like structure forming a tangle in the constriction. The second barrier is associated with the disentangling of this region.
Energy Technology Data Exchange (ETDEWEB)
Xu, Ya-Qiong [Department of Pharmacology, Ningxia Medical university, Yinchuan 750000 (China); Jin, Shao-Ju [Department of Pharmacology, Ningxia Medical university, Yinchuan 750000 (China); Luohe Medical College, Luohe 462002, Henan Province (China); Liu, Ning [Department of Pharmacology, Ningxia Medical university, Yinchuan 750000 (China); Li, Yu-Xiang [College of Nursing, Ningxia Medical University, Yinchuan 750004 (China); Zheng, Jie [Department of Pharmacology, Ningxia Medical university, Yinchuan 750000 (China); Ma, Lin [Ningxia Key Lab of Craniocerebral Diseases of Ningxia Hui Autonomous Region, Ningxia Medical University, Yinchuan 750004 (China); Du, Juan; Zhou, Ru [Department of Pharmacology, Ningxia Medical university, Yinchuan 750000 (China); Zhao, Cheng-Jun [Key Laboratory of Fertility Preservation and Maintenance of Ministry of Education, Ningxia Medical University, Yinchuan 750000 (China); Niu, Yang [Key Laboratory of Hui Ethnic Medicine Modernization, Ministry of Education, Ningxia Medical University, Yinchuan 750004 (China); Sun, Tao [Ningxia Key Lab of Craniocerebral Diseases of Ningxia Hui Autonomous Region, Ningxia Medical University, Yinchuan 750004 (China); Yu, Jian-Qiang, E-mail: Yujq910315@163.com [Department of Pharmacology, Ningxia Medical university, Yinchuan 750000 (China); Luohe Medical College, Luohe 462002, Henan Province (China)
2014-09-05
Highlights: • Aloperine has anti-nociceptive effects on neuropathic pain induced CCI. • Aloperine reduces ROS in neuropathic pain mice. • Aloperine down-regulates the expression of NF-κB and its downstream pro-inflammatory cytokines in neuropathic pain mice. - Abstract: Objective: To investigate whether aloperine (ALO) has antinociceptive effects on neuropathic pain induced by chronic constriction injury, whether ALO reduces ROS against neuropathic pain, and what are the mechanisms involved in ALO attenuated neuropathic pain. Methods: Mechanical and cold allodynia, thermal and mechanical hyperalgesia and spinal thermal hyperalgesia were estimated by behavior methods such as Von Frey filaments, cold-plate, radiant heat, paw pressure and tail immersion on one day before surgery and days 7, 8, 10, 12 and 14 after surgery, respectively. In addition, T-AOC, GSH-PX, T-AOC and MDA in the spinal cord (L4/5) were measured to evaluate anti-oxidation activity of ALO on neuropathic pain. Expressions of NF-κB and pro-inflammatory cytokines (TNF-α, IL-6, IL-1β) in the spinal cord (L4/5) were analyzed by using Western blot. Results: Administration of ALO (80 mg/kg and 40 mg/kg, i.p.) significantly increased paw withdrawal threshold, paw pressure, paw withdrawal latencies, tail-curling latencies, T-AOC, GSH-PX and T-SOD concentration, reduced the numbers of paw lifts and MDA concentration compared to CCI group. ALO attenuated CCI induced up-regulation of expressions of NF-κB, TNF-α, IL-6, IL-1β at the dose of 80 mg/kg (i.p.). Pregabalin produced similar effects serving as positive control at the dose of 10 mg/kg (i.p.). Conclusion: ALO has antinociceptive effects on neuropathic pain induced by CCI. The antinociceptive effects of ALO against neuropathic pain is related to reduction of ROS, via suppression of NF-κB pathway.
International Nuclear Information System (INIS)
Xu, Ya-Qiong; Jin, Shao-Ju; Liu, Ning; Li, Yu-Xiang; Zheng, Jie; Ma, Lin; Du, Juan; Zhou, Ru; Zhao, Cheng-Jun; Niu, Yang; Sun, Tao; Yu, Jian-Qiang
2014-01-01
Highlights: • Aloperine has anti-nociceptive effects on neuropathic pain induced CCI. • Aloperine reduces ROS in neuropathic pain mice. • Aloperine down-regulates the expression of NF-κB and its downstream pro-inflammatory cytokines in neuropathic pain mice. - Abstract: Objective: To investigate whether aloperine (ALO) has antinociceptive effects on neuropathic pain induced by chronic constriction injury, whether ALO reduces ROS against neuropathic pain, and what are the mechanisms involved in ALO attenuated neuropathic pain. Methods: Mechanical and cold allodynia, thermal and mechanical hyperalgesia and spinal thermal hyperalgesia were estimated by behavior methods such as Von Frey filaments, cold-plate, radiant heat, paw pressure and tail immersion on one day before surgery and days 7, 8, 10, 12 and 14 after surgery, respectively. In addition, T-AOC, GSH-PX, T-AOC and MDA in the spinal cord (L4/5) were measured to evaluate anti-oxidation activity of ALO on neuropathic pain. Expressions of NF-κB and pro-inflammatory cytokines (TNF-α, IL-6, IL-1β) in the spinal cord (L4/5) were analyzed by using Western blot. Results: Administration of ALO (80 mg/kg and 40 mg/kg, i.p.) significantly increased paw withdrawal threshold, paw pressure, paw withdrawal latencies, tail-curling latencies, T-AOC, GSH-PX and T-SOD concentration, reduced the numbers of paw lifts and MDA concentration compared to CCI group. ALO attenuated CCI induced up-regulation of expressions of NF-κB, TNF-α, IL-6, IL-1β at the dose of 80 mg/kg (i.p.). Pregabalin produced similar effects serving as positive control at the dose of 10 mg/kg (i.p.). Conclusion: ALO has antinociceptive effects on neuropathic pain induced by CCI. The antinociceptive effects of ALO against neuropathic pain is related to reduction of ROS, via suppression of NF-κB pathway
Nanowire structures and electrical devices
Bezryadin, Alexey; Remeika, Mikas
2010-07-06
The present invention provides structures and devices comprising conductive segments and conductance constricting segments of a nanowire, such as metallic, superconducting or semiconducting nanowire. The present invention provides structures and devices comprising conductive nanowire segments and conductance constricting nanowire segments having accurately selected phases including crystalline and amorphous states, compositions, morphologies and physical dimensions, including selected cross sectional dimensions, shapes and lengths along the length of a nanowire. Further, the present invention provides methods of processing nanowires capable of patterning a nanowire to form a plurality of conductance constricting segments having selected positions along the length of a nanowire, including conductance constricting segments having reduced cross sectional dimensions and conductance constricting segments comprising one or more insulating materials such as metal oxides.
Küpper, Thomas; Hettlich, Malaika; Horz, Hans-Peter; Lechner, Karin; Scharfenberg, Christine; Conrads, Georg; Yekta, Said S; Lampert, Friedrich; Gore, Claudia
2014-04-01
Dental problems are rarely mentioned in the training of medical students or physicians in travel medicine, and there are little data on dental problems of travellers in the literature. We studied the epidemiology of dental problems amongst trekkers in Nepal to develop strategies for preventive care during/before travelling and propose a curriculum for dental First Aid training. We undertook a prospective, cross-sectional questionnaire and clinical dental survey of Trekkers at Manang (3550 m, Annapurna Circuit, Nepal). The questionnaire was developed based on published literature and clinical experience (exploring: availability of dental kits, dental history, current dental problems, and nutritional behavior). Dental examination included: dental status, papillary bleeding index (PBI), and plaque index (Quigley and Hein; QH). Questionnaire and clinical findings were compared to data of the Annapurna Conservancy Authority about the number of days of trekkers in the region to estimate the incidence of dental problems of trekkers. None of the 309 participants carried a dental first aid kit. Dental problems, potentially treatable with a dental first aid kit, were reported by 50/309 (16.5%). Oral hygiene en route was significantly worse than home hygiene practice; overall increased plaque indices were found (Median QH: 2.25 in women; 2.36 in men). Participants who visited a dentist ≤6 months before departure had significantly fewer problems, and had lower PBI [males 0.07 (IQR 0.0 to 0.29), females 0.0 (IQR 0.0 to 0.11)]. Combining our findings with data of the park authorities on person days in the region (2007), we found a risk of dental problems as follows: any dental problem 1:23.7 trekking days; gingival bleeding 1:37.7 trekking days; dental pain 1:145.2 trekking days; lost fillings 1:339 trekking days; fractured teeth 1:509 trekking days. Dental problems can pose significant discomfort for anybody travelling in regions with low/missing infrastructure. Improved
Bark chemical analysis explains selective bark damage by rodents
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Jánová, Eva; Suchomel, J.; Purchart, L.; Homolka, Miloslav
2009-01-01
Roč. 2, č. 2 (2009), s. 137-140 ISSN 1803-2451 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : bark damage * bark selection * bark chemical analysis * rowan * beech * spruce * mountain forest regeneration Subject RIV: GK - Forestry
The role of granivorous rodents in beech forest regeneration in the Beskydy Mts. (Czech Republic)
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Suchomel, J.; Purchart, L.; Homolka, Miloslav
2008-01-01
Roč. 1, č. 2 (2008), s. 131-134 ISSN 1803-2451 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : beech mast biomass * granivorous rodents * daily consumption rate * mountain beech forest * regeneration Subject RIV: EH - Ecology, Behaviour
Herbivore impact on beech in selected tree plantations in the Beskydy and Jeseniky Mountains
Czech Academy of Sciences Publication Activity Database
Suchomel, J.; Heroldová, Marta; Purchart, L.; Homolka, Miloslav
2010-01-01
Roč. 3, č. 2 (2010), s. 187-192 ISSN 1803-2451 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : browsing on tree species * man-made plantations * red deer * roe deer * brown hare Subject RIV: GK - Forestry
Lifescience Database Archive (English)
Full Text Available GAAGTTGAAGGTAGTGACAACATT GAGAATGTAAAAACAAAAATTCAAGACAAAGAAGGTATCCCA sequence update 2001. 6. 1 Translated Amino Acid sequence ---xxxx...xxxxxxxi*XXFXXXXVXXXXXXVXFXXVXXXXMVXXLXXNIQKXXXXHLVLX LX... sequence (All Frames) Frame A: ---xxxxxxvxxxxnlkxxxxkxxfxxxxxxxxxxgxxxxxgxxsxxqypkxxxx...rs*rf**h*ec*sqnprqrrystrs ttshfrr*tiggwsysl*lqhskgihspfssqikrwyanfcknshw*nhytrs*r**qh* ecknknsrqrryp Frame B: ---xxxxxxxxxxx...FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIE NVKTKIQDKEGIP Frame C: ---pxxxxgxxtxkfkxxsxxxxfxxxsxxfxfxw*xxxxwxxxxxx
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Suchomel, J.; Purchart, L.; Čepelka, L.
2013-01-01
Roč. 6, č. 1 (2013), s. 27-32 ISSN 1803-2451 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : beech mountain forests * biomass of beechnuts harvest * diet supply for granivorous species Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection
Czech Academy of Sciences Publication Activity Database
Pavingerová, Daniela; Bříza, Jindřich; Niedermeierová, Hana; Vlasák, Josef
2011-01-01
Roč. 57, č. 7 (2011), s. 277-280 ISSN 1212-4834 R&D Projects: GA MZe QH71290 Institutional research plan: CEZ:AV0Z50510513 Keywords : Agrobacterium tumefaciens * genetic engineering * GUS activity * Picea abies (L.) Karst Subject RIV: EB - Genetic s ; Molecular Biology
Vliv pěstování GM kukuřice na vybrané necílové druhy členovců
Czech Academy of Sciences Publication Activity Database
Skoková Habuštová, Oxana; Svobodová, Zdeňka
2012-01-01
Roč. 60, č. 9 (2012), s. 29-32 ISSN 0139-6013 R&D Projects: GA MZe QH91093 Grant - others:GA JU(CZ) 04-062/2011/P Institutional research plan: CEZ:AV0Z50070508 Keywords : Diabrotica virgifera virgifera Subject RIV: EH - Ecology, Behaviour
Effect of Postmining Waters on Cyanobacterial Photosynthesis
Czech Academy of Sciences Publication Activity Database
Medová, Hana; Přikryl, I.; Zapomělová, Eliška; Pechar, L.
2015-01-01
Roč. 87, č. 2 (2015), s. 180-190 ISSN 1061-4303 R&D Projects: GA MZe QH82078 Institutional support: RVO:61388971 ; RVO:60077344 Keywords : acid ic waters * postmining area * Dolichospermum sp Subject RIV: EE - Microbiology, Virology Impact factor: 0.659, year: 2015
Czech Academy of Sciences Publication Activity Database
Malá, J.; Pavingerová, Daniela; Cvrčková, H.; Bříza, Jindřich; Dostál, J.; Šíma, P.
2009-01-01
Roč. 55, č. 4 (2009), s. 156-161 ISSN 1212-4834 R&D Projects: GA MZe QH71290 Institutional research plan: CEZ:AV0Z50510513 Keywords : somatic embryogenesis * Norway spruce * penicillin antibiotics * Agrobacterium tumefaciens * carbapenem antibiotics Subject RIV: EB - Genetics ; Molecular Biology
Czech Academy of Sciences Publication Activity Database
Malá, J.; Hrubcová, Marie; Máchová, P.; Cvrčková, H.; Martincová, Olga; Cvikrová, Milena
2011-01-01
Roč. 57, č. 1 (2011), s. 1-7 ISSN 1212-4834 R&D Projects: GA MZe QH82303 Institutional research plan: CEZ:AV0Z50380511 Keywords : defence response * Norway spruce * phenylpropanoids Subject RIV: GK - Forestry http://www.agriculturejournals.cz/publicFiles/33920.pdf
Aplikace centralizovaného telemetrického řídícího systému pro decentralizované čištění odpadních vod
Czech Academy of Sciences Publication Activity Database
Holba, Marek; Plotěný, K.; Sládek, R.; Tomšů, J.
2010-01-01
Roč. 60, č. 12 (2010), s. 347-349 ISSN 1211-0760 R&D Projects: GA MZe QH81012; GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : decentralized treatment * wastewater * centralized telemetric control system Subject RIV: EF - Botanics
Record of the invasive alien ladybird Harmonia axyridis (Coleoptera, Coccinellidae) from Kenya
Czech Academy of Sciences Publication Activity Database
Nedvěd, Oldřich; Háva, J.; Kulíková, D.
-, č. 106 (2011), s. 77-81 ISSN 1313-2989 Grant - others:Ministry of Agriculture of Czech Republic(CZ) QH82047 Institutional research plan: CEZ:AV0Z50070508 Keywords : multicolored Asian ladybird * distribution * new record Subject RIV: EG - Zoology Impact factor: 0.879, year: 2011
Effect of stacking fault energy on steady-state creep rate of face ...
African Journals Online (AJOL)
Continuum elastic theory was used to establish the relationships between the force of interaction required to constrict dislocation partials, energy of constriction and climb velocity of the constricted thermal jogs, in order to examine the effect of stacking fault energy (SFE) on steady state creep rate of face centered cubic ...
International Nuclear Information System (INIS)
Hudon, M.P.J.; Jamieson, W.R.E.; Qayumi, A.K.; Lyster, D.M.; Sartori, C.; Dougan, H.
1990-01-01
The purpose of this study was to examine the longitudinal effect of gradual coronary occlusion on regional myocardial metabolism of 15-p- 123 I-iodophenyl pentadecanoic acid ([ 123 I]IPPA). Adult dogs were images using [ 123 I]IPPA and planar gamma imaging. A thoracotomy as performed and an ameroid constricter of appropriate size permanently positioned on the left anterior descending artery. The dogs were imaged after injection of 3-5 mCi [ 123 I]IPPA at various times over a 2-week period. With imaging on days 7 and 14, the dogs were paced at a rate of 185. Time-activity curves were generated and t 1/2 values calculated using monoexponential curve fitting. Results indicate a significant increase in t 1/2 between control and 14 days after surgery in the apical wall (29±7 to 53±18 min; P 1/2 in the lateral wall, this was not significant (27±8 to 78±99 min; P>0.05). There was no significant change in t 1/2 in the septal wall (27±9 to 33±8 min; P>0.05). We conclude that [ 123 I]IPPA is a useful indicator of developing myocardial ischemia. (orig.)
