WorldWideScience

Sample records for conductive afm investigations

  1. Investigation of the electronic transport in polarization-induced nanowires using conductive atomic force microscopy (AFM)

    Science.gov (United States)

    Selcu, Camelia; Carnevale, Santino C.; Kent, Thomas F.; Akyol, Fatih; Phillips, Patrick J.; Mills, Michael J.; Rajan, Siddharth; Pelz, Jonathan P.; Myers, Roberto C.

    2013-03-01

    In the search to improve short wavelength light emitting diodes (LED's), where the dislocations limit their performance and hole doping (Mg) is a fundamental challenge, the III-Nitride polarization-induced nanowire LED provides a promising system to address these problems. The new type of pn diode, polarization-induced nanowire LED (PINLED), was developed by linearly grading AlGaN composition of the nanowires (from GaN to AlN and back to GaN) from 0% to 100% and back to 0% Al (Carnevale et al, Nano Lett., 12, 915 (2012)). In III-Nitrides (Ga,Al/N), the effects of polarization are commonly observed at the surfaces and interfaces. Thus, in the case of the polarization-induced nanowire LEDs, taking advantage of the bound polarization charge, due to the grading of the AlGaN, the pn diodes are formed. The polarity of the nanowires determines the carrier type in each graded region, and therefore the diode orientation (n/p vs p/n). We used conductive AFM to investigate polarity of the PINLED's as well as hole conductivity in PINLED's made of AlGaN with and without acceptor doping. The results reveal that most of the wires are n-top/p-bottom (N-face), but some are p-top/n-bottom (Ga-face). Also, we found that the current density is 3 orders of magnitude larger in the case of the doped nanowires than the nanowires with no impurity doping.

  2. Impedance Spectroscopic Investigation of Proton Conductivity in Nafion Using Transient Electrochemical Atomic Force Microscopy (AFM

    Directory of Open Access Journals (Sweden)

    Emil Roduner

    2012-06-01

    Full Text Available Spatially resolved impedance spectroscopy of a Nafion polyelectrolyte membrane is performed employing a conductive and Pt-coated tip of an atomic force microscope as a point-like contact and electrode. The experiment is conducted by perturbing the system by a rectangular voltage step and measuring the incurred current, followed by Fourier transformation and plotting the impedance against the frequency in a conventional Bode diagram. To test the potential and limitations of this novel method, we present a feasibility study using an identical hydrogen atmosphere at a well-defined relative humidity on both sides of the membrane. It is demonstrated that good quality impedance spectra are obtained in a frequency range of 0.2–1,000 Hz. The extracted polarization curves exhibit a maximum current which cannot be explained by typical diffusion effects. Simulation based on equivalent circuits requires a Nernst element for restricted diffusion in the membrane which suggests that this effect is based on the potential dependence of the electrolyte resistance in the high overpotential region.

  3. Investigation of the resistive switching in Ag{sub x}AsS{sub 2} layer by conductive AFM

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Bo [Department of General and Inorganic Chemistry, Faculty of Chemical Technology, University of Pardubice, Studentska 573, Pardubice, 532 10 Czech Republic (Czech Republic); Kutalek, Petr [Joint Laboratory of Solid State Chemistry of Institute of Macromolecular Chemistry Academy of Sciences of Czech Republic, v.v.i., and University of Pardubice, University of Pardubice, Studentska 573, Pardubice, 532 10 (Czech Republic); Knotek, Petr [Department of General and Inorganic Chemistry, Faculty of Chemical Technology, University of Pardubice, Studentska 573, Pardubice, 532 10 Czech Republic (Czech Republic); Hromadko, Ludek; Macak, Jan M. [Center of Materials and Nanotechnologies, Faculty of Chemical Technology, University of Pardubice, Nam. Cs. Legii 565, Pardubice, 53002 (Czech Republic); Wagner, Tomas, E-mail: tomas.wagner@upce.cz [Department of General and Inorganic Chemistry, Faculty of Chemical Technology, University of Pardubice, Studentska 573, Pardubice, 532 10 Czech Republic (Czech Republic); Center of Materials and Nanotechnologies, Faculty of Chemical Technology, University of Pardubice, Nam. Cs. Legii 565, Pardubice, 53002 (Czech Republic)

    2016-09-30

    Highlights: • The resistive switching was studied from topological maps and spread current maps by conductive AFM. • Both surface particles and filaments were created under bias from conductive AFM. • The combination of topological map and spread current map proves the current did not flow through surface particles. • A model, consisting of interactions between charge carriers and Ag ions, were introduced to explain the experiment phenomena. - Abstract: In this paper, a study of resistive switching in Ag{sub x}AsS{sub 2} layer, based on a utilization of conductive atomic force microscope (AFM), is reported. As the result of biasing, two distinct regions were created on the surface (the conductive region and non-conductive region). Both were analysed from the spread current maps. The volume change, corresponding to the growth of Ag particles, was derived from the topological maps, recorded simultaneously with the current maps. Based on the results, a model explaining the mechanism of the Ag particle and Ag filament formation was proposed from the distribution of charge carriers and Ag ions.

  4. Conductive supports for combined AFM SECM on biological membranes

    Science.gov (United States)

    Frederix, Patrick L. T. M.; Bosshart, Patrick D.; Akiyama, Terunobu; Chami, Mohamed; Gullo, Maurizio R.; Blackstock, Jason J.; Dooleweerdt, Karin; de Rooij, Nico F.; Staufer, Urs; Engel, Andreas

    2008-09-01

    Four different conductive supports are analysed regarding their suitability for combined atomic force and scanning electrochemical microscopy (AFM-SECM) on biological membranes. Highly oriented pyrolytic graphite (HOPG), MoS2, template stripped gold, and template stripped platinum are compared as supports for high resolution imaging of reconstituted membrane proteins or native membranes, and as electrodes for transferring electrons from or to a redox molecule. We demonstrate that high resolution topographs of the bacterial outer membrane protein F can be recorded by contact mode AFM on all four supports. Electrochemical feedback experiments with conductive cantilevers that feature nanometre-scale electrodes showed fast re-oxidation of the redox couple Ru(NH3)63+/2+ with the two metal supports after prolonged immersion in electrolyte. In contrast, the re-oxidation rates decayed quickly to unpractical levels with HOPG or MoS2 under physiological conditions. On HOPG we observed heterogeneity in the re-oxidation rate of the redox molecules with higher feedback currents at step edges. The latter results demonstrate the capability of conductive cantilevers with small electrodes to measure minor variations in an SECM signal and to relate them to nanometre-scale features in a simultaneously recorded AFM topography. Rapid decay of re-oxidation rate and surface heterogeneity make HOPG or MoS2 less attractive for combined AFM-SECM experiments on biological membranes than template stripped gold or platinum supports.

  5. Nanogap based graphene coated AFM tips with high spatial resolution, conductivity and durability.

    Science.gov (United States)

    Lanza, Mario; Gao, Teng; Yin, Zixuan; Zhang, Yanfeng; Liu, Zhongfan; Tong, Yuzhen; Shen, Ziyong; Duan, Huiling

    2013-11-21

    After one decade of analyzing the intrinsic properties of graphene, interest into the development of graphene-based devices and micro electromechanical systems is increasing. Here, we fabricate graphene-coated atomic force microscope tips by growing the graphene on copper foil and transferring it onto the apex of a commercially available AFM tip. The resulting tip exhibits surprising enhanced resolution in nanoscale electrical measurements. By means of topographic AFM maps and statistical analyses we determine that this superior performance may be related to the presence of a nanogap between the graphene and the tip apex, which reduces the tip radius and tip-sample contact area. In addition, the graphene-coated tips show a low tip-sample interaction, high conductivity and long life times. The novel fabrication-friendly tip could improve the quality and reliability of AFM experiments, while reducing the cost of AFM-based research.

  6. Conducting-tip AFM Studies of Multi-Walled Carbon Nanotube/Polyimide Nanocomposites

    Science.gov (United States)

    Trionfi, A.; Scrymgeour, D.; Hsu, J. W. P.; Arlen, M. J.; Wang, D.; Tan, L.-S.; Vaia, R. A.

    2008-03-01

    Electrical transport studies of multi-walled carbon nanotube (c-MWNT)/polymer nanocomposites have shown metallic behavior with conductivity σ=σ0( φ-φc )^t above the percolation threshold. The conductivity depends on three aspects of the conducting network (CN): the conductivity of the constituent c-MWNT, the number of c-MWNT making up the CN, and the detailed interconnectivity of the CN. Using conducting-tip atomic force microscopy (C-AFM), we have studied the density and conductivity of the c-MWNT CN as a function of c-MWNT loading between 0.5 - 5.0 wt % in a polyimide matrix. Using the Principle of Delesse, the volume fraction of the c-MWNT CN can be calculated from the conducting areal density measured in the C-AFM scans. The results of the C-AFM tests have shown localized areas of electrical transport associated with c-MWNT as well a clear dependence of conducting areal density and conductivity on the c-MWNT loading. This work was performed in part at the US Department of Energy, Center for Integrated Nanotechnologies, at Los Alamos and Sandia National Laboratories. Sandia National Laboratories is a multi-program laboratory operated by Sandia Corporation, a Lockheed-Martin Company, for the U. S. Department of Energy under Contract No. DE-AC04-94AL85000.

  7. Polarization induced conductive AFM on cobalt doped ZnO nanostructures

    Science.gov (United States)

    Sahoo, Pradosh Kumar; Mangamma, G.; Rajesh, A.; Kamruddin, M.; Dash, S.

    2017-05-01

    In the present work cobalt doped ZnO (CZO) nanostructures (NS) have been synthesized by of sol-gel and spin coating process. After the crystal phase confirmation by GIXRD and Raman spectroscopy, Conductive Atomic Force Microscopy (C-AFM) measurement was performed on CZO NS which shows the random distribution of electrically conducting zones on the surface of the material exhibiting current in the range 4-170 pA. We provide the possible mechanisms for variation in current distribution essential for quantitative understanding of transport properties of ZnO NS in doped and undoped forms.

  8. Investigation of growth rate dispersion in lactose crystallisation by AFM

    Science.gov (United States)

    Dincer, T. D.; Ogden, M. I.; Parkinson, G. M.

    2014-09-01

    α-Lactose monohydrate crystals have been reported to exhibit growth rate dispersion (GRD). Variation in surface dislocations has been suggested as the cause of GRD, but this has not been further investigated to date. In this study, growth rate dispersion and the change in morphology were investigated in situ and via bottle roller experiments. The surfaces of the (0 1 0) faces of crystals were examined with Atomic Force Microscopy. Smaller, slow growing crystals tend to have smaller (0 1 0) faces with narrow bases and displayed a single double spiral in the centre of the crystal with 2 nm high steps. Additional double spirals in other crystals resulted in faster growth rates. Large, fast growing crystals were observed to have larger (0 1 0) faces with fast growth in both the a and b directions (giving a broader crystal base) with macro steps parallel to the (c direction). The number and location of spirals or existence of macro steps appears to influence the crystal morphology, growth rates and growth rate dispersion in lactose crystals.

  9. Mechanical properties of single nanostructures investigated by in-situ AFM and micro-XRD

    Energy Technology Data Exchange (ETDEWEB)

    Cornelius, Thomas; Scheler, Thomas; Magalhaes-Paniago, Rogerio; Metzger, Till Hartmut [ESRF, Grenoble (France)

    2010-07-01

    In recent years, nanostructures attracted enormous attention due to size-effects influencing the structural, optical, electrical, and mechanical properties of materials with low dimensions. Concerning the mechanical properties mainly the plastic regime was explored showing a trend that ''smaller is stronger''. In contrast, studies of the elastic behaviour of nanowires revealed contradictory results concerning the influence of size-effects on the elasticity. To investigate single nanoobjects in the elastic regime, we combined an in-situ AFM with XRD in a microfocused beam. The AFM is used to image the sample surface, to select an individual nanostructure, and to apply pressure on a chosen object. Due to the interaction between the AFM-tip and the compressed object the resonance frequency of the AFM force sensor shifts to larger values enabling us to derive the stiffness of the contact area. Simultaneous to the pressure application, XRD images around a pre-defined Bragg peak are recorded. These images allow for the determination of the elastic lattice parameter change in-situ. From the contact stiffness and the lattice parameter change, the Young modulus of an individual nanoobject is derived. Here, we present results both for SiGe islands grown by liquid-phase epitaxy on Si wafers and GaAs nanorods created by selective-area metalorganic vapor phase epitaxy on GaAs substrates.

  10. Custom AFM for X-ray beamlines: in situ biological investigations under physiological conditions

    Energy Technology Data Exchange (ETDEWEB)

    Gumí-Audenis, B. [ESRF, The European Synchrotron, Grenoble (France); Institute for Bioengineering of Catalonia (IBEC), Barcelona (Spain); Physical Chemistry Department, Universitat de Barcelona, Barcelona (Spain); Networking Biomedical Research Center on Bioengineering, Biomaterials and Nanomedicine (CIBER-BBN), Madrid (Spain); Carlà, F. [ESRF, The European Synchrotron, Grenoble (France); Vitorino, M. V. [University of Lisboa, Falculty of Science, Biosystems and Integrative Sciences Institute - BIOISI, Lisbon (Portugal); Panzarella, A. [ESRF, The European Synchrotron, Grenoble (France); Porcar, L. [Institut Laue-Langevin, Grenoble (France); Boilot, M. [ORTEC, Marseille (France); Guerber, S. [CEA, LETI Grenoble (France); Bernard, P. [ESRF, The European Synchrotron, Grenoble (France); Rodrigues, M. S. [University of Lisboa, Falculty of Science, Biosystems and Integrative Sciences Institute - BIOISI, Lisbon (Portugal); Sanz, F.; Giannotti, M. I. [Institute for Bioengineering of Catalonia (IBEC), Barcelona (Spain); Physical Chemistry Department, Universitat de Barcelona, Barcelona (Spain); Networking Biomedical Research Center on Bioengineering, Biomaterials and Nanomedicine (CIBER-BBN), Madrid (Spain); Costa, L., E-mail: luca.costa@esrf.fr [ESRF, The European Synchrotron, Grenoble (France)

    2015-09-30

    The performance of a custom atomic force microscope for grazing-incidence X-ray experiments on hydrated soft and biological samples is presented. A fast atomic force microscope (AFM) has been developed that can be installed as a sample holder for grazing-incidence X-ray experiments at solid/gas or solid/liquid interfaces. It allows a wide range of possible investigations, including soft and biological samples under physiological conditions (hydrated specimens). The structural information obtained using the X-rays is combined with the data gathered with the AFM (morphology and mechanical properties), providing a unique characterization of the specimen and its dynamics in situ during an experiment. In this work, lipid monolayers and bilayers in air or liquid environment have been investigated by means of AFM, both with imaging and force spectroscopy, and X-ray reflectivity. In addition, this combination allows the radiation damage induced by the beam on the sample to be studied, as has been observed on DOPC and DPPC supported lipid bilayers under physiological conditions.

  11. Investigation of geometrical effects in the carbon allotropes manipulation based on AFM: multiscale approach

    Energy Technology Data Exchange (ETDEWEB)

    Korayem, M. H., E-mail: hkorayem@iust.ac.ir; Hefzabad, R. N.; Homayooni, A.; Aslani, H. [Iran University of Science and Technology, Robotic Research Laboratory, Center of Excellence in Experimental Solid Mechanics and Dynamics, School of Mechanical Engineering (Iran, Islamic Republic of)

    2017-01-15

    Carbon allotropes are used as nanocarriers for drug and cell delivery. To obtain an accurate result in the nanoscale, it is important to use a precise model. In this paper, a multiscale approach is presented to investigate the manipulation process of carbon allotropes based on atomic force microscopy (AFM). For this purpose, the AFM setup is separated into two parts with different sizes as macro field (MF) and nano field (NF). Using Kirchhoff’s plate model, the cantilever (the main part of MF) is modeled. The molecular dynamics method is applied to model the NF part, and then the MF and NF are coupled with the multiscale algorithm. With this model, by considering the effect of size and shape, the manipulation of carbon allotropes is carried out. The manipulations of armchair CNTs and fullerenes are performed to study the diameter changing effects. The result shows that the manipulation and friction force increases by increasing the diameter. The result of the indentation depth for the armchair CNTs indicates that decreasing the diameter causes the indentation depth to reduce. Moreover, the manipulations of four kinds of carbon allotropes with the same number of atoms have been studied to investigate the geometrical effects. The shapes of these nanoparticles change from sphere to cylinder. The results illustrate that the manipulation and the friction force decrease as the nanoparticle shape varies from sphere to cylinder. The Von-Mises results demonstrate that by changing the nanoparticle shape from the spherical to the cylindrical form, the stress increases, although the manipulation force reduces.

  12. AFM Bio-Mechanical Investigation of the Taxol Treatment of Breast Cancer Cells

    Science.gov (United States)

    Smith, Dylan; Patel, Dipika; Monjaraz, Fernando; Park, Soyeun

    2009-10-01

    Cancerous cells are known to be softer and easier to deform than normal cells. Changes in mechanical properties originate from the alteration of the actin cytoskeleton. The mechanism of cancer treatment using Taxol is related to the stabilization of microtubules. It has been shown that Taxol binds to polymerized tublin, stabilizes it against disassembly, and consequently inhibits cell division. An accurate quantitative study still lacks to relate the microtubule stabilizing effect with the cellular mechanical properties. We utilized our AFM to study changes in elastic properties of treated breast cancer cells. The AFM has several advantages for precise force measurements on a localized region with nanometer lateral dimension. In previous AFM studies, measurable contributions from the underlying hard substrate have been an obstacle to accurately determine the properties on thin samples. We modified our AFM tip to obtain the exact deformation profile as well as reducing the high stresses produced. We have probed depth profiles of mechanical properties of the taxol-treated and untreated cells by varying the indentation depth of the AFM-nanoindenting experiments.

  13. Investigating Oil-Prone Kerogen Conversion to Hydrocarbons Using AFM-based Infrared Spectroscopy

    Science.gov (United States)

    Eoghan, D.; Cook, D.; Hackley, P. C.; Kjoller, K.; Dawson, D.; Shetty, R.

    2016-12-01

    Understanding in situ chemical changes occurring during thermal conversion of oil-prone kerogen to hydrocarbons can provide fundamental information regarding the origin of the earth's fossil fuel endowment and reduce uncertainty in hydrocarbon prospecting and resource assessment. Tasmanites algal bodies were studied using an Atomic Force Microscope-based IR spectroscopy technique (AFM-IR) that offers chemical characterization of organic materials with spatial resolution below the diffraction limit. The AFM allows precise positioning within the algal bodies. A tunable IR laser irradiates the sample under the AFM probe. At absorbing wavenumbers, the sample heats up and expands. The AFM detects the expansion of the material under the probe tip to generate local IR spectra. The Tasmanites algal bodies from the Devonian-Mississippian Woodford Shale were contained in two polished rock fragment pellets. To simulate maturation, one was subjected to isothermal hydrous pyrolysis at 320 °C for 72 hours. AFM-IR spectra were collected at multiple sites on algal bodies in both samples (Figure 1). The aromatic C=C ring stretching at 1600 cm-1 (unheated) shifted to 1606 cm-1 with increased absorption in the heated algal bodies, indicating development of increased aromaticity with thermal maturation. The ratio of the 1606 cm-1 peak to peaks at 1708 cm-1 (C=O stretching) and 1460 cm-1 (CH2 wag) was higher in the heated sample, indicating loss of oxygenated functional groups and aliphatic components with thermal advance. A shift of the 1372 cm-1 peak to 1376 cm-1 with lower absorption in the heated samples suggests reduction in the abundance of methyl substituents and development of preferred localization. These results are consistent with extant information from FTIR analysis and demonstrate the ability of AFM-IR to provide in situ characterization of organic matter with respect to thermal maturity advance, and its application to understanding conversion of oil-prone kerogen to

  14. Investigation of fullerenol-induced changes in poroelasticity of human hepatocellular carcinoma by AFM-based creep tests.

    Science.gov (United States)

    Zhu, Xinyao; Cirovic, Srdjan; Shaheen, Aliah; Xu, Wei

    2017-12-01

    In this study, atomic force microscopy (AFM) is used to investigate the alterations of the poroelastic properties of hepatocellular carcinoma (SMMC-7721) cells treated with fullerenol. The SMMC-7721 cells were subject to AFM-based creep tests, and a corresponding poroelastic indentation model was used to determine the poroelastic parameters by curve fitting. Comparative analyses indicated that the both permeability and diffusion of fullerenol-treated cells increased significantly while their elastic modulus decreased by a small amount. From the change in the trend of the determined parameter, we verified the corresponding alternations of cytoskeleton (mainly filaments actin), which was reported by the previous study using confocal imaging method. Our investigation on SMMC-7721 cell reveals that the poroelastic properties could provide a better understanding how the cancer cells are affected by fullerenol or potentially other drugs which could find possible applications in drug efficacy test, cancer diagnosis and secure therapies.

  15. Scanning conductance microscopy investigations on fixed human chromosomes

    DEFF Research Database (Denmark)

    Clausen, Casper Hyttel; Lange, Jacob Moresco; Jensen, Linda Boye

    2008-01-01

    Scanning conductance microscopy investigations were carried out in air on human chromosomes fixed on pre-fabricated SiO2 surfaces with a backgate. The point of the investigation was to estimate the dielectric constant of fixed human chromosomes in order to use it for microfluidic device...... optimization. The phase shift caused by the electrostatic forces, together with geometrical measurements of the atomic force microscopy (AFM) cantilever and the chromosomes were used to estimate a value,for the dielectric constant of different human chromosomes....

  16. In situ AFM investigation of electrochemically induced surface-initiated atom-transfer radical polymerization.

    Science.gov (United States)

    Li, Bin; Yu, Bo; Zhou, Feng

    2013-02-12

    Electrochemically induced surface-initiated atom-transfer radical polymerization is traced by in situ AFM technology for the first time, which allows visualization of the polymer growth process. It affords a fundamental insight into the surface morphology and growth mechanism simultaneously. Using this technique, the polymerization kinetics of two model monomers were studied, namely the anionic 3-sulfopropyl methacrylate potassium salt (SPMA) and the cationic 2-(metharyloyloxy)ethyltrimethylammonium chloride (METAC). The growth of METAC is significantly improved by screening the ammonium cations by the addition of ionic liquid electrolyte in aqueous solution. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Electrically conducting, ultra-sharp, high aspect-ratio probes for AFM fabricated by electron-beam-induced deposition of platinum

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Jason, E-mail: jason.brown@physics.ox.ac.uk [Clarendon Laboratory, Department of Physics, University of Oxford, Oxford OX1 3PU (United Kingdom); Kocher, Paul; Ramanujan, Chandra S; Sharp, David N [Clarendon Laboratory, Department of Physics, University of Oxford, Oxford OX1 3PU (United Kingdom); Torimitsu, Keiichi [NTT Basic Research Laboratories, NTT Corporation, Atsugi, 243-0198 (Japan); Ryan, John F [Clarendon Laboratory, Department of Physics, University of Oxford, Oxford OX1 3PU (United Kingdom)

    2013-10-15

    We report on the fabrication of electrically conducting, ultra-sharp, high-aspect ratio probes for atomic force microscopy by electron-beam-induced deposition of platinum. Probes of 4.0 ±1.0 nm radius-of-curvature are routinely produced with high repeatability and near-100% yield. Contact-mode topographical imaging of the granular nature of a sputtered gold surface is used to assess the imaging performance of the probes, and the derived power spectral density plots are used to quantify the enhanced sensitivity as a function of spatial frequency. The ability of the probes to reproduce high aspect-ratio features is illustrated by imaging a close-packed array of nanospheres. The electrical resistance of the probes is measured to be of order 100 kΩ. - Highlights: • Electrically conducting, ultra-sharp, high aspect-ratio probes for AFM with radius-of-curvature 4.0±±1.0 nm. • AFM probe fabrication by electron-beam-induced deposition of platinum. • Enhanced spatial resolution demonstrated through AFM of sputtered gold grains. • AFM imaging of deep clefts and recesses on a close-packed array of nanospheres.

  18. Tribological properties investigation of the thermoplastic elastomers surface with the AFM lateral forces mode

    Science.gov (United States)

    Kuznetsova, T. A.; Zubar, T. I.; Lapitskaya, V. A.; Sudzilouskaya, K. A.; Chizhik, S. A.; Didenko, A. L.; Svetlichnyi, V. M.; Vylegzhanina, M. E.; Kudryavtsev, V. V.; Sukhanova, T. E.

    2017-10-01

    The series of new thermoplastic elastomer films based on copoly(urethane-imide)s (coPUI)s and nanocomposites containing from 1 to 10 wt. % carbon nanofillers of different morphology (single-walled carbon nanotubes, carbon nanofibers, and graphene) as well as WS2 and WSe2 nanoparticles, were prepared and investigated by atomic force microscopy in contact mode. The friction coefficient (Cfr) on the films surfaces under conditions of true slip was determined both in one scan field and with multiple scans (200-400) in one place. The measurements were carried out at room temperature and at a heating up to 120°C. It is shown that at heating up to 75-85°C, the friction coefficient of some coPUI decreases significantly. The same effect can be achieved also after 100 scans during multi-scan testing at 20°C.

  19. DNA-coated AFM cantilevers for the investigation of cell adhesion and the patterning of live cells

    Energy Technology Data Exchange (ETDEWEB)

    Hsiao, Sonny C.; Crow, Ailey K.; Lam, Wilbur A.; Bertozzi, Carolyn R.; Fletcher, Daniel A.; Francis, Matthew B.

    2008-08-01

    Measurement of receptor adhesion strength requires the precise manipulation of single cells on a contact surface. To attach live cells to a moveable probe, DNA sequences complementary to strands displayed on the plasma membrane are introduced onto AFM cantilevers (see picture, bp=base pairs). The strength of the resulting linkages can be tuned by varying the length of DNA strands, allowing for controlled transport of the cells.

  20. Influence of increasing zinc contents in brass in the early stages of corrosion investigated by in-situ TM-AFM and SIMS

    Energy Technology Data Exchange (ETDEWEB)

    Kleber, Christoph; Schreiner, Manfred [Institute for Chemical Technologies and Analytics, Analytical Chemistry Division, Vienna University of Technology, Getreidemarkt 9/151, 1060 Vienna (Austria); Institute of Science and Technologies in Art, Academy of Fine Arts, Schillerplatz 3, 1010 Vienna (Austria); Rosner, Martin; Hutter, Herbert [Institute for Chemical Technologies and Analytics, Analytical Chemistry Division, Vienna University of Technology, Getreidemarkt 9/151, 1060 Vienna (Austria)

    2002-09-01

    In-situ tapping mode atomic force microscopy (TM-AFM), a powerful, high-resolution imaging technique for determining the structure of surfaces and ex-situ secondary ion mass spectroscopy (SIMS), a multielement, high-depth-resolution method, were used to examine the influence of increasing zinc contents in brass in the early stages of corrosion. Four different samples (pure Cu, pure Zn, Cu/Zn=90/10 wt% and Cu/Zn=70/30 wt%) were studied in order to determine their chemical behaviour under various atmospheric conditions. The in-situ TM-AFM investigations were carried out in synthetic air with 60% relative humidity (RH) and 80% RH with 250 ppb SO{sub 2}. The samples for the ex-situ SIMS experiments were weathered over a period of 60 h in 80% RH and 250 ppb SO{sub 2}. The in-situ TM-AFM investigations have shown that an increasing Zn content in brass increases the corrosion rate. (orig.)

  1. AFM-investigation of differently treated Ti-surfaces with respect to their usability for dental implants

    Energy Technology Data Exchange (ETDEWEB)

    Wille, Sebastian; Adelung, Rainer [Funktionale Nanomaterialien, Institut fuer Materialwissenschaft, CAU Kiel Kaiserstr. 2 24143 Kiel (Germany); Yang, Bin [Klinik fuer Zahnaerztliche Prothetik, Propaedeutik und Werkstoffkunde, Arnold-Heller-Strasse 16, 24105 Kiel (Germany); Groessner-Schreiber, Birte [Klinik fuer Zahnerhaltungskunde und Parodontologie, Arnold-Heller-Str. 16, 24105 Kiel (Germany)

    2008-07-01

    Microbial adherence to dental implant surfaces is one initiating step in the formation of plaque and is considered to be an important event in the pathogenesis of peri-implant disease. Besides good connective tissue adhesion in the transmucosal part of an implant, titanium implants exposed to the oral cavity require surface modification to inhibit the adherence of oral bacteria. Surface roughness and chemical composition of the implant surface were found to have a significant impact on plaque formation. The aim of the present study was to examine bacterial adherence of differently modified potential implant surfaces. Therefore the surface roughness was decreased and for example a thin ceramic or composite layer of antibacterial material was deposited on abutment surface by sputtering. We analyze the new surface with AFM to control the roughness. For further characterization contact angle measurements were carried out. Biocompatibility and antibacterial effects will be determined in cooperation with the dental clinic at the University Kiel.

  2. Neuroscience Investigations: An Overview of Studies Conducted

    Science.gov (United States)

    Reschke, Millard F.

    1999-01-01

    The neural processes that mediate human spatial orientation and adaptive changes occurring in response to the sensory rearrangement encountered during orbital flight are primarily studied through second and third order responses. In the Extended Duration Orbiter Medical Project (EDOMP) neuroscience investigations, the following were measured: (1) eye movements during acquisition of either static or moving visual targets, (2) postural and locomotor responses provoked by unexpected movement of the support surface, changes in the interaction of visual, proprioceptive, and vestibular information, changes in the major postural muscles via descending pathways, or changes in locomotor pathways, and (3) verbal reports of perceived self-orientation and self-motion which enhance and complement conclusions drawn from the analysis of oculomotor, postural, and locomotor responses. In spaceflight operations, spatial orientation can be defined as situational awareness, where crew member perception of attitude, position, or motion of the spacecraft or other objects in three-dimensional space, including orientation of one's own body, is congruent with actual physical events. Perception of spatial orientation is determined by integrating information from several sensory modalities. This involves higher levels of processing within the central nervous system that control eye movements, locomotion, and stable posture. Spaceflight operational problems occur when responses to the incorrectly perceived spatial orientation are compensatory in nature. Neuroscience investigations were conducted in conjunction with U. S. Space Shuttle flights to evaluate possible changes in the ability of an astronaut to land the Shuttle or effectively perform an emergency post-landing egress following microgravity adaptation during space flights of variable length. While the results of various sensory motor and spatial orientation tests could have an impact on future space flights, our knowledge of

  3. Morphostructural Damage in Food-Spoiling Bacteria due to the Lemon Grass Oil and Its Vapour: SEM, TEM, and AFM Investigations

    Science.gov (United States)

    Tyagi, Amit Kumar; Malik, Anushree

    2012-01-01

    In this study, antimicrobial activity and morphostructural damages due to lemon grass oil (LGO) and its vapour (LGOV) against Escherichia coli strains were investigated. Minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) of LGO were determined by broth-dilution method to be 0.288 mg/mL and 0.567 mg/mL, respectively. Furthermore, the zone of inhibition (45 mm) due to the vapour phase antimicrobial efficacy evaluated using disc volatilization assay was compared with that using disc diffusion assay (i.e., 13.5 mm for the same dose of oil). The morphological and ultrastructural alterations in LGO- and LGOV-treated E. coli cells were studied using scanning electron microscopy (SEM), transmission electron microscopy (TEM), and atomic-force microscopy (AFM). In SEM observation, LGO-treated cells appeared to be aggregated and partially deformed, while LGOV-treated cells lost their turgidity, and the cytoplasmic material completely leaked from the cells. In TEM observation, extensive intracytoplasmic changes and various abnormalities were observed in LGOV-treated cells more than LGO-treated cells. Significant variations in the height and root mean square values of untreated, LGO-, and LGOV-treated E. coli cells were noticed by AFM. Present results indicate that LGO is highly effective against E. coli in vapour phase. PMID:23082083

  4. Investigations of smooth surfaces by measuring the BRDF with a stray light sensor in comparison with PSD curves evaluated from topography of large AFM scans

    Science.gov (United States)

    Rothe, Hendrik; Hueser, Dorothee; Kasper, Andre; Rinder, Thomas

    1999-03-01

    For quality inspection of polished surfaces as applied in semiconductor and optical industry, various methods are used for a fast detection of microroughness, defects, and contaminations. With the aid of stray light sensors the intensity distribution of the reflected and scattered light, i.e. the BRDF, is measured. The probability distribution of values of a BRDF is parametrized to obtain a measure for roughness and for classes of defects. There is still need for justifying the choice of statistical moments to characterize and finally to classify different surfaces. Of course, a basic quantitative, i.e. metrological understanding of stray light sensors is necessary. The power spectrum of surface topographies sufficiently smooth to obey Rayleigh-Rice approximation is proportional to the BRDF. Therefore a comparison was only carried out with sample surfaces obeying this approximation. Defects and contaminations with lateral sizes smaller than the wavelength of the illuminating light employed in the stray light sensor, however, could not be analyzed within this investigation. We have measured the topography of large areas up to 600 micrometer X 100 micrometer with an AFM by patching several scans (up to 8) with overlap. BRDFs evaluated from AFM measurements agree well with BRDFs measured with a stray light sensor.

  5. An experimental investigation of electrical conductivities in ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 23; Issue 4. An experimental ... polymers doped with inorganic salts. The ion transference number of these biopolymers show their superionic nature of electrical conduction. The overall conduction mechanism seems to be protonic in nature rather than electronic one.

  6. In-situ investigation of adsorption of dye and coadsorbates on TiO 2 films using QCM-D, fluorescence and AFM techniques

    KAUST Repository

    Harms, Hauke A.

    2013-09-11

    Simultaneous adsorption of dye molecules and coadsorbates is important for the fabrication of high-efficiency dyesensitized solar cells, but its mechanism is not well understood. Herein, we use a quartz crystal microbalance with dissipation technique (QCM-D) to study dynamically and quantitatively the sensitization of TiO2 in situ. We investigate dye loading for a ruthenium(II) polypyridyl complex (Z907), of a triphenylamine-based D-π-A dye (Y123), and of a ullazine sensitizer (JD21), as well as the simultaneous adsorption of the latter two with the coadsorbate chenodeoxycholic acid. By combining the QCM-D technique with fluorescence measurements, we quantify molar ratios between the dye and coadsorbate. Furthermore, we will present first studies using liquid-phase AFM on the adsorbed dye monolayer, thus obtaining complementary microscopic information that may lead to understanding of the adsorption mechanism on the molecular scale. © 2013 SPIE.

  7. Investigations Regarding the Thermal Conductivity of Straw

    Directory of Open Access Journals (Sweden)

    Marian Pruteanu

    2010-01-01

    Full Text Available The reduction of buildings heat losses and pollutants emissions is a worldwide priority. It’s intending to reduce the specific final energy consumption under limit of 120...150 kWh/m2.yr and even under 15...45 kWh/m2.yr, foreseen in 2020 for the passive houses, which is necessary for a sustainable development and for allowing to became profitable the use of unconventional energies [1]. These values can be achieved through the use of thermal insulations, for protecting the constructions fund and through making envelope elements, as much as possible, from materials with a high thermal resistance, for new buildings. With intention to substitute the conventional thermal insulations: mineral wool, expanded polystyrene, which are both great energy consumers, it’s proposed, among others unconventional technologies and materials, the use of vegetable wastes both as a thermal insulation material and as a material used for building load-bearing and in-fill straw-bale construction. In speciality literature there are presented experimental determinations of this material’s thermal conductivity. The paper proposes a simple method, adequate for the measurement of thermal conductivity for bulk’s materials as straw bales.

  8. PREFACE: Non-contact AFM Non-contact AFM

    Science.gov (United States)

    Giessibl, Franz J.; Morita, Seizo

    2012-02-01

    This special issue is focussed on high resolution non-contact atomic force microscopy (AFM). Non-contact atomic force microscopy was established approximately 15 years ago as a tool to image conducting and insulating surfaces with atomic resolution. Since 1998, an annual international conference has taken place, and although the proceedings of these conferences are a useful source of information, several key developments warrant devoting a special issue to this subject. In the theoretic field, the possibility of supplementing established techniques such as scanning tunneling microscopy (STM) and Kelvin probe microscopy with atomically resolved force micrsoscopy poses many challenges in the calculation of contrast and contrast reversal. The surface science of insulators, self-assembled monolayers and adsorbates on insulators is a fruitful field for the application of non-contact AFM: several articles in this issue are devoted to these subjects. Atomic imaging and manipulation have been pioneered using STM, but because AFM allows the measurement of forces, AFM has had a profound impact in this field as well. Three-dimensional force spectroscopy has allowed many important insights into surface science. In this issue a combined 3D tunneling and force microscopy is introduced. Non-contact AFM typically uses frequency modulation to measure force gradients and was initially used mainly in a vacuum. As can be seen in this issue, frequency modulation is now also used in ambient conditions, allowing better spatial and force resolution. We thank all of the contributors for their time and efforts in making this special issue possible. We are also very grateful to the staff of IOP Publishing for handling the administrative aspects and for steering the refereeing process. Non-contact AFM contents Relation between the chemical force and the tunnelling current in atomic point contacts: a simple model Pavel Jelínek, Martin Ondrácek and Fernando Flores Theoretical simulation of

  9. Influence of electron irradiation on the electronic transport mechanisms during the conductive AFM imaging of InAs/GaAs quantum dots capped with a thin GaAs layer

    Science.gov (United States)

    Troyon, M.; Smaali, K.

    2008-06-01

    We have used conductive atomic force microscopy (C-AFM) to study the electronic transport mechanisms through InAs quantum dots (QDs) grown by molecular beam epitaxy on an n-type GaAs(001) substrate and covered with a 5 nm thick GaAs cap layer. The study is performed with a conductive atomic force microscope working inside a scanning electron microscope. Electric images can be obtained only if the sample is preliminarily irradiated with an electron probe current sufficiently high to generate strong electron beam induced current. In these conditions holes are trapped in QDs and surface states, so allowing the release of the Fermi level pinning and thus conduction through the sample. The electronic transport mechanism depends on the type of AFM probe used; it is explained for a metal (Co/Cr) coated probe and p-doped diamond coated probe with the aid of energy band diagrams. The writing (charge trapping) and erasing (untrapping) phenomena is conditioned by the magnitude of the electron probe current. A strong memory effect is evidenced for the sample studied.

  10. 12 CFR 622.105 - Conduct of investigation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Conduct of investigation. 622.105 Section 622.105 Banks and Banking FARM CREDIT ADMINISTRATION FARM CREDIT SYSTEM RULES OF PRACTICE AND PROCEDURE Rules and Procedures Applicable to Formal Investigations § 622.105 Conduct of investigation. (a) Review...

  11. Biophysical analysis of bacterial and viral systems. A shock tube study of bio-aerosols and a correlated AFM/nanosims investigation of vaccinia virus

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Sean Damien [Stanford Univ., CA (United States)

    2013-05-01

    The work presented herein is concerned with the development of biophysical methodology designed to address pertinent questions regarding the behavior and structure of select pathogenic agents. Two distinct studies are documented: a shock tube analysis of endospore-laden bio-aerosols and a correlated AFM/NanoSIMS study of the structure of vaccinia virus.

  12. Advances in Atomic Force Microscopy (AFM) for investigating soil wettability states and soil organic matter (SOM) properties at the nano-scale

    Science.gov (United States)

    Gazze, Andrea; Hallin, Ingrid; Van Keulen, Geertje; Matthews, Peter; Dudely, Edward; Whalley, Richard; Quinn, Gerry; Sinclair, Kathryn; Ashton, Rhys; Doerr, Stefan; Francis, Lewis

    2017-04-01

    Many environmental processes that have a major impact at the field-scale are determined by events occurring at the micro- and nanometer scales. Due to technical challenges, soil has only relatively recently been the focus of nanoscale studies. Recent advances in Atomic Force Microscopy (AFM) now allow the characterization of natural soil samples both topographically, mechanically and chemically at the micro- to nanometer scale. To date AFM has been used for analysing materials that occur in soil ex-situ, such as minerals and organic matter as individual components; however its application to complete natural soil material has been very limited. Here we report on applications of AFM for mechanically and topographically characterising soil aggregates. Mechanical properties of interest are Young's modulus, surface deformation, adhesion and chemical mapping, all of which allow for gaining information on soil nano-mechanical properties that have implications for particle wettability. This presentation includes (i) a brief summary of recent advances in AFM capabilities and applications relevant to studying soil materials, and (ii) our latest findings in soil profiling for wettable and repellent soils, and the role of soil organic matter in affecting soil topographical and mechanical properties.

  13. Investigation of the technology of conductive yarns manufacturing

    Science.gov (United States)

    Ryklin, Dzmitry; Medvetski, Sergey

    2017-10-01

    The paper is devoted to development of technology of electrically conductive yarn production. This technology allows manufacturing conductive yarns of copper wire and polyester filament yarns. Method of the predicting of the conductive yarn breaking force was developed on the base of analysing of load-elongation curves of each strand of the yarn. Also the method of the predicting of the conductive yarn diameter was offered. Investigation shows that conductive yarns can be integrated into the textiles structure using sewing or embroidery equipment. Application of developed conductive yarn is wearable electronics creating with wide range of functions, for example, for specific health issue monitoring, navigation tools or communication gadgets.

  14. Electrically conducting, ultra-sharp, high aspect-ratio probes for AFM fabricated by electron-beam-induced deposition of platinum.

    Science.gov (United States)

    Brown, Jason; Kocher, Paul; Ramanujan, Chandra S; Sharp, David N; Torimitsu, Keiichi; Ryan, John F

    2013-10-01

    We report on the fabrication of electrically conducting, ultra-sharp, high-aspect ratio probes for atomic force microscopy by electron-beam-induced deposition of platinum. Probes of 4.0 ±1.0 nm radius-of-curvature are routinely produced with high repeatability and near-100% yield. Contact-mode topographical imaging of the granular nature of a sputtered gold surface is used to assess the imaging performance of the probes, and the derived power spectral density plots are used to quantify the enhanced sensitivity as a function of spatial frequency. The ability of the probes to reproduce high aspect-ratio features is illustrated by imaging a close-packed array of nanospheres. The electrical resistance of the probes is measured to be of order 100 kΩ. © 2013 Elsevier B.V. All rights reserved.

  15. AFM study of montmorillonite

    Energy Technology Data Exchange (ETDEWEB)

    Pettersson, Torbjoern; Thormann, Esben; Claesson, Per (Dept. of Chemistry, Surface Chemistry, Royal Inst. of Technology, Stockholm (Sweden))

    2010-02-15

    Na-montmorillonite and Ca-montmorillonite particles have been attached to molecularly flat mica surfaces using simple evaporation of montmorillonite solutions. The particles stick to the surface by strong van der Waals forces. The homogeneity of the montmorillonite particle surfaces has been evaluated by AFM imaging and by AFM force raster measurements. As a control, molecularly smooth mica surfaces were used, and the data obtained for montmorillonite was compared with the data obtained for mica. In images of the size 100x100 nm we can identify variations on the Na-montmorillonite particle surfaces. This variation is attributed to inhomogeneities of the montmorillonite particles. The inhomogeneous nature of the montmorillonite surface is also clearly demonstrated by the force raster measurement, in particular the force raster adhesion maps show larger variations and a more patterned structure for montmorillonite than for mica. Thus, any attempt to model the interaction between montmorillonite particles using a model of ideally flat surfaces with a homogeneous charge distribution is an oversimplification. We suggest that this explains the differences between measured swelling pressures and modelling results

  16. Phase transition behaviors of the supported DPPC bilayer investigated by sum frequency generation (SFG) vibrational spectroscopy and atomic force microscopy (AFM).

    Science.gov (United States)

    Wu, Heng-Liang; Tong, Yujin; Peng, Qiling; Li, Na; Ye, Shen

    2016-01-21

    The phase transition behaviors of a supported bilayer of dipalmitoylphosphatidyl-choline (DPPC) have been systematically evaluated by in situ sum frequency generation (SFG) vibrational spectroscopy and atomic force microscopy (AFM). By using an asymmetric bilayer composed of per-deuterated and per-protonated monolayers, i.e., DPPC-d75/DPPC and a symmetric bilayer of DPPC/DPPC, we were able to probe the molecular structural changes during the phase transition process of the lipid bilayer by SFG spectroscopy. It was found that the DPPC bilayer is sequentially melted from the top (adjacent to the solution) to bottom leaflet (adjacent to the substrate) over a wide temperature range. The conformational ordering of the supported bilayer does not decrease (even slightly increases) during the phase transition process. The conformational defects in the bilayer can be removed after the complete melting process. The phase transition enthalpy for the bottom leaflet was found to be approximately three times greater than that for the top leaflet, indicating a strong interaction of the lipids with the substrate. The present SFG and AFM observations revealed similar temperature dependent profiles. Based on these results, the temperature-induced structural changes in the supported lipid bilayer during its phase transition process are discussed in comparison with previous studies.

  17. Noncontact AFM Imaging of Atomic Defects on the Rutile TiO2 (110) Surface

    DEFF Research Database (Denmark)

    Lauritsen, Jeppe Vang

    2015-01-01

    The atomic force microscope (AFM) operated in the noncontact mode (nc-AFM) offers a unique tool for real space, atomic-scale characterisation of point defects and molecules on surfaces, irrespective of the substrate being electrically conducting or non-conducting. The nc-AFM has therefore in rece...

  18. XPS and AFM Investigations of Ti-Al-N Coatings Fabricated Using DC Magnetron Sputtering at Various Nitrogen Flow Rates and Deposition Temperatures

    Directory of Open Access Journals (Sweden)

    Aleksei Obrosov

    2017-02-01

    Full Text Available Ti-Al-N coatings were deposited by direct current magnetron sputtering (DCMS onto IN 718 at different nitrogen flow rates and deposition temperatures. The coatings’ properties were characterized using atomic force microscopy (AFM, X-ray photoelectron spectroscopy (XPS as well as nanoindentation. It was found that higher deposition temperature leads to higher surface roughness and nitrogen flux influences the shape of grains. According to XPS, the bonding structure of all coatings exhibited the (Ti,AlN phase. Mechanical properties depend on the Al content within the films. The coating with the best mechanical properties (deposited at 500 °C and 20 standard cubic centimeters per minute (sccm was further deposited onto tungsten carbide (WC cutting tools for cylindrical turning experiments. A quasi-constant flank wear was observed until a machining volume of 23,500 mm3.

  19. Investigating Student Understanding of Quantum Physics: Spontaneous Models of Conductivity.

    Science.gov (United States)

    Wittmann, Michael C.; Steinberg, Richard N.; Redish, Edward F.

    2002-01-01

    Investigates student reasoning about models of conduction. Reports that students often are unable to account for the existence of free electrons in a conductor and create models that lead to incorrect predictions and responses contradictory to expert descriptions of the physics involved. (Contains 36 references.) (Author/YDS)

  20. Investigations on gradient ac conductivity characteristics of bamboo ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 29; Issue 2. Investigations on gradient a.c. conductivity characteristics of ... presence of moisture in bamboo, which liberated on heating. Sharp peak is observed in case of sample 4, which is inner most strip. Maximum sharp peak is observed at lowest 4 kHz frequency.

  1. Experimental Investigation of Thermal Conductivity of Meat During Freezing

    Science.gov (United States)

    Shinbayeva, A.; Arkharov, I.; Aldiyarov, A.; Drobyshev, A.; Zhubaniyazova, M.; Kurnosov, V.

    2017-04-01

    The cryogenic technologies of processing and storage of agricultural products are becoming increasingly indispensable in the food industry as an important factor of ensuring food safety. One of such technologies is the shock freezing of meat, which provides a higher degree of preservation of the quality of frozen products in comparison with traditional technologies. The thermal conductivity of meat is an important parameter influencing the energy consumption in the freezing process. This paper presents the results of an experimental investigation of the temperature dependence of the thermal conductivity of beef. The measurements were taken by using a specially designed measurement cell, which allows covering the temperature range from 80 to 300 K.

  2. Numerical Investigation of the Thermal Conductivity of Graphite Nanofibers

    Science.gov (United States)

    Hakak Khadem, Masoud

    was also investigated using equilibrium molecular dynamics (EMD) with GK relations. Simple Hexagonal (AAA), Bernal (ABA), and Rhombohedral (ABC) stacking forms were considered. The intralayer and interlayer thermal conductivity values were predicted in both zigzag and armchair directions to be in the range of 450-800 W/m.K and 17-55 W/m.K, respectively. Furthermore, non-equilibrium molecular dynamics (NEMD) simulations were used to investigate the thermal conductivity of herringbone graphite nanofibers (GNFs) at room temperature by breaking down the axial and transverse conductivity values into intralayer and interlayer components. The edge effect on a layer's thermal conductivity was investigated by computing the thermal conductivity values in both zigzag and armchair directions of the heat flow. The limiting case of a 90 degree crease angle was used to compare the results with those of single-layer graphene and few-layer graphene. The thermal conductivity values in the axial, transverse in the crease direction, and transverse normal to the crease directions for the case of a five-layer herringbone GNF with a 45-degree crease angle were calculated to be 27 W/m.K, 263 W/m.K, and 1500 W/m.K, respectively.

  3. AFM-IR: Technology and Applications in Nanoscale Infrared Spectroscopy and Chemical Imaging.

    Science.gov (United States)

    Dazzi, Alexandre; Prater, Craig B

    2016-12-13

    Atomic force microscopy-based infrared spectroscopy (AFM-IR) is a rapidly emerging technique that provides chemical analysis and compositional mapping with spatial resolution far below conventional optical diffraction limits. AFM-IR works by using the tip of an AFM probe to locally detect thermal expansion in a sample resulting from absorption of infrared radiation. AFM-IR thus can provide the spatial resolution of AFM in combination with the chemical analysis and compositional imaging capabilities of infrared spectroscopy. This article briefly reviews the development and underlying technology of AFM-IR, including recent advances, and then surveys a wide range of applications and investigations using AFM-IR. AFM-IR applications that will be discussed include those in polymers, life sciences, photonics, solar cells, semiconductors, pharmaceuticals, and cultural heritage. In the Supporting Information , the authors provide a theoretical section that reviews the physics underlying the AFM-IR measurement and detection mechanisms.

  4. Investigating the Complex Conductivity Response of Different Biofilm Components

    Science.gov (United States)

    Atekwana, E. A.; Abdel Aal, G. Z.; Sarkisova, S. A.; Patrauchan, M.

    2013-12-01

    Microbial biofilms are structured communities of microorganisms commonly attached to a surface and embedded in a self-produced matrix. The matrix is composed of extracellular polymeric substances (EPS), which commonly include extracellular DNA, proteins, and polysaccharides. In addition, the biofilm structure may contain some other components such as metabolic byproducts and biogenic nanoparticle minerals. Biogeophysical studies have demonstrated the sensitivity of spectral induced polarization (SIP) measurements to the growth and development of biofilm in saturated porous media. However, the mechanisms are not very well understood. The overarching goal of this study is to determine the contribution of the different biofilm components to the spectral induced polarization (SIP) signatures in aqueous and/or porous media. We investigated the SIP response of different biofilm components including bacterial cells, alginate (exopolysaccharide), phenazine (redox-active metabolite) and magnetite (semi-conductive particulate matter). The porous media was glass beads with grain diameter of 1 mm. Each of the biofilm components was suspended in a low salt growth medium with electrolytic conductivity of 513 μS/cm. Using Pseudomonas aeruginosa PAO1 cells in suspension and in porous media, we observed the increase in SIP parameters with increasing cell density with a very well defined relaxation peak at a frequency of ~10 Hz, which was predicted by recently developed quantitative models. However, this characteristic relaxation peak was minimized in the presence of porous media. We also observed that cells suspended in alginate enhance the polarization and show a peak frequency at ~10 Hz. The study of alginate gelation in liquid phase and porous media in vitro revealed that solidified (gelated) alginate (from brown algae) increased the magnitude of imaginary conductivity while real conductivity increased very moderately. In contrast, the study of the SIP response within a porous

  5. Investigation of ITO free transparent conducting polymer based electrode

    Science.gov (United States)

    Sharma, Vikas; Sapna, Sachdev, Kanupriya

    2016-05-01

    The last few decades have seen a significant improvement in organic semiconductor technology related to solar cell, light emitting diode and display panels. The material and structure of the transparent electrode is one of the major concerns for superior performance of devices such as OPV, OLED, touch screen and LCD display. Commonly used ITO is now restricted due to scarcity of indium, its poor mechanical properties and rigidity, and mismatch of energy levels with the active layer. Nowadays DMD (dielectric-metal-dielectric) structure is one of the prominent candidates as alternatives to ITO based electrode. We have used solution based spin coated polymer layer as the dielectric layer with silver thin film embedded in between to make a polymer-metal-polymer (PMP) structure for TCE applications. The PMP structure shows low resistivity (2.3 x 10-4Ω-cm), high carrier concentration (2.9 x 1021 cm-3) and moderate transparency. The multilayer PMP structure is characterized with XRD, AFM and Hall measurement to prove its suitability for opto-electronic device applications.

  6. Investigation of ITO free transparent conducting polymer based electrode

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, Vikas; Sapna,; Sachdev, Kanupriya [Department of Physics, Malaviya National Institute of Technology Jaipur, JLN Marg, Jaipur-India-302017 (India)

    2016-05-23

    The last few decades have seen a significant improvement in organic semiconductor technology related to solar cell, light emitting diode and display panels. The material and structure of the transparent electrode is one of the major concerns for superior performance of devices such as OPV, OLED, touch screen and LCD display. Commonly used ITO is now restricted due to scarcity of indium, its poor mechanical properties and rigidity, and mismatch of energy levels with the active layer. Nowadays DMD (dielectric-metal-dielectric) structure is one of the prominent candidates as alternatives to ITO based electrode. We have used solution based spin coated polymer layer as the dielectric layer with silver thin film embedded in between to make a polymer-metal-polymer (PMP) structure for TCE applications. The PMP structure shows low resistivity (2.3 x 10{sup −4}Ω-cm), high carrier concentration (2.9 x 10{sup 21} cm{sup −3}) and moderate transparency. The multilayer PMP structure is characterized with XRD, AFM and Hall measurement to prove its suitability for opto-electronic device applications.