Progress Towards Increased Understanding and Control of Internal Transport Barriers on DIII-D
Energy Technology Data Exchange (ETDEWEB)
Doyle, E. J. [University of California, Los Angeles; Greenfield, C. M. [General Atomics; Austin, M. E. [University of Texas, Austin; Baylor, Larry R [ORNL; Burrell, K. H. [General Atomics; Casper, T. A. [Lawrence Livermore National Laboratory (LLNL); DeBoo, J. C. [General Atomics; Ernst, D. R. [Princeton Plasma Physics Laboratory (PPPL); Fenzi, C. [University of Wisconsin, Madison; Gohil, P. [General Atomics; Groebner, R. J. [General Atomics; Heidbrink, W. W. [University of California, Irvine; Jackson, G. L. [General Atomics; Jernigan, Thomas C [ORNL; Kinsey, J. E. [Lehigh University, Bethlehem, PA; Lao, L. L. [General Atomics; Makowski, M. A. [Lawrence Livermore National Laboratory (LLNL); Mckee, G. R. [University of Wisconsin, Madison; Murakami, Masanori [ORNL; Peebles, W. A. [University of California, Los Angeles; Prater, R. [General Atomics; Rettig, C. L. [University of California, Los Angeles; Rhodes, T. L. [University of California, Los Angeles; Rost, J. C. [Massachusetts Institute of Technology (MIT); Staebler, G. M. [General Atomics; Stallard, B. W. [Lawrence Livermore National Laboratory (LLNL); Strait, E. J. [General Atomics; Synakowski, E. J. [Princeton Plasma Physics Laboratory (PPPL); Thomas, D. M. [General Atomics; Wade, Mickey R [ORNL; Waltz, R. E. [General Atomics; Zeng, L. [University of California, Los Angeles
2001-01-01
Substantial progress has been made towards both understanding and control of internal transport barriers (ITBs) on DIII-D, resulting in the discovery of a new sustained high performance operating mode termed the Quiescent Double-Barrier (QDB) regime. The QDB regime combines core transport barriers with a quiescent, ELM-free H-mode edge (termed QH-mode), giving rise to separate (double) core and edge transport barriers. The core and edge barriers are mutually compatible and do not merge, resulting in broad core profiles with an edge pedestal. The QH-mode edge is characterized by ELM-free behavior with continuous multiharmonic MHD activity in the pedestal region, and has provided density and impurity control for 3.5 s (>20 τE) with divertor pumping. QDB plasmas are long-pulse high-performance candidates, having maintained a βNH89 product of 7 for 5 energy confinement times (Ti ≤ 16 keV, βN ≤ 2.9, H89 ≤ 2.4, τE ≤ 150 ms, DD neutron rate Sn ≤ 4x1015 s-1). The QDB regime has only been obtained in counter-NBI discharges (injection anti-parallel to plasma current) with divertor pumping. Other results include successful expansion of the ITB radius using (separately) both impurity injection and counter-NBI, and the formation of ITBs in the electron thermal channel using both ECH and strong negative central shear (NCS) at high power. These results are interpreted within a theoretical framework in which turbulence suppression is the key to ITB formation and control, and a decrease in core turbulence is observed in all cases of ITB formation.
Progress towards increased understanding and control of internal transport barriers (ITBs) on DIII-D
International Nuclear Information System (INIS)
Doyle, E.J.; Greenfield, C.M.; Austin, M.E.
2001-01-01
Substantial progress has been made towards both understanding and control of internal transport barriers (ITBs) on DIII-D, resulting in the discovery of a new sustained high performance operating mode termed the Quiescent Double-Barrier (QDB) regime. The QDB regime combines core transport barriers with a quiescent, ELM-free H-mode edge (termed QH-mode), giving rise to separate (double) core and edge transport barriers. The core and edge barriers are mutually compatible and do not merge, resulting in broad core profiles with an edge pedestal. The QH-mode edge is characterized by ELM-free behavior with continuous multiharmonic MHD activity in the pedestal region, and has provided density and impurity control for 3.5 s (>20 τ E ) with divertor pumping. QDB plasmas are long-pulse high-performance candidates, having maintained a β N H 89 product of 7 for 5 energy confinement times (T i ≤16 keV, β N ≤2.9, H 89 ≤2.4, τ E ≤150 ms, DD neutron rate S n ≤4x10 15 s -1 ). The QDB regime has only been obtained in counter-NBI discharges (injection anti-parallel to plasma current) with divertor pumping. Other results include successful expansion of the ITB radius using (separately) both impurity injection and counter-NBI, and the formation of ITBs in the electron thermal channel using both ECH and strong negative central shear (NCS) at high power. These results are interpreted within a theoretical framework in which turbulence suppression is the key to ITB formation and control, and a decrease in core turbulence is observed in all cases of ITB formation. (author)
Lifescience Database Archive (English)
Full Text Available A sequence update 2001. 6. 1 Translated Amino Acid sequence ---xvvxkxlxxxlxxxxxxxxxxgxxxyxkx*XKRXKTXKVXXXXNK...RLRGGMQIFVKTLTGKTITLEVEGSD NIENVKTKIQDKEGIP Translated Amino Acid sequence (All Frames) Frame A: ---xggxxx...fxxxfxxxxxxxxxxgxxxixkmxxxkixdkxgxxxxqqxlxxxgxqlxxx xxlxdynixkxstxhfsxxikrwyanfcqnx...xw*dyytxs*rx**hxec*xqnxxqxrys trxttfhfxr*tixgwsysl*lqhskgihspfsxqikrwyanfcknshw*nhytrs*r** qh*ecknknsrqrrys Frame B: ---xvvxkxlxxx...lxxxxxxxxxxgxxxyxkx*XKRXKTXKVXXXXNKXXFXXVXNXXMX XLXXIITXKXN
Hryzec vodní versus ovocné výsadby
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Zejda, Jan
2010-01-01
Roč. 2010, č. 3 (2010), s. 16-17 ISSN 1213-7596 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : water vole * pest species * tree plantations Subject RIV: GK - Forestry http://zahradaweb.cz/hryzec-vodni-versus-ovocne-vysadby/
GFLV coat protein constructs based on local isolates from the Czech Republic
Czech Academy of Sciences Publication Activity Database
Vlasák, Josef; Bříza, Jindřich; Niedermeierová, Hana; Pavingerová, Daniela; Eichmeier, A.; Baránek, M.; Pidra, M.
2012-01-01
Roč. 11, č. 5 (2012), s. 1133-1137 ISSN 1684-5315 R&D Projects: GA MZe QH91214 Institutional research plan: CEZ:AV0Z50510513 Keywords : Grapevine fanleaf virus * Vitis vinifera * resistance Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.573, year: 2010
Structure of small mammal communities on clearings in managed Central European forests
Czech Academy of Sciences Publication Activity Database
Krojerová-Prokešová, Jarmila; Homolka, Miloslav; Barančeková, Miroslava; Heroldová, Marta; Baňař, P.; Kamler, Jiří; Purchart, L.; Suchomel, J.; Zejda, Jan
2016-01-01
Roč. 367, 1 May 2016 (2016), s. 41-51 ISSN 0378-1127 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Clear-cuts * Forestry practice * Insectivores * Rodents * Small mammals * Species diversity Subject RIV: EH - Ecology, Behaviour Impact factor: 3.064, year: 2016
Chemical properties of forest soils as affected by nests of .i.Myrmica ruginodis./i. (Formicidae)
Czech Academy of Sciences Publication Activity Database
Véle, A.; Frouz, Jan; Holuša, J.; Kalčík, Jiří
2010-01-01
Roč. 65, č. 1 (2010), s. 122-127 ISSN 0006-3088 R&D Projects: GA MZe(CZ) QH81136 Institutional research plan: CEZ:AV0Z60660521 Keywords : ant nests * Myrmica * soil chemical properties Subject RIV: EH - Ecology, Behaviour Impact factor: 0.609, year: 2010
Biomass of Speckled Alder on an Air-Polluted Mountain Site and its Response to Fertilization
Czech Academy of Sciences Publication Activity Database
Kuneš, I.; Baláš, M.; Koňasová, T.; Špulák, O.; Balcar, V.; Bednářová Millerová, K.; Kacálek, D.; Jakl, M.; Zahradník, D.; Vítámvás, J.; Šťastná, J.; Jaklová Dytrtová, Jana
2014-01-01
Roč. 54, č. 6 (2014), s. 1421-1433 ISSN 0364-152X Grant - others:GA MZe(CZ) QH92087 Institutional support: RVO:61388963 Keywords : Alnus incana * site amelioration * biological amelioration * slow-acting amendments * ecosystem restoration Subject RIV: GK - Forestry Impact factor: 1.724, year: 2014
Czech Academy of Sciences Publication Activity Database
Matiašovič, J.; Štěpánová, H.; Volf, J.; Kubala, Lukáš; Ovesná, P.; Rychlík, I.; Faldyna, M.
2011-01-01
Roč. 150, 1-2 (2011), s. 167-172 ISSN 0378-1135 Grant - others:GA MZe(CZ) QH81062 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Salmonella * pig * lipopolysaccharide Subject RIV: BO - Biophysics Impact factor: 3.327, year: 2011
A simple method to correct the results of acoustic surveys for fish hidden in the dead zone
Czech Academy of Sciences Publication Activity Database
Tušer, Michal; Prchalová, Marie; Mrkvička, Tomáš; Frouzová, Jaroslava; Čech, Martin; Peterka, Jiří; Jůza, Tomáš; Vašek, Mojmír; Kratochvíl, Michal; Draštík, Vladislav; Kubečka, Jan
2013-01-01
Roč. 29, č. 2 (2013), s. 358-363 ISSN 0175-8659 R&D Projects: GA MZe(CZ) QH81046 Institutional support: RVO:60077344 Keywords : acoustic dead zone * benthic gillnet * freshwater benthic habitats * bottom slope Subject RIV: EH - Ecology, Behaviour Impact factor: 0.903, year: 2013
Czech Academy of Sciences Publication Activity Database
Špak, Josef; Přibylová, Jaroslava; Kubelková, Darina; Sedlák, J.; Paprštein, F.; Svobodová, L.
2010-01-01
Roč. 9, č. 8 (2010), s. 14-16 ISSN 1213-7596 R&D Projects: GA MZe QH91224 Institutional research plan: CEZ:AV0Z50510513 Keywords : Currant * Blackcurrant reversion virus * Gooseberry vein banding associated virus * Strawberry latent ringspot virus Subject RIV: EE - Microbiology, Virology
„Transgenní“ metabolom chmelu, některé aspekty jeho přípravy a perspektivy využití
Czech Academy of Sciences Publication Activity Database
Matoušek, Jaroslav
2012-01-01
Roč. 58, č. 1 (2012), s. 13-19 ISSN 0023-5830 R&D Projects: GA ČR GA521/08/0740; GA MZe QH81052 Institutional research plan: CEZ:AV0Z50510513 Keywords : lupulin * transgenosis * anticancerogenic compounds * biotechnology Subject RIV: EB - Genetics ; Molecular Biology
Jesse, Cristiano R; Wilhelm, Ethel A; Nogueira, Cristina W
2010-12-01
Neuropathic pain is associated with significant co-morbidities, including depression, which impact considerably on the overall patient experience. Pain co-morbidity symptoms are rarely assessed in animal models of neuropathic pain. Neuropathic pain is characterized by hyperexcitability within nociceptive pathways and remains difficult to treat with standard analgesics. The present study determined the effect of bis selenide and conventional antidepressants (fluoxetine, amitriptyline, and bupropion) on neuropathic pain using mechanical allodynic and on depressive-like behavior. Male mice were subjected to chronic constriction injury (CCI) or sham surgery and were assessed on day 14 after operation. Mice received oral treatment with bis selenide (1-5 mg/kg), fluoxetine, amitriptyline, or bupropion (10-30 mg/kg). The response frequency to mechanical allodynia in mice was measured with von Frey hairs. Mice were evaluated in the forced swimming test (FST) test for depression-like behavior. The CCI procedure produced mechanical allodynia and increased depressive-like behavior in the FST. All of the drugs produced antiallodynic effects in CCI mice and produced antidepressant effects in control mice without altering locomotor activity. In CCI animals, however, only the amitriptyline and bis selenide treatments significantly reduced immobility in the FST. These data demonstrate an important dissociation between the antiallodynic and antidepressant effects in mice when tested in a model of neuropathic pain. Depressive behavior in CCI mice was reversed by bis selenide and amitriptyline but not by the conventional antidepressants fluoxetine and buproprion. Bis selenide was more potent than the other drugs tested for antidepressant-like and antiallodynic effects in mice.
Synthetic Microwave Imaging Reflectometry diagnostic using 3D FDTD Simulations
Kruger, Scott; Jenkins, Thomas; Smithe, David; King, Jacob; Nimrod Team Team
2017-10-01
Microwave Imaging Reflectometry (MIR) has become a standard diagnostic for understanding tokamak edge perturbations, including the edge harmonic oscillations in QH mode operation. These long-wavelength perturbations are larger than the normal turbulent fluctuation levels and thus normal analysis of synthetic signals become more difficult. To investigate, we construct a synthetic MIR diagnostic for exploring density fluctuation amplitudes in the tokamak plasma edge by using the three-dimensional, full-wave FDTD code Vorpal. The source microwave beam for the diagnostic is generated and refelected at the cutoff surface that is distorted by 2D density fluctuations in the edge plasma. Synthetic imaging optics at the detector can be used to understand the fluctuation and background density profiles. We apply the diagnostic to understand the fluctuations in edge plasma density during QH-mode activity in the DIII-D tokamak, as modeled by the NIMROD code. This work was funded under DOE Grant Number DE-FC02-08ER54972.
Energy Technology Data Exchange (ETDEWEB)
Quinn, John
2009-11-30
Work related to this project introduced the idea of an effective monopole strength Q* that acted as the effective angular momentum of the lowest shell of composite Fermions (CF). This allowed us to predict the angular momentum of the lowest band of energy states for any value of the applied magnetic field simply by determining N{sub QP} the number of quasielectrons (QE) or quasiholes (QH) in a partially filled CF shell and adding angular momenta of the N{sub QP} Fermions excitations. The approach reported treated the filled CF level as a vacuum state which could support QE and QH excitations. Numerical diagonalization of small systems allowed us to determine the angular momenta, the energy, and the pair interaction energies of these elementary excitations. The spectra of low energy states could then be evaluated in a Fermi liquid-like picture, treating the much smaller number of quasiparticles and their interactions instead of the larger system of N electrons with Coulomb interactions.
Regionalism, Regionalization and Regional Development
Directory of Open Access Journals (Sweden)
Liviu C. Andrei
2016-03-01
Full Text Available Sustained development is a concept associating other concepts, in its turn, in the EU practice, e.g. regionalism, regionalizing and afferent policies, here including structural policies. This below text, dedicated to integration concepts, will limit on the other hand to regionalizing, otherwise an aspect typical to Europe and to the EU. On the other hand, two aspects come up to strengthen this field of ideas, i.e. the region (al-regionalism-(regional development triplet has either its own history or precise individual outline of terms.
Directory of Open Access Journals (Sweden)
Andreas Schaefer
Full Text Available Previous small animal models for simulation of mechanical unloading are solely performed in healthy or infarcted hearts, not representing the pathophysiology of hypertrophic and dilated hearts emerging in heart failure patients. In this article, we present a new and economic small animal model to investigate mechanical unloading in hypertrophic and failing hearts: the combination of transverse aortic constriction (TAC and heterotopic heart transplantation (hHTx in rats.To induce cardiac hypertrophy and failure in rat hearts, three-week old rats underwent TAC procedure. Three and six weeks after TAC, hHTx with hypertrophic and failing hearts in Lewis rats was performed to induce mechanical unloading. After 14 days of mechanical unloading animals were euthanatized and grafts were explanted for further investigations.50 TAC procedures were performed with a survival of 92% (46/50. When compared to healthy rats left ventricular surface decreased to 5.8±1.0 mm² (vs. 9.6± 2.4 mm² (p = 0.001 after three weeks with a fractional shortening (FS of 23.7± 4.3% vs. 28.2± 1.5% (p = 0.01. Six weeks later, systolic function decreased to 17.1± 3.2% vs. 28.2± 1.5% (p = 0.0001 and left ventricular inner surface increased to 19.9±1.1 mm² (p = 0.0001. Intraoperative graft survival during hHTx was 80% with 46 performed procedures (37/46. All transplanted organs survived two weeks of mechanical unloading.Combination of TAC and hHTx in rats offers an economic and reproducible small animal model enabling serial examination of mechanical unloading in a truly hypertrophic and failing heart, representing the typical pressure overloaded and dilated LV, occurring in patients with moderate to severe heart failure.
Clinical application of magnetic resonance coronary angiography
International Nuclear Information System (INIS)
Murakami, Akihiko; Onoe, Teruyuki; Kodera, Akifumi; Ohtsuki, Tetsuya; Shiomi, Akio; Ida, Masaaki; Sawada, Takahisa
1999-01-01
We performed the magnetic resonance coronary angiography (MRCA) in the cases which underwent coronary angiography (CAG) and obtained images were compared. Lesion with significant constriction more than 75% on CAG were determined as abnormal findings on MRCA, however, lesions with about 50% constriction were as the normal findings. On the assessment of the re-constriction after PTCA, the changes in signal were found in about half of cases. This may come from the contribution of flexion lesions, the difficulty to assess moderate constriction after PTCA, etc. For the anomalous aortic origin of coronary artery, peripheral large vessels could be simultaneously imaged by MRCA and be also assessed among their clear spatial relationship. Although MRCA has some problems on the assessment for flexion or moderate constriction, these results suggested that MRCA is useful to clinical application as the non-invasive examination. (K.H.)