  7. Experimental Investigations on Thermal Conductivity of Fenugreek and Banana Composites

    Science.gov (United States)

    Pujari, Satish; Venkatesh, Talari; Seeli, Hepsiba

    2017-06-01

    The use of composite materials in manufacturing has significantly increased in the past decade. Research is being done to identify natural fibers that can be used as composites. Several natural fibers are already being used in the industry as composites. The appealing advantages of using natural fibers are reflected in lower density when compared to synthetic fibers and also in saving costs. This research paper highlights the experiment that analyses the use of biodegradable fenugreek composite as natural fiber and concludes that fenugreek natural fibers are an excellent substitute to the synthetic fibers in terms of reinforcement properties for the polymers. These fenugreek fibers are naturally sourced, renewable, cost effective and bio-friendly. In thermal energy storage systems as well as in air conditioning systems, thermal insulators are predominantly used to enhance the storage properties. An experiment was created to investigate the thermal properties of fenugreek banana composites for different fiber concentrations. The experimental results showed that the thermal conductivity of the composites decrease with an increase in the fiber content. The experimental results were compared with the theoretical models to describe the variation of thermal conductivity with the volume fraction of the fiber. Good agreement between theoretical and experimental results was observed.

  8. [Application of atomic force microscopy (AFM) in ophthalmology].

    Science.gov (United States)

    Milka, Michał; Mróz, Iwona; Jastrzebska, Maria; Wrzalik, Roman; Dobrowolski, Dariusz; Roszkowska, Anna M; Moćko, Lucyna; Wylegała, Edward

    2012-01-01

    Atomic force microscopy (AFM) allows to examine surface of different biological objects in the nearly physiological conditions at the nanoscale. The purpose of this work is to present the history of introduction and the potential applications of the AFM in ophthalmology research and clinical practice. In 1986 Binnig built the AFM as a next generation of the scanning tunnelling microscope (STM). The functional principle of AFM is based on the measurement of the forces between atoms on the sample surface and the probe. As a result, the three-dimensional image of the surface with the resolution on the order of nanometres can be obtained. Yamamoto used as the first the AFM on a wide scale in ophthalmology. The first investigations used the AFM method to study structure of collagen fibres of the cornea and of the sclera. Our research involves the analysis of artificial intraocular lenses (IOLs). According to earlier investigations, e.g. Lombardo et al., the AFM was used to study only native IOLs. Contrary to the earlier investigations, we focused our measurements on lenses explanted from human eyes. The surface of such lenses is exposed to the influence of the intraocular aqueous environment, and to the related impacts of biochemical processes. We hereby present the preliminary results of our work in the form of AFM images depicting IOL surface at the nanoscale. The images allowed us to observe early stages of the dye deposit formation as well as local calcinosis. We believe that AFM is a very promising tool for studying the structure of IOL surface and that further observations will make it possible to explain the pathomechanism of artificial intraocular lens opacity formation.

  9. Investigations on dc conductivity behaviour of milled carbon fibre ...

    Indian Academy of Sciences (India)

    This paper reports the d.c. conductivity behaviour of milled carbon fibre reinforced polysulphide modified epoxy gradient composites. Milled carbon fibre reinforced composites having 3 vol. % of milled carbon fibre and poly sulphide modified epoxy resin have been developed. D.C. conductivity measurements are conducted ...

  10. AFM measurements on ferrous materials

    Directory of Open Access Journals (Sweden)

    Ros Yáñez, T.

    2000-08-01

    Full Text Available The Atomic Force Microscope (AFM has been successfully used for the characterisation of the surface topography of a very wide range of materials. The AFM is an interesting technique to study the surface of materials and specifically to study surface effects in steel, e.g. after polishing and/or after etching. This technique allows not only to study the topography of the samples, but it is also a useful tool to obtain structural details of surfaces and for the identification of different phases. In this paper, some applications are shown concerning the study of the microstructure of multiphase-steels.

    El Microcopio de Fuerza Atómica (AFM es utilizado en la caracterización topográfica de una gran variedad de materiales. El AFM es una interesante técnica para el estudio de la superficie de los aceros, ya sea con ataque químico o no. Esta técnica es también una útil herramienta para obtener detalles estructurales en las superficies y en la identificación de fases. En este trabajo algunas de estas aplicaciones son mostradas en el estudio de la microestructura de aceros multifásicos.

  11. AFM study of structure influence on butterfly wings coloration

    OpenAIRE

    Dinara Sultanovna Dallaeva; Pavel Tomanek

    2012-01-01

    This study describes the structural coloration of the butterfly Vanessa Atalanta wings and shows how the atomic force microscopy (AFM) can be applied to the study of wings morphology and wings surface behavior under the temperature. The role of the wings morphology in colors was investigated. Different colors of wings have different topology and can be identified by them. AFM in semi-contact mode was used to study the wings surface. The wing surface area, which is close to the butterfly body,...

  12. 15 CFR 270.200 - Technical conduct of investigation.

    Science.gov (United States)

    2010-01-01

    ... site of a building failure without establishing a Team. (2) If the Director establishes and deploys a...(b)(2) of the Act, and may perform all activities that Teams are authorized to perform under the Act... advice on investigation Team activities. (c) Investigation. (1) The duration of an investigation that...

  13. A review of the application of atomic force microscopy (AFM) in food science and technology.

    Science.gov (United States)

    Liu, Shaoyang; Wang, Yifen

    2011-01-01

    Atomic force microscopy (AFM) is a powerful nanoscale analysis technique used in food area. This versatile technique can be used to acquire high-resolution sample images and investigate local interactions in air or liquid surroundings. In this chapter, we explain the principles of AFM and review representative applications of AFM in gelatin, casein micelle, carrageenan, gellan gum, starch, and interface. We elucidate new knowledge revealed with AFM as well as ways to use AFM to obtain morphology and rheology information in different food fields. Copyright © 2011 Elsevier Inc. All rights reserved.

  14. [Application of atomic force microscopy (AFM) to study bacterial biofilms].

    Science.gov (United States)

    Yang, Shanshan; Huang, Qiaoyun; Cai, Peng

    2017-09-25

    Because of the nanometre resolution, piconewton force sensitivity, label-free technique and the ability to operate in liquid environments, atomic force microscopy (AFM) has emerged as a powerful tool to explore the biofilm development processes. AFM provides three-dimensional topography and structural details of biofilm surfaces under in-situ conditions. It also helps to generate key information on the mechanical properties of biofilm surfaces, such as elasticity and stickiness. Additionally, single-molecule and single-cell force spectroscopies can be applied to measure the strength of adhesion, attraction, and repulsion forces between cell-solid and cell-cell surfaces. This paper outlined the basic principle of AFM technique and introduced recent advances in the application of AFM for the investigation of ultra-morphological, mechanical and interactive properties of biofilms. Furthermore, the existing problems and future prospects were discussed.

  15. Investigation of Thermal and Electrical Properties for Conductive Polymer Composites

    Science.gov (United States)

    Juwhari, Hassan K.; Abuobaid, Ahmad; Zihlif, Awwad M.; Elimat, Ziad M.

    2017-10-01

    This study addresses the effects of temperature ranging from 300 K to 400 K on thermal ( κ) and electrical ( σ) conductivities, and Lorenz number ( L) for different conductive polymeric composites (CPCs), as tailoring the ratios between both conductivities of the composites can be influential in the design optimization of certain thermo-electronic devices. Both κ and σ were found to have either a linear or a nonlinear (2nd and 3rd degree polynomial function) increasing behavior with increased temperatures, depending on the conduction mechanism occurring in the composite systems studied. Temperature-dependent behavior of L tends to show decreasing trends above 300 K, where at 300 K the highest and the lowest values were found to be 3 × 103 W Ω/K2 for CPCs containing iron particles and 3 × 10-2 W Ω/K2 for CPCs-containing carbon fibers respectively. Overall, temperature-dependent behavior of κ/ σ and L can be controlled by heterogeneous structures produced via mechanical-molding-compression. These structures are mainly responsible for energy-transfer processes or transport properties that take place by electrons and phonons in the CPCs' bulks. Hence, the outcome is considered significant in the development process of high performing materials for the thermo-electronic industry.

  16. BOREAS AFM-11 Aircraft Flux Analysis Reports

    Data.gov (United States)

    National Aeronautics and Space Administration — Reports from the BOREAS AFM-11 team regarding quality control and sampling analysis of data collected by other AFM personnel using the Electra, LongEZ, and Twin...

  17. Bottom-up on-crystal in-chip formation of a conducting salt and a view of its restructuring: from organic insulator to conducting “switch” through microfluidic manipulation† †Electronic supplementary information (ESI) available: Additional AFM images and I/V curves from the conducting AFM, SEM and EDX measurements. See DOI: 10.1039/c5sc00203f Click here for additional data file.

    Science.gov (United States)

    Paradinas, Markos; Bailo, Elena; Rodriguez-Trujillo, Romen; Pfattner, Raphael

    2015-01-01

    The chemical modification of an immobilized single crystal in a fluid cell is reported, whereby a material with switching functions is generated in situ by generating a chemical reagent in the flow. Crystals of the insulating organic crystal of TCNQ (tetracyanoquinodimethane) were grown in a microfluidic channel and were trapped using a pneumatic valve, a nascent technique for materials manipulation. They were subsequently reduced using solution-deposited silver to provide a conducting material in situ by a heterogeneous reaction. Removal of the new material from the chip proved it to be the silver salt of reduced TCNQ. Uniquely, conducting atomic force microscope (CAFM) studies show three regions in the solid. The localized original neutral organic material crystal is shown to be an insulator but to produce areas with Ohmic conducting characteristics after reduction. This inhomogeneous doping provides an opportunity for probing electrical materials properties side by side. Measurements with the CAFM witness this conducting material where the TCNQ is fully transformed to the silver salt. Additionally, an intermediate phase is observed that exhibits bipolar resistive switching typical of programmable resistive memories. Raman microscopy proves the conversion of the material in specific regions and clearly defines the intermediate phase region that could be responsible for the switching effect in related materials. This kind of “on crystal chemistry” exploiting immobilization and masking by a pneumatic clamp in a microfluidic channel shows how material can be selectively converted to give different functionalities in the same material piece, even though it is not a single crystal to single crystal conversion, and beckons exploitation for the preparation of systems relevant for molecular electronics as well as other areas where chemical manipulation of single crystals could be beneficial. PMID:28706708

  18. AFM Studies of Lunar Soils and Application to the Mars 2001 Mission

    Science.gov (United States)

    Weitz, C. M.; Anderson, M. S.; Marshall, J.

    1999-09-01

    The upcoming Mars 01 mission will carry an Atomic Force Microscope (AFM) as part of the Mars Environmental Compatibility Assessment (MECA) instrument. By operating in a tapping mode, the AFM is capable of sub-nanometer resolution in three dimensions and can distinguish between substances of different compositions by employing phase contrast imaging. To prepare for the Mars 01 mission, we are testing the AFM on a lunar soil to determine its ability to define particle shapes and sizes and grain-surface textures. The test materials are from the Apollo 17 soil 79221, which is a mixture of agglutinates, impact and volcanic beads, and mare and highland rock and mineral fragments. The majority of the lunar soil particles are less than 100 microns in size, comparable to the sizes estimated for martian dust. We have used the AFM to examine several different soil particles at various resolutions. The instrument has demonstrated the ability to identify parallel ridges characteristic of twinning on a 150 micron plagioclase feldspar particle. Extremely small (10-100 nanometer) adhering particles are visible on the surface of the feldspar grain, and they appear elongate with smooth surfaces. Phase contrast imaging of the nanometer particles shows several compositions to be present. When the AFM was applied to a 100 micron glass spherule, it was possible to define an extremely smooth surface; this is in clear contrast to results from a basalt fragment which exhibited a rough surface texture. Also visible on the surface of the glass spherule were chains of 100 nanometer and smaller impact melt droplets. For the '01 Mars mission, the AFM is intended to define the size and shape distributions of soil particles, in combination with the NMCA optical microscope system and images from the Robot Arm Camera (RAC). These three data sets will provide a means of assessing potentially hazardous soil and dust properties. The study that we have conducted on the lunar soils now suggests that the

  19. AFM Structural Characterization of Drinking Water Biofilm ...

    Science.gov (United States)

    Due to the complexity of mixed culture drinking water biofilm, direct visual observation under in situ conditions has been challenging. In this study, atomic force microscopy (AFM) revealed the three dimensional morphology and arrangement of drinking water relevant biofilm in air and aqueous solution. Operating parameters were optimized to improve imaging of structural details for a mature biofilm in liquid. By using a soft cantilever (0.03 N/m) and slow scan rate (0.5 Hz), biofilm and individual bacterial cell’s structural topography were resolved and continuously imaged in liquid without loss of spatial resolution or sample damage. The developed methodology will allow future in situ investigations to temporally monitor mixed culture drinking water biofilm structural changes during disinfection treatments. Due to the complexity of mixed culture drinking water biofilm, direct visual observation under in situ conditions has been challenging. In this study, atomic force microscopy (AFM) revealed the three dimensional morphology and arrangement of drinking water relevant biofilm in air and aqueous solution. Operating parameters were optimized to improve imaging of structural details for a mature biofilm in liquid. By using a soft cantilever (0.03 N/m) and slow scan rate (0.5 Hz), biofilm and individual bacterial cell’s structural topography were resolved and continuously imaged in liquid without loss of spatial resolution or sample damage. The developed methodo

  20. AFM Study of Structure Influence on Butterfly Wings Coloration

    Directory of Open Access Journals (Sweden)

    Dinara Sultanovna Dallaeva

    2012-01-01

    Full Text Available This study describes the structural coloration of the butterfly Vanessa Atalanta wings and shows how the atomic force microscopy (AFM can be applied to the study of wings morphology and wings surface behavior under the temperature. The role of the wings morphology in colors was investigated. Different colors of wings have different topology and can be identified by them. AFM in semi-contact mode was used to study the wings surface. The wing surface area, which is close to the butterfly body, has shiny brown color and the peak of surface roughness is about 600 nm. The changing of morphology at different temperatures is shown.

  1. Investigating the Inter-Tube Conduction Mechanism in Polycarbonate Nanocomposites Prepared with Conductive Polymer-Coated Carbon Nanotubes

    KAUST Repository

    Ventura, Isaac Aguilar

    2015-12-16

    A well-known strategy to improve the electrical conductivity of polymers is to dope them with high-aspect-ratio and conductive nanoparticles such as carbon nanotubes (CNTs). However, these nanocomposites also exhibit undesirable properties such as damage-sensitive and history-dependent conductivity because their macroscopic electrical conductivity is largely determined by the tunneling effect at the tube/tube interface. To reduce these issues, new nanocomposites have been developed with CNTs that have been coated with a conductive layer of poly(3,4-ethylenedioxythiophene)poly(styrenesulfonate) (PEDOT/PSS). It has been posited that the insulating region between the CNTs is replaced by a conductive polymer bridge; this has not been proven up to now. We propose here to investigate in-depth how the macroscopic conductivity of these materials is changing when (1) varying the frequency of the electrical loading (impedance spectroscopy), (2) varying the mechanical hydrostatic pressure, and (3) varying the voltage of the electrical loading. The response is systematically compared to the one of conventional carbon nanotube/polycarbonate (CNT/PC) nanocomposites so we can clarify how efficiently the tunneling effect is suppressed from these composites. The objective is to elucidate further the mechanism for conduction in such material formulations.

  2. AFM of metallic nano-particles and nano-structures in heavily irradiated NaCl

    NARCIS (Netherlands)

    Gaynutdinov, R; Vainshtein, DI; Hak, SJ; Tolstikhina, A; Den Hartog, HW

    2003-01-01

    AFM investigations are reported for heavily, electron irradiated NaCl crystals in ultra high vacuum (UHV) in the non-contact mode-with an UHV AFM/STM Omicron system. To avoid chemical reactions between the radiolytic Na and oxygen and water, the irradiated samples were cleaved and prepared for the

  3. 12 CFR 19.182 - Order to conduct a formal investigation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Order to conduct a formal investigation. 19.182 Section 19.182 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Formal Investigations § 19.182 Order to conduct a formal investigation. A formal...

  4. 14 CFR 13.117 - Conduct of investigative proceeding or deposition.

    Science.gov (United States)

    2010-01-01

    ... TRANSPORTATION PROCEDURAL RULES INVESTIGATIVE AND ENFORCEMENT PROCEDURES Formal Fact-Finding Investigation Under an Order of Investigation § 13.117 Conduct of investigative proceeding or deposition. (a) The...) Question witnesses, provided the questions are relevant and material to the matters under investigation and...

  5. Surface analysis with STM and AFM

    CERN Document Server

    Magonov, Sergi N

    1996-01-01

    Scanning tunneling microscopy (STM) and atomic force microscopy (AFM) are powerful tools for surface examination. In the past, many STM and AFM studies led to erroneous conclusions due to lack of proper theoretical considerations and of an understanding of how image patterns are affected by measurement conditions. For this book, two world experts, one on theoretical analysis and the other on experimental characterization, have joined forces to bring together essential components of STM and AFM studies: The practical aspects of STM, the image simulation by surface electron density plot calculat

  6. Error-corrected AFM: a simple and broadly applicable approach for substantially improving AFM image accuracy.

    Science.gov (United States)

    Bosse, James L; Huey, Bryan D

    2014-04-18

    Atomic force microscopy (AFM) has become an indispensable tool for imaging the topography and properties of surfaces at the nanoscale. A ubiquitous problem, however, is that optimal accuracy demands smooth surfaces, slow scanning, and expert users, contrary to many AFM applications and practical use patterns. Accordingly, a simple correction to AFM topographic images is implemented, incorporating error signals such as deflection and/or amplitude data that have long been available but quantitatively underexploited. This is demonstrated to substantially improve both height and lateral accuracy for expert users, with a corresponding 3-5 fold decrease in image error. Common image artifacts due to inexperienced AFM use, generally poorly scanned surfaces, or high speed images acquired in as fast as 7 s, are also shown to be effectively rectified, returning results equivalent to standard 'expert-user' images. This concept is proven for contact mode AFM, AC-mode, and high speed imaging, as well as property mapping such as phase contrast, with obvious extensions to many specialized AFM variations as well. Conveniently, as this correction procedure is based on either real time or post-processing, it is easily employed for future as well as legacy AFM systems and data. Such error-corrected AFM therefore offers a simple, broadly applicable approach for more accurate, more efficient, and more user-friendly implementation of AFM for nanoscale topography and property mapping.

  7. Error-corrected AFM: a simple and broadly applicable approach for substantially improving AFM image accuracy

    Science.gov (United States)

    Bosse, James L.; Huey, Bryan D.

    2014-04-01

    Atomic force microscopy (AFM) has become an indispensable tool for imaging the topography and properties of surfaces at the nanoscale. A ubiquitous problem, however, is that optimal accuracy demands smooth surfaces, slow scanning, and expert users, contrary to many AFM applications and practical use patterns. Accordingly, a simple correction to AFM topographic images is implemented, incorporating error signals such as deflection and/or amplitude data that have long been available but quantitatively underexploited. This is demonstrated to substantially improve both height and lateral accuracy for expert users, with a corresponding 3-5 fold decrease in image error. Common image artifacts due to inexperienced AFM use, generally poorly scanned surfaces, or high speed images acquired in as fast as 7 s, are also shown to be effectively rectified, returning results equivalent to standard ‘expert-user’ images. This concept is proven for contact mode AFM, AC-mode, and high speed imaging, as well as property mapping such as phase contrast, with obvious extensions to many specialized AFM variations as well. Conveniently, as this correction procedure is based on either real time or post-processing, it is easily employed for future as well as legacy AFM systems and data. Such error-corrected AFM therefore offers a simple, broadly applicable approach for more accurate, more efficient, and more user-friendly implementation of AFM for nanoscale topography and property mapping.

  8. Hydration states of AFm cement phases

    Energy Technology Data Exchange (ETDEWEB)

    Baquerizo, Luis G., E-mail: luis.baquerizoibarra@holcim.com [Innovation, Holcim Technology Ltd., CH-5113 Holderbank (Switzerland); Matschei, Thomas [Innovation, Holcim Technology Ltd., CH-5113 Holderbank (Switzerland); Scrivener, Karen L. [Laboratory of Construction Materials, Ecole Polytechnique Fédérale de Lausanne, CH-1015 Lausanne (Switzerland); Saeidpour, Mahsa; Wadsö, Lars [Building Materials, Lund University, Box 124, 221 000 Lund (Sweden)

    2015-07-15

    The AFm phase, one of the main products formed during the hydration of Portland and calcium aluminate cement based systems, belongs to the layered double hydrate (LDH) family having positively charged layers and water plus charge-balancing anions in the interlayer. It is known that these phases present different hydration states (i.e. varying water content) depending on the relative humidity (RH), temperature and anion type, which might be linked to volume changes (swelling and shrinkage). Unfortunately the stability conditions of these phases are insufficiently reported. This paper presents novel experimental results on the different hydration states of the most important AFm phases: monocarboaluminate, hemicarboaluminate, strätlingite, hydroxy-AFm and monosulfoaluminate, and the thermodynamic properties associated with changes in their water content during absorption/desorption. This data opens the possibility to model the response of cementitious systems during drying and wetting and to engineer systems more resistant to harsh external conditions.

  9. Investigation of the Effective Thermal Conductivity in Containment Wall of OPR1000

    Energy Technology Data Exchange (ETDEWEB)

    Noh, Hyung Gyun [Pohang University, Pohang (Korea, Republic of); Lee, Jong Hwi; Kang, Hie Chan [Kunsan National University, Gunsan (Korea, Republic of)

    2016-05-15

    Many computational codes used for analyzing pressure of containment was developed such as CAP (Containment Analysis Package). These computational codes consider concrete conductivity instead of thermal conductivity of containment wall which have special geometry as heat sink. For precise analysis, effective thermal conductivity of containment wall has to be measured in individual NPPs. Thermal properties of concrete such as thermal conductivity have been investigated as function of chemical composition and temperature. Generally, containment of OPR1000 is constructed by Prestressed (PS) concrete-a composite material. Containment wall of OPR1000 is made up of steel liner, tendon, rebar and concrete as shown in Figure 1. Role of steel liner protects release of radioactive materials so called leak tightness. The effective thermal conductivity of containment wall in OPR1000 is analyzed by numerical tool (CFD) and compared with thermal conductivity models in composite solids. The effective thermal conductivity of containment wall of OPR1000 is investigated by numerical analysis (CFD). The thermal conductivity of reinforced concrete is 18.6% higher than that of concrete only. Several models were compared with CFD results. Rayleigh-Parallel liner model agrees well with CFD results. Experiment results will be compared with CFD result and models. CFD result was calculated in low steel volume fraction (0.0809) than that of OPR1000 (0.1043). The effective thermal conductivity in OPR1000 has slightly higher than CFD result because of different volume fraction.

  10. Numerical Study of Hydrodynamic Forces for AFM Operations in Liquid

    Directory of Open Access Journals (Sweden)

    Tobias Berthold

    2017-01-01

    Full Text Available For advanced atomic force microscopy (AFM investigation of chemical surface modifications or very soft organic sample surfaces, the AFM probe tip needs to be operated in a liquid environment because any attractive or repulsive forces influenced by the measurement environment could obscure molecular forces. Due to fluid properties, the mechanical behavior of the AFM cantilever is influenced by the hydrodynamic drag force due to viscous friction with the liquid. This study provides a numerical model based on computational fluid dynamics (CFD and investigates the hydrodynamic drag forces for different cantilever geometries and varying fluid conditions for Peakforce Tapping (PFT in liquids. The developed model was verified by comparing the predicted values with published results of other researchers and the findings confirmed that drag force dependence on tip speed is essentially linear in nature. We observed that triangular cantilever geometry provides significant lower drag forces than rectangular geometry and that short cantilever offers reduced flow resistance. The influence of different liquids such as ultrapure water or an ethanol-water mixture as well as a temperature induced variation of the drag force could be demonstrated. The acting forces are lowest in ultrapure water, whereas with increasing ethanol concentrations the drag forces increase.

  11. Numerical Study of Hydrodynamic Forces for AFM Operations in Liquid.

    Science.gov (United States)

    Berthold, Tobias; Benstetter, Guenther; Frammelsberger, Werner; Rodríguez, Rosana; Nafría, Montserrat

    2017-01-01

    For advanced atomic force microscopy (AFM) investigation of chemical surface modifications or very soft organic sample surfaces, the AFM probe tip needs to be operated in a liquid environment because any attractive or repulsive forces influenced by the measurement environment could obscure molecular forces. Due to fluid properties, the mechanical behavior of the AFM cantilever is influenced by the hydrodynamic drag force due to viscous friction with the liquid. This study provides a numerical model based on computational fluid dynamics (CFD) and investigates the hydrodynamic drag forces for different cantilever geometries and varying fluid conditions for Peakforce Tapping (PFT) in liquids. The developed model was verified by comparing the predicted values with published results of other researchers and the findings confirmed that drag force dependence on tip speed is essentially linear in nature. We observed that triangular cantilever geometry provides significant lower drag forces than rectangular geometry and that short cantilever offers reduced flow resistance. The influence of different liquids such as ultrapure water or an ethanol-water mixture as well as a temperature induced variation of the drag force could be demonstrated. The acting forces are lowest in ultrapure water, whereas with increasing ethanol concentrations the drag forces increase.

  12. Dicty_cDB: AFM648 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM648 (Link to dictyBase) - - - - - (Link to Original site) A...FM648F 626 - - - - - - Show AFM648 Library AF (Link to library) Clone ID AFM648 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM...QQAQSASD ILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKEVAIM SKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLLL...IQIQQAQSASD ILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKEVAIM SKIFHPNIVLFLGACTSTPGKLMICT

  13. [Synthesis of particle-free silver conductive ink and investigation of fabrication of conductive film by printing].

    Science.gov (United States)

    Nie, Xiao-Lei; Wang, Hong; Zou, Jing

    2012-11-01

    Particle-free conductive ink was prepared, taking silver citrate as conductive metal precursor, sec-butylamine as complexing agent and ethanol as media adjusting the viscosity and wettability. The ink could be printed on PET substrate by gravure printing, and silver conductive film with high electrical conductivity was obtained after thermal treated at low temperature. Silver citrate, silver citrate based conductive ink and silver conductive film were characterized with EDS, STA, IR, XRD, SEM and four point probe method. The results of STA showed that the mass of the conductive ink came to constant at 132 degrees C which is much lower than that of silver citrate (210 degrees C); the results of SEM and XRD showed that the silver conductive film cured at 150 C was constituted by compact silver nano particles with high purity; the result of four point probe method showed that its sheet resistance was 1.83 omega x square(-1).