Yakunin, M.V.; Galistu, G.; de Visser, A.
2008-01-01
Rich patterns of transformations in the structure of quantum Hall (QH) effect and magnetoresistivity under tilted magnetic fields were obtained in the InxGa1-xAs/GaAs double quantum well at mK temperatures. Local features correspond to the calculated intersections of Landau levels from different
Tula virus in populations of small terrestrial mammals in a rural landscape
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Pejčoch, M.; Bryja, Josef; Jánová, Eva; Suchomel, J.; Tkadlec, Emil
2010-01-01
Roč. 10, č. 6 (2010), s. 599-603 ISSN 1530-3667 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : crop fields * host species * rural habitat * Tula virus antigen Subject RIV: EH - Ecology, Behaviour Impact factor: 2.733, year: 2010
Cold stress and acclimation – what is important for metabolic adjustment?
Czech Academy of Sciences Publication Activity Database
Janská, A.; Maršík, Petr; Zelenková, S.; Ovesná, J.
2010-01-01
Roč. 12, č. 3 (2010), s. 395-405 ISSN 1435-8603 R&D Projects: GA MZe QH81287; GA AV ČR KJB400550705 Institutional research plan: CEZ:AV0Z50380511 Keywords : Cold acclimation * crops * metabolomics Subject RIV: GE - Plant Breeding Impact factor: 2.409, year: 2010
Czech Academy of Sciences Publication Activity Database
Hamáčková, J.; Prokeš, Miroslav; Kozák, P.; Peňáz, Milan; Stanny, L. A.; Policar, T.; Baruš, Vlastimil
2009-01-01
Roč. 287, 1-2 (2009), s. 158-162 ISSN 0044-8486 R&D Projects: GA MZe QH71305 Institutional research plan: CEZ:AV0Z60930519 Keywords : ASTA starter feed * Artemia salina * Total length * Weight * Level of ontogeny Subject RIV: GL - Fishing Impact factor: 1.925, year: 2009
Molecular identification of stolbur phytoplasma associated with red clover dwarf disease symptoms
Czech Academy of Sciences Publication Activity Database
Fránová, Jana; Navrátil, M.; Jakešová, H.
2009-01-01
Roč. 157, 7-8 (2009), s. 502-506 ISSN 0931-1785 R&D Projects: GA MZe QH71145 Institutional research plan: CEZ:AV0Z50510513 Keywords : Trifolium pratense * stolbur phytoplasma * PCR/RFLP * sequencing * rDNA Subject RIV: EE - Microbiology, Virology Impact factor: 0.983, year: 2009
Czech Academy of Sciences Publication Activity Database
Mašková, Z.; Doležal, J.; Květ, Jan; Zemek, František
2009-01-01
Roč. 12, č. 132 (2009), s. 192-202 ISSN 0167-8809 R&D Projects: GA MZe QH92034 Institutional research plan: CEZ:AV0Z60870520 Keywords : Šumava National Park and Biosphere Reserve * grassland management * plant biomass Subject RIV: EF - Botanics Impact factor: 3.130, year: 2009
Inventory of rodent damage to forests
Czech Academy of Sciences Publication Activity Database
Kamler, Jiří; Turek, K.; Homolka, Miloslav; Baňař, P.; Barančeková, Miroslava; Heroldová, Marta; Krojerová, Jarmila; Suchomel, J.; Purchart, L.
2011-01-01
Roč. 57, č. 5 (2011), s. 219-225 ISSN 1212-4834 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : bank vole * field vole * bark damage * forest protection Subject RIV: GK - Forestry http://www.agriculturejournals.cz/publicFiles/40074.pdf
The dynamics of nitrogenous substances in rodent diet in a forest environment
Czech Academy of Sciences Publication Activity Database
Čepelka, L.; Heroldová, Marta; Jánová, Eva; Suchomel, J.
2014-01-01
Roč. 78, č. 3 (2014), s. 327-333 ISSN 0025-1461 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Apodemus flavicollis * Apodemus sylvaticus * Clethrionomys glareolus * diet quality * Microtus arvalis * NIR spectroscopy * nitrogenous substances Subject RIV: EG - Zoology Impact factor: 0.681, year: 2014
Estimation of genetic and genotypic parameters for growth and ...
African Journals Online (AJOL)
Bekezela
2013-12-18
Dec 18, 2013 ... These included 50 Dongan chickens (DA) from Dongan county, 50 ..... Chang, G.B., Chang, H., Liu, X.P., Wang, H.Y., Xu, W., Zhao, W.M. & Wang, Q.H., 2005. ... Su, Y., Chen, G.H., Long, R.J., Bao, W.B. & Wan, J.H., 2006.
Degradation of cellulose by basidiomycetous fungi
Czech Academy of Sciences Publication Activity Database
Baldrian, Petr; Valášková, Vendula
2008-01-01
Roč. 32, č. 3 (2008), s. 501-521 ISSN 0168-6445 R&D Projects: GA MŠk LC06066; GA MZe QH72216 Institutional research plan: CEZ:AV0Z50200510 Keywords : cellobiohydrolase * cellulose dehydrogenase * basidiomycetes Subject RIV: EE - Microbiology, Virology Impact factor: 7.963, year: 2008
Czech Academy of Sciences Publication Activity Database
Füssy, Zoltán; Patzak, J.; Stehlík, Jan; Matoušek, Jaroslav
2013-01-01
Roč. 170, č. 7 (2013), s. 688-695 ISSN 0176-1617 R&D Projects: GA ČR GCP501/10/J018; GA MZe QH81052 Institutional support: RVO:60077344 Keywords : Humulus lupulus * Phenylpropanoid * Viroid Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.770, year: 2013
Combined exposure to cyanobacterial biomass, lead and the Newcastle virus enhances avian toxicity
Czech Academy of Sciences Publication Activity Database
Pikula, J.; Bandouchová, H.; Hilscherová, Klára; Pašková, Veronika; Sedláčková, J.; Adamovský, Ondřej; Knotková, Z.; Lány, P.; Machat, J.; Maršálek, Blahoslav; Novotný, L.; Pohanka, M.; Vitula, F.
2011-01-01
Roč. 408, č. 21 (2011), s. 4984-4992 ISSN 0048-9697 R&D Projects: GA MŠk 1M0571; GA MZe QH81012 Institutional research plan: CEZ:AV0Z60050516 Keywords : birds * microcystins * heavy metals Subject RIV: EF - Botanics Impact factor: 3.286, year: 2011
Czech Academy of Sciences Publication Activity Database
Věchet, L.; Burketová, Lenka; Šindelářová, Milada
2009-01-01
Roč. 28, č. 2 (2009), s. 151-154 ISSN 0261-2194 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Winter wheat * Powdery mildew * Induced resistance Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.331, year: 2009
Czech Academy of Sciences Publication Activity Database
Kratochvíl, Michal; Mrkvička, Tomáš; Vašek, Mojmír; Peterka, Jiří; Čech, Martin; Draštík, Vladislav; Jůza, Tomáš; Matěna, Josef; Muška, Milan; Seďa, Jaromír; Znachor, Petr; Kubečka, Jan
2012-01-01
Roč. 696, č. 1 (2012), s. 185-198 ISSN 0018-8158 R&D Projects: GA MZe(CZ) QH81046 Institutional research plan: CEZ:AV0Z60170517 Keywords : habitat preference * electrofishing * growing season * slope steepness * percids * cyprinids Subject RIV: EH - Ecology, Behaviour Impact factor: 1.985, year: 2012
Energy Technology Data Exchange (ETDEWEB)
Grierson, B. A., E-mail: bgriers@pppl.gov; Nazikian, R. M.; Solomon, W. M. [Princeton Plasma Physics Laboratory, Princeton University, Princeton, New Jersey 08543 (United States); Burrell, K. H.; Garofalo, A. M.; Belli, E. A.; Staebler, G. M.; Evans, T. E.; Smith, S. P.; Chrobak, C. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Fenstermacher, M. E. [Lawerence Livermore National Laboratory, P.O. Box 808, Livermore, California 94550 (United States); McKee, G. R. [Department of Engineering Physics, University of Wisconsin-Madison, Madison, Wisconsin 53796 (United States); Orlov, D. M. [Center for Energy Research, University of California San Diego, 9500 Gilman Dr., La Jolla, California 92093-0417 (United States); Chrystal, C. [University of California San Diego, 9500 Gilman Dr., La Jolla, California 92093-0417 (United States)
2015-05-15
Impurity transport in the DIII-D tokamak [J. L. Luxon, Nucl. Fusion 42, 614 (2002)] is investigated in stationary high confinement (H-mode) regimes without edge localized modes (ELMs). In plasmas maintained by resonant magnetic perturbation (RMP), ELM-suppression, and QH-mode, the confinement time of fluorine (Z = 9) is equivalent to that in ELMing discharges with 40 Hz ELMs. For selected discharges with impurity injection, the impurity particle confinement time compared to the energy confinement time is in the range of τ{sub p}/τ{sub e}≈2−3. In QH-mode operation, the impurity confinement time is shown to be smaller for intense, coherent magnetic, and density fluctuations of the edge harmonic oscillation than weaker fluctuations. Transport coefficients are derived from the time evolution of the impurity density profile and compared to neoclassical and turbulent transport models NEO and TGLF. Neoclassical transport of fluorine is found to be small compared to the experimental values. In the ELMing and RMP ELM-suppressed plasma, the impurity transport is affected by the presence of tearing modes. For radii larger than the mode radius, the TGLF diffusion coefficient is smaller than the experimental value by a factor of 2–3, while the convective velocity is within error estimates. Low levels of diffusion are observed for radii smaller than the tearing mode radius. In the QH-mode plasma investigated, the TGLF diffusion coefficient is higher inside of ρ=0.4 and lower outside of 0.4 than the experiment, and the TGLF convective velocity is more negative by a factor of approximately 1.7.
International Nuclear Information System (INIS)
Erkarslan, U; Oylumluoglu, G; Grayson, M; Siddiki, A
2012-01-01
The influence of the incompressible strips on the integer quantized Hall effect (IQHE) is investigated, considering a cleaved-edge overgrown (CEO) sample as an experimentally realizable sharp edge system. We propose a set of experiments to clarify the distinction between the large-sample limit when bulk disorder defines the IQHE plateau width and the small-sample limit smaller than the disorder correlation length, when self-consistent edge electrostatics define the IQHE plateau width. The large-sample or bulk quantized Hall (QH) regime is described by the usual localization picture, whereas the small-sample or edge regime is discussed within the compressible/incompressible strips picture, known as the screening theory of QH edges. Utilizing the unusually sharp edge profiles of the CEO samples, a Hall bar design is proposed to manipulate the edge potential profile from smooth to extremely sharp. By making use of a side-gate perpendicular to the two-dimensional electron system, it is shown that the plateau widths can be changed or even eliminated altogether. Hence, the visibility of IQHE is strongly influenced when adjusting the edge potential profile and/or changing the dc current direction under high currents in the nonlinear transport regime. As a second investigation, we consider two different types of ohmic contacts, namely highly transmitting (ideal) and highly reflecting (non-ideal) contacts. We show that if the injection contacts are non-ideal, but still ohmic, it is possible to measure directly the non-quantized transport taking place at the bulk of the CEO samples. The results of the experiments we propose will clarify the influence of the edge potential profile and the quality of the contacts, under QH conditions. (paper)
Directory of Open Access Journals (Sweden)
Mateus Mondin
2007-01-01
Full Text Available The chromosomes of Crotalaria juncea, a legume of agronomic interest with a 2n = 16 karyotype composed of metacentric chromosomes, were analyzed using several cytogenetic techniques. C-banding revealed heterochromatic regions around the centromeres in all chromosomes and adjacent to the secondary constriction on the chromosome 1 short arm. Fluorescent staining with the GC-specific chromomycin A3 (CMA highlighted these heterochromatic regions and a tiny site on the chromosome 1 long arm while the AT-specific stain 4'-6-diamidino-2-phenylindole (DAPI induced a reversed pattern. Staining with CMA combined with AT-specific distamycin A (DA counterstaining quenched the pericentromeric regions of all chromosomes, but enhanced fluorescence was observed at the heterochromatic regions around the secondary constriction and on the long arms of chromosomes 1 and 4. Fluorescence in situ hybridization (FISH revealed 18S-5.8S-26S rRNA gene sites (45S rDNA on chromosomes 1 and 4, and one 5S rDNA locus on chromosome 1. All the rDNA sites were co-located with the positive-CMA/DA bands, suggesting they were very rich in GC. Silver staining revealed signals at the main 45S rDNA locus on chromosome 1 and, in some cells, chromosome 4 was labeled. Two small nucleoli were detected in a few interphase cells, suggesting that the minor site on chromosome 4 could be active at some stages of the cell cycle.
Ikeda, Shohei; Satoh, Kimio; Kikuchi, Nobuhiro; Miyata, Satoshi; Suzuki, Kota; Omura, Junichi; Shimizu, Toru; Kobayashi, Kenta; Kobayashi, Kazuto; Fukumoto, Yoshihiro; Sakata, Yasuhiko; Shimokawa, Hiroaki
2014-06-01
Right ventricular (RV) failure is the leading cause of death in various cardiopulmonary diseases, including pulmonary hypertension. It is generally considered that the RV is vulnerable to pressure overload as compared with the left ventricle (LV). However, as compared with LV failure, the molecular mechanisms of RV failure are poorly understood, and hence therapeutic targets of the disorder remain to be elucidated. Thus, we aimed to identify molecular therapeutic targets for RV failure in a mouse model of pressure overload. To induce pressure overload to respective ventricles, we performed pulmonary artery constriction or transverse aortic constriction in mice. We first performed microarray analysis and found that the molecules related to RhoA/Rho-kinase and integrin pathways were significantly upregulated in the RV with pulmonary artery constriction compared with the LV with transverse aortic constriction. Then, we examined the responses of both ventricles to chronic pressure overload in vivo. We demonstrated that compared with transverse aortic constriction, pulmonary artery constriction caused greater extents of mortality, Rho-kinase expression (especially ROCK2 isoform), and oxidative stress in pressure-overloaded RV, reflecting the weakness of the RV in response to pressure overload. Furthermore, mice with myocardial-specific overexpression of dominant-negative Rho-kinase showed resistance to pressure overload-induced hypertrophy and dysfunction associated with reduced oxidative stress. Finally, dominant-negative Rho-kinase mice showed a significantly improved long-term survival in both pulmonary artery constriction and transverse aortic constriction as compared with littermate controls. These results indicate that the Rho-kinase pathway plays a crucial role in RV hypertrophy and dysfunction, suggesting that the pathway is a novel therapeutic target of RV failure in humans. © 2014 American Heart Association, Inc.
International Nuclear Information System (INIS)
Shit, G.C.; Majee, Sreeparna
2015-01-01
Unsteady flow of blood and heat transfer characteristics in the neighborhood of an overlapping constricted artery have been investigated in the presence of magnetic field and whole body vibration. The laminar flow of blood is taken to be incompressible and Newtonian fluid with variable viscosity depending upon temperature with an aim to provide resemblance to the real situation in the physiological system. The unsteady flow mechanism in the constricted artery is subjected to a pulsatile pressure gradient arising from systematic functioning of the heart and from the periodic body acceleration. The numerical computation has been performed using finite difference method by developing Crank–Nicolson scheme. The results show that the volumetric flow rate, skin-friction and the rate of heat transfer at the wall are significantly altered in the downstream of the constricted region. The axial velocity profile, temperature and flow rate increases with increase in temperature dependent viscosity, while the opposite trend is observed in the case of skin-friction and flow impedance. - Highlights: • We have investigated the pulsatile MHD flow of blood and heat transfer in arteries. • The influence of periodic body acceleration has been taken into account. • The temperature dependent viscosity of blood is considered. • The variable viscosity has an increasing effect on blood flow and heat transfer. • The overall temperature distribution enhances in the presence of magnetic field
Energy Technology Data Exchange (ETDEWEB)
Shit, G.C., E-mail: gopal_iitkgp@yahoo.co.in; Majee, Sreeparna
2015-08-15
Unsteady flow of blood and heat transfer characteristics in the neighborhood of an overlapping constricted artery have been investigated in the presence of magnetic field and whole body vibration. The laminar flow of blood is taken to be incompressible and Newtonian fluid with variable viscosity depending upon temperature with an aim to provide resemblance to the real situation in the physiological system. The unsteady flow mechanism in the constricted artery is subjected to a pulsatile pressure gradient arising from systematic functioning of the heart and from the periodic body acceleration. The numerical computation has been performed using finite difference method by developing Crank–Nicolson scheme. The results show that the volumetric flow rate, skin-friction and the rate of heat transfer at the wall are significantly altered in the downstream of the constricted region. The axial velocity profile, temperature and flow rate increases with increase in temperature dependent viscosity, while the opposite trend is observed in the case of skin-friction and flow impedance. - Highlights: • We have investigated the pulsatile MHD flow of blood and heat transfer in arteries. • The influence of periodic body acceleration has been taken into account. • The temperature dependent viscosity of blood is considered. • The variable viscosity has an increasing effect on blood flow and heat transfer. • The overall temperature distribution enhances in the presence of magnetic field.