  14. Investigation on two abnormal phenomena about thermal conductivity enhancement of BN/EG nanofluids

    Directory of Open Access Journals (Sweden)

    Wu Jiangtao

    2011-01-01

    Full Text Available Abstract The thermal conductivity of boron nitride/ethylene glycol (BN/EG nanofluids was investigated by transient hot-wire method and two abnormal phenomena was reported. One is the abnormal higher thermal conductivity enhancement for BN/EG nanofluids at very low-volume fraction of particles, and the other is the thermal conductivity enhancement of BN/EG nanofluids synthesized with large BN nanoparticles (140 nm which is higher than that synthesized with small BN nanoparticles (70 nm. The chain-like loose aggregation of nanoparticles is responsible for the abnormal increment of thermal conductivity enhancement for the BN/EG nanofluids at very low particles volume fraction. And the difference in specific surface area and aspect ratio of BN nanoparticles may be the main reasons for the abnormal difference between thermal conductivity enhancements for BN/EG nanofluids prepared with 140- and 70-nm BN nanoparticles, respectively.

  15. Electrospray deposition from fountain pen AFM probes

    NARCIS (Netherlands)

    Geerlings, J.; Sarajlic, Edin; Berenschot, Johan W.; Abelmann, Leon; Tas, Niels Roelof

    2012-01-01

    In this paper we present for the first time electrospraying from fountain pen probes. By using electrospray contactless deposition in an AFM setup becomes possible. Experiments on a dedicated setup were carried out as first step towards this goal. Spraying from 8 and 2 µm apertures was observed. For

  16. Reconstruction Algorithms in Undersampled AFM Imaging

    DEFF Research Database (Denmark)

    Arildsen, Thomas; Oxvig, Christian Schou; Pedersen, Patrick Steffen

    2016-01-01

    This paper provides a study of spatial undersampling in atomic force microscopy (AFM) imaging followed by different image reconstruction techniques based on sparse approximation as well as interpolation. The main reasons for using undersampling is that it reduces the path length and thereby the s...

  17. AFM plough YBCO micro bridges: substrate effects

    CSIR Research Space (South Africa)

    Elkaseh, A

    2009-04-01

    Full Text Available AFM nanolithography was used as a novel cutting technique to define micro-size YBCO superconducting constrictions. Researchers studied the substrate effects on MgO and STO substrates and showed that the observed Shapiro steps from the bridges on STO...

  18. Experimental and theoretical investigation of thermal conductivity of ethylene glycol containing functionalized single walled carbon nanotubes

    Science.gov (United States)

    Hemmat Esfe, Mohammad; Firouzi, Masoumeh; Afrand, Masoud

    2018-01-01

    In this paper, functionalized single walled carbon nanotubes (FSWCNTs) were suspended in Ethylene Glycol (EG) at different volume fractions. A KD2 pro thermal conductivity meter was used to measure the thermal conductivity in the temperature range from 30 to 50 °C. Nanofluids were prepared in solid volume fraction of 0.02, 0.05, 0.075, 0.1, 0.25, 0.5 and, 0.75%. Experimental results revealed that the thermal conductivity of the nanofluid is a non-linear function of temperature and SWCNTs volume fraction in the range of this investigation. Thermal conductivity increases with temperature and nanoparticles volume fraction as usual for this type of nanofluid. Maximum increment in thermal conductivity of the nanofluids was found to be about 45% at 0.75 vol fractions loading at 50 °C. Finally, a new correlation based on artificial neural network (ANN) approach has been proposed for SWCNT-EG thermal conductivity in terms of nanoparticles volume fraction and temperature using the experimental data. Used ANN approach has estimated the experimental values of thermal conductivity with the absolute average relative deviation lower than 0.9%, mean square error of 3.67 × 10-5 and regression coefficient of 0.9989. Comparison between the suggested techniques with various used correlation in the literatures established that the ANN approach is better to other presented methods and therefore can be proposed as a useful means for predicting of the nanofluids thermal conductivity.

  19. Diamond-modified AFM probes: from diamond nanowires to atomic force microscopy-integrated boron-doped diamond electrodes.

    Science.gov (United States)

    Smirnov, Waldemar; Kriele, Armin; Hoffmann, René; Sillero, Eugenio; Hees, Jakob; Williams, Oliver A; Yang, Nianjun; Kranz, Christine; Nebel, Christoph E

    2011-06-15

    In atomic force microscopy (AFM), sharp and wear-resistant tips are a critical issue. Regarding scanning electrochemical microscopy (SECM), electrodes are required to be mechanically and chemically stable. Diamond is the perfect candidate for both AFM probes as well as for electrode materials if doped, due to diamond's unrivaled mechanical, chemical, and electrochemical properties. In this study, standard AFM tips were overgrown with typically 300 nm thick nanocrystalline diamond (NCD) layers and modified to obtain ultra sharp diamond nanowire-based AFM probes and probes that were used for combined AFM-SECM measurements based on integrated boron-doped conductive diamond electrodes. Analysis of the resonance properties of the diamond overgrown AFM cantilevers showed increasing resonance frequencies with increasing diamond coating thicknesses (i.e., from 160 to 260 kHz). The measured data were compared to performed simulations and show excellent correlation. A strong enhancement of the quality factor upon overgrowth was also observed (120 to 710). AFM tips with integrated diamond nanowires are shown to have apex radii as small as 5 nm and where fabricated by selectively etching diamond in a plasma etching process using self-organized metal nanomasks. These scanning tips showed superior imaging performance as compared to standard Si-tips or commercially available diamond-coated tips. The high imaging resolution and low tip wear are demonstrated using tapping and contact mode AFM measurements by imaging ultra hard substrates and DNA. Furthermore, AFM probes were coated with conductive boron-doped and insulating diamond layers to achieve bifunctional AFM-SECM probes. For this, focused ion beam (FIB) technology was used to expose the boron-doped diamond as a recessed electrode near the apex of the scanning tip. Such a modified probe was used to perform proof-of-concept AFM-SECM measurements. The results show that high-quality diamond probes can be fabricated, which are

  20. ' I ~ ' A trial Was conducted to investigate the possible improvetmnt of ...

    African Journals Online (AJOL)

    I ~ ' A trial Was conducted to investigate the possible improvetmnt of Dominant D300 cock' '. (D3 OOCX) with Anak ... Key words: Broodiness, chicken breeds, cross breeding, egg Pmduaion, . indigcnous production ... 6, No.1, 2006 and BxD300Px were brooded together for 6'weeks using the conventional deep litter system.

  1. High-stress study of bioinspired multifunctional PEDOT:PSS/nanoclay nanocomposites using AFM, SEM and numerical simulation.

    Science.gov (United States)

    Diaz, Alfredo J; Noh, Hanaul; Meier, Tobias; Solares, Santiago D

    2017-01-01

    Bioinspired design has been central in the development of hierarchical nanocomposites. Particularly, the nacre-mimetic brick-and-mortar structure has shown excellent mechanical properties, as well as gas-barrier properties and optical transparency. Along with these intrinsic properties, the layered structure has also been utilized in sensing devices. Here we extend the multifunctionality of nacre-mimetics by designing an optically transparent and electron conductive coating based on PEDOT:PSS and nanoclays Laponite RD and Cloisite Na+. We carry out extensive characterization of the nanocomposite using transmittance spectra (transparency), conductive atomic force microscopy (conductivity), contact-resonance force microscopy (mechanical properties), and SEM combined with a variety of stress-strain AFM experiments and AFM numerical simulations (internal structure). We further study the nanoclay's response to the application of pressure with multifrequency AFM and conductive AFM, whereby increases and decreases in conductivity can occur for the Laponite RD composites. We offer a possible mechanism to explain the changes in conductivity by modeling the coating as a 1-dimensional multibarrier potential for electron transport, and show that conductivity can change when the separation between the barriers changes under the application of pressure, and that the direction of the change depends on the energy of the electrons. We did not observe changes in conductivity under the application of pressure with AFM for the Cloisite Na+ nanocomposite, which has a large platelet size compared with the AFM probe diameter. No pressure-induced changes in conductivity were observed in the clay-free polymer either.

  2. Experimental Investigation of Size Effects on the Thermal Conductivity of Silicon-Germanium Alloy Thin Films

    Science.gov (United States)

    Cheaito, Ramez; Duda, John C.; Beechem, Thomas E.; Hattar, Khalid; Ihlefeld, Jon F.; Medlin, Douglas L.; Rodriguez, Mark A.; Campion, Michael J.; Piekos, Edward S.; Hopkins, Patrick E.

    2012-11-01

    We experimentally investigate the role of size effects and boundary scattering on the thermal conductivity of silicon-germanium alloys. The thermal conductivities of a series of epitaxially grown Si1-xGex thin films with varying thicknesses and compositions were measured with time-domain thermoreflectance. The resulting conductivities are found to be 3 to 5 times less than bulk values and vary strongly with film thickness. By examining these measured thermal conductivities in the context of a previously established model, it is shown that long wavelength phonons, known to be the dominant heat carriers in alloy films, are strongly scattered by the film boundaries, thereby inducing the observed reductions in heat transport. These results are then generalized to silicon-germanium systems of various thicknesses and compositions; we find that the thermal conductivities of Si1-xGex superlattices are ultimately limited by finite size effects and sample size rather than periodicity or alloying. This demonstrates the strong influence of sample size in alloyed nanosystems. Therefore, if a comparison is to be made between the thermal conductivities of superlattices and alloys, the total sample thicknesses of each must be considered.

  3. Nanomechanics of Yeast Surfaces Revealed by AFM

    Science.gov (United States)

    Dague, Etienne; Beaussart, Audrey; Alsteens, David

    Despite the large and well-documented characterization of the microbial cell wall in terms of chemical composition, the determination of the mechanical properties of surface molecules in relation to their function remains a key challenge in cell biology.The emergence of powerful tools allowing molecular manipulations has already revolutionized our understanding of the surface properties of fungal cells. At the frontier between nanophysics and molecular biology, atomic force microscopy (AFM), and more specifically single-molecule force spectroscopy (SMFS), has strongly contributed to our current knowledge of the cell wall organization and nanomechanical properties. However, due to the complexity of the technique, measurements on live cells are still at their infancy.In this chapter, we describe the cell wall composition and recapitulate the principles of AFM as well as the main current methodologies used to perform AFM measurements on live cells, including sample immobilization and tip functionalization.The current status of the progress in probing nanomechanics of the yeast surface is illustrated through three recent breakthrough studies. Determination of the cell wall nanostructure and elasticity is presented through two examples: the mechanical response of mannoproteins from brewing yeasts and elasticity measurements on lacking polysaccharide mutant strains. Additionally, an elegant study on force-induced unfolding and clustering of adhesion proteins located at the cell surface is also presented.

  4. Dicty_cDB: AFM422 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quences producing significant alignments: (bits) Value AFM422 (AFM422Q) /CSM/AF/AFM4-A/AFM422Q.Seq.d/ 2353 0.0 SFE471 (SFE471...Q) /CSM/SF/SFE4-C/SFE471Q.Seq.d/ 1328 0.0 AFN817 (AFN817Q) /CSM/AF/AFN8-A/AFN817Q.Seq.d/ 10

  5. Dicty_cDB: AFM469 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omology vs DNA Score E Sequences producing significant alignments: (bits) Value N... producing significant alignments: (bits) Value AF222688_1( AF222688 |pid:none) Dictyostelium discoideum dyn...VISILMDLVKESANFGXTLSST Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Val...ue AFM469 (AFM469Q) /CSM/AF/AFM4-C/AFM469Q.Seq.d/ 212 1e-54 VFL163 (VFL163Q) /CSM/V

  6. Dicty_cDB: AFM873 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value AFM873 (AFM873Q) /CSM/AF/AFM8-D/AFM873Q.Seq.d/ 258 2e-...49 own update 2009. 4. 3 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... update 2009. 4.15 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value ( P5

  7. Optical investigations on thermal conductivity in n- and p-type porous silicon

    Energy Technology Data Exchange (ETDEWEB)

    Lettieri, S.; Bernini, U.; Maddalena, P. [Coherentia-INFM and Dipartimento di Scienze Fisiche, Universita di Napoli ' ' Federico II' ' , Complesso Universitario di M. S. Angelo, 80126 Napoli (Italy); Massera, E. [CR-ENEA Portici, Loc. Granatello, Portici (Italy)

    2005-06-01

    Determination of thermal conductivity of top side illuminated n-type and p-type porous silicon (PS) samples have been performed by means of photo-acoustic and optical pump-probe techniques. Concerning the n-type samples, the values found can be explained in the framework of Looyenga effective medium theory, leading to a thermal conductivity of the solid phase of 13 W/mK. This result suggests that n-type thick PS samples formed by top side illumination has a complex multilayer morphology in which mesophases, nanophases and macrophases coexist. The investigation on p-type nanoporous silicon shows that the thermal conductivity does not scale with porosity p as (1-p){sup 3}, suggesting that the percolation of the solid phase is more pronounced respect to the case of a regular ''Looyoenga-like'' mesophase. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  8. Ethical conduct of palliative care research: enhancing communication between investigators and institutional review boards.

    Science.gov (United States)

    Abernethy, Amy P; Capell, Warren H; Aziz, Noreen M; Ritchie, Christine; Prince-Paul, Maryjo; Bennett, Rachael E; Kutner, Jean S

    2014-12-01

    Palliative care has faced moral and ethical challenges when conducting research involving human subjects. There are currently no resources to guide institutional review boards (IRBs) in applying standard ethical principles and terms-in a specific way-to palliative care research. Using as a case study a recently completed multisite palliative care clinical trial, this article provides guidance and recommendations for both IRBs and palliative care investigators to facilitate communication and attain the goal of conducting ethical palliative care research and protecting study participants while advancing the science. Beyond identifying current challenges faced by palliative care researchers and IRBs reviewing palliative care research, this article suggests steps that the palliative care research community can take to establish a scientifically sound, stable, productive, and well-functioning relationship between palliative care investigators and the ethical bodies that oversee their work. Copyright © 2014 American Academy of Hospice and Palliative Medicine. All rights reserved.

  9. AFM as an analysis tool for high-capacity sulfur cathodes for Li–S batteries

    Directory of Open Access Journals (Sweden)

    Renate Hiesgen

    2013-10-01

    Full Text Available In this work, material-sensitive atomic force microscopy (AFM techniques were used to analyse the cathodes of lithium–sulfur batteries. A comparison of their nanoscale electrical, electrochemical, and morphological properties was performed with samples prepared by either suspension-spraying or doctor-blade coating with different binders. Morphological studies of the cathodes before and after the electrochemical tests were performed by using AFM and scanning electron microscopy (SEM. The cathodes that contained polyvinylidene fluoride (PVDF and were prepared by spray-coating exhibited a superior stability of the morphology and the electric network associated with the capacity and cycling stability of these batteries. A reduction of the conductive area determined by conductive AFM was found to correlate to the battery capacity loss for all cathodes. X-ray diffraction (XRD measurements of Li2S exposed to ambient air showed that insulating Li2S hydrolyses to insulating LiOH. This validates the significance of electrical ex-situ AFM analysis after cycling. Conductive tapping mode AFM indicated the existence of large carbon-coated sulfur particles. Based on the analytical findings, the first results of an optimized cathode showed a much improved discharge capacity of 800 mA·g(sulfur−1 after 43 cycles.

  10. Numerical investigation of entropy generation in unsteady MHD generalized Couette flow with variable electrical conductivity.

    Science.gov (United States)

    Chinyoka, T; Makinde, O D

    2013-01-01

    The thermodynamic second law analysis is utilized to investigate the inherent irreversibility in an unsteady hydromagnetic generalized Couette flow with variable electrical conductivity in the presence of induced electric field. Based on some simplified assumption, the model nonlinear governing equations are obtained and solved numerically using semidiscretization finite difference techniques. Effects of various thermophysical parameters on the fluid velocity, temperature, current density, skin friction, the Nusselt number, entropy generation number, and the Bejan number are presented graphically and discussed quantitatively.

  11. Dicty_cDB: AFM645 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFM645 (AFM645Q) /CSM/AF/AFM6-B...icant alignments: (bits) Value N ( AC115605 ) Dictyostelium discoideum chromosome 2 map 5817431... 149 4e-32...n Score E Sequences producing significant alignments: (bits) Value AC115605_2( AC115605 |pid:none) Dictyoste

  12. An investigation of conducted and radiated emissions from a hollow-cathode plasma contactor

    Science.gov (United States)

    Buchholtz, Brett W.; Wilbur, Paul J.

    1993-01-01

    An investigation conducted on the electrical interference induced by the operation of a hollow-cathode plasma contractor in a ground-based facility is described. The types of electrical interference, or noise, which are important to Space Station Freedom designers are classified as either conducted or radiated emissions. The procedures required to perform conducted and radiated emission measurements on a plasma contactor are examined. The experimental data obtained are typically examined in the frequency domain (i.e. amplitudes of the noise fluctuations versus frequency). Results presented indicate the conducted emissions, which are the current fluctuations from the contactor into the space station wiring, are affected by operating parameters such as expellant flow rate and discharge current. The radiated emissions, which are the electromagnetic waves induced and emitted by the contactor, appear to be influenced by the contactor emission current. Other experimental results suggest possible sources which are responsible for the observed noise. For example, the influence of the plasma environment downstream from the contactor on noise emission levels is described. In addition, a brief discussion is given on the correlation between conducted and radiated emissions and the mechanisms through which both are influenced by the plasma downstream of the contactor.

  13. Investigation of thermal conductivity of metal materials on view of influence of ultrasonic waves

    Science.gov (United States)

    Lepeshkin, A. R.; Shcherbakov, P. P.

    2017-11-01

    A devices and methods were developed to determine characteristics of thermal cunductivity in metals materials on view of influence of ultrasonic waves at frequencies of 20 kHz and 2.6 MHz. A thermograph was used for investigation of the nonstationary thermal state of a conical rod and contactless measurements of its surface temperatures. The curves of heating of the tip of the conical rod and the time of heat transfer from the electric heater to the tip of the rod in experiments with an ultrasonic radiator and without it were carried out. According to the results of the research it was obtained that the thermal conductivity of a metal rod is increased by 2 times at a frequency of 20 kHz with an intensity of 50 W. The measure technique and the experimental data on the thermal conductivity of AISI-304 stainless steel in the ultrasonic wave field 2.6 MHz are given. A stationary comparative method for determining the thermal conductivity is used. As a result of the experiments it was established that the thermal conductivity of the rod increases by 2 times in the temperature range 20-100 °C in the field of ultrasonic wave. The obtained results confirm that in the alloys under the influence of ultrasonic waves on electrons and nodes of the crystal structure the contribution of the electron and lattice components of the thermal conductivity increases.

  14. Hot-Fire Testing of a 1N AF-M315E Thruster

    Science.gov (United States)

    Burnside, Christopher G.; Pedersen, Kevin; Pierce, Charles W.

    2015-01-01

    This hot-fire test continues NASA investigation of green propellant technologies for future missions. To show the potential for green propellants to replace some hydrazine systems in future spacecraft, NASA Marshall Space Flight Center (MSFC) is continuing to embark on hot-fire test campaigns with various green propellant blends. NASA completed a hot-fire test of a 1N AF-M315E monopropellant thruster at the Marshall Space Flight Center in the small altitude test stand located in building 4205. The thruster is a ground test article used for basic performance determination and catalyst studies. The purpose of the hot-fire testing was for performance determination of a 1N size thruster and form a baseline from which to study catalyst performance and life with follow-on testing to be conducted at a later date. The thruster performed as expected. The result of the hot-fire testing are presented in this paper and presentation.

  15. Theoretical and practical implications on the subjects charged with duties of conducting special investigation activity

    Directory of Open Access Journals (Sweden)

    Obadă Dumitru

    2017-10-01

    Full Text Available This paper is an endeavor to analyze Moldova’s legal framework aimed at regulating Special investigative activity (SIA in terms of subjects or, in other words, of procedural exponents, invested by a legislator with duties of carrying out SIM. It is also an attempt to reveal the normative inconsistencies specified in the regulatory content of the Criminal Procedural Law, including a verifiable analysis of the legal norms stipulated in the Code of Criminal Procedure, as well as other regulations related to this specific area of state activity specified in the related legislation. Moreover, the author sought to highlight the adverse legal effects that may be generated by the misinterpretation and misapplication of the legal norms related to SIA. While carrying out this study, we have taken into account the practice of law enforcement by state bodies in conducting criminal investigations, as well as the attempt to clarify and define the concept of “carrying out special investigative activity”. The research is also an attempt to clarify the competences of procedural subjects in charge of conducting SIA, as well as their functional interdependence in this activity. Furthermore, the study reasons upon some author’s assertions regarding the legal nature of SIM results from the perspective of the theory of evidence, particularly the admissibility of evidence obtained through SIM, the procedural stage at which the SIM can be performed, the impact of the current normative inadvertences regarding the possibility of taking evidence by means of SIM. The research has also been focused on identifying the prosecutor’s functional characteristics in conducting special investigative activity.

  16. Investigation of thermal conductivity and rheological properties of nanofluids containing graphene nanoplatelets

    Science.gov (United States)

    2014-01-01

    In the present study, stable homogeneous graphene nanoplatelet (GNP) nanofluids were prepared without any surfactant by high-power ultrasonic (probe) dispersion of GNPs in distilled water. The concentrations of nanofluids were maintained at 0.025, 0.05, 0.075, and 0.1 wt.% for three different specific surface areas of 300, 500, and 750 m2/g. Transmission electron microscopy image shows that the suspensions are homogeneous and most of the materials have been well dispersed. The stability of nanofluid was investigated using a UV-visible spectrophotometer in a time span of 600 h, and zeta potential after dispersion had been investigated to elucidate its role on dispersion characteristics. The rheological properties of GNP nanofluids approach Newtonian and non-Newtonian behaviors where viscosity decreases linearly with the rise of temperature. The thermal conductivity results show that the dispersed nanoparticles can always enhance the thermal conductivity of the base fluid, and the highest enhancement was obtained to be 27.64% in the concentration of 0.1 wt.% of GNPs with a specific surface area of 750 m2/g. Electrical conductivity of the GNP nanofluids shows a significant enhancement by dispersion of GNPs in distilled water. This novel type of nanofluids shows outstanding potential for replacements as advanced heat transfer fluids in medium temperature applications including solar collectors and heat exchanger systems. PMID:24410867

  17. Investigation of thermal conductivity and rheological properties of nanofluids containing graphene nanoplatelets.

    Science.gov (United States)

    Mehrali, Mohammad; Sadeghinezhad, Emad; Latibari, Sara Tahan; Kazi, Salim Newaz; Mehrali, Mehdi; Zubir, Mohd Nashrul Bin Mohd; Metselaar, Hendrik Simon Cornelis

    2014-01-13

    In the present study, stable homogeneous graphene nanoplatelet (GNP) nanofluids were prepared without any surfactant by high-power ultrasonic (probe) dispersion of GNPs in distilled water. The concentrations of nanofluids were maintained at 0.025, 0.05, 0.075, and 0.1 wt.% for three different specific surface areas of 300, 500, and 750 m2/g. Transmission electron microscopy image shows that the suspensions are homogeneous and most of the materials have been well dispersed. The stability of nanofluid was investigated using a UV-visible spectrophotometer in a time span of 600 h, and zeta potential after dispersion had been investigated to elucidate its role on dispersion characteristics. The rheological properties of GNP nanofluids approach Newtonian and non-Newtonian behaviors where viscosity decreases linearly with the rise of temperature. The thermal conductivity results show that the dispersed nanoparticles can always enhance the thermal conductivity of the base fluid, and the highest enhancement was obtained to be 27.64% in the concentration of 0.1 wt.% of GNPs with a specific surface area of 750 m2/g. Electrical conductivity of the GNP nanofluids shows a significant enhancement by dispersion of GNPs in distilled water. This novel type of nanofluids shows outstanding potential for replacements as advanced heat transfer fluids in medium temperature applications including solar collectors and heat exchanger systems.

  18. Numerical Investigation of Characteristic of Anisotropic Thermal Conductivity of Natural Fiber Bundle with Numbered Lumens

    Directory of Open Access Journals (Sweden)

    Guan-Yu Zheng

    2014-01-01

    Full Text Available Natural fiber bundle like hemp fiber bundle usually includes many small lumens embedded in solid region; thus, it can present lower thermal conduction than that of conventional fibers. In the paper, characteristic of anisotropic transverse thermal conductivity of unidirectional natural hemp fiber bundle was numerically studied to determine the dependence of overall thermal property of the fiber bundle on that of the solid region phase. In order to efficiently predict its thermal property, the fiber bundle was embedded into an imaginary matrix to form a unit composite cell consisting of the matrix and the fiber bundle. Equally, another unit composite cell including an equivalent solid fiber was established to present the homogenization of the fiber bundle. Next, finite element thermal analysis implemented by ABAQUS was conducted in the two established composite cells by applying proper thermal boundary conditions along the boundary of unit cell, and influences of the solid region phase and the equivalent solid fiber on the composites were investigated, respectively. Subsequently, an optional relationship of thermal conductivities of the natural fiber bundle and the solid region was obtained by curve fitting technique. Finally, numerical results from the obtained fitted curves were compared with the analytic Hasselman-Johnson’s results and others to verify the present numerical model.

  19. Experimental investigation of the reliability issue of RRAM based on high resistance state conduction.

    Science.gov (United States)

    Zhang, Lijie; Hsu, Yen-Ya; Chen, Frederick T; Lee, Heng-Yuan; Chen, Yu-Sheng; Chen, Wei-Su; Gu, Pei-Yi; Liu, Wen-Hsing; Wang, Shun-Min; Tsai, Chen-Han; Huang, Ru; Tsai, Ming-Jinn

    2011-06-24

    In this paper, reliability issues of robust HfO(x)-based RRAM are experimentally investigated in terms of cycling ageing, temperature impact and voltage acceleration. All reliability issues can be estimated by the conduction of the high resistance state (HRS). The conduction current of the HRS exponentially increases as the square root of the applied voltage, which is well explained by 'quasi-Poole-Frenkel-type' trap assistant tunneling. Further experiments on HRS conduction at different temperatures show that the depth of the potential well of the trap in HfO(x) film is about 0.31 eV. The degradation induced by the cycling ageing is possibly ascribed to the increase of the amount of oxygen ions in the TiO(x) layer of the TiN/TiO(x)/HfO(x)/TiN device. The retention times with various stress voltages at different temperatures also exhibit an exponential relationship to the square root of the applied voltage, indicating that stress current plays a dominant role for the degradation of the HRS. An oxygen-release model is proposed to explain the relationship of retention time to HRS conduction current.

  20. Experimental investigation of the reliability issue of RRAM based on high resistance state conduction

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Lijie; Huang Ru [Institute of Microelectronics, Peking University, Beijing 100871 (China); Hsu, Yen-Ya; Chen, Frederick T; Lee, Heng-Yuan; Chen Yusheng; Chen Weisu; Gu Peiyi; Liu, Wen-Hsing; Wang, Shun-Min; Tsai, Chen-Han; Tsai, Ming-Jinn, E-mail: zhanglijie@ime.pku.edu.cn [Nanoelectronic Technology Division, Electronics and Optoelectronics Research Laboratories, Industrial Technology Research Institute (ITRI), Chutung, Hsinchu 31040, Taiwan (China)

    2011-06-24

    In this paper, reliability issues of robust HfO{sub x}-based RRAM are experimentally investigated in terms of cycling ageing, temperature impact and voltage acceleration. All reliability issues can be estimated by the conduction of the high resistance state (HRS). The conduction current of the HRS exponentially increases as the square root of the applied voltage, which is well explained by 'quasi-Poole-Frenkel-type' trap assistant tunneling. Further experiments on HRS conduction at different temperatures show that the depth of the potential well of the trap in HfO{sub x} film is about 0.31 eV. The degradation induced by the cycling ageing is possibly ascribed to the increase of the amount of oxygen ions in the TiO{sub x} layer of the TiN/TiO{sub x}/HfO{sub x}/TiN device. The retention times with various stress voltages at different temperatures also exhibit an exponential relationship to the square root of the applied voltage, indicating that stress current plays a dominant role for the degradation of the HRS. An oxygen-release model is proposed to explain the relationship of retention time to HRS conduction current.

  1. Phase imaging quality improvement by modification of AFM probes' cantilever.

    Science.gov (United States)

    Skibinski, J; Rebis, J; Kaczmarek, L; Wejrzanowski, T; Plocinski, T; Rozniatowski, K

    2017-08-16

    Imaging of the surface of materials by atomic force microscopy under tapping and phase imaging mode, with use of modified probes is addressed. In this study, the circularly shaped holes located in varying distance from the probe base, were cut out by focused ion beam. Such modification was a consequence of the results of the previous experiments (probe tip sharpening and cantilever thinning) where significant improvement of image quality in tapping and phase imaging mode has been revealed. The solution proposed herein gives similar results, but is much simpler from the technological point of view. Shorter exposition time of the tip onto gallium ions during FIB processing allows to reduce material degradation. The aim of this modification was to change harmonic oscillators' properties in the simplest and fastest way, to obtain stronger signal for higher resonant frequencies, which can be advantageous for improving the quality of imaging in PI mode. Probes shaped in that way were used for AFM investigations with Bruker AFM nanoscope 8. As a testing material, titanium roughness standard sample, supplied by Bruker, was used. The results have shown that the modifications performed within these studies influence the oscillation of the probes, which in some cases may result in deterioration of the imaging quality under tapping mode for one or both self-resonant frequencies. However, phase imaging results obtained using modified probes are of higher quality. The numerical simulations performed by application of finite element method were used to explain the results obtained experimentally. Phenomenon described within this study allows to apply developed modelling methodology for prediction of effects of various modifications on the probes' tip, and as a result, to predict how proposed modifications will affect AFM imaging quality. © 2017 The Authors Journal of Microscopy © 2017 Royal Microscopical Society.

  2. 19 CFR 206.44a - Special rules for conducting investigations under section 421(b) of the Trade Act.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Special rules for conducting investigations under... Disruption § 206.44a Special rules for conducting investigations under section 421(b) of the Trade Act. (a... COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS...

  3. Investigation of fracture conductivity under in situ conditions as a function of frac- and formation parameters

    Energy Technology Data Exchange (ETDEWEB)

    Meyn, V.; Lajcsak, I.

    1998-10-01

    Because of their low permeability, deep-lying gas fields are often developed by the fracturing technique. Essential for the economy of this measure is a high fracture conductivity which persists over a long period. The objective of the project was the investigation of the various factors influencing the fracture conductivity under reservoir conditions. Besides the breaking strength of proppants, which is decisive for the conductivity attainable at high confining pressure, the long-term stability, the embedment and the transport of fragments, which results in plugging, were examined. With the proppants Superprop and Carboprop HC, fracture conductivity exhibits only a slight dependence on the closure pressure. Transport of fragments and embedment play no important role. With resin-coated proppants, conductivity is not improved appreciably. The resin-coating doesn`t resist reservoir conditions. After only one week, aquathermolytic products were detected. (orig.) [Deutsch] Tiefliegende Erdgasfelder werden aufgrund ihrer niedrigen Permeabilitaet haeufig durch eine Frac-Behandlung erschlossen. Eine wesentliche Voraussetzung fuer die Wirtschaftlichkeit einer solchen Massnahme ist eine hohe Rissleitfaehigkeit, die ueber einen langen Zeitraum bestehen bleibt. Ziel des Projektes war die Untersuchung der verschiedenen Faktoren, die die Rissleitfaehigkeit unter Lagerstaettenbedingungen beeinflussen. Neben der Bruchfestigkeit des Stuetzmittels, die fuer die bei hohen Schliessdrucken erreichbaren Rissleitfaehigkeiten entscheidend ist, wurde die Langzeitstabilitaet, das Embedment und der zu Verstopfung fuehrende Transport von Bruchstuecken untersucht. Die Stuetzmittel Superprop und Carboprop HC weisen nur eine geringe Abhaengigkeit der Rissleitfaehigkeit vom Schliessdruck auf. Der Bruchstuecktransport sowie das Embedment spielen nur eine untergeordnete Rolle. Durch die Verwendung von beschichtetem Stuetzmittel wird die Rissleitfaehigkeit nicht wesentlich erhoeht. Die Beschichtung

  4. [An Investigation of the Role Responsibilities of Clinical Research Nurses in Conducting Clinical Trials].

    Science.gov (United States)

    Kao, Chi-Yin; Huang, Guey-Shiun; Dai, Yu-Tzu; Pai, Ya-Ying; Hu, Wen-Yu

    2015-06-01

    Clinical research nurses (CRNs) play an important role in improving the quality of clinical trials. In Taiwan, the increasing number of clinical trials has increased the number of practicing CRNs. Understanding the role responsibilities of CRNs is necessary to promote professionalism in this nursing category. This study investigates the role responsibilities of CRNs in conducting clinical trials / research. A questionnaire survey was conducted in a medical center in Taipei City, Taiwan. Eighty CRNs that were registered to facilitate and conduct clinical trials at this research site completed the survey. "Subject protection" was the CRN role responsibility most recognized by participants, followed by "research coordination and management", "subject clinical care", and "advanced professional nursing". Higher recognition scores were associated with higher importance scores and lower difficulty scores. Participants with trial training had significantly higher difficulty scores for "subject clinical care" and "research coordination and management" than their peers without this training (p role responsibilities" (p management" (p role responsibilities, explaining 21.9% of the total variance. To further promote CRN as a professional career in Taiwan, the findings of this study recommend identifying the core competences of CRNs and adding CRN-related study materials into the advanced nursing curriculum. Long-term and systematic educational training may help CRNs understand the importance of their role responsibilities, better recognize their professional role, and reflect these responsibilities in clinical practice.

  5. Experimental Investigation of Surface Layer Properties of High Thermal Conductivity Tool Steel after Electrical Discharge Machining

    Directory of Open Access Journals (Sweden)

    Rafał Świercz

    2017-12-01

    Full Text Available New materials require the use of advanced technology in manufacturing complex shape parts. One of the modern materials widely used in the tool industry for injection molds or hot stamping dies is high conductivity tool steel (HTCS 150. Due to its hardness (55 HRC and thermal conductivity at 66 W/mK, this material is difficult to machine by conventional treatment and is being increasingly manufactured by nonconventional technology such as electrical discharge machining (EDM. In the EDM process, material is removed from the workpiece by a series of electrical discharges that cause changes to the surface layers properties. The final state of the surface layer directly influences the durability of the produced elements. This paper presents the influence of EDM process parameters: discharge current Ic and the pulse time ton on surface layer properties. The experimental investigation was carried out with an experimental methodology design. Surface layers properties including roughness 3D parameters, the thickness of the white layer, heat affected zone, tempered layer and occurring micro cracks were investigated and described. The influence of the response surface methodology (RSM of discharge current Ic and the pulse time ton on the thickness of the white layer and roughness parameters Sa, Sds and Ssc were described and established.

  6. Experimental investigation of thermal conductivity coefficient and heat exchange between fluidized bed and inclined exchange surface

    Directory of Open Access Journals (Sweden)

    B. Stojanovic

    2009-06-01

    Full Text Available The paper presents experimental research of thermal conductivity coefficients of the siliceous sand bed fluidized by air and an experimental investigation of the particle size influence on the heat transfer coefficient between fluidized bed and inclined exchange surfaces. The measurements were performed for the specific fluidization velocity and sand particle diameters d p=0.3, 0.5, 0.9 mm. The industrial use of fluidized beds has been increasing rapidly in the past 20 years owing to their useful characteristics. One of the outstanding characteristics of a fluidized bed is that it tends to maintain a uniform temperature even with nonuniform heat release. On the basis of experimental research, the influence of the process's operational parameters on the obtained values of the bed's thermal conductivity has been analyzed. The results show direct dependence of thermal conductivity on the intensity of mixing, the degree of fluidization, and the size of particles. In the axial direction, the coefficients that have been treated have values a whole order higher than in the radial direction. Comparison of experimental research results with experimental results of other authors shows good agreement and the same tendency of thermal conductivity change. It is well known in the literature that the value of the heat transfer coefficient is the highest in the horizontal and the smallest in the vertical position of the heat exchange surface. Variation of heat transfer, depending on inclination angle is not examined in detail. The difference between the values of the relative heat transfer coefficient between vertical and horizontal heater position for all particle sizes reduces by approximately 15% with the increase of fluidization rate.

  7. Fractal analysis of AFM images of the surface of Bowman's membrane of the human cornea.

    Science.gov (United States)

    Ţălu, Ştefan; Stach, Sebastian; Sueiras, Vivian; Ziebarth, Noël Marysa

    2015-04-01

    The objective of this study is to further investigate the ultrastructural details of the surface of Bowman's membrane of the human cornea, using atomic force microscopy (AFM) images. One representative image acquired of Bowman's membrane of a human cornea was investigated. The three-dimensional (3-D) surface of the sample was imaged using AFM in contact mode, while the sample was completely submerged in optisol solution. Height and deflection images were acquired at multiple scan lengths using the MFP-3D AFM system software (Asylum Research, Santa Barbara, CA), based in IGOR Pro (WaveMetrics, Lake Oswego, OR). A novel approach, based on computational algorithms for fractal analysis of surfaces applied for AFM data, was utilized to analyze the surface structure. The surfaces revealed a fractal structure at the nanometer scale. The fractal dimension, D, provided quantitative values that characterize the scale properties of surface geometry. Detailed characterization of the surface topography was obtained using statistical parameters, in accordance with ISO 25178-2: 2012. Results obtained by fractal analysis confirm the relationship between the value of the fractal dimension and the statistical surface roughness parameters. The surface structure of Bowman's membrane of the human cornea is complex. The analyzed AFM images confirm a fractal nature of the surface, which is not taken into account by classical surface statistical parameters. Surface fractal dimension could be useful in ophthalmology to quantify corneal architectural changes associated with different disease states to further our understanding of disease evolution.

  8. Exploring the complex mechanical properties of xanthan scaffolds by AFM-based force spectroscopy

    Directory of Open Access Journals (Sweden)

    Hao Liang

    2014-03-01

    Full Text Available The polysaccharide xanthan has been extensively studied owing to its potential application in tissue engineering. In this paper, xanthan scaffold structures were investigated by atomic force microscope (AFM in liquid, and the mechanical properties of the complex xanthan structures were investigated by using AFM-based force spectroscopy (FS. In this work, three types of structures in the xanthan scaffold were identified based on three types of FS stretching events. The fact that the complex force responses are the combinations of different types of stretching events suggests complicated intermolecular interactions among xanthan fibrils. The results provide crucial information to understand the structures and mechanical properties of the xanthan scaffold.

  9. Investigation of the lithium ion mobility in cyclic model compounds and their ion conduction properties

    Energy Technology Data Exchange (ETDEWEB)

    Thielen, Joerg

    2011-07-27

    In view of both, energy density and energy drain, rechargeable lithium ion batteries outperform other present accumulator systems. However, despite great efforts over the last decades, the ideal electrolyte in terms of key characteristics such as capacity, cycle life, and most important reliable safety, has not yet been identified. Steps ahead in lithium ion battery technology require a fundamental understanding of lithium ion transport, salt association, and ion solvation within the electrolyte. Indeed, well defined model compounds allow for systematic studies of molecular ion transport. Thus, in the present work, based on the concept of immobilizing ion solvents, three main series with a cyclotriphosphazene (CTP), hexaphenylbenzene (HBP), and tetramethylcyclotetrasiloxane (TMS) scaffold were prepared. Lithium ion solvents, among others ethylene carbonate (EC), which has proven to fulfill together with propylene carbonate safety and market concerns in commercial lithium ion batteries, were attached to the different cores via alkyl spacers of variable length. All model compounds were fully characterized, pure and thermally stable up to at least 235 C, covering the requested broad range of glass transition temperatures from -78.1 C up to +6.2 C. While the CTP models tend to rearrange at elevated temperatures over time, which questions the general stability of alkoxide related (poly)phosphazenes, both, the HPB and CTP based models show no evidence of core stacking. In particular the CTP derivatives represent good solvents for various lithium salts, exhibiting no significant differences in the ionic conductivity {sigma}{sub dc} and thus indicating comparable salt dissociation and rather independent motion of cations and ions. In general, temperature-dependent bulk ionic conductivities investigated via impedance spectroscopy follow a William-Landel-Ferry (WLF) type behavior. Modifications of the alkyl spacer length were shown to influence ionic conductivities only in

  10. Sexual Abuse against Children. Preliminary Findings of the Investigation Conducted in May 2008, by Gallup Institute

    Directory of Open Access Journals (Sweden)

    SORIN M. RĂDULESCU

    2008-03-01

    Full Text Available Sexual abuse against minors has become in the last decades an important social issue for specialists in several countries, including Romania. Although sexual victimization rates in various countries appear to have declined beginning with 1993,there is still a greater probability for children and teenagers to suffer from sexual aggression rather than adults. Despite the increased preoccupation with the issue of sexual abuse against children and the new knowledge acquired in this field, several aspects have been left unsolved, among which that of the accuracy of data collected and underrepresented statistics. This study is a preliminary analysis of the main findings of the investigation conducted in May 2008, by the Gallup Institute, at the request of the Institute of Sociology of the Romanian Academy and whose object was, among others, sexual abuse against children in Romania.

  11. The memory effect of nanoscale memristors investigated by conducting scanning probe microscopy methods

    Directory of Open Access Journals (Sweden)

    César Moreno

    2012-11-01

    Full Text Available We report on the use of scanning force microscopy as a versatile tool for the electrical characterization of nanoscale memristors fabricated on ultrathin La0.7Sr0.3MnO3 (LSMO films. Combining conventional conductive imaging and nanoscale lithography, reversible switching between low-resistive (ON and high-resistive (OFF states was locally achieved by applying voltages within the range of a few volts. Retention times of several months were tested for both ON and OFF states. Spectroscopy modes were used to investigate the I–V characteristics of the different resistive states. This permitted the correlation of device rectification (reset with the voltage employed to induce each particular state. Analytical simulations by using a nonlinear dopant drift within a memristor device explain the experimental I–V bipolar cycles.

  12. Application of a model to investigate the effective thermal conductivity of randomly packed fusion pebble beds

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiaoliang; Zheng, Jie; Chen, Hongli, E-mail: hlchen1@ustc.edu.cn

    2016-05-15

    In our precious study, a prediction model, which calculates the effective thermal conductivity k{sub eff} of mono-sized pebble beds, has been developed and validated. Based on this model, here the effects of these influencing factors such as pebble size, thermal radiation, contact area, filling gas, gas flow, gas pressure, etc. on the k{sub eff} of randomly packed fusion pebble beds are studied and analyzed. The pebble beds investigated include Li{sub 4}SiO{sub 4}, Li{sub 2}ZrO{sub 3}, Li{sub 2}TiO{sub 3}, Li{sub 2}O, Be and BeO pebble beds. In the current study, many important and meaningful conclusions are derived and some of them are similar to the existing research results. Particularly, some critters that under which conditions the effect of some influencing factors can be neglected or should be considered are also presented.

  13. Influence of ionic liquid on pseudocapacitance performance of electrochemically synthesized conductive polymer: Electrochemical and theoretical investigation.

    Science.gov (United States)

    Ehsani, A; Kowsari, E; Dashti Najafi, M; Safari, R; Mohammad Shiri, H

    2017-08-15

    This study demonstrates a method for improving supercapacitive performance of electrochemically synthesized conductive polymer. In this regards, 1-Butyl-3-methyl imidazolium hexafluorophosphate (BI) as a new high efficient ionic liquid was synthesized using chemical approach and then fabricated POAP/BI films by electro-polymerization of POAP in the presence of BI to serve as the active electrode for electrochemical supercapacitor. Theoretical study (AIM) and electrochemical analysis have been used for characterization of ionic liquid and POAP/BI composite film. Different electrochemical methods including galvanostatic charge-discharge experiments, cyclic voltammetry and electrochemical impedance spectroscopy are carried out in order to investigate the performance of the system. This work introduces new most efficient materials for electrochemical redox capacitors with advantages including ease synthesis, high active surface area and stability in an aqueous electrolyte. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Investigation into conductivity of silver-coated cenosphere composites prepared by a modified electroless process

    Energy Technology Data Exchange (ETDEWEB)

    Cao Xiaoguo, E-mail: xgcao@gdut.edu.cn [School of Materials and Energy, Guangdong University of Technology, Guangzhou, Guangdong 510006 (China); Zhang Haiyan [School of Materials and Energy, Guangdong University of Technology, Guangzhou, Guangdong 510006 (China)

    2013-01-01

    Highlights: Black-Right-Pointing-Pointer In this paper we described a modified eletroless Ag-coating process on cenospheres. Black-Right-Pointing-Pointer The modified method makes the plating process more cost-saving and with less steps. Black-Right-Pointing-Pointer The relatively uniform and continuous silver coating is obtained. Black-Right-Pointing-Pointer The effects of silver coating on cenospheres on conductivity were investigated. - Abstract: Silver-coated cenosphere composites are successfully fabricated by a modified electroless plating process that is modified by replacing the conventional pretreatment and sensitization steps by only using surface hydroxylation step to simplify the steps and reduce the overall cost of the coating process. Furthermore, the activation and electroless plating steps are merged into one step. The cenosphere particles are characterized by scanning electron microscope (SEM), energy dispersive X-ray spectroscopy (EDX) and X-ray diffraction analysis (XRD) before and after the coating process. The relatively continuous and compact coating is obtained under the given coating conditions. The results indicated that the conductivity of Ag-coated cenospheres was improved with increasing the AgNO{sub 3} solution dosage and reaction time. It was also found that the optimum AgNO{sub 3} solution concentration was 0.05 mol/L, and the optimum range of reaction temperature was from 50 Degree-Sign C to 65 Degree-Sign C.

  15. First-principles investigations on ionization and thermal conductivity of polystyrene for inertial confinement fusion applications

    Science.gov (United States)

    Hu, S. X.; Collins, L. A.; Goncharov, V. N.; Kress, J. D.; McCrory, R. L.; Skupsky, S.

    2016-04-01

    Using quantum molecular-dynamics (QMD) methods based on the density functional theory, we have performed first-principles investigations of the ionization and thermal conductivity of polystyrene (CH) over a wide range of plasma conditions (ρ = 0.5 to 100 g/cm3 and T = 15 625 to 500 000 K). The ionization data from orbital-free molecular-dynamics calculations have been fitted with a "Saha-type" model as a function of the CH plasma density and temperature, which gives an increasing ionization as the CH density increases even at low temperatures (T hydrodynamics codes for inertial confinement fusion simulations, the QMD results show a large difference in the low-temperature regime in which strong coupling and electron degeneracy play an essential role in determining plasma properties. Hydrodynamic simulations of cryogenic deuterium-tritium targets with CH ablators on OMEGA and the National Ignition Facility using the QMD-derived ionization and thermal conductivity of CH have predicted ˜20% variation in target performance in terms of hot-spot pressure and neutron yield (gain) with respect to traditional model simulations.

  16. INVESTIGATIVE RESEARCH PROJECTS RELATED TO THE TOHOKU EARTHQUAKE (THE GREAT EAST JAPAN EARTHQUAKE) CONDUCTED IN FUKUSHIMA.

    Science.gov (United States)

    Yamamoto, Toshiyuki; Hashimoto, Yasuhiro; Yoshida, Masayuki; Ohno, Kikuo; Ohto, Hitoshi; Abe, Masafumi

    2015-01-01

    On March 11(th) 2011, the Tohoku region of Japan was struck by catastrophic disasters. Thousands of people were killed due to a magnitude 9.0 earthquake and its subsequent tsunami. Furthermore, a serious nuclear crisis occurred in Fukushima Prefecture as a result of the disasters, and an emergency evacuation was ordered to people living near the nuclear power plants. There was a lot of anxiety regarding lost families as well as the influences of radioactivity on the health of people and their children. Based on these urgent and uncertain situations, a number of research projects were developed at many institutes both inside and outside Fukushima. We herein report the investigative research projects related to the Tohoku Earthquake (The Great East Japan Earthquake) conducted after the disasters. The research projects were reviewed by the Institutional Review Board in Fukushima Medical University during the two years following the disasters. The research projects conducted in universities other than Fukushima Medical University were also examined using questionnaire analysis. Among the research projects conducted in Fukushima Medical University (n=424), 7% (n=32) were disaster-related investigative research. The mean duration planned to pursue the projects was 25.5 months. Among these projects, those focusing on the health of Fukushima citizens were most common (n=9), followed by the influence of chronic exposure of radiation on chronic inflammatory disorders (n=6), and the mental health of Fukushima citizens (n=5). They were carefully reviewed for the purpose, suitability, and necessity from ethical as well as scientific viewpoints. The majority of the research projects focused on the effects of the Tohoku Earthquake and/or chronic exposure to low-dose radioactivity on the health of children and pregnant women, as well as on various disorders, such as mental health and chronic inflammatory diseases. On the other hand, among 58 projects we collected from 22

  17. Comparison of different aminofunctionalization strategies for attachment of single antibodies to AFM cantilevers

    Energy Technology Data Exchange (ETDEWEB)

    Ebner, Andreas [Institute of Biophysics, University of Linz, 4040 Linz (Austria)], E-mail: andreas.ebner@jku.at; Hinterdorfer, Peter; Gruber, Hermann J. [Institute of Biophysics, University of Linz, 4040 Linz (Austria)

    2007-10-15

    Atomic force microscopy (AFM) has developed into a key technique for elucidation of biological systems on the single molecular level. In particular, molecular recognition force microscopy has proven to be a powerful tool for the investigation of biological interactions under near physiological conditions. For this purpose, ligands are tethered to AFM tips and the interaction forces with cognate receptors on the sample surface are measured with pico-Newton accuracy. In the first step of tip functionalization, amino groups are typically introduced on the initially inert AFM tip. Several methods have been developed to reproducibly adjust the desired low density of amino groups on the tip surface, i.e. esterification with ethanolamine, gas-phase silanization with aminopropyl-triethoxysilane (APTES), or treatment with aminophenyl-trimethoxysilane (APhS) in toluene solution. In the present study, the usefulness of these methods for attachments of antibodies to AFM tips was characterized by a standardized test system, in which biotinylated IgG was bound to the tip and a dense monolayer of avidin on mica served as test sample. All three methods of aminofunctionalization were found fully satisfactory for attachment of single antibodies to AFM tips, only in a parallel macroscopic assay on silicon nitride chips a minor difference was found in that APTES appeared to yield a slightly lower surface density of amino groups.

  18. A Study of Moisture Damage in Plastomeric Polymer Modified Asphalt Binder Using Functionalized AFM Tips

    Directory of Open Access Journals (Sweden)

    Rafiqul Tarefder

    2011-12-01

    Full Text Available In this study, moisture damage in plastomeric polymer modified asphalt binder is investigated using Atomic Force Microscopy (AFM with chemically functionalized AFM tips. Four different percentages of plastomeric polymers and two antistripping agents such as Kling Beta and Lime are used to modify a base asphalt binder. Chemical functional groups such as -COOH, -CH3, -NH3, and –OH, that are commonly present in plastomeric polymer modified asphalt system, are used to functionalize the AFM tips. The force distance mode of AFM is used to measure the adhesion forces between a modified asphalt sample surface and the functionalized AFM tips. This enables the measurement of adhesion within an asphalt binder system. It is shown that the adhesion force values in dry sample changed substantially from that in wet conditioned samples. It is evident from this study that plastomeric modification does not help reduce moisture damage in asphalt. The percentage change in adhesion forces due to moisture is about 20 nN for the lime modified samples, and about 50 nN for the Kling Beta modified samples. This indicates that lime is more effective than Kling Beta for reducing moisture damage in plastomeric polymer modified asphalt.

  19. AFM 4.0: a toolbox for DNA microarray analysis

    OpenAIRE

    Breitkreutz, Bobby-Joe; Jorgensen, Paul; Breitkreutz, Ashton; Tyers, Mike

    2001-01-01

    We have developed a series of programs, collectively packaged as Array File Maker 4.0 (AFM), that manipulate and manage DNA microarray data. AFM 4.0 is simple to use, applicable to any organism or microarray, and operates within the familiar confines of Microsoft Excel. Given a database of expression ratios, AFM 4.0 generates input files for clustering, helps prepare colored figures and Venn diagrams, and can uncover aneuploidy in yeast microarray data. AFM 4.0 should be especially useful to ...

  20. Investigations on an integrated conducting nanoparticle-liquid crystal elastomer layer

    Energy Technology Data Exchange (ETDEWEB)

    Chambers, Martin [J Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Zalar, Bostjan [J Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Remskar, Maja [J Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Kovac, Janez [J Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Finkelmann, Heino [Institute for Macromolecular Chemistry, University of Freiburg, Hermann-Staudinger-Haus, Stefan-Meier-Strasse 31, 79104, Freiburg (Germany); Zumer, Slobodan [J Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia)

    2007-10-17

    A process is outlined in which an existing liquid crystal elastomer (LCE) can be reprocessed from an insulating network to create an effectively conducting network. This is performed through the LCE volume expansion in a suitable solution containing conducting nanoparticles. Subsequent volume compression results in the formation of a conducting layer at the LCE surfaces. The swelling behaviour of the LCE is illustrated. Elemental composition analysis and electron imagining techniques show that the conducting layer is composed of conducting nanoparticles and LCE material. It was found that the integrated layer thickness and resistivity can be controlled through the LCE surface expansion ratio and conducting nanoparticle concentration, respectively.

  1. Local detection of X-ray spectroscopies with an in-situ AFM

    OpenAIRE

    Rodrigues, Mario; Dhez, Olivier; Le Denmat, Simon; Chevrier, Joël; Felici, Roberto; Comin, Fabio

    2008-01-01

    International audience; The in situ combination of Scanning Probe Microscopies (SPM) with X-ray microbeams adds a variety of new possibilities to the panoply of synchrotron radiation techniques. In this paper we describe an optics-free AFM/STM that can be directly installed on synchrotron radiation end stations for such combined experiments. The instrument can be used just for AFM imaging of the investigated sample or can be used for detection of photoemitted electrons with a sharp STM-like t...