Flow Energy Piezoelectric Bimorph Nozzle Harvester
Sherrit, Stewart (Inventor); Walkemeyer, Phillip E. (Inventor); Hall, Jeffrey L. (Inventor); Lee, Hyeong Jae (Inventor); Colonius, Tim (Inventor); Tosi, Phillipe (Inventor); Kim, Namhyo (Inventor); Sun, Kai (Inventor); Corbett, Thomas Gary (Inventor); Arrazola, Alvaro Jose (Inventor)
2016-01-01
A flow energy harvesting device having a harvester pipe includes a flow inlet that receives flow from a primary pipe, a flow outlet that returns the flow into the primary pipe, and a flow diverter within the harvester pipe having an inlet section coupled to the flow inlet, a flow constriction section coupled to the inlet section and positioned at a midpoint of the harvester pipe and having a spline shape with a substantially reduced flow opening size at a constriction point along the spline shape, and an outlet section coupled to the constriction section. The harvester pipe may further include a piezoelectric structure extending from the inlet section through the constriction section and point such that the fluid flow past the constriction point results in oscillatory pressure amplitude inducing vibrations in the piezoelectric structure sufficient to cause a direct piezoelectric effect and to generate electrical power for harvesting.
Saffarpour, S; Shaabani, M; Naghdi, N; Farahmandfar, M; Janzadeh, A; Nasirinezhad, F
2017-06-01
Patients with chronic pain usually suffer from learning and memory impairment which may significantly decrease their quality of life. Despite laboratory and clinical studies, the mechanism underlying this memory impairment remains elusive. We evaluated the effect of chronic pain on the glutamate and GABA levels and BDNF expression in the CA1 region of hippocampus as a possible explanation for memory impairment related to neuropathic pain. In this respect, 30 male rats were randomly allocated to 3 groups as control, sham and neuropathic. Neuropathic pain was induced by a chronic constriction injury of the sciatic nerve (CCI) and mechanical allodynia and the spatial memory was assessed using the Von Frey filaments and Morris water maze respectively. To determine the potential mechanisms, the in vivo extracellular levels of glutamate and γ-aminobutyric acid (GABA) were measured by microdialysis and the brain-derived neurotrophic factor (BDNF) expression was determined by using western blots technique in the hippocampus on days 14 and 21 post-CCI. We showed that CCI impaired spatial learning and memory in Morris water maze (MWM) task. BDNF expression level and glutamate concentration significantly decreased in rats with chronic constriction injury of the sciatic nerve (PGABA increased in hippocampal CA1 region (PGABA concentration and decrease in the glutamate and BDNF levels in the CA1 region of the hippocampus. Copyright © 2017 Elsevier Inc. All rights reserved.
Page 1 1059 Ethiopian Journal of Environmental Studies ...
African Journals Online (AJOL)
USER
2016-12-17
Dec 17, 2016 ... The interpretation from the resistivity log of regolith rocks shows different curve types which include HA, HKH, QH, H and A ... surface formations, the higher the permeability and porosity of the ... potential electrodes; Ra is called apparent electrical resistance given by the resistivity meter. However, the above ...
Unbalanced polyandry in wild-caught ladybirds Harmonia axyridis (Coleoptera: Coccinellidae)
Czech Academy of Sciences Publication Activity Database
Awad, Mona; Laugier, G. J. M.; Loiseau, A.; Nedvěd, Oldřich
2015-01-01
Roč. 50, č. 4 (2015), s. 427-434 ISSN 0003-6862 Grant - others:MZe(CZ) QH82047 Institutional support: RVO:60077344 Keywords : promiscuity * paternity * fertilization Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.102, year: 2015 http://link.springer.com/article/10.1007/s13355-015-0348-5
First study of C2491T FV mutation with ischaemic stroke risk in ...
Indian Academy of Sciences (India)
Faculty of Medicine and Pharmacy, Department of Genetic and Molecular Pathology Laboratory (LGPM),. Tarek Ibn Ziad, QH, Hassan II University, 9154 Casablanca, Morocco. [Diakite B., Hamzi K., Hmimech W., Nadifi S. and GMRAVC 2015 First study of C2491T FV mutation with ischaemic stroke risk in Morocco. J. Genet.
The use of RIDA ® COUNT for monitoring the American Foulbrood pathogen
Czech Academy of Sciences Publication Activity Database
Ryba, Š.; Krištůfek, Václav; Titěra, D.
2012-01-01
Roč. 2, č. 4 (2012), s. 233-236 ISSN 2165-3356 R&D Projects: GA MŠk(CZ) EE2.4.12.0082 Grant - others:GA MZe(CZ) QH72144 Institutional support: RVO:60077344 Keywords : AFB * Apis mellifera L. * bacterial disease * diagnosis * diseases of honeybees Subject RIV: EE - Microbiology, Virology
van Nispen, Karin; van de Sandt-Koenderman, Mieke; Mol, Lisette; Krahmer, Emiel
2014-01-01
Background: Gesticulation (gestures accompanying speech) and pantomime (gestures in the absence of speech) can each be comprehensible. Little is known about the differences between these two gesture modes in people with aphasia. Aims: To discover whether there are differences in the communicative use of gesticulation and pantomime in QH, a person…
Czech Academy of Sciences Publication Activity Database
Matoušek, Jaroslav; Patzak, J.; Kocábek, Tomáš; Füssy, Zoltán; Stehlík, Jan; Orctová, Lidmila; Duraisamy, Ganesh Selvaraj
2011-01-01
Roč. 64, č. 6 (2011), s. 151-155 ISSN 1613-2041 R&D Projects: GA ČR GA521/08/0740; GA MZe QH81052 Institutional research plan: CEZ:AV0Z50510513 Keywords : lupulin metabolome * Humulus lupulus L. * protein complexes * transcription factors Subject RIV: EB - Genetics ; Molecular Biology
Cytogenetics of Festulolium (Festuca x Lolium hybrids)
Czech Academy of Sciences Publication Activity Database
Kopecký, David; Lukaszewski, A.J.; Doležel, Jaroslav
2008-01-01
Roč. 120, 3-4 (2008), s. 370-383 ISSN 1424-8581 R&D Projects: GA ČR GP521/07/P479; GA MZe QH71267 Institutional research plan: CEZ:AV0Z50380511 Keywords : Grasses * hybrids * FISH Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.965, year: 2008
Short communication: Molecular analysis of Potato leafroll virus isolates from the Czech Republic
Czech Academy of Sciences Publication Activity Database
Plchová, Helena; Čeřovská, Noemi; Moravec, Tomáš; Dědič, P.
2009-01-01
Roč. 39, č. 1 (2009), s. 153-155 ISSN 0920-8569 R&D Projects: GA MZe QH71123; GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50380511 Keywords : Potato leafroll virus * Sequencing * Phylogeny Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.705, year: 2009
Diet and growth of 1+ Siberian sturgeon, Acipenser baerii in alternative pond culture
Czech Academy of Sciences Publication Activity Database
Adámek, Z.; Prokeš, Miroslav; Baruš, Vlastimil; Sukop, I.
2007-01-01
Roč. 7, č. 2 (2007), s. 153-160 ISSN 1303-2712 R&D Projects: GA MZe QH71305 Institutional research plan: CEZ:AV0Z60930519 Keywords : feeding * weight condition * length-weight relationship * Acipenseridae Subject RIV: GL - Fishing http://www.trjfas.org/pdf/issue_7_2/153_160.pdf
Markery pro určení náchylnosti brambor k obecné strupovitosti
Czech Academy of Sciences Publication Activity Database
Krištůfek, Václav; Diviš, J.; Ságová-Marečková, M.; Kopecký, J.
2011-01-01
Roč. 19, č. 5 (2011), s. 19-21 ISSN 1211-2429 R&D Projects: GA ČR(CZ) GA526/96/0168; GA AV ČR IBS6066001; GA MZe QH92151 Institutional research plan: CEZ:AV0Z60660521 Keywords : potatoes * common scab * detection Subject RIV: EH - Ecology, Behaviour
Laccase activity in soils: Considerations for the measurement of enzyme activity
Czech Academy of Sciences Publication Activity Database
Eichlerová, Ivana; Šnajdr, Jaroslav; Baldrian, Petr
2012-01-01
Roč. 88, č. 10 (2012), s. 1154-1160 ISSN 0045-6535 R&D Projects: GA MŠk(CZ) OC10064; GA MŠk(CZ) ME10152; GA MZe QH72216 Institutional support: RVO:61388971 Keywords : Laccase * Soil * Michaelis constant Subject RIV: EE - Microbiology, Virology Impact factor: 3.137, year: 2012
Czech Academy of Sciences Publication Activity Database
Nedvěd, Oldřich; Fois, X.; Ungerová, D.; Kalushkov, P.
2013-01-01
Roč. 66, č. 1 (2013), s. 73-78 ISSN 1721-8861 Grant - others:Mze ČR(CZ) QH82047 Institutional support: RVO:60077344 Keywords : Coccinellidae * Chrysopidae * Syrphidae Subject RIV: EH - Ecology, Behaviour Impact factor: 0.722, year: 2013 http://www.bulletinofinsectology.org/pdfarticles/vol66-2013-073-078nedved.pdf
Interactions between nitrogen nutrition and phytohormone levels in Festulolium plants
Czech Academy of Sciences Publication Activity Database
Pavlíková, D.; Neuberg, M.; Žižková, Eva; Motyka, Václav; Pavlík, Milan
2012-01-01
Roč. 58, č. 8 (2012), s. 367-372 ISSN 1214-1178 Grant - others:GA MZe(CZ) QH71077 Institutional research plan: CEZ:AV0Z50380511 Keywords : abscisic acid * amino acid * CULTAN Subject RIV: EF - Botanics Impact factor: 1.113, year: 2012 http://www.agriculturejournals.cz/publicFiles/71493.pdf
Directory of Open Access Journals (Sweden)
Venkata R.K. Thiagarajan
2012-12-01
Full Text Available The present study was designed to investigate the ameliorative role of ethanolic extract from leaves of Butea monosperma in chronic constriction injury (CCI of sciatic nerve induced neuropathic pain in rats. Hot plate, acetone drop, paw pressure, Von Frey hair and tail immersion tests were performed to assess the degree of thermal hyperalgesia, cold chemical allodynia, mechanical hyperalgesia & allodynia in the left hind paw and tail thermal hyperalgesia. Further on, thiobarbituric acid reactive substances (TBARS, reduced glutathione (GSH and total calcium levels were estimated to assess the biochemical changes in the sciatic nerve tissue. Histopathological changes were also observed in the sciatic nerve tissue. Ethanolic extract of Butea monosperma leaves and pregabalin (serving as positive control were administered for 14 consecutive days starting from the day of surgery. CCI resulted in significant changes in behavioural and biochemical parameters. Pretreatment of Butea monosperma attenuated CCI induced development of behavioural, biochemical and histopathological alterations in a dose dependent manner, which is comparable to that of pregabalin pretreated group. These findings may be attributed to its potential anti-oxidative, neuroprotective and calcium channel modulatory actions of Butea monosperma.O presente trabalho visou investigar o papel do extrato etanólico de folhas de Butea monosperma no alívio da dor neuropática pela injúria de constrição crônica (CCI do nervo ciático induzida em ratos. Placa quente, gota de acetona, pressão na pata, testes de imersão de pelo e cauda de Von Frey foram utilizados para acessar o grau de hiperalgesia térmica, alodinia química fria, hiperalgesia mecânica e alodinia na pata trazeira esquerda e hiperalgesia térmica da cauda. Além disso, substâncias reativas com ácido tiobarbitúrico (TBARS, glutatião reduzido (GSH e níveis de cálcio total foram estimados para acessar as altera
Molecular Dynamics Studies on Ballistic Thermal Resistance of Graphene Nano-Junctions
International Nuclear Information System (INIS)
Yao Wen-Jun; Cao Bing-Yang
2015-01-01
Ballistic thermal resistance of graphene nano-junctions is investigated using non-equilibrium molecular dynamics simulation. The simulation system is consisted of two symmetrical trapezoidal or rectangular graphene nano-ribbons (GNRs) and a connecting nanoscale constriction in between. From the simulated temperature profile, a big temperature jump resulted from the constriction is found, which is proportional to the heat current and corresponds to a local ballistic thermal resistance. Fixing the constriction width and the length of GNRs, this ballistic thermal resistance is independent of the width of the GNRs bottom layer, i.e., the convex angle. But interestingly, this thermal resistance has obvious size effect. It is inversely proportional to the constriction width and will disappear with the constriction being wider. Moreover, based on the phonon dynamics theory, a theoretical model of the ballistic thermal resistance in two-dimensional nano-systems is developed, which gives a good explanation on microcosmic level and agrees well with the simulation result quantitatively and qualitatively. (paper)
Robust gap repair in the contractile ring ensures timely completion of cytokinesis.
Silva, AM; Osório, DS; Pereira, AJ; Maiato, H; Pinto, IM; Rubinstein, B; Gassmann, R; Telley, IA; Carvalho, AX
2016-01-01
Cytokinesis in animal cells requires the constriction of an actomyosin contractile ring, whose architecture and mechanism remain poorly understood. We use laser microsurgery to explore the biophysical properties of constricting rings in Caenorhabditis elegans embryos. Laser cutting causes rings to snap open. However, instead of disintegrating, ring topology recovers and constriction proceeds. In response to severing, a finite gap forms and is repaired by recruitment of new material in an acti...
Fecundity and fertility of ladybird beetle Harmonia axyridis after prolonged cold storage
Czech Academy of Sciences Publication Activity Database
Awad, Mona; Kalushkov, P.; Nedvědová, T.; Nedvěd, Oldřich
2013-01-01
Roč. 58, č. 5 (2013), s. 657-666 ISSN 1386-6141 Grant - others:MZe ČR(CZ) QH82047 Institutional support: RVO:60077344 Keywords : ladybird * hatching rate * overwintering Subject RIV: ED - Physiology Impact factor: 2.253, year: 2013 http://link.springer.com/article/10.1007%2Fs10526-013-9512-4#
Czech Academy of Sciences Publication Activity Database
Bartoš, Jan; Sandve, S. R.; Kolliker, R.; Kopecký, David; Christelová, Pavla; Stočes, Štěpán; Ostrem, L.; Larsen, A.; Kilian, A.; Rognli, O. A.; Doležel, Jaroslav
2011-01-01
Roč. 122, č. 6 (2011), s. 1133-1147 ISSN 0040-5752 R&D Projects: GA MZe QH71267; GA MŠk ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : PRATENSIS HUDS * TEMPERATE CEREALS * MULTIFLORUM LAM Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.297, year: 2011
Czech Academy of Sciences Publication Activity Database
Baldrian, Petr; Šnajdr, Jaroslav; Merhautová, Věra; Dobiášová, Petra; Cajthaml, Tomáš; Valášková, Vendula
2013-01-01
Roč. 56, JAN 2013 (2013), s. 60-68 ISSN 0038-0717 R&D Projects: GA MŠk(CZ) LA10001; GA MŠk(CZ) ME10152; GA MZe QH72216 Institutional support: RVO:61388971 Keywords : Extracellular enzymes * Forest soil * Lignocellulose Subject RIV: EE - Microbiology, Virology Impact factor: 4.410, year: 2013
Czech Academy of Sciences Publication Activity Database
Svobodová, Zdeňka; Skoková Habuštová, Oxana; Hutchison, W. D.; Hussein, Hany; Sehnal, František
2015-01-01
Roč. 10, č. 6 (2015), e0130656 E-ISSN 1932-6203 R&D Projects: GA MZe QH91093 Institutional support: RVO:60077344 Keywords : Diabrotica Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 3.057, year: 2015 http:// journal s.plos.org/plosone/article?id=10.1371/ journal .pone.0130656
Czech Academy of Sciences Publication Activity Database
Tkadlec, Emil; Suchomel, J.; Purchart, L.; Heroldová, Marta; Čepelka, L.; Homolka, Miloslav
2011-01-01
Roč. 432, - (2011), s. 97-98 ISSN 1868-9892. [European Vertebrate Pest Management Conference /8./. Berlin, 26.09.2011-30.09.2011] R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : bank vole * common vole * correlation of population fluctuations Subject RIV: EH - Ecology, Behaviour
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Čižmář, D.; Tkadlec, Emil
2010-01-01
Roč. 29, č. 7 (2010), s. 773-776 ISSN 0261-2194 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : Agroecosystem * Fecal analysis * Apodemus * Food choice tests * Microtus * NIRS Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.517, year: 2010
Johnson, Christopher M.
Neurofilaments are the intermediate filaments of neurons and are the most abundant structure of the neuronal cytoskeleton. Once synthesized within the cell body they are then transported throughout the axon along microtubule tracks, driven by the molecular motors kinesin and dynein. This movement is characterized by long pauses with no movement interrupted by infrequent bouts of rapid movement, resulting in an aggregate dense cytoskeletal structure, which serves to regulate an axon's shape and size. Curiously, the modulated kinetics of these polymers produces a very regular, yet non-uniform, morphology in myelinated axons which are composed of discretely spaced myelin-ensheathed segments that are separated by short constricted regions called "nodes of Ranvier". This unique design optimizes the conduction velocity of myelinated axons at minimal fiber size. Hence, neurofilaments regulate the axon caliber to optimize neuron function. The goal of this dissertation is to investigate the motile mechanism of neurofilament transport as well as the resulting electrophysiological effects that follow. We start by examining highly time-resolved kymograph images generated from recorded neurofilament movement via epifluorescence microscopy. Using kymograph analysis, edge detection algorithms, and pixel smoothing tactics, neurofilament trajectories are extracted and used to obtain statistical distributions for the characteristics of how these filaments move within cells. The results suggest that the observed intermittent and bidirectional motions of these filaments might be explained by a model in which dynein and kinesin motors attach to a single neurofilament cargo and interact through mechanical forces only (i.e. a "tug-of-war" model). We test this hypothesis by developing two discrete-state stochastic models for the kinetic cycles of kinesin and dynein, which are then incorporated into a separate stochastic model that represents the posed tug-of-war scenario. We then
Carbon nanotube thermal interfaces and related applications
Hodson, Stephen L
2016-01-01
The development of thermal interface materials (TIMs) is necessitated by the temperature drop across interfacing materials arising from macro and microscopic irregularities of their surfaces that constricts heat through small contact regions as well as mismatches in their thermal properties. Similar to other types of TIMs, CNT TIMs alleviate the thermal resistance across the interface by thermally bridging two materials together with cylindrical, high-aspect ratio, and nominally vertical cond...
Computed tomography findings in cases of Minamata disease
International Nuclear Information System (INIS)
Shirakawa, Kenichi; Hirota, Koichi; Tsubaki, Tadao; Tanimura, Kenichi; Yamamoto, Tsuneo.
1979-01-01
Computed tomography (CT) was used to evaluate 57 patients with Minamata disease (methylmercury poisoning); it was proved to be an objective and practical screening procedure. A typical patient who presented an acute onset of concentric constriction of visual fields and cerebellar ataxia showed a low-density area in both occipital regions; cerebellar atrophy and enlarged cerebral cortical sulci. On the other hand, the majority of patients who presented a chronic onset, with only a mild concentric constriction of visual fields, dysdiadochokinesis, and sensory disturbance showed only a questionable or a mild cerebellar atrophy. An enlarged paracerebellar space in mild cerebellar atrophy was easily identified at the pontine angle cistern, the paravermian cistern, and the triangular space of the rectal sinus in the coronal section on an enhanced CT scan. These findings were compatible with pathological findings of mild cases of Minamata disease. The correlation of dysdiadochokinesis with the degree of cerebellar atrophy was demonstrated. (author)
Degenerative lumbar spinal stenosis: correlation with Oswestry Disability Index and MR Imaging
Sirvanci, Mustafa; Bhatia, Mona; Ganiyusufoglu, Kursat Ali; Duran, Cihan; Tezer, Mehmet; Ozturk, Cagatay; Aydogan, Mehmet; Hamzaoglu, Azmi
2008-01-01
Because neither the degree of constriction of the spinal canal considered to be symptomatic for lumbar spinal stenosis nor the relationship between the clinical appearance and the degree of a radiologically verified constriction is clear, a correlation of patient’s disability level and radiographic constriction of the lumbar spinal canal is of interest. The aim of this study was to establish a relationship between the degree of radiologically established anatomical stenosis and the severity o...
Prichard, David O; Byrne, Anne Marie; Murphy, James O; Reynolds, John V; O'Sullivan, Jacintha; Feighery, Ronan; Doyle, Brendan; Eldin, Osama Sharaf; Finn, Stephen P; Maguire, Aoife; Duff, Deirdre; Kelleher, Dermot P; Long, Aideen
2017-12-01
The fundamental mechanisms underlying erosive oesophagitis and subsequent development of Barrett's oesophagus (BO) are poorly understood. Here, we investigated the contribution of specific components of the gastric refluxate on adhesion molecules involved in epithelial barrier maintenance. Cell line models of squamous epithelium (HET-1A) and BO (QH) were used to examine the effects of bile acids on cell adhesion to extracellular matrix proteins (Collagen, laminin, vitronectin, fibronectin) and expression of integrin ligands (α 3 , α 4, α 5 , α 6 and α ν ). Experimental findings were validated in human explant oesophageal biopsies, a rat model of gastroesophageal reflux disease (GORD) and in patient tissue microarrays. The bile acid deoxycholic acid (DCA) specifically reduced adhesion of HET-1A cells to vitronectin and reduced cell-surface expression of integrin-α ν via effects on endocytic recycling processes. Increased expression of integrin-α v was observed in ulcerated tissue in a rat model of GORD and in oesophagitis and Barrett's intestinal metaplasia patient tissue compared to normal squamous epithelium. Increased expression of integrin-α ν was observed in QH BO cells compared to HET-1A cells. QH cells were resistant to DCA-mediated loss of adhesion and reduction in cell-surface expression of integrin-α ν . We demonstrated that a specific component of the gastric refluxate, DCA, affects the epithelial barrier through modulation of integrin α ν expression, providing a novel mechanism for bile acid-mediated erosion of oesophageal squamous epithelium and promotion of BO. Strategies aimed at preventing bile acid-mediated erosion should be considered in the clinical management of patients with GORD. © 2017 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.
Roy, Sanjay; Mondal, Palash; Sengupta, Partha Sarathi; Dhak, Debasis; Santra, Ramesh Chandra; Das, Saurabh; Guin, Partha Sarathi
2015-03-28
A 1 : 2 copper(II) complex of 1-amino-4-hydroxy-9,10-anthraquinone (QH) having the molecular formula CuQ2 was prepared and characterized by elemental analysis, NMR, FTIR, UV-vis and mass spectroscopy. The powder diffraction of the solid complex, magnetic susceptibility and ESR spectra were also recorded. The presence of the planar anthraquinone moiety in the complex makes it extremely difficult to obtain a single crystal suitable for X-ray diffraction studies. To overcome this problem, density functional theory (DFT) was used to evaluate an optimized structure of CuQ2. In the optimized structure, it was found that there is a tilt of the two planar aromatic anthraquinone rings of the complex with respect to each other in the two planes containing the O-Cu(II)-O plane. The present study is an important addition to the understanding of the structural aspects of metal-anthracyclines because there are only a few reports on the actual structures of metal-anthracyclines. The theoretical vibrational spectrum of the complex was assigned with the help of vibrational energy distribution analysis (VEDA) using potential energy distribution (PED) and compared with experimental results. Being important in producing the biochemical action of this class of molecules, the electrochemical behavior of the complex was studied in aqueous and non-aqueous solvents to find certain electrochemical parameters. In aqueous media, reduction involves a kinetic effect during electron transfer at an electrode surface, which was characterized very carefully using cyclic voltammetry. Electrochemical studies showed a significant modification in the electrochemical properties of 1-amino-4-hydroxy-9,10-anthraquinone (QH) when bound to Cu(II) in the complex compared to those observed for free QH. This suggests that the copper complex might be a good choice as a biologically active molecule, which was reflected in the lack of stimulated superoxide generation by the complex.
Directory of Open Access Journals (Sweden)
Haixia Xiao
Full Text Available To combat the possibility of a zoonotic H5N1 pandemic in a timely fashion, it is necessary to develop a vaccine that would confer protection against homologous and heterologous human H5N1 influenza viruses. Using a replicating modified vaccinia virus Tian Tan strain (MVTT as a vaccine vector, we constructed MVTTHA-QH and MVTTHA-AH, which expresses the H5 gene of a goose-derived Qinghai strain A/Bar-headed Goose/Qinghai/1/2005 or human-derived Anhui Strain A/Anhui/1/2005. The immunogenicity profiles of both vaccine candidates were evaluated. Vaccination with MVTTHA-QH induced a significant level of neutralizing antibodies (Nabs against a homologous strain and a wide range of H5N1 pseudoviruses (clades 1, 2.1, 2.2, 2.3.2, and 2.3.4. Neutralization tests (NT and Haemagglutination inhibition (HI antibodies inhibit the live autologous virus as well as a homologous A/Xingjiang/1/2006 and a heterologous A/Vietnam/1194/2004, representing two human isolates from clade 2.2 and clade 1, respectively. Importantly, mice vaccinated with intranasal MVTTHA-QH were completely protected from challenge with lethal dosages of A/Bar-headed Goose/Qinghai/1/2005 and the A/Viet Nam/1194/2004, respectively, but not control mice that received a mock MVTTS vaccine. However, MVTTHA-AH induced much lower levels of NT against its autologous strain. Our results suggest that it is feasible to use the H5 gene from A/Bar-headed Goose/Qinghai/1/2005 to construct an effective vaccine, when using MVTT as a vector, to prevent infections against homologous and genetically divergent human H5N1 influenza viruses.
Cell Wall Components of Leptosphaeria maculans Enhance Resistance of Brassica napus
Czech Academy of Sciences Publication Activity Database
Kim, P.D.; Šašek, Vladimír; Burketová, Lenka; Čopíková, J.; Synytsya, A.; Jindřichová, Barbora; Valentová, O.
2013-01-01
Roč. 61, č. 22 (2013), s. 5207-5214 ISSN 0021-8561 R&D Projects: GA ČR GA522/08/1581; GA MZe QH81201 Institutional research plan: CEZ:AV0Z50380511 Keywords : elicitor * oligosaccharide * Leptosphaeria maculans Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 3.107, year: 2013
Czech Academy of Sciences Publication Activity Database
Plchová, Helena; Moravec, Tomáš; Dědič, P.; Čeřovská, Noemi
2011-01-01
Roč. 159, č. 2 (2011), s. 130-132 ISSN 0931-1785 R&D Projects: GA MŠk 1M06030; GA MZe QH71123 Institutional research plan: CEZ:AV0Z50380511 Keywords : Potato leafroll virus * recombinant viral antigen * antibody production Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.791, year: 2011
Czech Academy of Sciences Publication Activity Database
Šnajdr, Jaroslav; Valášková, Vendula; Merhautová, Věra; Herinková, Jana; Cajthaml, Tomáš; Baldrian, Petr
2008-01-01
Roč. 40, č. 9 (2008), s. 2068-2075 ISSN 0038-0717 R&D Projects: GA MŠk LC06066; GA MZe QH72216; GA AV ČR KJB600200516 Institutional research plan: CEZ:AV0Z50200510 Keywords : enzyme activity * forest soil * lignocellulose Subject RIV: EE - Microbiology, Virology Impact factor: 2.926, year: 2008
Czech Academy of Sciences Publication Activity Database
Matoušek, Jaroslav; Kocábek, Tomáš; Patzak, J.; Füssy, Zoltán; Procházková, Jitka; Heyerick, A.
2012-01-01
Roč. 12, č. 27 (2012), s. 1471-2229 ISSN 1471-2229 R&D Projects: GA ČR GA521/08/0740; GA MZe QH81052 Institutional research plan: CEZ:AV0Z50510513 Keywords : transcription factor * protein complexes * transient expression assay Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.354, year: 2012
Czech Academy of Sciences Publication Activity Database
Patzak, J.; Matoušek, Jaroslav
2011-01-01
Roč. 55, č. 4 (2011), s. 761-765 ISSN 0006-3134 R&D Projects: GA ČR GA521/08/0740; GA MZe QH81052 Institutional research plan: CEZ:AV0Z50510513 Keywords : cluster analysis * dendrogram * Humulus lupulus * simple sequence repeat Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.974, year: 2011
Czech Academy of Sciences Publication Activity Database
Šašek, Vladimír; Nováková, Miroslava; Dobrev, Petre; Valentová, O.; Burketová, Lenka
2012-01-01
Roč. 133, č. 1 (2012), s. 279-289 ISSN 0929-1873 R&D Projects: GA ČR GA522/08/1581; GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Antimicrobial * BTH * Gene expression Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.610, year: 2012
The utility of predatory fish in biomanipulation of deep reservoirs
Czech Academy of Sciences Publication Activity Database
Vašek, Mojmír; Prchalová, Marie; Peterka, Jiří; Ketelaars, H. A. M.; Wagenvoort, A. J.; Čech, Martin; Draštík, Vladislav; Říha, Milan; Jůza, Tomáš; Kratochvíl, Michal; Mrkvička, Tomáš; Blabolil, Petr; Boukal S., David; Duras, J.; Kubečka, Jan
2013-01-01
Roč. 52, March (2013), s. 104-111 ISSN 0925-8574 R&D Projects: GA MZe(CZ) QH81046; GA MŠk(CZ) EE2.3.20.0204 Institutional support: RVO:60077344 Keywords : biomanipulation * eutrophication * top-down control * water quality * piscivores * recreational fishing Subject RIV: EH - Ecology, Behaviour Impact factor: 3.041, year: 2013
Czech Academy of Sciences Publication Activity Database
Bříza, Jindřich; Pavingerová, Daniela; Vlasák, Josef; Niedermeierová, Hana
2013-01-01
Roč. 60, č. 3 (2013), s. 395-400 ISSN 0001-527X R&D Projects: GA MZe QH71290; GA ČR(CZ) GAP502/11/1471 Institutional support: RVO:60077344 Keywords : Cry3A gene modification * Picea abies * Agrobacterium tumefaciens Subject RIV: EB - Genetic s ; Molecular Biology Impact factor: 1.389, year: 2013
Full Text Available Hypertension caused by preeclampsia can adversely affect the fetus by causing constriction of the placental arteries. Arterial constriction may result in severe reduction in the blood flow ...
Effect of prophylactic digitalization on the development of myocardial hypertrophy.
Cutilletta, A F; Rudnik, M; Arcilla, R A; Straube, R
1977-11-01
The effect of prophylactic digitalization on the development of left ventricular hypertrophy was studied in adult rats. Digitoxin, 0.1 mg/100 g body wt or solvent was given daily for 1 wk prior to either aortic constriction or sham operation and was continued until the animals were killed, either 1 or 4 wk after surgery. A hemodynamic study was done in those animals killed 1 wk after surgery; hearts of all animals were examined for evidence of myocardial hypertrophy. Constriction of the ascending aorta had no significant effect on cardiac output but did reduce peak flow velocity and flow acceleration. An increase in left ventricular mass, RNA, and hydroxyproline was found in the animals with aortic constriction. Digitoxin treatment did not alter peak flow velocity or flow acceleration, but did significantly increase isovolumic (dP/dt)P-1. Digitoxin had no effect on body weight, heart weight, RNA, or hydroxyproline in either the sham-operated animals or in the animals with aortic constriction. Therefore, despite plasma digitoxin levels sufficient to affect myocardial contractility, left ventricular hypertrophy still developed after aortic constriction.
Czech Academy of Sciences Publication Activity Database
Jakl, M.; Jaklová Dytrtová, Jana; Kuneš, I.; Baláš, M.; Száková, J.; Balík, J.
2014-01-01
Roč. 225, č. 5 (2014), 1937/1-1937/9 ISSN 0049-6979 R&D Projects: GA ČR GP13-21409P Grant - others:GA MZe(CZ) QH92087 Institutional support: RVO:61388963 Keywords : liming * forest soil * disturbed stand * hazardous metals * diffusive gradient in thin films Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.554, year: 2014
Development and mapping of DArT markers within the Festuca-Lolium complex
Czech Academy of Sciences Publication Activity Database
Kopecký, David; Bartoš, Jan; Lukaszewski, A.; Baird, J. H.; Černoch, V.; Koelliker, R.; Rognli, O. A.; Blois, H.; Caig, V.; Luebberstedt, T.; Studer, B.; Shaw, P.; Doležel, Jaroslav; Kilian, A.