  2. Investigating bioremediation of petroleum hydrocarbons through landfarming using apparent electrical conductivity measurements

    Science.gov (United States)

    Van De Vijver, Ellen; Van Meirvenne, Marc; Seuntjens, Piet

    2015-04-01

    Bioremediation of soil contaminated with petroleum hydrocarbons through landfarming has been widely applied commercially at large scale. Biodegradation is one of the dominant pollutant removal mechanisms involved in landfarming, but strongly depends on the environmental conditions (e.g. presence of oxygen, moisture content). Conventionally the biodegradation process is monitored by the installation of field monitoring equipment and repeated sample collection and analysis. Because the presence of petroleum hydrocarbons and their degradation products can affect the electrical properties of the soil, proximal soil sensors such as electromagnetic induction (EMI) sensors may provide an alternative to investigate the biodegradation process of these contaminants. We investigated the relation between the EMI-based apparent electrical conductivity (ECa) of a landfarm soil and the presence and degradation status of petroleum hydrocarbons. The 3 ha study area was located in an oil refinery complex contaminated with petroleum hydrocarbons, mainly composed of diesel. At the site, a landfarm was constructed in 1999. The most recent survey of the petroleum hydrocarbon concentrations was conducted between 2011 and 2013. The sampling locations were defined by a grid with a 10 m by 10 m cell size and on each location a sample was taken from four successive soil layers with a thickness of 0.5 m each. Because the survey was carried out in phases using different georeferencing methods, the final dataset suffered from uncertainty in the coordinates of the sampling locations. In September 2013 the landfarm was surveyed for ECa with a multi-receiver electromagnetic induction sensor (DUALEM-21S) using motorized conveyance. The horizontal measurement resolution was 1 m by 0.25 m. On each measurement location the sensor recorded four ECa values representative of measurement depths of 0.5 m, 1.0 m, 1.6 m and 3.2 m. After the basic processing, the ECa measurements were filtered to remove

  3. Investigation of the electrical conductivity and structurization of disperse-organic powdered titanium and silicon carbides

    Energy Technology Data Exchange (ETDEWEB)

    Zhigotskii, A.G.; Fomenko, E.B.; Deinega, Y.F. [Institute of Colloid Chemistry and Water Chemistry, Kiev (Ukraine)

    1995-05-01

    Disperse systems based on carbides of high melting metals are of considerable scientific and practical interest for the devising of new methods of obtaining them and extending their fields of application in various branches of engineering. Particularly important in this respect are carbide containing materials with anisotropic structure in whose formation electric fields, in addition to mechanical, thermal, chemical, and other technological factors, may play an important, if not the decisive role. Here the authors present the results of the investigation of the electrical conductivity of disperse micropowders of TiC and SiC in vaseline oil and in polyester, and also in processes of their structurization in an electric field. According to the data of sedimentographic analysis the mean particle size of powdered titanium carbide marque KTM (TU 88 USSR 147.012-71) and of silicon carbide (OST 71-1-82) was 5-7 {mu}m. To remove the iron whose content did not exceed 0.5 and 0.3 (wt.)%, respectively, the powdered carbides were treated with hydrochloric acid, and then with distilled water.

  4. Altered hemodynamic activity in conduct disorder: a resting-state FMRI investigation.

    Directory of Open Access Journals (Sweden)

    Jiansong Zhou

    Full Text Available Youth with conduct disorder (CD not only inflict serious physical and psychological harm on others, but are also at greatly increased risk of sustaining injuries, developing depression or substance abuse, and engaging in criminal behaviors. The underlying neurobiological basis of CD remains unclear.The present study investigated whether participants with CD have altered hemodynamic activity under resting-state conditions.Eighteen medication-naïve boys with CD and 18 age- and sex- matched typically developing (TD controls underwent functional magnetic resonance imaging (MRI scans in the resting state. The amplitude of low-frequency fluctuations (ALFF was measured and compared between the CD and TD groups.Compared with the TD participants, the CD participants showed lower ALFF in the bilateral amygdala/parahippocampus, right lingual gyrus, left cuneus and right insula. Higher ALFF was observed in the right fusiform gyrus and right thalamus in the CD participants compared to the TD group.Youth with CD displayed widespread functional abnormalities in emotion-related and visual cortical regions in the resting state. These results suggest that deficits in the intrinsic activity of resting state networks may contribute to the etiology of CD.

  5. Nonwoven production from agricultural okra wastes and investigation of their thermal conductivities

    Science.gov (United States)

    Duman, M. N.; Kocak, E. D.; Merdan, N.; Mistik, I.

    2017-10-01

    Nowadays bio-based composite materials have been used in rising amounts and demanded widely in industrial uses, as they provide cost reduction and weight loss in the end use products. Agricultural cellulose based wastes can be a good alternative to synthetic fibers and can be used in natural fiber reinforced composite production, as there is a huge (more than 40 million tons) potential for natural cellulose production from agricultural wastes. Okra is one of the most grown vegetables around the world with stems left on the fields after harvest. When the similarity of mechanical properties of okra fibers with traditional bast fibers (flax, kenaf, hemp) are considered, from an economical and an environmental point of view this research emphasizes the potential of agricultural biomass for natural fiber production. In this study, okra stem wastes used for natural cellulosic fiber production and treated with 10% NaOH at 60°C for 10, 20, 30 and 40 minutes. By alkali treatment, decrease in fiber diameter and weight, and increase in tensile strength and elongation % have been observed. Nonwoven production has been done from both the fibers with and without surface treatments. Thermal conductivity properties of both nonwovens have been investigated.

  6. Investigating H (hydrogen) self-diffusion in olivine and upper mantle electrical conductivity

    Science.gov (United States)

    Novella, D.; Du Frane, W. L.; Jacobsen, B.; Weber, P. K.; Ryerson, F. J.; Tyburczy, J. A.

    2016-12-01

    Considerable amounts of H2O could be present deep within Earth's interior, where H (hydrogen) atoms can enter natural minerals as defect in their nominally anhydrous structures. Up to several wt.% H2O have been observed in natural minerals that were originally formed in the deep mantle and brought to the surface through volcanic eruptions. The range of observed H2O contents in mantle minerals collected at Earth's surfaces would drastically influence the physical and chemical properties of mantle material. As a consequence, hydrogen has likely played a critical role in the evolution of the Earth, its atmosphere and the oceans. H2O contained in upwelling plumes and downwelling slabs complete a potentially deep water cycle between Earth's mantle and oceans. Such a cycle would traverse through the upper mantle, where H diffusion through the predominant mineral olivine would control its transport and distribution. Chemical diffusion (diffusion due to a chemical gradient) in olivine has been widely investigated over the past few decades, but only limited data have been reported on self-diffusion (the intrinsic transport of H in the mineral structure). This gap in information needs to be investigated more extensively to fully understand how H2O transports throughout the mantle. We will discuss results of H self-diffusion in San Carlos olivine single crystal that were obtained in experiments performed at high-pressure and high-temperature using a piston cylinder apparatus, reproducing conditions encountered in the deep upper mantle. H self-diffusion coefficients were investigated by tracking deuterium diffusion profiles in oriented, single crystals of olivine that were saturated by hydrogen. Diffusion coefficients along the 3 principal orientation of olivine are highly anisotropic, with an over 1 order of magnitude difference between the `fast' [100], and the `slower' [010] and [001] orientations. Diffusion coefficients are used to calculate a substantial contribution of

  7. Helium ion beam induced growth of hammerhead AFM probes

    NARCIS (Netherlands)

    Nanda, G.; Van Veldhoven, E.; Maas, D.; Sadeghian, H.; Alkemade, P.F.A.

    2015-01-01

    The authors report the direct-write growth of hammerhead atomic force microscope(AFM) probes by He+beam induced deposition of platinum-carbon. In order to grow a thin nanoneedle on top of a conventional AFM probe, the authors move a focused He+beam during exposure to a PtC precursor gas. In the

  8. Simultaneous AFM nano-patterning and imaging for photomask repair

    NARCIS (Netherlands)

    Keyvani, A.; Tamer, M.S.; Es, M.H. van; Sadeghian Marnani, H.

    2016-01-01

    In this paper we present a new AFM based nano-patterning technique that can be used for fast defect repairing of high resolution photomasks and possibly other high-speed nano-patterning applications. The proposed method works based on hammering the sample with tapping mode AFM followed by wet

  9. Dicty_cDB: AFM127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFM127 (AFM127Q) /...3 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ346853 ) Dictyostelium...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54HY4) RecName: Full=Putative

  10. Structural and Mechanical Mechanisms of Ocular Tissues Probed by AFM

    Science.gov (United States)

    Ziebarth, Noël M.; Rico, Felix; Moy, Vincent T.

    In recent years, the atomic force microscope (AFM) has become an important tool in ophthalmic research. It has gained popularity largely because AFM is not restricted by the diffraction limits of light microscopy and can be applied to resolve images with molecular resolution. AFM is a minimally invasive technique and can be used to visualize molecular structures under near-physiological conditions. In addition, the AFM can be employed as a force apparatus to characterize the viscoelastic properties of biomaterials on the micron level and at the level of individual proteins. In this article, we summarize recent AFM studies of ocular tissues, while highlighting the great potential of AFM technology in ophthalmic research. Previous research demonstrates the versatility of the AFM as high resolution imaging technique and as a sensitive force apparatus for probing the mechanical properties of ocular tissues. The structural and mechanical properties of ocular tissues are of major importance to the understanding of the optomechanical functions of the human eye. In addition, AFM has played an important role in the development and characterization of ocular biomaterials, such as contact lenses and intraocular lenses. Studying ocular tissues using Atomic Force Microscopy has enabled several advances in ophthalmic research.

  11. Ultra thin films of nanocrystalline Ge studied by AFM and ...

    Indian Academy of Sciences (India)

    Initial growth stages of the ultra thin films of germanium (Ge) prepared by ion beam sputter deposition have been studied using atomic force microscope (AFM) and interference enhanced Raman scattering. The growth of the films follows Volmer-Weber growth mechanism. Analysis of the AFM images shows that Ostwald ...

  12. Helium ion beam induced growth of hammerhead AFM probes

    NARCIS (Netherlands)

    Nanda, G.; Veldhoven, E. van; Maas, D.J.; Sadeghian Marnani, H.; Alkemade, P.F.A.

    2015-01-01

    The authors report the direct-write growth of hammerhead atomic force microscope (AFM) probes by He+ beam induced deposition of platinum-carbon. In order to grow a thin nanoneedle on top of a conventional AFM probe, the authors move a focused He+ beam during exposure to a PtC precursor gas. In the

  13. High-stress study of bioinspired multifunctional PEDOT:PSS/nanoclay nanocomposites using AFM, SEM and numerical simulation

    Directory of Open Access Journals (Sweden)

    Alfredo J. Diaz

    2017-10-01

    Full Text Available Bioinspired design has been central in the development of hierarchical nanocomposites. Particularly, the nacre-mimetic brick-and-mortar structure has shown excellent mechanical properties, as well as gas-barrier properties and optical transparency. Along with these intrinsic properties, the layered structure has also been utilized in sensing devices. Here we extend the multifunctionality of nacre-mimetics by designing an optically transparent and electron conductive coating based on PEDOT:PSS and nanoclays Laponite RD and Cloisite Na+. We carry out extensive characterization of the nanocomposite using transmittance spectra (transparency, conductive atomic force microscopy (conductivity, contact-resonance force microscopy (mechanical properties, and SEM combined with a variety of stress-strain AFM experiments and AFM numerical simulations (internal structure. We further study the nanoclay’s response to the application of pressure with multifrequency AFM and conductive AFM, whereby increases and decreases in conductivity can occur for the Laponite RD composites. We offer a possible mechanism to explain the changes in conductivity by modeling the coating as a 1-dimensional multibarrier potential for electron transport, and show that conductivity can change when the separation between the barriers changes under the application of pressure, and that the direction of the change depends on the energy of the electrons. We did not observe changes in conductivity under the application of pressure with AFM for the Cloisite Na+ nanocomposite, which has a large platelet size compared with the AFM probe diameter. No pressure-induced changes in conductivity were observed in the clay-free polymer either.

  14. Investigation of the electrical characteristics of electrically conducting yarns and fabrics

    Science.gov (United States)

    Akbarov, R. D.; Baymuratov, B. H.; Akbarov, D. N.; Ilhamova, M.

    2017-11-01

    Electro-conductive textile materials and products are used presently giving solutions to the problems, related to static electricity, electromagnetic shielding and electromagnetic radiation. Thus a study of their electro-physical characteristics, character of conductivity, possibility of forecasting of electric parameters etc has a substantial value. This work shows the possibility of production electro-conducting textile materials with stable anti-static properties by introduction of electro-conducting yarn into the structure of fabrics. The results of the research, directed to the study of the electro-physical characteristics of electroconducting yarn and fabrics, are influenced by the frequent washing of polyester fabrics containing the different amounts of electro-conducting filaments in the composition. This article reviews the results of the related research, of the electrical characteristics of the yarn and fabric, of the effect of multiple water treatments on the electrical properties of polyester fabrics, containing in their composition different amounts of electrically conductive yarns.

  15. Evaluation of the Air Force Office of Special Investigations Conduct of Internet Based Operations and Investigations (REDACTED)

    Science.gov (United States)

    2016-04-25

    transfer of computer files containing child pornography and (b) investigations concerning the use of the Internet for solicitation of a minor (under the...law enforcement agencies in the realm of the investigation of P2P file transfers of child pornography and the solicitation of minors for sexual...depicting the sexual exploitation of minors, and the heightened online activity by predators searching for unsupervised contact with underage

  16. Strength analysis of a ferrite+bainite steel by AFM ultra-micro hardness tester; AFM chobisho katasa shiken ni yoru ferrite+bainite ko no kyodo kaiseki

    Energy Technology Data Exchange (ETDEWEB)

    Nagashima, N.; Miyahara, K.; Matsuoka, S.; Tsuzaki, K.; Hara, T.; Takahashi, T. [National Research Institute for Metals, Tsukuba (Japan)

    2000-12-01

    AFM ultra-micro hardness test, micro Vickers hardness test and TEM observation were conducted for a ferrite+bainite steel, which consists of bainite and polygonal ferrite. The results obtained are in the following. (1) AFM ultra-micro hardness tests show that nanoscopic hardness is 155 near the center of bainitic ferrite grain and increases closer to its boundary. Nanoscopic hardness is kept constant at 151 in the polygonal ferrite grain. (2) Micro-Vickers hardness tests show that macroscopic hardness is 251 and 147 for the bainite and polygonal ferrite regions, respectively. (3) TEM observations show that many carbides precipitated along the grain boundaries of bainitic ferrite and the dislocation density was almost same in both grains of bainitic and polygonal ferrite. It is suggested from the above results that the strengthening by grain boundaries is important in the bainitic ferrite and this strengthening effect is enhanced by carbides along grain boundaries. (author)

  17. Investigations on d.c. conductivity behaviour of milled carbon fibre ...

    Indian Academy of Sciences (India)

    Wintec

    plaining the kinematics of its formation and development of the boundaries of the domain for its existence (Be- loshenko et al 2002a,b). Conduction process in .... moving, which makes the movement of charge carriers easy and hence they take place in conduction process after release from traps. This observation is very ...

  18. The conductivity of Bi(111) investigated with nanoscale four point probes

    DEFF Research Database (Denmark)

    Wells, J.W.; Handrup, K.; Kallehauge, J.F.

    2008-01-01

    The room temperature conductance of Bi(111) was measured using microscopic four point probes with a contact spacing down to 500 nm. The conductance is remarkably similar to that of the bulk, indicating that surface scattering is not a major mechanism for restricting the mobility at this length...

  19. Investigation of the electrical conductivity of propylene glycol-based ZnO nanofluids.

    Science.gov (United States)

    White, Steven Bryan; Shih, Albert Jau-Min; Pipe, Kevin Patrick

    2011-04-19

    Electrical conductivity is an important property for technological applications of nanofluids that has not been widely studied. Conventional descriptions such as the Maxwell model do not account for surface charge effects that play an important role in electrical conductivity, particularly at higher nanoparticle volume fractions. Here, we perform electrical characterizations of propylene glycol-based ZnO nanofluids with volume fractions as high as 7%, measuring up to a 100-fold increase in electrical conductivity over the base fluid. We observe a large increase in electrical conductivity with increasing volume fraction and decreasing particle size as well as a leveling off of the increase at high volume fractions. These experimental trends are shown to be consistent with an electrical conductivity model previously developed for colloidal suspensions in salt-free media. In particular, the leveling off of electrical conductivity at high volume fractions, which we attribute to counter-ion condensation, represents a significant departure from the "linear fit" models previously used to describe the electrical conductivity of nanofluids.

  20. Investigation of the electrical conductivity of propylene glycol-based ZnO nanofluids

    Directory of Open Access Journals (Sweden)

    White Steven

    2011-01-01

    Full Text Available Abstract Electrical conductivity is an important property for technological applications of nanofluids that has not been widely studied. Conventional descriptions such as the Maxwell model do not account for surface charge effects that play an important role in electrical conductivity, particularly at higher nanoparticle volume fractions. Here, we perform electrical characterizations of propylene glycol-based ZnO nanofluids with volume fractions as high as 7%, measuring up to a 100-fold increase in electrical conductivity over the base fluid. We observe a large increase in electrical conductivity with increasing volume fraction and decreasing particle size as well as a leveling off of the increase at high volume fractions. These experimental trends are shown to be consistent with an electrical conductivity model previously developed for colloidal suspensions in salt-free media. In particular, the leveling off of electrical conductivity at high volume fractions, which we attribute to counter-ion condensation, represents a significant departure from the "linear fit" models previously used to describe the electrical conductivity of nanofluids.

  1. Phase shifting-based debris effect detection in USV-assisted AFM nanomachining

    Science.gov (United States)

    Shi, Jialin; Liu, Lianqing; Yu, Peng; Cong, Yang; Li, Guangyong

    2017-08-01

    Atomic force microscopy (AFM) mechanical-based lithography attracts much attention in nanomanufacturing due to its advantages of low cost, high precision and high resolution. However, debris effects during mechanical lithography often lead to an unstable machining process and inaccurate results, which limits further applications of AFM-based lithography. There is a lack of a real-time debris detection approach, which is the prerequisite to eventually eliminating the influence of the debris, and of a method that can solve the above problems well. The ultrasonic vibration (USV)-assisted AFM has the ability to sense the machining depth in real time by detecting the phase shifting of cantilever. However, whether the pile-up of debris affect the phase response of cantilever is still lack of investigation. Therefore, we analyzed the mechanism of the debris effect on force control mode and investigated the relationship between phase shifting and pile-up of debris. Theoretical analysis and experimental results reveal that the pile-up of debris have negligible effect on phase shifting of cantilever. Therefore, the phase shifting-based method can detect the debris effect on machining depth in force control mode of AFM machining.

  2. Subtask 1.8 - Investigation of Improved Conductivity and Proppant Applications in the Bakken Formation

    Energy Technology Data Exchange (ETDEWEB)

    Bethany Kurz; Darren Schmidt; Steven Smith Christopher Beddoe; Corey Lindeman; Blaise Mibeck

    2012-07-31

    Given the importance of hydraulic fracturing and proppant performance for development of the Bakken and Three Forks Formations within the Williston Basin, a study was conducted to evaluate the key factors that may result in conductivity loss within the reservoirs. Various proppants and reservoir rock cores were exposed to several different fracturing and formation fluids at reservoir conditions. The hardness of the rock cores and the strength of the proppants were evaluated prior to and following fluid exposure. In addition, the conductivity of various proppants, as well as formation embedment and spalling, was evaluated at reservoir temperatures and pressures using actual reservoir rock cores. The results of this work suggest that certain fluids may affect both rock and proppant strength, and therefore, fluid exposure needs to be considered in the field. In addition, conductivity decreases within the Bakken Formation appear to be a function of a variety of factors, including proppant and rock strength, as well as formation embedment and spalling. The results of this study highlight the need for advanced conductivity testing, coupled with quantification of formation embedment and spalling. Given the importance of proppant performance on conductivity loss and, ultimately, oil recovery, better understanding the effects of these various factors on proppant and rock strength in the field is vital for more efficient production within unconventional oil and gas reservoirs.

  3. Groundwater redox conditions and conductivity in a contaminant plume from geoelectrical investigations

    Directory of Open Access Journals (Sweden)

    V. Naudet

    2004-01-01

    Full Text Available Accurate mapping of the electrical conductivity and of the redox potential of the groundwater is important in delineating the shape of a contaminant plume. A map of redox potential in an aquifer is indicative of biodegradation of organic matter and of concentrations of redox-active components; a map of electrical conductivity provides information on the mineralisation of the groundwater. Both maps can be used to optimise the position of pumping wells for remediation. The self-potential method (SP and electrical resistivity tomography (ERT have been applied to the contaminant plume associated with the Entressen landfill in south-east France. The self-potential depends on groundwater flow (electrokinetic contribution and redox conditions ('electro-redox' contribution. Using the variation of the piezometric head in the aquifer, the electrokinetic contribution is removed from the SP signals. A good linear correlation (R2=0.85 is obtained between the residual SP data and the redox potential values measured in monitoring wells. This relationship is used to draw a redox potential map of the overall contaminated site. The electrical conductivity of the subsoil is obtained from 3D-ERT analysis. A good linear correlation (R2=0.91 is observed between the electrical conductivity of the aquifer determined from the 3D-ERT image and the conductivity of the groundwater measured in boreholes. This indicates that the formation factor is nearly homogeneous in the shallow aquifer at the scale of the ERT. From this correlation, a map of the pore water conductivity of the aquifer is obtained. Keywords: self-potential, redox potential, electrical resistivity tomography, fluid conductivity, contaminant plume

  4. Investigation of conductive thermal control coatings by a contactless method in vacuo

    Science.gov (United States)

    Viehmann, W.; Shai, C. M.; Sanford, E. L.

    1977-01-01

    A technique for determining the conductance per unit area of thermal control coatings for electrostatically clean spacecraft is described. In order to simulate orbital conditions more closely, current-density-voltage (j-V) curves are obtained by a contactless method in which the paint on an aluminum substrate is the anode of a vacuum diode configuration with a tungsten filament cathode. Conductances per unit area which satisfy the International Sun Earth Explorer (ISEE) requirement were observed on black paints containing carbon and in white and green paints filled with zinc oxide which were fired in order to induce defect conductivity. Because of surface effects and the nonhomogeneous nature of paints, large discrepancies were found between measurements with the contactless method and measurements employing metallic contacts, particularly at low current densities. Therefore, measurements with metallic contacts are considered to be of questionable value in deciding the suitability of coatings for electrostatic charge control.

  5. Groundwater redox conditions and conductivity in a contaminant plume from geoelectrical investigations

    Science.gov (United States)

    Naudet, V.; Revil, A.; Rizzo, E.; Bottero, J.-Y.; Bégassat, P.

    Accurate mapping of the electrical conductivity and of the redox potential of the groundwater is important in delineating the shape of a contaminant plume. A map of redox potential in an aquifer is indicative of biodegradation of organic matter and of concentrations of redox-active components; a map of electrical conductivity provides information on the mineralisation of the groundwater. Both maps can be used to optimise the position of pumping wells for remediation. The self-potential method (SP) and electrical resistivity tomography (ERT) have been applied to the contaminant plume associated with the Entressen landfill in south-east France. The self-potential depends on groundwater flow (electrokinetic contribution) and redox conditions ("electro-redox" contribution). Using the variation of the piezometric head in the aquifer, the electrokinetic contribution is removed from the SP signals. A good linear correlation (R2=0.85) is obtained between the residual SP data and the redox potential values measured in monitoring wells. This relationship is used to draw a redox potential map of the overall contaminated site. The electrical conductivity of the subsoil is obtained from 3D-ERT analysis. A good linear correlation (R2=0.91) is observed between the electrical conductivity of the aquifer determined from the 3D-ERT image and the conductivity of the groundwater measured in boreholes. This indicates that the formation factor is nearly homogeneous in the shallow aquifer at the scale of the ERT. From this correlation, a map of the pore water conductivity of the aquifer is obtained.

  6. Nonlinear Dynamical analysis of an AFM tapping mode microcantilever beam

    Directory of Open Access Journals (Sweden)

    Choura S.

    2012-07-01

    Full Text Available We focus in this paper on the modeling and dynamical analysis of a tapping mode atomic force microscopy (AFM microcantilever beam. This latter is subjected to a harmonic excitation of its base displacement and to Van der Waals and DMT contact forces at its free end. For AFM design purposes, we derive a mathematical model for accurate description of the AFM microbeam dynamics. We solve the resulting equations of motions and associated boundary conditions using the Galerkin method. We find that using one-mode approximation in tapping mode operating in the neighborhood of the contact region one-mode approximation may lead to erroneous results.

  7. Regiochemistry of Poly(3-Hexylthiophene): Synthesis and Investigation of a Conducting Polymer

    Science.gov (United States)

    Pappenfus, Ted M.; Hermanson, David L.; Kohl, Stuart G.; Melby, Jacob H.; Thoma, Laura M.; Carpenter, Nancy E.; Filho, Demetrio A. da Silva; Bredas, Jean-Luc

    2010-01-01

    A series of experiments for undergraduate laboratory courses (e.g., organic, polymer, inorganic) have been developed. These experiments focus on understanding the regiochemistry of the conducting polymer poly(3-hexylthiophene) (P3HT). The substitution patterns in P3HTs control their conformational features, which, in turn, dictates the [pi]…

  8. Investigations on Thermal Conductivities of Jute and Banana Fiber Reinforced Epoxy Composites

    Science.gov (United States)

    Pujari, Satish; Ramakrishna, Avasarala; Balaram Padal, Korabu Tulasi

    2017-04-01

    The Jute and Banana fibers are used as reinforcement in epoxy resin matrix for making partially green biodegradable material composite via hand lay-up technique. The thermal conductivity of the jute fiber epoxy composites and banana fiber epoxy composites at different volume fraction of the fiber is determined experimentally by using guarded heat flow meter method. The experimental results had shown that thermal conductivity of the composites decrease with an increase in the fiber content. Experimental results are compared with theoretical models (Series model, Hashin model and Maxwell model) to describe the variation of the thermal conductivity versus the volume fraction of the fiber. Good agreement between theoretical and experimental results is observed. Thermal conductivity of Banana fiber composite is less when compared to that of Jute composite which indicates banana is a good insulator and also the developed composites can be used as insulating materials in building, automotive industry and in steam pipes to save energy by reducing rate of heat transfer.

  9. Reliability investigations on LIFT-printed isotropic conductive adhesive joints for system-in-foil applications

    NARCIS (Netherlands)

    Sridhar, A.; Perinchery, S.M.; Smits, E.C.P.; Mandamparambil, R.; Brand, J. van den

    2015-01-01

    The reliability of a commercially available isotropic conductive adhesive (ICA) deposited via laser induced forward transfer (LIFT) printing is reported. ICAs are particularly important for surfacemount device (SMD) integration onto low-cost, large-area system-in-foil (SiF) applications such as

  10. Using a Web Application to Conduct and Investigate Syntheses of Methyl Orange Remotely

    NARCIS (Netherlands)

    van Rens, L.; van Dijk, H.; Mulder, J.; Nieuwland, P

    2013-01-01

    Thirty-six pre-university chemistry students and two chemistry teachers used flow chemistry as a technology for the synthesis of methyl orange. FutureChemistry and VU University Amsterdam cooperatively created FlowStart Remote, a device that enabled the students to remotely conduct this synthesis

  11. Tasers and Community Controversy: Investigating Training Officer Perceptions of Public Concern over Conducted Energy Weapons

    Science.gov (United States)

    De Angelis, Joseph; Wolf, Brian

    2013-01-01

    Over the last several decades, "Tasers," "stun guns" and other conducted energy devices (CEDs) have become a widely adopted, though publicly controversial, form of police restraint technology. While there is a growing body of research on the physiological effects of these types of weapons, less attention has been devoted to the…

  12. Using a Web Application to Conduct and Investigate Syntheses of Methyl Orange Remotely

    Science.gov (United States)

    van Rens, Lisette; van Dijk, Hans; Mulder, Jan; Nieuwland, Pieter

    2013-01-01

    Thirty-six pre-university chemistry students and two chemistry teachers used flow chemistry as a technology for the synthesis of methyl orange. FutureChemistry and VU University Amsterdam cooperatively created FlowStart Remote, a device that enabled the students to remotely conduct this synthesis and in real time monitor and control the device via…

  13. Effective AFM cantilever tip size: methods for in-situ determination

    Science.gov (United States)

    Maragliano, Carlo; Glia, Ayoub; Stefancich, Marco; Chiesa, Matteo

    2015-01-01

    In atomic force microscopy (AFM) investigations, knowledge of the cantilever tip radius R is essential for the quantitative interpretation of experimental observables. Here we propose two techniques to rapidly quantify in-situ the effective tip radius of AFM probes. The first method is based on the strong dependency of the minimum value of the free amplitude required to observe a sharp transition from attractive to repulsive force regimes on the AFM probe radius. Specifically, the sharper the tip, the smaller the value of free amplitude required to observe such a transition. The key trait of the second method is to treat the tip-sample system as a capacitor. Provided with an analytical model that takes into account the geometry of the tip-sample’s capacitance, one can quantify the effective size of the tip apex fitting the experimental capacitance versus distance curve. Flowchart-like algorithms, easily implementable on any hardware, are provided for both methods, giving a guideline to AFM practitioners. The methods’ robustness is assessed over a wide range of probes of different tip radii R (i.e. 4 microscopy images. Our observations show that while both methods are reliable and robust over the range of tip sizes tested, the critical amplitude method is more accurate for relatively sharp tips (4 nm < R < 10 nm).

  14. Investigation of subauroral ion drifts and related field-aligned currents and ionospheric Pedersen conductivity distribution

    Directory of Open Access Journals (Sweden)

    S. Figueiredo

    2004-03-01

    Full Text Available Based on Astrid-2 satellite data, results are presented from a statistical study on subauroral ion drift (SAID occurrence. SAID is a subauroral phenomenon characterized by a westward ionospheric ion drift with velocity greater than 1000m/s, or equivalently, by a poleward-directed electric field with intensity greater than 30mV/m. SAID events occur predominantly in the premidnight sector, with a maximum probability located within the 20:00 to 23:00 MLT sector, where the most rapid SAID events are also found. They are substorm related, and show first an increase in intensity and a decrease in latitudinal width during the expansion phase, followed by a weakening and widening of the SAID structures during the recovery phase. The potential drop across a SAID structure is seen to remain roughly constant during the recovery phase. The field-aligned current density and the height-integrated Pedersen conductivity distribution associated with the SAID events were calculated. The results reveal that the strongest SAID electric field peaks are associated with the lowest Pedersen conductivity minimum values. Clear modifications are seen in the ionospheric Pedersen conductivity distribution associated with the SAID structure as time evolves: the SAID peak is located on the poleward side of the corresponding region of reduced Pedersen conductivity; the shape of the regions of reduced conductivity is asymmetric, with a steeper poleward edge and a more rounded equatorward edge; the SAID structure becomes less intense and widens with evolution of the substorm recovery phase. From the analysis of the SAID occurrence relative to the mid-latitude trough position, SAID peaks are seen to occur relatively close to the corresponding mid-latitude trough minimum. Both these features show a similar response to magnetospheric disturbances, but on different time scales - with increasing magnetic activity, the SAID structure shows a faster movement towards lower latitudes

  15. Nonlinear Phenomena in the Single-Mode Dynamics in an AFM Cantilever Beam

    KAUST Repository

    Ruzziconi, Laura

    2016-12-05

    This study deals with the nonlinear dynamics arising in an atomic force microscope cantilever beam. After analyzing the static behavior, a single degree of freedom Galerkin reduced order model is introduced, which describes the overall scenario of the structure response in a neighborhood of the primary resonance. Extensive numerical simulations are performed when both the forcing amplitude and frequency are varied, ranging from low up to elevated excitations. The coexistence of competing attractors with different characteristics is analyzed. Both the non-resonant and the resonant behavior are observed, as well as ranges of inevitable escape. Versatility of behavior is highlighted, which may be attractive in applications. Special attention is devoted to the effects of the tip-sample separation distance, since this aspect is of fundamental importance to understand the operation of an AFM. We explore the metamorphoses of the multistability region when the tip-sample separation distance is varied. To have a complete description of the AFM response, comprehensive behavior charts are introduced to detect the theoretical boundaries of appearance and disappearance of the main attractors. Also, extensive numerical simulations investigate the AFM response when both the forcing amplitude and the tip-sample separation distance are considered as control parameters. The main features are analyzed in detail and the obtained results are interpreted in terms of oscillations of the cantilever-tip ensemble. However, we note that all the aforementioned results represent the limit when disturbances are absent, which never occurs in practice. Here comes the importance of overcoming local investigations and exploring dynamics from a global perspective, by introducing dynamical integrity concepts. To extend the AFM results to the practical case where disturbances exist, we develop a dynamical integrity analysis. After performing a systematic basin of attraction analysis, integrity

  16. Investigations for Thermal and Electrical Conductivity of ABS-Graphene Blended Prototypes.

    Science.gov (United States)

    Singh, Rupinder; Sandhu, Gurleen S; Penna, Rosa; Farina, Ilenia

    2017-07-31

    The thermoplastic materials such as acrylonitrile-butadiene-styrene (ABS) and Nylon have large applications in three-dimensional printing of functional/non-functional prototypes. Usually these polymer-based prototypes are lacking in thermal and electrical conductivity. Graphene (Gr) has attracted impressive enthusiasm in the recent past due to its natural mechanical, thermal, and electrical properties. This paper presents the step by step procedure (as a case study) for development of an in-house ABS-Gr blended composite feedstock filament for fused deposition modelling (FDM) applications. The feedstock filament has been prepared by two different methods (mechanical and chemical mixing). For mechanical mixing, a twin screw extrusion (TSE) process has been used, and for chemical mixing, the composite of Gr in an ABS matrix has been set by chemical dissolution, followed by mechanical blending through TSE. Finally, the electrical and thermal conductivity of functional prototypes prepared from composite feedstock filaments have been optimized.

  17. Investigation of the electronic properties and morphology of conducting polymer electrodes for engineering applications

    Energy Technology Data Exchange (ETDEWEB)

    Landeros, J. Jr.; Pizzo, P.; Cantow, M. [San Jose State Univ., CA (United States). Dept. of Materials Engineering; Uribe, F. [Los Alamos National Lab., NM (United States)

    1995-02-01

    We evaluate the performance of the conducting polymers, polyaniline (PAni) and poly-3-(4-fluorophenyl)-thiophene (PFPT), as the active material in electrochemical capacitors. Using scanning electron microscopy and cyclic voltammetry, the morphology and charge/discharge characteristics of the as-grown polymers were studied under different electrochemical conditions. When electropolymerized at high current densities in aqueous acid solution, PAni exhibits a morphology consisting of a network of interwoven fibrils. It was shown that layers of this PAni network can be electropolymerized onto a thin-planar metal substrate resulting in a decrease in cathodic and anodic peak separations, improving charge/discharge reversibility. A continuous PAni network will make possible a decreases in the total weight of the electrodes with respect to those electrodes grown onto a fibrous carbon substrate of high surface area and high porosity. The effect of different growth electrolytes on the charge/discharge process was also characterized. Hydrochloric acid electrolyte provided an optimum polymer deposition, with respect to morphology and capacitive performance. PFPT films were grown from a solution in a non-aqueous solution. High growth current densities affected the performance of PFPT polymer films in a positive manner. A growth rate of 20 mA/cm{sup 2} not only provided an increase in charge storage, but in the amount of polymer deposited when compared to equivalent amounts deposited at 1 mA/cm{sup 2}. The morphology of the deposited conducting polymer is shown to be one of the most important characteristics in the attempt to achieve an ideal electrochemical capacitor electrode. The polymer morphology directly affects the charge/discharge process because of the strong interaction between ionic conductivity in the electrolyte and the electronic conductivity of the polymer. Cyclic-dependent degradation of the PFPT films was observed.

  18. A morphological investigation of conductive networks in polymers loaded with carbon nanotubes

    KAUST Repository

    Lubineau, Gilles

    2017-01-13

    Loading polymers with conductive nanoparticles, such as carbon nanotubes, is a popular approach toward improving their electrical properties. Resultant materials are typically described by the weight or volume fractions of their nanoparticles. Because these conductive particles are only capable of charge transfer over a very short range, most do not interact with the percolated paths nor do they participate to the electrical transfer. Understanding how these particles are arranged is necessary to increase their efficiency. It is of special interest to understand how these particles participate in creating percolated clusters, either in a specific or in all directions, and non-percolated clusters. For this, we present a computational modeling strategy based on a full morphological analysis of a network to systematically analyse conductive networks and show how particles are arranged. This study provides useful information for designing these types of materials and examples suitable for characterizing important features, such as representative volume element, the role of nanotube tortuosity and the role of tunneling cutoff distance.

  19. Investigation of subauroral ion drifts and related field-aligned currents and ionospheric Pedersen conductivity distribution

    Directory of Open Access Journals (Sweden)

    S. Figueiredo

    2004-03-01

    Full Text Available Based on Astrid-2 satellite data, results are presented from a statistical study on subauroral ion drift (SAID occurrence. SAID is a subauroral phenomenon characterized by a westward ionospheric ion drift with velocity greater than 1000m/s, or equivalently, by a poleward-directed electric field with intensity greater than 30mV/m. SAID events occur predominantly in the premidnight sector, with a maximum probability located within the 20:00 to 23:00 MLT sector, where the most rapid SAID events are also found. They are substorm related, and show first an increase in intensity and a decrease in latitudinal width during the expansion phase, followed by a weakening and widening of the SAID structures during the recovery phase. The potential drop across a SAID structure is seen to remain roughly constant during the recovery phase.

    The field-aligned current density and the height-integrated Pedersen conductivity distribution associated with the SAID events were calculated. The results reveal that the strongest SAID electric field peaks are associated with the lowest Pedersen conductivity minimum values. Clear modifications are seen in the ionospheric Pedersen conductivity distribution associated with the SAID structure as time evolves: the SAID peak is located on the poleward side of the corresponding region of reduced Pedersen conductivity; the shape of the regions of reduced conductivity is asymmetric, with a steeper poleward edge and a more rounded equatorward edge; the SAID structure becomes less intense and widens with evolution of the substorm recovery phase. From the analysis of the SAID occurrence relative to the mid-latitude trough position, SAID peaks are seen to occur relatively close to the corresponding mid-latitude trough minimum. Both these features show a similar response to magnetospheric disturbances, but on different time scales - with increasing magnetic activity, the SAID structure shows a faster

  20. Spectroscopic Investigation of Composite Polymeric and Monocrystalline Systems with Ionic Conductivity

    Directory of Open Access Journals (Sweden)

    Darya V. Radziuk

    2011-03-01

    Full Text Available The conductivity mechanism is studied in the LiCF3SO3-doped polyethylene oxide by monitoring the vibrations of sulfate groups and mobility of Li+ ion along the polymeric chain at different EO/Li molar ratios in the temperature range from 16 to 90 °С. At the high EO/Li ratio (i.e., 30, the intensity of bands increases and a triplet appears at 1,045 cm−1, indicating the presence of free anions, ionic pairs and aggregates. The existence of free ions in the polymeric electrolyte is also proven by the red shift of bands in Raman spectra and a band shift to the low frequency Infra-red region at 65 < T < 355 °С. Based on quantum mechanical modeling, (method MNDO/d, the energies (minimum and maximum correspond to the most probable and stable positions of Li+ along the polymeric chain. At room temperature, Li+ ion overcomes the intermediate state (minimum energy through non-operating transitions (maximum energy due to permanent intrapolymeric rotations (rotation of C, H and O atoms around each other. In solid electrolyte (Li2SO4 the mobility of Li+ ions increases in the temperature range from 20 to 227 °С, yielding higher conductivity. The results of the present work can be practically applied to a wide range of compact electronic devices, which are based on polymeric or solid electrolytes.

  1. Anisotropic percolation conduction in elastomer-carbon black composites investigated by polarization-sensitive terahertz time-domain spectroscopy

    Science.gov (United States)

    Okano, Makoto; Fujii, Misako; Watanabe, Shinichi

    2017-11-01

    We investigated the draw ratio (DR) dependence of the anisotropic dielectric function and conductivity of styrene butadiene rubbers (SBRs) with different carbon black (CB) concentrations by polarization-sensitive terahertz time-domain spectroscopy. From the frequency dependence of the conductivity in the unstretched SBRs ranging from direct current to terahertz frequencies, it is found that the SBR with a CB concentration above 30 wt. % exhibits percolation conductivity. We investigated the spectral shape of the dielectric function and conductivity of the SBR samples below and above the percolation threshold for two representative DRs in the terahertz frequency region. We found that the DR dependence of the spectral shape is well explained by the effective medium approximation, except for the sample with the CB concentration above 30 wt. % under the unstretched condition. The conductivity in that sample remarkably changes in the low terahertz frequency region, which suggests a change in the CB network by deformation. The investigation of the dielectric anisotropy and percolation conductivity using our polarization technique can be applied to a wide range of elastomer composites.

  2. Investigation into conductivity of silver-coated cenosphere composites prepared by a modified electroless process

    Science.gov (United States)

    Cao, Xiao Guo; Zhang, Hai Yan

    2013-01-01

    Silver-coated cenosphere composites are successfully fabricated by a modified electroless plating process that is modified by replacing the conventional pretreatment and sensitization steps by only using surface hydroxylation step to simplify the steps and reduce the overall cost of the coating process. Furthermore, the activation and electroless plating steps are merged into one step. The cenosphere particles are characterized by scanning electron microscope (SEM), energy dispersive X-ray spectroscopy (EDX) and X-ray diffraction analysis (XRD) before and after the coating process. The relatively continuous and compact coating is obtained under the given coating conditions. The results indicated that the conductivity of Ag-coated cenospheres was improved with increasing the AgNO3 solution dosage and reaction time. It was also found that the optimum AgNO3 solution concentration was 0.05 mol/L, and the optimum range of reaction temperature was from 50 °C to 65 °C.

  3. Molecular dynamics investigation of the thermal conductivity of ternary silicon–germanium–tin alloys

    Science.gov (United States)

    Lee, Yongjin; Hwang, Gyeong S.

    2017-12-01

    A further reduction of the thermal conductivity (κ) of silicon-germanium (SiGe) alloys is indispensable for their use as thermoelectric materials. Thus far, heteroatom-doped and nanostructured SiGe systems have been mainly synthesized and tested. This work presents a possibility of reducing the κ of SiGe by alloying with tin (Sn). Our molecular dynamics simulations predict that the κ of ternary SiGeSn alloys can be 40% lower than those of binary SiGe and GeSn alloys due mainly to increased mass disorder scattering of phonons. Our findings provide insight into the mechanism of κ suppression in multielement alloys and guidance on how to design them for thermoelectric applications.

  4. Preparing the National Capital Region to Conduct a Multijurisdictional and Interdisciplinary Law Enforcement Investigation

    Science.gov (United States)

    2013-09-01

    there are a number of FEMA-sponsored online and classroom NIMS training programs (e.g., IS-100, IS-700, ICS-200, ICS-300, ICS-400). There are articles...NIMS online training modules are available through the NIMS Resource Center while dozens of NIMS/ICS online and classroom courses are advertised on the...Under this model, local LE would be asked to augment their staffing compliment to the JTTF to support the investigation. At a terrorism crime scene, the

  5. The investigation of colloidal based conducting polymer films for chemical sensor applications

    Energy Technology Data Exchange (ETDEWEB)

    Evans, P

    1999-03-01

    This project was concerned with investigating the gas sensing abilities of polypyrrole and its 3- and N-substituted derivatives. Composites based upon finely ground bulk polypyrrole powders were fabricated using thermoplastics as binder elements. When used as sensors, responses to a wide range of headspace vapours of organic species were obtained. Exposure to a series of volatile amines ranging from ammonia to trimethylamine produced responses at concentrations as low as 1 vpm in all cases. Given the sensitivity of polypyrrole toward amines, colloidal sensors were investigated as potential sensors in a system for detecting the freshness of various seafoods. A feasibility study for the detection of Helicobacter pylori in the stomachs of Humans was also investigated using colloid based thin films. Sensitivity was found to be within the range of NH{sub 3} evolution expected to be generated from infected subjects based upon a comparable test system that utilised the detection of {sup 13}C labelled CO{sub 2} from an urea meal. Composites of polypyrrole and tin dioxide were investigated as potential sensor systems. Sensors of this type manifested significant and reversible resistance changes to a range of volatile organic species in the 1 to 100 vpm range. They also required no heating unlike tin dioxide ceramic type sensors and were more sensitive than polypyrrole alone. Thin films of polypyrrole were synthesised via a colloidal dip coating method. Sensors fabricated from these films were responsive to a wide range of organic vapours associated with food freshness and quality. Means of altering their performance, post synthesis, were also investigated by anion exchange and `doping` with organic compounds. Treatment of films with chiral anions produced a response which was sensitive to the chiral nature of the vapours. The novel chiral polymers, poly(N-(S-(+)-2-phenylglycine methylester)-(pyrrol-3-yl)acetic acid) and poly(N-(R-(-)-2-phenylglycine methylester)-(pyrrol-3

  6. BOREAS AFM-12 1-km AVHRR Seasonal Land Cover Classification

    Science.gov (United States)

    Steyaert, Lou; Hall, Forrest G.; Newcomer, Jeffrey A. (Editor); Knapp, David E. (Editor); Loveland, Thomas R.; Smith, David E. (Technical Monitor)

    2000-01-01

    The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-12 team's efforts focused on regional scale Surface Vegetation and Atmosphere (SVAT) modeling to improve parameterization of the heterogeneous BOREAS landscape for use in larger scale Global Circulation Models (GCMs). This regional land cover data set was developed as part of a multitemporal one-kilometer Advanced Very High Resolution Radiometer (AVHRR) land cover analysis approach that was used as the basis for regional land cover mapping, fire disturbance-regeneration, and multiresolution land cover scaling studies in the boreal forest ecosystem of central Canada. This land cover classification was derived by using regional field observations from ground and low-level aircraft transits to analyze spectral-temporal clusters that were derived from an unsupervised cluster analysis of monthly Normalized Difference Vegetation Index (NDVI) image composites (April-September 1992). This regional data set was developed for use by BOREAS investigators, especially those involved in simulation modeling, remote sensing algorithm development, and aircraft flux studies. Based on regional field data verification, this multitemporal one-kilometer AVHRR land cover mapping approach was effective in characterizing the biome-level land cover structure, embedded spatially heterogeneous landscape patterns, and other types of key land cover information of interest to BOREAS modelers.The land cover mosaics in this classification include: (1) wet conifer mosaic (low, medium, and high tree stand density), (2) mixed coniferous-deciduous forest (80% coniferous, codominant, and 80% deciduous), (3) recent visible bum, vegetation regeneration, or rock outcrops-bare ground-sparsely vegetated slow regeneration bum (four classes), (4) open water and grassland marshes, and (5) general agricultural land use/ grasslands (three classes). This land cover mapping approach did not detect small subpixel-scale landscape

  7. Soft colloidal probes for AFM force measurements between water droplets in oil

    KAUST Repository

    Vakarelski, Ivan Uriev

    2014-11-01

    Here we introduce an extension of the atomic force microscopy (AFM) colloidal probe technique, as a simple and reliable experimental approach to measure the interaction forces between small water droplets (~80-160. μm) dispersed in oil. Small water droplets are formed by capillary breakup of a microscale water jet in air, which is forced out of a fine capillary nozzle, and deposited on a superhydrophobic substrate immersed in tetradecane oil medium. In these conditions the water droplets are very loosely attached to the superhydrophobic substrate and are easily picked up with a hydrophobic AFM cantilever to form a soft colloidal probe. Sample force measurements are conducted to demonstrate the capability of the technique.

  8. Molecular Dynamic Simulations of Interaction of an AFM Probe with the Surface of an SCN Sample

    Science.gov (United States)

    Bune, Adris; Kaukler, William; Rose, M. Franklin (Technical Monitor)

    2001-01-01

    Molecular dynamic (MD) simulations is conducted in order to estimate forces of probe-substrate interaction in the Atomic Force Microscope (AFM). First a review of available molecular dynamic techniques is given. Implementation of MD simulation is based on an object-oriented code developed at the University of Delft. Modeling of the sample material - succinonitrile (SCN) - is based on the Lennard-Jones potentials. For the polystyrene probe an atomic interaction potential is used. Due to object-oriented structure of the code modification of an atomic interaction potential is straight forward. Calculation of melting temperature is used for validation of the code and of the interaction potentials. Various fitting parameters of the probe-substrate interaction potentials are considered, as potentials fitted to certain properties and temperature ranges may not be reliable for the others. This research provides theoretical foundation for an interpretation of actual measurements of an interaction forces using AFM.

  9. Cell mechanics as a marker for diseases: Biomedical applications of AFM

    Energy Technology Data Exchange (ETDEWEB)

    Rianna, Carmela; Radmacher, Manfred, E-mail: mr@biophysik.uni-bremen.de [Institute of Biophysics, University of Bremen, Otto-Hahn Allee 1, Bremen, D-28359 Germany (Germany)

    2016-08-02

    Many diseases are related to changes in cell mechanics. Atomic Force Microscopy (AFM) is one of the most suitable techniques allowing the investigation of both topography and mechanical properties of adherent cells with high spatial resolution under physiological conditions. Over the years the use of this technique in medical and clinical applications has largely increased, resulting in the notion of cell mechanics as a biomarker to discriminate between different physiological and pathological states of cells. Cell mechanics has proven to be a biophysical fingerprint able discerning between cell phenotypes, unraveling processes in aging or diseases, or even detecting and diagnosing cellular pathologies. We will review in this report some of the works on cell mechanics investigated by AFM with clinical and medical relevance in order to clarify the state of research in this field and to highlight the role of cell mechanics in the study of pathologies, focusing on cancer, blood and cardiovascular diseases.

  10. Investigations on electrical conductivity and dielectric properties of Na doped ZnO synthesized from sol gel method

    Energy Technology Data Exchange (ETDEWEB)

    Tabib, Asma; Sdiri, Nasr [Laboratoire de Physico-Chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95 Hammam-Lif, 2050 (Tunisia); Elhouichet, Habib, E-mail: habib.elhouichet@fst.rnu.tn [Laboratoire de Physico-Chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95 Hammam-Lif, 2050 (Tunisia); Département de Physique, Faculté des Sciences de Tunis, University Tunis El Manar, Tunis 2092 (Tunisia); Férid, Mokhtar [Laboratoire de Physico-Chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95 Hammam-Lif, 2050 (Tunisia)

    2015-02-15

    Highlights: • ZnO nanoparticles doped with Na were prepared from sol-gel method. • Electric conductivity and dielectric properties were investigated. • The ZnO conductivity is estimated to be of p-type for critical Na doping of 1.5% at. - Abstract: Na doped ZnO nanoparticles (NPs) were elaborated by sol gel technique. The X-ray diffraction patterns show that the peaks are indexed to the hexagonal structure without any trace of an extra phase. Electric and dielectric properties were investigated using complex impedance spectroscopy. The impedance spectra were analyzed in terms of equivalent circuits involving resistors, capacitors and constant phase elements (CPE). The contribution of grain boundary resistance to the total resistance of the system is remarkable. The AC conductivity increases with temperature following the Arrhenius law, with single apparent activation energy for conduction process. The frequency dependence of the electric conductivity follows a simple power law behavior, in according to relation σ{sub AC}(ω) = σ(0) + A ω{sup s}, where s is smaller than 1. The analysis of dc conductivity indicates that the conduction is ionic in nature. The study of its variation, at fixed temperature, with Na content shows sharp decrease which is explained by the formation of Na{sub Zn} acceptor. It was found that the dc conductivity reaches its minimum value for critical Na concentration of 1.5% at which the conductivity is estimated to be of p-type. Impedance and modulus study reveals the temperature dependent non-Debye type relaxation phenomenon. Dielectric studies revealed a promising dielectric properties (relatively high ε′ at low frequencies and low loss at high frequencies). In the low-frequency region, the values of M′ tends to zero suggesting negligible or absent electrode polarization phenomenon. The frequency dependent maxima in the imaginary modulus are found to obey to Arrhenius law.

  11. On the Right to the Protection of Persons in Respect of Whom a Preliminary Investigation Is Conducted

    Directory of Open Access Journals (Sweden)

    Kirill A. Naumov

    2016-11-01

    Full Text Available The article examines the procedural status of the person in respect of whom an investigation is conducted of a report of crime in the manner prescribed by article 144 of the Criminal Procedure Code of the Russian Federation. The order of the realization of the right to protection under a criminal investigation is studied. The problem of correlation of the status of lawyer and defender is considered.