2009-01-01
Roč. 10, Art_No_473 (2009), s. 1-11 ISSN 1471-2164 R&D Projects: GA MZe QH71267; GA ČR GP521/07/P479 Institutional research plan: CEZ:AV0Z50380511 Keywords : DIVERSITY ARRAYS TECHNOLOGY * GENETIC-LINKAGE MAP * PERENNIAL RYEGRASS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.759, year: 2009
Early development and growth of sterlet (Acipenser ruthenus) in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Rybnikár, J.; Prokeš, Miroslav; Mareš, J.; Cileček, M.
2011-01-01
Roč. 59, č. 5 (2011), s. 217-225 ISSN 1211-8516 R&D Projects: GA MZe QH71305 Institutional research plan: CEZ:AV0Z60930519 Keywords : early ontogeny * specific growth rate * length-weight relationship * factor of weight condition Subject RIV: GL - Fishing http://www.mendelu.cz/dok_server/slozka.pl?id=51329;download=82072
Czech Academy of Sciences Publication Activity Database
Prokeš, Miroslav; Baruš, Vlastimil; Mareš, J.; Peňáz, Milan; Baránek, V.
2011-01-01
Roč. 59, č. 6 (2011), s. 281-290 ISSN 1211-8516 R&D Projects: GA MZe QH71305 Institutional research plan: CEZ:AV0Z60930519 Keywords : sterlet juveniles and adults * specific growth rate * length-weight relationship * condition factor Subject RIV: GL - Fishing http://www.mendelu.cz/dok_server/slozka.pl?id=51329;download=85841
Lifescience Database Archive (English)
Full Text Available 12960231 Macrophage activation through CCR5- and CXCR4-mediated gp120-elicited sign...82. Epub 2003 Jul 22. (.png) (.svg) (.html) (.csml) Show Macrophage activation through CCR5- and CXCR4-media...on through CCR5- and CXCR4-mediated gp120-elicited signalingpathways. Authors Lee C, Liu QH, Tomkowicz B, Yi
Czech Academy of Sciences Publication Activity Database
Vlasák, Josef; Bříza, Jindřich; Pavingerová, Daniela; Modlinger, R.; Knížek, M.; Malá, J.
2012-01-01
Roč. 11, č. 86 (2012), s. 15236-15240 ISSN 1684-5315 R&D Projects: GA MZe QH71290; GA ČR(CZ) GAP502/11/1471 Institutional research plan: CEZ:AV0Z50510513 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * Ips typographus * Picea abies Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.573, year: 2010
Czech Academy of Sciences Publication Activity Database
Štursová, Martina; Baldrian, Petr
2011-01-01
Roč. 338, 1-2 (2011), s. 99-110 ISSN 0032-079X R&D Projects: GA ČR GA526/08/0751; GA MŠk LC06066; GA MZe QH72216 Institutional research plan: CEZ:AV0Z50200510 Keywords : Extracellular enzymes * Decomposition * Lignocellulose Subject RIV: EE - Microbiology, Virology Impact factor: 2.733, year: 2011
Czech Academy of Sciences Publication Activity Database
Nováková, Miroslava; Kim, P.D.; Šašek, Vladimír; Burketová, Lenka; Jindřichová, Barbora; Šantrůček, J.; Valentová, O.
2016-01-01
Roč. 32, č. 4 (2016), s. 918-928 ISSN 8756-7938 R&D Projects: GA ČR GA522/08/1581; GA MZe QH81201; GA MŠk LD14093 Institutional support: RVO:61389030 Keywords : elicitor * Brassica napus * Leptosphaeria maculans Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.986, year: 2016
Microbial enzyme-catalyzed processes in soils and their analysis
Czech Academy of Sciences Publication Activity Database
Baldrian, Petr
2009-01-01
Roč. 55, č. 9 (2009), s. 370-378 ISSN 1214-1178 R&D Projects: GA MŠk LC06066; GA MŠk OC 155; GA MŠk OC08050; GA MZe QH72216 Institutional research plan: CEZ:AV0Z50200510 Keywords : assay methods * extracellular enzymes * ecology Subject RIV: EE - Microbiology, Virology Impact factor: 0.697, year: 2009
The influence of diel period on fish assemblage in the unstructured littoral of reservoirs
Czech Academy of Sciences Publication Activity Database
Říha, Milan; Kubečka, Jan; Prchalová, Marie; Mrkvička, Tomáš; Čech, Martin; Draštík, Vladislav; Frouzová, Jaroslava; Hohausová, Eva; Jůza, Tomáš; Kratochvíl, Michal; Peterka, Jiří; Tušer, Michal; Vašek, Mojmír
2011-01-01
Roč. 18, č. 4 (2011), s. 339-347 ISSN 0969-997X R&D Projects: GA ČR(CZ) GA206/07/1392; GA MZe(CZ) QH81046 Institutional research plan: CEZ:AV0Z60170517 Keywords : beach seining * diel migration * sampling * species composition * Římov Reservoir Subject RIV: EG - Zoology Impact factor: 1.294, year: 2011
Genomic constitution of Festuca x Lolium hybrids revealed by the DArTFest array
Czech Academy of Sciences Publication Activity Database
Kopecký, David; Bartoš, Jan; Christelová, Pavla; Černoch, V.; Kilian, A.; Doležel, Jaroslav
2011-01-01
Roč. 122, č. 2 (2011), s. 355-363 ISSN 0040-5752 R&D Projects: GA MZe QH71267; GA ČR GP521/07/P479 Institutional research plan: CEZ:AV0Z50380511 Keywords : IN-SITU HYBRIDIZATION * GENETIC-LINKAGE MAP * PRATENSIS HUDS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.297, year: 2011
Effects of Soil Substrate Contaminated by Knotweed Leaves on Seed Development
Czech Academy of Sciences Publication Activity Database
Šerá, Božena
2012-01-01
Roč. 21, č. 3 (2012), s. 713-717 ISSN 1230-1485 R&D Projects: GA MŠk OC10032; GA MZe QH72117 Institutional research plan: CEZ:AV0Z60870520 Keywords : seed germination * early growth * hormesis * allelopathy * phytotoxicity * Reynoutria * biotechnology Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides Impact factor: 0.462, year: 2012
Activities of modified Cry3A-type toxins on the red flour beetle, Tribolium castaneum (Herbst)
Czech Academy of Sciences Publication Activity Database
Mostafa, Moataz; Vlasák, Josef; Sehnal, František
2013-01-01
Roč. 137, č. 9 (2013), s. 684-692 ISSN 0931-2048 R&D Projects: GA MZe QI91A229; GA MZe QH71290 Institutional support: RVO:60077344 Keywords : Bacillus thuringensis * biocontrol * Cry3Aa Subject RIV: ED - Physiology Impact factor: 1.701, year: 2013 http://onlinelibrary.wiley.com/doi/10.1111/jen.12054/pdf
.i.Utricularia./i. carnivory revisited: plants supply photosynthetic carbon to traps
Czech Academy of Sciences Publication Activity Database
Sirová, Dagmara; Borovec, Jakub; Šantrůčková, H.; Šantrůček, J.; Vrba, Jaroslav; Adamec, Lubomír
2010-01-01
Roč. 61, č. 1 (2010), s. 99-103 ISSN 0022-0957 R&D Projects: GA MZe(CZ) QH81012 Institutional research plan: CEZ:AV0Z60170517; CEZ:AV0Z60050516 Keywords : aquatic carnivorous plants * stable isotope labelling * carbon exudation * microbial community * Utricularia australis * Utricularia vulgaris Subject RIV: EH - Ecology, Behaviour Impact factor: 4.818, year: 2010
The effect of different nitrogen nutrition on proline and asparagine content in plant
Czech Academy of Sciences Publication Activity Database
Neuberg, M.; Pavlíková, D.; Pavlík, Milan; Balík, J.
2010-01-01
Roč. 56, č. 7 (2010), s. 305-311 ISSN 1214-1178 R&D Projects: GA MZe QH71077 Institutional research plan: CEZ:AV0Z50380511 Keywords : plant metabolism * Fabaceae * Poaceae Subject RIV: GD - Fertilization, Irrigation, Soil Processing Impact factor: 1.076, year: 2010 http://www.agriculturejournals.cz/publishedArticle?journal=PSE&volume=56&firstPage=305
Harvesting behaviour of three central European rodents: Identifying the rodent pest in cereals
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Tkadlec, Emil
2011-01-01
Roč. 30, č. 1 (2011), s. 82-84 ISSN 0261-2194 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : Apodemus sylvaticus * Apodemus uralensis * feeding behaviour * lab experiments * Microtus arvalis * rodent pest control Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.402, year: 2011
r isotopes in the yrgueil gs meteoriteX ghronology of e rly sol r ...
Indian Academy of Sciences (India)
h ve een deposited intermittently st rting ne r the time of p rent ody form tion nd ontinuing for t le st QH w F he r .... mounts of w ter flowed through the yrgueil p rent m teri l during lter ... n lysis were rried outF pirstD series of le hing experiments ...
First record of spider Mermessus trilobatus (Araneae) in South Bohemia
Czech Academy of Sciences Publication Activity Database
Holec, M.; Svobodová, Zdeňka; Habuštová, Oxana; Hussein, Hany; Sehnal, František
2012-01-01
Roč. 6, č. 1 (2012), s. 15-17 ISSN 1802-212X R&D Projects: GA MZe QH91093 Grant - others:projekt MOBITAG(CZ) 7FP-REGPOT-2008-1, GA 229518 Institutional support: RVO:60077344 Keywords : Mermessus trilobatus * Eperigone trilobata * spreading Subject RIV: EG - Zoology http://fzp.ujep.cz/Veda/Edice/StudiaOecologica/SO_1-2012_web.pdf
Ye, Ting; Shi, Huixin; Phan-Thien, Nhan; Lim, Chwee Teck; Li, Yu
2018-01-24
The changes in the mechanical properties of a cell are not only the cause of some diseases, but can also be a biomarker for some disease states. In recent times, microfluidic devices with built-in constrictions have been widely used to measure these changes. The transit time in such devices, defined as the time that a cell takes to pass through a constriction, has been found to be a crucial factor associated with the cell mechanical properties. Here, we use smoothed dissipative particle dynamics (SDPD), a particle-based numerical method, to explore the relationship between the transit time and mechanical properties of a cell. Three expressions of the transit time are developed from our simulation data, with respect to the stenosed size of constrictions, the shear modulus and bending modulus of cells, respectively. We show that a convergent constriction (the inlet is wider than the outlet), and a sharp-corner constriction (the constriction outlet is narrow) are better in identifying the differences in the transit time of cells. Moreover, the transit time increases and gradually approaches a constant as the shear modulus of cells increases, but increases first and then decreases as the bending modulus increases. These results suggest that the mechanical properties of cells can indeed be measured by analyzing their transit time, based on the recommended microfluidic device.
Timely Endocytosis of Cytokinetic Enzymes Prevents Premature Spindle Breakage during Mitotic Exit.
Directory of Open Access Journals (Sweden)
Cheen Fei Chin
2016-07-01
Full Text Available Cytokinesis requires the spatio-temporal coordination of membrane deposition and primary septum (PS formation at the division site to drive acto-myosin ring (AMR constriction. It has been demonstrated that AMR constriction invariably occurs only after the mitotic spindle disassembly. It has also been established that Chitin Synthase II (Chs2p neck localization precedes mitotic spindle disassembly during mitotic exit. As AMR constriction depends upon PS formation, the question arises as to how chitin deposition is regulated so as to prevent premature AMR constriction and mitotic spindle breakage. In this study, we propose that cells regulate the coordination between spindle disassembly and AMR constriction via timely endocytosis of cytokinetic enzymes, Chs2p, Chs3p, and Fks1p. Inhibition of endocytosis leads to over accumulation of cytokinetic enzymes during mitotic exit, which accelerates the constriction of the AMR, and causes spindle breakage that eventually could contribute to monopolar spindle formation in the subsequent round of cell division. Intriguingly, the mitotic spindle breakage observed in endocytosis mutants can be rescued either by deleting or inhibiting the activities of, CHS2, CHS3 and FKS1, which are involved in septum formation. The findings from our study highlight the importance of timely endocytosis of cytokinetic enzymes at the division site in safeguarding mitotic spindle integrity during mitotic exit.
International Nuclear Information System (INIS)
Stanton-Hicks, M.; Hoeck, A.S.; Stuehmeier, K.D.A.; Arndt, J.O.
1987-01-01
The authors studied the effects of dihydroergotamine (DHE) and etilefrine hydrochloride (E) on the regional distribution of /sup 99m/Tc-marked erythrocytes during epidural anesthesia in eight supine men to determine if vasoactive agents with venoconstrictor action would enhance cardiac filling during epidural anesthesia. Radioactivity was recorded with a gamma camera, and its distribution determined in the thorax, abdomen, and limbs. Arterial and central venous pressure, heart rate, and calf volume by plethysmography were measured. During epidural anesthesia with a sensory block up to T4/5, DHE (7.5 micrograms/kg) reduced the radioactivity, i.e., blood volume, in both the innervated (-5.9 +/- 3.5%) and denervated muscle/skin (-16.9 +/- 7%) regions, and increased it in both the intrathoracic (+7.0 +/- 2.3%), and splanchnic vasculature (+4.2 +/- 3.2). In contrast, E (6 micrograms X kg-1 X min-1) decreased the blood volume most markedly in the splanchnic region (-5.4 +/- 0.7%) and increased it in the thorax (+2 +/- 0.6%). All these changes were statistically significant. The combined effects were estimated to be equivalent to a transfusion of nearly 1.01 of blood. Both drugs reversed the hypotensive action of epidural anesthesia. During epidural anesthesia, DHE preferentially constricted the capacitance vessels in skeletal muscle and skin irrespective of the state of innervation, whereas E preferentially constricted the splanchnic vasculature. In the doses used, the two agents replenished in an additive fashion the central circulation during epidural anesthesia
Zeng, Yan-Fei; Zhang, Jian-Guo; Abuduhamiti, Bawerjan; Wang, Wen-Ting; Jia, Zhi-Qing
2018-05-25
The effects of historical geology and climatic events on the evolution of plants around the Qinghai-Tibetan Plateau region have been at the center of debate for years. To identify the influence of the uplift of the Tianshan Mountains and/or climatic oscillations on the evolution of plants in arid northwest China, we investigated the phylogeography of the Euphrates poplar (Populus euphratica) using chloroplast DNA (cpDNA) sequences and nuclear microsatellites, and estimated its historical distribution using Ecological Niche Modeling (ENM). We found that the Euphrates poplar differed from another desert poplar, P. pruinosa, in both nuclear and chloroplast DNA. The low clonal diversity in both populations reflected the low regeneration rate by seed/seedlings in many locations. Both cpDNA and nuclear markers demonstrated a clear divergence between the Euphrates poplar populations from northern and southern Xinjiang regions. The divergence time was estimated to be early Pleistocene based on cpDNA, and late Pleistocene using an Approximate Bayesian Computation analysis based on microsatellites. Estimated gene flow was low between these two regions, and the limited gene flow occurred mainly via dispersal from eastern regions. ENM analysis supported a wider distribution of the Euphrates poplar at 3 Ma, but a more constricted distribution during both the glacial period and the interglacial period. These results indicate that the deformation of the Tianshan Mountains has impeded gene flow of the Euphrates poplar populations from northern and southern Xinjiang, and the distribution constriction due to climatic oscillations further accelerated the divergence of populations from these regions. To protect the desert poplars, more effort is needed to encourage seed germination and seedling establishment, and to conserve endemic gene resources in the northern Xinjiang region.
Amniotic band syndrome: A clinical brief
Directory of Open Access Journals (Sweden)
Dasaradha Ramireddy Malireddy
2017-01-01
Full Text Available Amniotic band syndrome (ABS results from bands of amnion entangling fetal parts. They may manifest as constriction rings or complex congenital anomalies resulting in stillbirth. Karyotyping is important for exclusion of inherited disorders and proper counseling. Two case reports one stillbirth and the other with constriction ring of fingers and mild hydronephrosis are presented. The aim of this paper is to make awareness and stress the need for doing thorough work-up in all cases of constriction bands.
What is the clinical significance of ventricular mural antagonism?
DEFF Research Database (Denmark)
Lunkenheimer, Paul P; Niederer, Peter; Stephenson, Robert S
2018-01-01
alignment, thus deviating from the prevailing tangential orientation. Upon contraction, they produce, in addition to a tangential force, a radial force component that counteracts ventricular constriction and aids widening of the ventricular cavity. In experimental studies, we have provided evidence...... for the existence of such forces, which are auxotonic in nature. This is in contrast to the tangentially aligned myocytes that produce constrictive forces, which are unloading in nature. The ventricular myocardium is, therefore, able to function in an antagonistic fashion, with the prevailing constrictive forces...
Zigzag phosphorene nanoribbons: one-dimensional resonant channels in two-dimensional atomic crystals
Páez, Carlos J; Pereira, Ana L C; Schulz, Peter A
2016-01-01
We theoretically investigate phosphorene zigzag nanoribbons as a platform for constriction engineering. In the presence of a constriction at one of the edges, quantum confinement of edge-protected states reveals conductance peaks, if the edge is uncoupled from the other edge. If the constriction is narrow enough to promote coupling between edges, it gives rise to Fano-like resonances as well as antiresonances in the transmission spectrum. These effects are shown to mimic an atomic chain like behavior in a two dimensional atomic crystal. PMID:28144546
Zigzag phosphorene nanoribbons: one-dimensional resonant channels in two-dimensional atomic crystals
Directory of Open Access Journals (Sweden)
Carlos. J. Páez
2016-12-01
Full Text Available We theoretically investigate phosphorene zigzag nanoribbons as a platform for constriction engineering. In the presence of a constriction at one of the edges, quantum confinement of edge-protected states reveals conductance peaks, if the edge is uncoupled from the other edge. If the constriction is narrow enough to promote coupling between edges, it gives rise to Fano-like resonances as well as antiresonances in the transmission spectrum. These effects are shown to mimic an atomic chain like behavior in a two dimensional atomic crystal.
Paternity following multiple mating in ladybird Harmonia axyridis
Czech Academy of Sciences Publication Activity Database
Awad, Mona; Piálek, L.; Krejčí, Alena; Laugier, G. J. M.; Nedvěd, Oldřich
2017-01-01
Roč. 62, č. 3 (2017), s. 297-307 ISSN 1386-6141 Grant - others:MZe ČR(CZ) QH82047 Institutional support: RVO:60077344 Keywords : Coccinellidae * microsatellites * fertility Subject RIV: ED - Physiology OBOR OECD: Reproductive biology (medical aspects to be 3) Impact factor: 1.918, year: 2016 https://link.springer.com/article/10.1007%2Fs10526-017-9806-z
Czech Academy of Sciences Publication Activity Database
Rayapuram, C.; Hemzalová, Vendula; Lyngkjaer, M. E.
2011-01-01
Roč. 93, č. 3 (2011), s. 613-625 ISSN 1125-4653 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blumeria graminis f. sp hordei * Hordeum vulgare * hypersensitive response Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.912, year: 2011 http://sipav.org/main/jpp/index.php/jpp/article/view/1229
Impact of genetically modified maize expressing Cry 3Bb1 on some non-target arthropods
Czech Academy of Sciences Publication Activity Database
Hussein, Hany; Svobodová, Zdeňka; Habuštová, Oxana; Půža, Vladimír; Sehnal, František
2012-01-01
Roč. 8, č. 10 (2012), s. 5124-5131 ISSN 1819-544X R&D Projects: GA MZe QH91093 Grant - others:projekt MOBITAG(CZ) REGPOT-2008-1, GA 229518 Institutional support: RVO:60077344 Keywords : MON 88017 * Cry3Bb1 * non-target organisms Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection http://www.aensiweb.com/jasr/jasr/2012/5124-5131.pdf
Unexpected visitors: flightless beetles in window traps
Czech Academy of Sciences Publication Activity Database
Horák, J.; Vodka, Štěpán; Pavlíček, J.; Boža, P.
2013-01-01
Roč. 17, č. 3 (2013), s. 441-449 ISSN 1366-638X Grant - others:Ministerstvo zemědělství(CZ) QH91097 Institutional support: RVO:60077344 Keywords : altitude * host tree * non-intervention Subject RIV: EH - Ecology, Behaviour Impact factor: 1.789, year: 2013 http://link.springer.com/article/10.1007%2Fs10841-012-9526-8#page-1
Czech Academy of Sciences Publication Activity Database
Jan, Jiří; Borovec, Jakub; Kopáček, Jiří; Hejzlar, Josef
2013-01-01
Roč. 47, č. 2 (2013), s. 547-557 ISSN 0043-1354 R&D Projects: GA ČR(CZ) GA206/09/1764; GA MZe(CZ) QH81012; GA MZe(CZ) QI102A265 Institutional support: RVO:60077344 Keywords : sequential fractionation * ascorbate and oxalate extration * non-calcareous sediments Subject RIV: DA - Hydrology ; Limnology Impact factor: 5.323, year: 2013
Czech Academy of Sciences Publication Activity Database
Neuberg, M.; Pavlíková, D.; Žižková, Eva; Motyka, Václav; Pavlík, Milan
2011-01-01
Roč. 57, č. 8 (2011), s. 381-387 ISSN 1214-1178 R&D Projects: GA MZe QH71077; GA ČR(CZ) GAP506/11/0774 Institutional research plan: CEZ:AV0Z50380511 Keywords : poaceae * fabaceae * N nutrition Subject RIV: GD - Fertilization, Irrigation, Soil Processing Impact factor: 1.078, year: 2011 http://www.agriculturejournals.cz/publicFiles/44520.pdf
Star formation and gas inflows in the OH Megamaser galaxy IRAS03056+2034
Hekatelyne, C.; Riffel, Rogemar A.; Sales, Dinalva; Robinson, Andrew; Storchi-Bergmann, Thaisa; Kharb, Preeti; Gallimore, Jack; Baum, Stefi; O'Dea, Christopher
2018-06-01
We have obtained observations of the OH Megamaser galaxy IRAS03056+0234 using Gemini Multi-Object Spectrograph (GMOS) Integral Field Unit (IFU), Very Large Array (VLA) and Hubble Space Telescope (HST). The HST data reveals spiral arms containing knots of emission associated to star forming regions. The GMOS-IFU data cover the spectral range of 4500 to 7500 Å at a velocity resolution of 90 km s-1 and spatial resolution of 506 pc. The emission-line flux distributions reveal a ring of star forming regions with radius of 786 pc centred at the nucleus of the galaxy, with an ionized gas mass of 1.2× 108M⊙, an ionizing photon luminosity of log Q[H+]=53.8 and a star formation rate of 4.9 M⊙ yr-1. The emission-line ratios and radio emission suggest that the gas at the nuclear region is excited by both starburst activity and an active galactic nucleus. The gas velocity fields are partially reproduced by rotation in the galactic plane, but show, in addition, excess redshifts to the east of the nucleus, consistent with gas inflows towards the nucleus, with velocity of ˜45 km s-1 and a mass inflow rate of ˜7.7 × 10-3 M⊙ yr-1.
Branes constrictions with White Dwarfs
Energy Technology Data Exchange (ETDEWEB)
García-Aspeitia, Miguel A., E-mail: aspeitia@fisica.uaz.edu.mx [Consejo Nacional de Ciencia y Tecnología, Av, Insurgentes Sur 1582, Colonia Crédito Constructor, Del. Benito Juárez, C.P. 03940, Mexico, D.F. (Mexico); Unidad Académica de Física, Universidad Autónoma de Zacatecas, Calzada Solidaridad esquina con Paseo a la Bufa S/N, C.P. 98060, Zacatecas (Mexico)
2015-11-06
We consider here a robust study of stellar dynamics for white dwarf stars with polytropic matter in the weak-field approximation using the Lane–Emden equation from the brane-world scenario. We also derive an analytical solution to the nonlocal energy density and show the behavior and sensitivity of these stars to the presence of extra dimensions. Similarly, we analyze stability and compactness, in order to show whether it is possible to agree with the conventional wisdom of white dwarfs dynamics. Our results predict an average value of the brane tension of <λ>≳84.818 MeV{sup 4}, with a standard deviation σ≃82.021 MeV{sup 4}, which comes from a sample of dwarf stars, being weaker than other astrophysical observations but remaining higher than cosmological results provided by nucleosynthesis among others.
Branes constrictions with White Dwarfs
International Nuclear Information System (INIS)
García-Aspeitia, Miguel A.
2015-01-01
We consider here a robust study of stellar dynamics for white dwarf stars with polytropic matter in the weak-field approximation using the Lane–Emden equation from the brane-world scenario. We also derive an analytical solution to the nonlocal energy density and show the behavior and sensitivity of these stars to the presence of extra dimensions. Similarly, we analyze stability and compactness, in order to show whether it is possible to agree with the conventional wisdom of white dwarfs dynamics. Our results predict an average value of the brane tension of <λ>≳84.818 MeV 4 , with a standard deviation σ≃82.021 MeV 4 , which comes from a sample of dwarf stars, being weaker than other astrophysical observations but remaining higher than cosmological results provided by nucleosynthesis among others
Branes constrictions with White Dwarfs
Energy Technology Data Exchange (ETDEWEB)
Garcia-Aspeitia, Miguel A. [Consejo Nacional de Ciencia y Tecnologia, Mexico (Mexico); Unidad Academica de Fisica, Universidad Autonoma de Zacatecas (Mexico)
2015-11-15
We consider here a robust study of stellar dynamics for white dwarf stars with polytropic matter in the weak-field approximation using the Lane-Emden equation from the brane-world scenario. We also derive an analytical solution to the nonlocal energy density and show the behavior and sensitivity of these stars to the presence of extra dimensions. Similarly, we analyze stability and compactness, in order to show whether it is possible to agree with the conventional wisdom of white dwarfs dynamics. Our results predict an average value of the brane tension of left angle λ right angle >or similar 84.818 MeV{sup 4}, with a standard deviation σ ≅ 82.021 MeV{sup 4}, which comes from a sample of dwarf stars, being weaker than other astrophysical observations but remaining higher than cosmological results provided by nucleosynthesis among others. (orig.)
Choi, Jaewon; Yang, MinHo; Kim, Sung-Kon
2017-11-01
Bio-inspired and environmentally friendly chemical functionalization is a successful way to a new class of hybrid electrode materials for applications in energy storage. Quinone (Q)-hydroquinone (QH2) couples, a prototypical example of organic redox systems, provide fast and reversible proton-coupled electron-transfer reactions which lead to increased capacity. To achieve high capacitance and rate performance, constructing three-dimensional (3D) continuous porous structure is highly desirable. Here we report the hybrid electrodes (GA-C) consisting of 3D graphene aerogel (GA) functionalized with organic redox-active material, catechol derivative, for application to high-performance supercapacitors. The catechol derivative is adsorbed on the surface of GA through non-covalent interactions and promotes fast and reversible Q/QH2 faradaic reactions, providing large specific capacitance of 188 F g-1 at a current of 1 A g-1 and a specific energy of ∼25 Wh kg-1 at a specific power of ∼18,000 W kg-1. 3D continuous porous structure of GA electrode facilitates ion and electron transports, resulting in high rate performance (∼140 F g-1 at a current of 10 A g-1).
An On-Chip RBC Deformability Checker Significantly Improves Velocity-Deformation Correlation
Directory of Open Access Journals (Sweden)
Chia-Hung Dylan Tsai
2016-10-01
Full Text Available An on-chip deformability checker is proposed to improve the velocity–deformation correlation for red blood cell (RBC evaluation. RBC deformability has been found related to human diseases, and can be evaluated based on RBC velocity through a microfluidic constriction as in conventional approaches. The correlation between transit velocity and amount of deformation provides statistical information of RBC deformability. However, such correlations are usually only moderate, or even weak, in practical evaluations due to limited range of RBC deformation. To solve this issue, we implemented three constrictions of different width in the proposed checker, so that three different deformation regions can be applied to RBCs. By considering cell responses from the three regions as a whole, we practically extend the range of cell deformation in the evaluation, and could resolve the issue about the limited range of RBC deformation. RBCs from five volunteer subjects were tested using the proposed checker. The results show that the correlation between cell deformation and transit velocity is significantly improved by the proposed deformability checker. The absolute values of the correlation coefficients are increased from an average of 0.54 to 0.92. The effects of cell size, shape and orientation to the evaluation are discussed according to the experimental results. The proposed checker is expected to be useful for RBC evaluation in medical practices.
Croft, Quentin P P; Formenti, Federico; Talbot, Nick P; Lunn, Daniel; Robbins, Peter A; Dorrington, Keith L
2013-01-01
The human pulmonary vasculature constricts in response to hypercapnia and hypoxia, with important consequences for homeostasis and adaptation. One function of these responses is to direct blood flow away from poorly-ventilated regions of the lung. In humans it is not known whether the stimuli of hypercapnia and hypoxia constrict the pulmonary blood vessels independently of each other or whether they act synergistically, such that the combination of hypercapnia and hypoxia is more effective than the sum of the responses to each stimulus on its own. We independently controlled the alveolar partial pressures of carbon dioxide (Paco 2) and oxygen (Pao 2) to examine their possible interaction on human pulmonary vasoconstriction. Nine volunteers each experienced sixteen possible combinations of four levels of Paco 2 (+6, +1, -4 and -9 mmHg, relative to baseline) with four levels of Pao 2 (175, 100, 75 and 50 mmHg). During each of these sixteen protocols Doppler echocardiography was used to evaluate cardiac output and systolic tricuspid pressure gradient, an index of pulmonary vasoconstriction. The degree of constriction varied linearly with both Paco 2 and the calculated haemoglobin oxygen desaturation (1-So2). Mixed effects modelling delivered coefficients defining the interdependence of cardiac output, systolic tricuspid pressure gradient, ventilation, Paco 2 and So2. No interaction was observed in the effects on pulmonary vasoconstriction of carbon dioxide and oxygen (p>0.64). Direct effects of the alveolar gases on systolic tricuspid pressure gradient greatly exceeded indirect effects arising from concurrent changes in cardiac output.
Regional development and regional policy
Šabić, Dejan; Vujadinović, Snežana
2017-01-01
Economic polarization is a process that is present at global, national and regional level. Economic activity is extremely spatially concentrated. Cities and developed regions use the agglomeration effect to attract labor and capital, thus achieving more favorable economic conditions than the agrarian region. Scientific research and European experiences over the past decades have contributed to the discrepancy among theorists about the causes and consequences of regional inequalities. Regional...
Atomistic Determination of Cross-Slip Pathway and Energetics
DEFF Research Database (Denmark)
Rasmussen, Torben; Jacobsen, Karsten Wedel; Leffers, Torben
1997-01-01
plane. The transition state and activation energy for cross slip as well as the energies of the involved dislocation constrictions are determined. One constriction has a negative energy compared to parallel partials. The energy vs splitting width for recombination of parallel partials into a perfect...
Parameters of the constricted plasma discharge produced by radio-frequency for atmospheric pressures
International Nuclear Information System (INIS)
Zambrano R, G.
1987-01-01
The main electrophysical characteristics of high-frequency discharge between two electrodes for pressures of the order of atmospheric pressure were investigated. The vibrational and kinetic temperatures of the discharge, and the possibilities for creating the conditions which using these type of discharge an instability between vibrational and kinetic temperatures can be obtained. For determining main characteristics of this type of discharge, argon gas, nitrogen gas and air, when oxygen and nitrogen are predominated, were used. The obtained electrical discharge parameters were: the high frequency voltage between electrocathodes, the current, the phase displacement between current and voltage, and the discharge power. The kinetic temperature distribution in the discharge region, and the vibrational temperature of the nitrogen molecules in discharge channel were also obtained. (M.C.K.) [pt
2001-09-01
From the Original Proposal Estrogens: H H OH COH CH0 HQ ~ HHo QH HHO ’ OH3 HAOH 3 H Estradiol Hexestrol Benzestrol Cyclofenil Y~e Pure Antiestrogens...overlapping s, fl-CH 2), 4.95 (2H, PS-ArCH 20), 5.16 emission wavelength of 364 nm were used, based on the (1H, cx/cx’-CH), 7.98 (4H, ArCH
Czech Academy of Sciences Publication Activity Database
Svobodová, Zdeňka; Skoková Habuštová, Oxana; Boháč, J.; Sehnal, František
2016-01-01
Roč. 106, č. 4 (2016), s. 432-445 ISSN 0007-4853 R&D Projects: GA MZe QH91093 Grant - others:GA JU(CZ) 038/2014/P; project MOBILITY(CZ) 7AMB14SK096 Program:7A Institutional support: RVO:60077344 Keywords : GM crops * Bt maize * Cry3Bb1 Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.758, year: 2016
Kinetics and mechanism of the gas phase reaction of Cl atoms with iodobenzene
DEFF Research Database (Denmark)
Andersen, Mads Peter Sulbæk; Ponomarev, DA; Nielsen, OJ
2001-01-01
Smog chamber/FTIR techniques were used to study the kinetics and mechanism of the reaction of Cl atoms with iodobenzene (C6H5I) in 20-700 Torr of N-2, air, or O-2 diluent at 296 K. The reaction proceeds with a rate constant k(Cl + QH(5)I) = (3.3 +/- 0.7) x 10(-11) cm(3) molecule(-1) s(-1) to give...
Czech Academy of Sciences Publication Activity Database
Kula, E.; Nedvěd, Oldřich
2011-01-01
Roč. 108, č. 4 (2011), s. 603-608 ISSN 1210-5759 Grant - others:Ministry of Education of the Czech Republic(CZ) VZ MSM 6215648902; Ministry of Agriculture(CZ) QH82047 Institutional research plan: CEZ:AV0Z50070508 Keywords : Coccinellidae * Chilocorus renipustulatus * scale insect Subject RIV: EH - Ecology, Behaviour Impact factor: 1.061, year: 2011 http://www.eje.cz/scripts/viewabstract.php?abstract=1659
Czech Academy of Sciences Publication Activity Database
Prchalová, Marie; Kubečka, Jan; Čech, Martin; Frouzová, Jaroslava; Draštík, Vladislav; Hohausová, Eva; Jůza, Tomáš; Kratochvíl, Michal; Matěna, Josef; Peterka, Jiří; Říha, Milan; Tušer, Michal; Vašek, Mojmír
2009-01-01
Roč. 18, č. 2 (2009), s. 247-260 ISSN 0906-6691 R&D Projects: GA AV ČR(CZ) 1QS600170504; GA ČR(CZ) GA206/07/1392; GA MZe(CZ) QH81046 Institutional research plan: CEZ:AV0Z60170517 Keywords : horizontal distribution * vertical distribution * gillnet * reservoir * Cyprinidae * Percidae * redundancy analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 1.512, year: 2009
Frostbite in an adolescent football player: a case report.
Rivlin, Michael; King, Marnie; Kruse, Richard; Ilyas, Asif M
2014-01-01
To present the case of vascular compromise of a finger from a confluent circumferential blister due to an inappropriately applied commercial cold pack in a high school athlete and to describe the mechanism of iatrogenic injury, acute surgical management, rehabilitation, and pathophysiology of frostbite and constriction injuries. A 17-year-old male football player presented with a frostbite and constriction injury to the index finger secondary to prolonged use of a cooling pack after a mild traumatic injury to the digit. He developed a prolonged sensory deficit from thermal injury, as well as acute vascular compromise requiring urgent operative intervention. Frostbite and constriction injury to the index finger. Emergency surgical decompression and occupational therapy. Frostbite injuries can occur iatrogenically because of inappropriate use of cooling devices or gel packs. Fingers are commonly injured extremities that are particularly susceptible to frostbite and compression injuries. To our knowledge, no case of vascular compromise from the blister constriction of digits has been reported. Patients and their caregivers must be educated about how to properly use cooling devices. Clinicians need to fully evaluate patients with iatrogenic frostbite injuries, giving particular attention to neurovascular status, and must recognize the need for surgical release of constriction syndrome to prevent substantial morbidity.
International Nuclear Information System (INIS)
CASPER, TA; BURRELL, KH; DOYLE, EJ; GOHIL, P; GREENFIELD, CM; GROEBNER, RJ; JAYAKUMAR, RJ; MAKOWSKI, MA; RHODES, TL; WEST, WP
2003-01-01
OAK-B135 High confinement mode (H-mode) operation is a leading scenario for burning plasma devices due to its inherently high energy-confinement characteristics. The quiescent H-mode (QH-mode) offers these same advantages with the additional attraction of more steady edge conditions where the highly transient power loads due to edge localized mode (ELM) activity is replaced by the steadier power and particle losses associated with an edge harmonic oscillation (EHO). With the addition of an internal transport barrier (ITB), the capability is introduced for independent control of both the edge conditions and the core confinement region giving potential control of fusion power production for an advanced tokamak configuration. The quiescent double barrier (QDB) conditions explored in DIII-D experiments exhibit these characteristics and have resulted in steady plasma conditions for several confinement times (∼ 26 τ E ) with moderately high stored energy, β N H 89 ∼ 7 for 10 τ E
2010-10-01
... vehicle's fuel and cooling systems shall have no leaks or constricted fluid passages and all sealing devices and caps shall operate in the normal manner. (4) The vehicle's exhaust system shall have no leaks or constrictions. (5) The vehicle's propulsion, suspension, steering, and braking systems shall...
Microfluidic model experiments on the injectability of monoclonal antibody solutions
Duchene, Charles; Filipe, Vasco; Nakach, Mostafa; Huille, Sylvain; Lindner, Anke
2017-11-01
Autoinjection devices that allow patients to self-administer medicine are becoming used more frequently; however, this advance comes with an increased need for precision in the injection process. The rare occurrence of protein aggregates in solutions of monoclonal antibodies constitutes a threat to the reliability of such devices. Here we study the flow of protein solutions containing aggregates in microfluidic model systems, mimicking injection devices, to gain fundamental understanding of the catastrophic clogging of constrictions of given size. We form aggregates by mechanically shaking or heating antibody solutions and then inject these solutions into microfluidic channels with varying types of constrictions. Geometrical clogging occurs when aggregates reach the size of the constriction and can in some cases be undone by increasing the applied pressure. We perform systematic experiments varying the relative aggregate size and the flow rate or applied pressure. The mechanical deformation of aggregates during their passage through constrictions is investigated to gain a better understanding of the clogging and unclogging mechanisms.
[Impact of introduction of O2 on the welding arc of gas pool coupled activating TIG].
Huang, Yong; Wang, Yan-Lei; Zhang, Zhi-Guo
2014-05-01
In the present paper, Boltzmann plot method was applied to analyze the temperature distributions of the are plasma when the gas pool coupled activating TIG welding was at different coupling degrees with the outer gas being O2. Based on this study of temperature distributions, the changing regularities of are voltage and are appearance were studied. The result shows that compared with traditional TIG welding, the introduction of O2 makes the welding arc constricted slightly, the temperature of the are center build up, and the are voltage increase. When argon being the inner gas, oxygen serving as the outer gas instead of argon makes the are constricted more obviously. When the coupling degree increases from 0 to 2, the temperature of the are center and the are voltage both increase slightly. In the gas pool coupled activating TIG welding the are is constricted not obviously, and the reason why the weld penetration is improved dramatically in the welding of stainless steel is not are constriction.
Efimova, Nadia; Korobova, Farida; Stankewich, Michael C; Moberly, Andrew H; Stolz, Donna B; Wang, Junling; Kashina, Anna; Ma, Minghong; Svitkina, Tatyana
2017-07-05
Dendritic spines are postsynaptic structures in neurons often having a mushroom-like shape. Physiological significance and cytoskeletal mechanisms that maintain this shape are poorly understood. The spectrin-based membrane skeleton maintains the biconcave shape of erythrocytes, but whether spectrins also determine the shape of nonerythroid cells is less clear. We show that βIII spectrin in hippocampal and cortical neurons from rodent embryos of both sexes is distributed throughout the somatodendritic compartment but is particularly enriched in the neck and base of dendritic spines and largely absent from spine heads. Electron microscopy revealed that βIII spectrin forms a detergent-resistant cytoskeletal network at these sites. Knockdown of βIII spectrin results in a significant decrease in the density of dendritic spines. Surprisingly, the density of presynaptic terminals is not affected by βIII spectrin knockdown. However, instead of making normal spiny synapses, the presynaptic structures in βIII spectrin-depleted neurons make shaft synapses that exhibit increased amplitudes of miniature EPSCs indicative of excessive postsynaptic excitation. Thus, βIII spectrin is necessary for formation of the constricted shape of the spine neck, which in turn controls communication between the synapse and the parent dendrite to prevent excessive excitation. Notably, mutations of SPTNB2 encoding βIII spectrin are associated with neurodegenerative syndromes, spinocerebellar ataxia Type 5, and spectrin-associated autosomal recessive cerebellar ataxia Type 1, but molecular mechanisms linking βIII spectrin functions to neuronal pathologies remain unresolved. Our data suggest that spinocerebellar ataxia Type 5 and spectrin-associated autosomal recessive cerebellar ataxia Type 1 pathology likely arises from poorly controlled synaptic activity that leads to excitotoxicity and neurodegeneration. SIGNIFICANCE STATEMENT Dendritic spines are small protrusions from neuronal
IMMUNOLOGICAL CHARACTERISTIC OF SYNTHETIC PEPTIDES SIMILAR TO ACTUAL HIV ANTIGEN DETERMINANTS
Directory of Open Access Journals (Sweden)
S. V. Korobova
2016-01-01
Full Text Available The development of HIV vaccine remains an important goal in prophylaxis and therapy of HIV/ AIDS epidemics. There are various approaches for development of а candidate vaccine based on induction of neutralizing antibodies and cell-mediated immunity. Synthetic peptides are considered promising vaccine antigens since they are capable of activating both humoral and cellular immune response. HIV-1 envelope gp120 is the target for neutralizing antiviral antibodies. The V3 region of the HIV-1 gp120 is highly immunogenic and important for the virus-coreceptor interaction. In a RV144 vaccine trial, the levels of vaccine-induced IgG antibodies recognizing V1V2 regions from multiple HIV-1 subtypes show inverse correlations with a risk for HIV-1 infection. Meanwhile, HIV is characterized by high diversity. The consensus and mosaic immunogens are complete but artificial proteins, which are computationally designed to elicit immune responses with improved cross-reactive broadness. We have been studied immunogenic properties of synthetic peptides derived from V1, V2, V3 loop regions of the consensus M HIV1 (CON-S sequence group of the gp 120 envelope protein and V3 loop derived from a Russian RUA022a2 isolate. These peptides specifically reacted to HIV-positive sera in ELISA, thus indicating their similarity to appropriate HIV proteins. The peptides proved to be weakly immunogenic. Therefore, Freund complete adjuvant was used to enhance peptide immunogenicity. To assess the immunogenicity, the mice were immunized with a peptide mixture. Antibodies have been developed to every peptide from the mixture, being, predominantly, of IgG isotype. The antibody titers depended on the length of peptide sequences. However, the sera from immunized mice did not have a HIV neutralizing activity. The serum neutralization was assessed by pseudovirus-based assay, using a molecular clone of virus isolates CAP 45.2.00.G3 and QH.209.14.M.EnvA2. The virus neutralization is a
Symmetry breaking in clogging for oppositely driven particles
Glanz, Tobias; Wittkowski, Raphael; Löwen, Hartmut
2016-11-01
The clogging behavior of a symmetric binary mixture of colloidal particles that are driven in opposite directions through constrictions is explored by Brownian dynamics simulations and theory. A dynamical state with a spontaneously broken symmetry occurs where one species is flowing and the other is blocked for a long time, which can be tailored by the size of the constrictions. Moreover, we find self-organized oscillations in clogging and unclogging of the two species. Apart from statistical physics, our results are of relevance for fields like biology, chemistry, and crowd management, where ions, microparticles, pedestrians, or other particles are driven in opposite directions through constrictions.
Predicting asp and pikeperch recruitment in a riverine reservoir.
Czech Academy of Sciences Publication Activity Database
Blabolil, Petr; Ricard, Daniel; Peterka, Jiří; Říha, Milan; Jůza, Tomáš; Vašek, Mojmír; Prchalová, Marie; Čech, Martin; Muška, Milan; Seďa, Jaromír; Mrkvička, Tomáš; Boukal S., David; Kubečka, Jan
2016-01-01
Roč. 173, January (2016), s. 45-52 ISSN 0165-7836 R&D Projects: GA AV ČR(CZ) 1QS600170504; GA MZe(CZ) QH81046; GA MŠk(CZ) EE2.3.20.0204; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : sliced inversion regression * stock recruitment * temperature * water level fluctuations * zooplankton Subject RIV: GL - Fishing Impact factor: 2.185, year: 2016
Survivability Using Controlled Security Services
2005-06-01
signature scheme secure against adaptive chosen-message attacks. SIAM J. Computing, 17(2):281–308, 1988. [29] ISO TC86 Committee. ISO 8583 : Financial...fsIKXZO ISO bbDU?M&D*P$JSIKD F$LKD[*J>RKX$J\\OINTP$`p]Wf�OP_f�INX$TL’Q�FZOeLNINTJMnTP_[*D*b[^J QhG��J:RObb?OuINX$TL’Q�FZOeLNIf�U?X$D
Czech Academy of Sciences Publication Activity Database
Matoušek, Jaroslav; Kocábek, Tomáš; Patzak, J.; Stehlík, Jan; Füssy, Zoltán; Krofta, K.; Heyerick, A.; Roldán-Ruiz, I.; Maloukh, L.; De Keukeleire, D.
2010-01-01
Roč. 58, č. 2 (2010), s. 902-912 ISSN 0021-8561 R&D Projects: GA ČR GA521/08/0740; GA MZe QH81052; GA MŠk ME 940 Institutional research plan: CEZ:AV0Z50510513 Keywords : secondary metabolites transcriptional regulation * cDNA-AFLP analysis * hop cDNA library screening * Nicotiana benthamiana * Petunia hybrida Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.816, year: 2010
Czech Academy of Sciences Publication Activity Database
Mácová, S.; Máchová, J.; Prokeš, Miroslav; Plhalová, L.; Široká, Z.; Dlesková, K.; Doleželová, P.; Svobodová, Z.
2009-01-01
Roč. 30, Suppl. 1 (2009), s. 192-198 ISSN 0172-780X. [Interdisciplinary Czech-Slovak Toxicological Conference /14./. Brno, 01.06.2009-03.06.2009] R&D Projects: GA MZe QH71305 Institutional research plan: CEZ:AV0Z60930519 Keywords : fish * acute toxicity test * embryo-larval toxicity test * pH Subject RIV: GL - Fishing Impact factor: 1.047, year: 2009 http://node.nel.edu/?node_id=9497
Czech Academy of Sciences Publication Activity Database
Knapp, M.; Nedvěd, Oldřich
2013-01-01
Roč. 8, č. 9 (2013), e74984 E-ISSN 1932-6203 Grant - others:Ministerstvo zemědělství ČR(CZ) QH82047; Czech University of Life Sciences(CZ) 42900/1312/3166 Institutional support: RVO:60077344 Keywords : Harmonia axyridis Subject RIV: EH - Ecology, Behaviour Impact factor: 3.534, year: 2013 http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0074984
Returning "Region" to World Regional Geography
Rees, Peter W.; Legates, Margaret
2013-01-01
World regional geography textbooks rarely focus on the process of region formation, despite frequent calls to reincorporate a regional approach to teaching global geography. An instructional strategy using problem-based learning in a small honors section of a large world regional geography course is described. Using a hypothetical scenario…
A study of direct-current surface discharge plasma for a Mach 3 supersonic flow control
Shin, Jichul
A direct-current, non-equilibrium surface glow discharge plasma in the presence of a Mach 2.85 flow is studied experimentally for flow control applications. The discharge is generated with pin-like electrodes flush mounted on a ceramic plate with sustaining currents from 25 mA to 300 mA. In the presence of a supersonic flow, two distinct discharge modes - diffuse and constricted - are observed depending on the flow and discharge operating conditions. In cathode upstream location, both diffuse and constricted discharges are observed while in cathode downstream location, the discharge mostly exhibits either constricted mode or bistable mixed mode. The effect of the discharge on the flow ("plasma actuation'') is characterized by the appearance of a weak shock wave in the vicinity of the discharge. The shock is observed at low powers (˜10 W) for the diffuse discharge mode but is absent for the higher power (˜100 W) constricted mode. High speed laser schlieren imaging suggests that the diffuse mode plasma actuation is rapid as it occurs on a time scale that is less than 100 microsec. Rotational (gas) and vibrational temperatures within the discharge are estimated by emission spectral line fits of N 2 and N+2 rovibronic bands near 365-395 nm. The electronic temperatures are estimated by using the Boltzmann plot method for Fe(I) atomic lines. Rotational temperatures are found to be high (˜1500 K) in the absence of a flow but drop sharply (˜500 K) in the presence of a supersonic flow for both the diffuse and constricted discharge modes. The vibrational and electronic temperatures are measured to be about 3000 K and 1.25 eV (14500 K), respectively, and these temperatures are the same with and without flow. The gas (rotational) temperature spatial profiles above the cathode surface are found to be similar for the diffuse and constricted modes indicating that dilatational effects due to gas heating are similar. However, complete absence of flow actuation for the
Hawaii Regional Sediment Management (RSM): Regional Sediment Budget for the West Maui Region
2016-06-01
ER D C/ CH L TR -1 6- 5 Regional Sediment Management (RSM) Program Hawaii Regional Sediment Management (RSM): Regional Sediment Budget...acwc.sdp.sirsi.net/client/default. Regional Sediment Management (RSM) Program ERDC/CHL TR-16-5 June 2016 Hawaii Regional Sediment Management...distribution is unlimited. Prepared for U.S. Army Corps of Engineers Washington, DC 20314-1000 Under Project 454632, “ Hawaii Regional Sediment Management
ASEAN : Extra-Regional Cooperation Triggers Regional Integration
Krapohl, S.; Krapohl, S.
2017-01-01
This chapter contains two case studies of regional cooperation within Southeast Asia. The network analysis of ASEAN demonstrates that the region is dependent on extra-regional trade with the EU and the USA, but also with China and Japan. However, the region is not dominated by a single regional