  12. Immobilisation of living bacteria for AFM imaging under physiological conditions

    Energy Technology Data Exchange (ETDEWEB)

    Louise Meyer, Rikke, E-mail: rikke.meyer@inano.au.dk [Interdisciplinary Nanoscience Center (iNANO), Aarhus University, DK-8000 Aarhus C (Denmark); Department of Biological Sciences, Aarhus University, DK-8000 Aarhus C (Denmark); Zhou, Xingfei [Interdisciplinary Nanoscience Center (iNANO), Aarhus University, DK-8000 Aarhus C (Denmark); Tang, Lone [Interdisciplinary Nanoscience Center (iNANO), Aarhus University, DK-8000 Aarhus C (Denmark); Department of Biological Sciences, Aarhus University, DK-8000 Aarhus C (Denmark); Arpanaei, Ayyoob; Kingshott, Peter [Interdisciplinary Nanoscience Center (iNANO), Aarhus University, DK-8000 Aarhus C (Denmark); Besenbacher, Flemming [Interdisciplinary Nanoscience Center (iNANO), Aarhus University, DK-8000 Aarhus C (Denmark); Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark)

    2010-10-15

    Atomic force microscopy (AFM) holds great potential for studying the nanoscale surface structures of living cells, and to measure their interactions with abiotic surfaces, other cells, or specific biomolecules. However, the application of AFM in microbiology is challenging due to the difficulty of immobilising bacterial cells to a flat surface without changing the cell surface properties or cell viability. We have performed an extensive and thorough study of how to functionalise surfaces in order to immobilise living bacteria for AFM studies in liquid environments. Our aim was to develop a scheme which allows bacterial cells to be immobilised to a flat surface with sufficient strength to avoid detachment during the AFM scanning, and without affecting cell surface chemistry, structure, and viability. We compare and evaluate published methods, and present a new, reproducible, and generally applicable scheme for immobilising bacteria cells for an AFM imaging. Bacterial cells were immobilised to modified glass surfaces by physical confinement of cells in microwells, physisorption to positively charged surfaces, covalent binding to amine- or carboxyl-terminated surfaces, and adsorption to surfaces coated with highly adhesive polyphenolic proteins originating from the mussel Mytilus edulis. Living cells could be immobilised with all of these approaches, but many cells detached when immobilised by electrostatic interactions and imaged in buffers like PBS or MOPS. Cells were more firmly attached when immobilised by covalent binding, although some cells still detached during AFM imaging. The most successful method revealed was immobilisation by polyphenolic proteins, which facilitated firm immobilisation of the cells. Furthermore, the cell viability was not affected by this immobilisation scheme, and adhesive proteins thus provide a fast, reproducible, and generally applicable scheme for immobilising living bacteria for an AFM imaging.

  13. Bullying victimisation, internalising symptoms, and conduct problems in South African children and adolescents: a longitudinal investigation.

    Science.gov (United States)

    Boyes, Mark E; Bowes, Lucy; Cluver, Lucie D; Ward, Catherine L; Badcock, Nicholas A

    2014-11-01

    Bullying victimisation has been prospectively linked with mental health problems among children and adolescents in longitudinal studies in the developed world. However, research from the developing world, where adolescents face multiple risks to social and emotional development, has been limited by cross-sectional designs. This is the first longitudinal study of the psychological impacts of bullying victimisation in South Africa. The primary aim was to examine prospective relationships between bullying victimisation and internalising and externalising symptoms in South African youth. Secondary aims were to examine gender and age-related differences in experiences of bullying victimisation. Children and adolescents (10-17 years, 57 % female, n = 3,515) from high HIV-prevalent (>30 %) communities in South Africa were interviewed and followed-up 1 year later (97 % retention). Census enumeration areas were randomly selected from urban and rural sites in two provinces and door-to-door sampling included all households with a resident child/adolescent. Exposure to multiple experiences of bullying victimisation at baseline predicted internalising symptoms and conduct problems 1 year later. Additionally, baseline mental health scores predicted later bullying victimisation, demonstrating bi-directionality of relationships between bullying victimisation and mental health outcomes in this sample. Expected gender differences in physical, verbal, and relational bullying victimisation were evident and predicted declines in bullying victimisation over time were observed. In the developed world, school-based anti-bullying programmes have been shown to be effective in reducing bullying and victimisation. Anti-bullying programmes should be implemented and rigorously evaluated in South Africa, as this may promote improved mental health among South African children and adolescents.

  14. Investigation of the effects of LIFT printing with a KrF-excimer laser on thermally sensitive electrically conductive adhesives

    NARCIS (Netherlands)

    Perinchery, S.M.; Smits, E.C.P.; Sridhar, A.; Albert, P.; Brand, J. van den; Mandamparambil, R.; Yakimets, I.; Schoo, H.F.M.

    2014-01-01

    Laser induced forward transfer is an emerging material deposition technology. We investigated the feasibility of this technique for printing thermally sensitive, electrically conductive adhesives with and without using an intermediate dynamic release layer. A 248nm KrF-excimer laser was used to

  15. Morphological analysis of stainless steel scale like surface morphology using STM and AFM

    Energy Technology Data Exchange (ETDEWEB)

    Vignal, V.; Olive, J.M.; Desjardins, D. [Univ. Bordeaux 1, Talence (France). Lab. de Mecanique-Physique; Roux, J.C.; Genton, V. [Univ. de Bordeaux-1, Pessac (France). Centre de Recherche Paul Pascal

    1997-12-19

    A combined atomic force microscopy (AFM) and scanning tunneling microscopy (STM) investigation of stainless steel like surface morphology formed either in electropolishing bath or in HNO{sub 3} medium is reported. A new numerical technique using the Nanoscope III software is proposed. The dimension, slope and orientation of scales can be easily determined. Moreover, grain boundaries structure and probable oxides present in the upper part of the film can be deduced.

  16. FEATURES OF SCIENTIFIC INVESTIGATIONS CONDUCTED IN THE LABORATORIES OF THE DEPARTMENT OF WATER SUPPLY OF MGSU

    Directory of Open Access Journals (Sweden)

    Nikitina Irina Nikolaevna

    2016-03-01

    Full Text Available The article focuses on the work of the laboratories of the Department of Water Supply of MGSU. The laboratory of pipe-lines, pumping equipment and sanitary equipment operates in MGSU affiliated to the department of water supply. A hydraulic stand for testing and defining the the hydraulic characteristics of pressure and free-flow pipelines of water supply and sewerage systems is installed there. There are also stands for investigating the sanitary equipment of the buildings, the fire and hot water supply systems. The main research directions of the department of water supply are diverse: hydraulics of water supply systems, recon-struction of pipelines using trenchless technologies, reliable water supply and distribution systems, purification of natural water for drinking and industrial water supply, post-treatment of natural water for domestic water supply, resource conservation in domes-tic water supply systems, etc. The laboratory also has a computer lab, able to simultane-ously hold up to 30 students. In collaboration with the laboratory there operates a scien-tific circle for students and Master students, which provides a lot of interesting and useful information on the latest developments.

  17. The colloid investigations conducted at the Aespoe Hard Rock Laboratory during 2000-2004

    Energy Technology Data Exchange (ETDEWEB)

    Laaksoharju, Marcus [Geopoint AB, Stockholm (Sweden); Wold, Susanna [Royal Inst. of Tech., Stockholm (Sweden). School of Chemical Science and Engineering, Nuclear Chemistry] (eds.)

    2005-12-15

    In 2000, SKB decided to initiate an international colloid project at the Aespoe Hard Rock Laboratory in Sweden. The objectives of the colloid project are to: (i) study the role of bentonite as a colloid source, (ii) verify the background colloid concentration at Aespoe HRL and, (iii) investigate the potential for colloid formation/transport in natural groundwater concentrations. The experimental concepts for the colloid project are: laboratory experiments with bentonite, background field measurements of natural colloids, borehole specific bentonite colloid stability experiments and a fracture specific transport experiment. The activities concerning the laboratory experiments and background field measurements are described in this work; the other activities are ongoing or planned. The following conclusions were made: The bentonite colloid stability is strongly dependent on the groundwater ionic strength. Natural colloids are organic degradation products such as humic and fulvic acids, inorganic colloids (clay, calcite, iron hydroxide) and microbes. Microbes form few but large particles and their concentration increase with increasing organic carbon concentrations. The small organic colloids are present in very low concentrations in deep granitic groundwater. The concentrations can be rather high in shallow waters. The colloid concentration decreases with depth and salinity, since colloids are less stable in saline waters. The colloid content at Aespoe is less than 300 ppb. The colloid content at repository level is less than 50 ppb. The groundwater variability obtained in the boreholes reflects well the natural groundwater variability along the whole HRL tunnel.

  18. A university system-wide qualitative investigation into student physical activity promotion conducted on college campuses.

    Science.gov (United States)

    Milroy, Jeffrey J; Wyrick, David L; Bibeau, Daniel L; Strack, Robert W; Davis, Paul G

    2012-01-01

    This study aimed to examine college student physical activity promotion. A cross-sectional approach to qualitative research was used. Southeastern state university system. Fourteen of 15 (93%) universities recruited were included in this study; 22 university employees participated in a semistructured interview. Nonprobabilistic purposive and snowball sampling strategies were used to recruit individuals who were likely to be engaged in physical activity promotion efforts on their respective campuses. Thematic analyses lead to the identification of emerging themes that were coded and analyzed using NVivo software. Themes informed three main areas: key personnel responsible for promoting physical activity to students, actual physical activity promotion efforts implemented, and factors that influence student physical activity promotion. Results suggest that ecological approaches to promote physical activity on college campuses are underused, the targeting of mediators of physical activity in college students is limited, and values held by university administration influence campus physical activity promotion. Findings support recommendations for future research and practice. Practitioners should attempt to implement social ecological approaches that target scientifically established mediators of physical activity in college students. Replication of this study is needed to compare these findings with other types of universities, and to investigate the relationship between promotion activities (type and exposure) and physical activity behaviors of college students.

  19. Reduction of the thermal conductivity in free-standing silicon nano-membranes investigated by non-invasive Raman thermometry

    Science.gov (United States)

    Chávez-Ángel, E.; Reparaz, J. S.; Gomis-Bresco, J.; Wagner, M. R.; Cuffe, J.; Graczykowski, B.; Shchepetov, A.; Jiang, H.; Prunnila, M.; Ahopelto, J.; Alzina, F.; Sotomayor Torres, C. M.

    2014-01-01

    We report on the reduction of the thermal conductivity in ultra-thin suspended Si membranes with high crystalline quality. A series of membranes with thicknesses ranging from 9 nm to 1.5 μm was investigated using Raman thermometry, a novel contactless technique for thermal conductivity determination. A systematic decrease in the thermal conductivity was observed as reducing the thickness, which is explained using the Fuchs-Sondheimer model through the influence of phonon boundary scattering at the surfaces. The thermal conductivity of the thinnest membrane with d = 9 nm resulted in (9 ± 2) W/mK, thus approaching the amorphous limit but still maintaining a high crystalline quality.

  20. Reduction of the thermal conductivity in free-standing silicon nano-membranes investigated by non-invasive Raman thermometry

    Directory of Open Access Journals (Sweden)

    E. Chávez-Ángel

    2014-01-01

    Full Text Available We report on the reduction of the thermal conductivity in ultra-thin suspended Si membranes with high crystalline quality. A series of membranes with thicknesses ranging from 9 nm to 1.5 μm was investigated using Raman thermometry, a novel contactless technique for thermal conductivity determination. A systematic decrease in the thermal conductivity was observed as reducing the thickness, which is explained using the Fuchs-Sondheimer model through the influence of phonon boundary scattering at the surfaces. The thermal conductivity of the thinnest membrane with d = 9 nm resulted in (9 ± 2 W/mK, thus approaching the amorphous limit but still maintaining a high crystalline quality.

  1. Ionic conductivity ageing investigation of 1Ce10ScSZ in different partial pressures of oxygen

    DEFF Research Database (Denmark)

    Omar, Shobit; Belda, Adriana; Escardino, Agustín

    2011-01-01

    The conductivity and its ageing behaviour has been determined for zirconia co-doped with 10 mol% of Sc2O3 and 1 mol% CeO2 in different partial pressures of oxygen at 600 °C. After 3000 h, samples kept in air, in a humidified mixture of H2/N2 and in humidified H2 exhibited loss in the ionic...... conductivity of 9%, 19% and 25%, respectively. The conductivity degradation rates after the first 1000 h were 1.5%/1000 h in air and 4.3%/1000 h in humidified H2. For all atmospheres, after 3000 h at 600 °C the conductivity value remained above 10 mS/cm, the minimum value required for viable solid oxide fuel...... of the reduction front. The core/shell model was applied on the aged reduced sample, and the conductivity of the reduced region is estimated to be 27% lower than the unaged sample. The conductivity behaviour upon re-oxidation is also investigated in air at 600 °C. The conductivity recovers significantly...

  2. Phase shifting-based debris effect detection in USV-assisted AFM nanomachining

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Jialin [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences (CAS), Shenyang, Liaoning 110016 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Beijing Advanced Innovation Center for Imaging Technology, Capital Normal University, Beijing 100049 (China); Liu, Lianqing, E-mail: lianqingliu@sia.cn [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences (CAS), Shenyang, Liaoning 110016 (China); Yu, Peng; Cong, Yang [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences (CAS), Shenyang, Liaoning 110016 (China); Li, Guangyong [Department of Electrical and Computer Engineering, University of Pittsburgh, Pittsburgh, PA 15213 (United States)

    2017-08-15

    Highlights: • The mechanism of the debris effect on machining depth in force control mode operation is analyzed. • The relationship between phase shifting and pile-up of debris is investigated. • The phase shifting-based method is hardly affected by the pile-up of debris. • Debris effect detection by phase shifting-based method is achived. - Abstract: Atomic force microscopy (AFM) mechanical-based lithography attracts much attention in nanomanufacturing due to its advantages of low cost, high precision and high resolution. However, debris effects during mechanical lithography often lead to an unstable machining process and inaccurate results, which limits further applications of AFM-based lithography. There is a lack of a real-time debris detection approach, which is the prerequisite to eventually eliminating the influence of the debris, and of a method that can solve the above problems well. The ultrasonic vibration (USV)-assisted AFM has the ability to sense the machining depth in real time by detecting the phase shifting of cantilever. However, whether the pile-up of debris affect the phase response of cantilever is still lack of investigation. Therefore, we analyzed the mechanism of the debris effect on force control mode and investigated the relationship between phase shifting and pile-up of debris. Theoretical analysis and experimental results reveal that the pile-up of debris have negligible effect on phase shifting of cantilever. Therefore, the phase shifting-based method can detect the debris effect on machining depth in force control mode of AFM machining.

  3. A.C. Conductivity Investigations on Layered Na2-x-yLixKyTi3O7 Ceramics

    Directory of Open Access Journals (Sweden)

    Rakesh Singh

    2013-01-01

    Full Text Available Frequency and temperature dependence of a.c. electrical conductivity of layered mixed ionic alkali trititanates, Na1.89Li0.10K0.01Ti3O7, Na1.88Li0.10K0.02Ti3O7, Na1.86Li0.10K0.04Ti3O7, and Na1.85Li0.10K0.05Ti3O7, have been investigated over a wide temperature 350 K ≤T≥ 725 K and frequency 10 kHz to 1 MHz range. For this, Arrhenius plots are used for a.c. electrical conductivity of these compounds. The obtained conductivity plots have been divided into four distinct regions and discussed the relevant theory. According to slop variation, the conduction mechanisms occurring are different in different temperature regions. At lower temperatures, the hopping electron disorders the surroundings by moving to its neighboring Ti atoms from their equilibrium positions, causing structural defect in the polycrystalline network named small polaron. At higher temperatures, associated/unassociated interlayer ionic conduction occurs along with the alkali ions hopping through the interlayer space and electron hopping (small polaron conduction through Ti–Ti chains in these layered polar alkali titanates.

  4. Surface Morphological Studies on Nerve Cells by AFM

    Science.gov (United States)

    Durkaya, Goksel; Zhong, Lei; Rehder, Vincent; Dietz, Nikolaus

    2009-03-01

    Surface morphological properties of fixed and living nerve cells removed from the buccal ganglion of Helisoma trivolvis have been studied by using Atomic Force Microscopy (AFM). Identified, individual neurons were removed from the buccal ganglion of Helisoma trivolvis and plated into poly-L-lysine coated glass cover-slips. The growth of the nerve cells was stopped and fixed with 0.1% Glutaraldehyde and 4% Formaldehyde solution after extension of growth cones at the tip of the axons. Topography and softness of growth cone filopodia and overlying lamellopodium (veil) were probed by AFM. Information obtained from AFM's amplitude and phase channels have been used for determination of softness of the region probed. The results of structural studies on the cells are linked to their mechanical properties and internal molecular density distribution.

  5. Structure Assisted Compressed Sensing Reconstruction of Undersampled AFM Images

    DEFF Research Database (Denmark)

    Oxvig, Christian Schou; Arildsen, Thomas; Larsen, Torben

    2017-01-01

    of the full image of it, and then use advanced computational techniques to reconstruct the remaining part of the image whenever this is possible. Our initial experiments have shown that it is possible to leverage inherent structure in acquired AFM images to improve image reconstruction. Thus, we have studied...... structure in the discrete cosine transform coefficients of typical AFM images. Based on this study, we propose a generic support structure model that may be used to improve the quality of the reconstructed AFM images. Furthermore, we propose a modification to the established iterative thresholding...... reconstruction algorithms that enables the use of our proposed structure model in the reconstruction process. Through a large set of reconstructions, the general reconstruction capability improvement achievable using our structured model is shown both quantitatively and qualitatively. Specifically, our...

  6. AF-M315E Propulsion System Advances and Improvements

    Science.gov (United States)

    Masse, Robert K.; Allen, May; Driscoll, Elizabeth; Spores, Ronald A.; Arrington, Lynn A.; Schneider, Steven J.; Vasek, Thomas E.

    2016-01-01

    Even as for the GR-1 awaits its first on-orbit demonstration on the planned 2017 launch of NASA's Green Propulsion Infusion Mission (GPIM) program, ongoing efforts continue to advance the technical state-of-the-art through improvements in the performance, life capability, and affordability of both Aerojet Rocketdyne's 1-N-class GR-1 and 20-N-class GR-22 green monopropellant thrusters. Hot-fire testing of a design upgrade of the GR-22 thruster successfully demonstrated resolution of a life-limiting thermo-structural issue encountered during prototype testing on the GPIM program, yielding both an approximately 2x increase in demonstrating life capability, as well as fundamental insights relating to how ionic liquid thrusters operate, thruster scaling, and operational factors affecting catalyst bed life. Further, a number of producibility improvements, related to both materials and processes and promising up to 50% unit cost reduction, have been identified through a comprehensive Design for Manufacturing and Assembly (DFMA) assessment activity recently completed at Aerojet Rocketdyne. Focused specifically on the GR-1 but applicable to the common-core architecture of both thrusters, ongoing laboratory (heavyweight) thruster testing being conducted under a Space Act Agreement at NASA Glenn Research Center has already validated a number of these proposed manufacturability upgrades, additionally achieving a greater than 40% increase in thruster life. In parallel with technical advancements relevant to conventional large spacecraft, a joint effort between NASA and Aerojet Rocketdyne is underway to prepare 1-U CubeSat AF-M315E propulsion module for first flight demonstration in 2018.

  7. STM, SECPM, AFM and Electrochemistry on Single Crystalline Surfaces.

    Science.gov (United States)

    Wolfschmidt, Holger; Baier, Claudia; Gsell, Stefan; Fischer, Martin; Schreck, Matthias; Stimming, Ulrich

    2010-08-05

    Scanning probe microscopy (SPM) techniques have had a great impact on research fields of surface science and nanotechnology during the last decades. They are used to investigate surfaces with scanning ranges between several 100 mm down to atomic resolution. Depending on experimental conditions, and the interaction forces between probe and sample, different SPM techniques allow mapping of different surface properties. In this work, scanning tunneling microscopy (STM) in air and under electrochemical conditions (EC-STM), atomic force microscopy (AFM) in air and scanning electrochemical potential microscopy (SECPM) under electrochemical conditions, were used to study different single crystalline surfaces in electrochemistry. Especially SECPM offers potentially new insights into the solid-liquid interface by providing the possibility to image the potential distribution of the surface, with a resolution that is comparable to STM. In electrocatalysis, nanostructured catalysts supported on different electrode materials often show behavior different from their bulk electrodes. This was experimentally and theoretically shown for several combinations and recently on Pt on Au(111) towards fuel cell relevant reactions. For these investigations single crystals often provide accurate and well defined reference and support systems. We will show heteroepitaxially grown Ru, Ir and Rh single crystalline surface films and bulk Au single crystals with different orientations under electrochemical conditions. Image studies from all three different SPM methods will be presented and compared to electrochemical data obtained by cyclic voltammetry in acidic media. The quality of the single crystalline supports will be verified by the SPM images and the cyclic voltammograms. Furthermore, an outlook will be presented on how such supports can be used in electrocatalytic studies.

  8. STM, SECPM, AFM and Electrochemistry on Single Crystalline Surfaces

    Directory of Open Access Journals (Sweden)

    Ulrich Stimming

    2010-08-01

    Full Text Available Scanning probe microscopy (SPM techniques have had a great impact on research fields of surface science and nanotechnology during the last decades. They are used to investigate surfaces with scanning ranges between several 100 mm down to atomic resolution. Depending on experimental conditions, and the interaction forces between probe and sample, different SPM techniques allow mapping of different surface properties. In this work, scanning tunneling microscopy (STM in air and under electrochemical conditions (EC-STM, atomic force microscopy (AFM in air and scanning electrochemical potential microscopy (SECPM under electrochemical conditions, were used to study different single crystalline surfaces in electrochemistry. Especially SECPM offers potentially new insights into the solid-liquid interface by providing the possibility to image the potential distribution of the surface, with a resolution that is comparable to STM. In electrocatalysis, nanostructured catalysts supported on different electrode materials often show behavior different from their bulk electrodes. This was experimentally and theoretically shown for several combinations and recently on Pt on Au(111 towards fuel cell relevant reactions. For these investigations single crystals often provide accurate and well defined reference and support systems. We will show heteroepitaxially grown Ru, Ir and Rh single crystalline surface films and bulk Au single crystals with different orientations under electrochemical conditions. Image studies from all three different SPM methods will be presented and compared to electrochemical data obtained by cyclic voltammetry in acidic media. The quality of the single crystalline supports will be verified by the SPM images and the cyclic voltammograms. Furthermore, an outlook will be presented on how such supports can be used in electrocatalytic studies.

  9. Nano-scale Topographical Studies on the Growth Cones of Nerve Cells using AFM

    Science.gov (United States)

    Durkaya, Goksel; Zhong, Lei; Rehder, Vincent; Dietz, Nikolaus

    2009-11-01

    Nerve cells are the fundamental units which are responsible for intercommunication within the nervous system. The neurites, fibrous cable-like extensions for information delivery, of nerve cells are tipped by highly motile sensory structures known as the growth cones which execute important functions; neural construction, decision making and navigation during development and regeneration of the nervous system. The highly dynamic subcomponents of the growth cones are important in neural activity. Atomic Force Microscopy (AFM) is the most powerful microscopy technique which is capable of imaging without conductivity constraint and in liquid media. AFM providing nano-scale topographical information on biological structures is also informative on the physical properties such as: elasticity, adhesion, and softness. This contribution focuses on AFM analysis of the growth cones of the nerve cells removed from the buccal ganglion of Helisoma trivolvis. The results of nano-scale topography and softness analysis on growth cone central domain, filopodia and overlying lamellopodium (veil) are presented. The subcomponents of the growth cones of different nerve cells are compared to each other. The results of the analysis are linked to the mechanical properties and internal molecular density distribution of the growth cones.

  10. A novel conductivity mechanism of highly disordered carbon systems based on an investigation of graph zeta function

    Science.gov (United States)

    Matsutani, Shigeki; Sato, Iwao

    2017-09-01

    In the previous report (Matsutani and Suzuki, 2000 [21]), by proposing the mechanism under which electric conductivity is caused by the activational hopping conduction with the Wigner surmise of the level statistics, the temperature-dependent of electronic conductivity of a highly disordered carbon system was evaluated including apparent metal-insulator transition. Since the system consists of small pieces of graphite, it was assumed that the reason why the level statistics appears is due to the behavior of the quantum chaos in each granular graphite. In this article, we revise the assumption and show another origin of the Wigner surmise, which is more natural for the carbon system based on a recent investigation of graph zeta function in graph theory. Our method can be applied to the statistical treatment of the electronic properties of the randomized molecular system in general.

  11. A methodology to investigate the contribution of conduction and radiation heat transfer to the effective thermal conductivity of packed graphite pebble beds, including the wall effect

    Energy Technology Data Exchange (ETDEWEB)

    De Beer, M., E-mail: maritz.db@gmail.com [School of Mechanical and Nuclear Engineering, North-West University, Private Bag X6001, Potchefstroom 2520 (South Africa); Du Toit, C.G., E-mail: Jat.DuToit@nwu.ac.za [School of Mechanical and Nuclear Engineering, North-West University, Private Bag X6001, Potchefstroom 2520 (South Africa); Rousseau, P.G., E-mail: pieter.rousseau@uct.ac.za [Department of Mechanical Engineering, University of Cape Town, Private Bag X3, Rondebosch 7701 (South Africa)

    2017-04-01

    Highlights: • The radiation and conduction components of the effective thermal conductivity are separated. • Near-wall effects have a notable influence on the effective thermal conductivity. • Effective thermal conductivity is a function of the macro temperature gradient. • The effective thermal conductivity profile shows a characteristic trend. • The trend is a result of the interplay between conduction and radiation. - Abstract: The effective thermal conductivity represents the overall heat transfer characteristics of a packed bed of spheres and must be considered in the analysis and design of pebble bed gas-cooled reactors. During depressurized loss of forced cooling conditions the dominant heat transfer mechanisms for the passive removal of decay heat are radiation and conduction. Predicting the value of the effective thermal conductivity is complex since it inter alia depends on the temperature level and temperature gradient through the bed, as well as the pebble packing structure. The effect of the altered packing structure in the wall region must therefore also be considered. Being able to separate the contributions of radiation and conduction allows a better understanding of the underlying phenomena and the characteristics of the resultant effective thermal conductivity. This paper introduces a purpose-designed test facility and accompanying methodology that combines physical measurements with Computational Fluid Dynamics (CFD) simulations to separate the contributions of radiation and conduction heat transfer, including the wall effects. Preliminary results obtained with the methodology offer important insights into the trends observed in the experimental results and provide a better understanding of the interplay between the underlying heat transfer phenomena.

  12. On the nature of AFM tip metal-MoS2 contact; effect of single layer character and tip force

    Science.gov (United States)

    Kaushik, Vishakha; Varandani, Deepak; Das, Pintu; Mehta, Bodh R.

    2017-10-01

    In the present study, the nature of metal-MoS2 contacts has been investigated using conductive atomic force microscopy. The point I-V characteristics have been acquired as a function of loading force (53 nN-252 nN) for an interface formed between the atomic force microscopy (AFM) tip (Pt and Co coated) and MoS2 domains (single and multilayer). The metal-MoS2 junctions for both Co and Pt tips exhibit a rectifying nature with higher forward current for the Co tip as compared to the Pt tip for both single and multilayer samples. An interesting behavior of decreasing junction current and rectification ratio with increasing tip loading force is observed in the case of single layer MoS2. In comparison, negligible or very small change in the forward junction current is observed in the case of multilayer samples. The single layer MoS2 undergoes charge polarization in the presence of uniaxial strain exerted in the form of AFM tip loading force, resulting in current in a direction opposite to the forward current due to the migration of majority electron carriers away from the tip-MoS2 interface. Therefore, the net current which is a sum of the forward junction current and the force induced current reduces with loading force for single layer MoS2. This study emphasizes the influence of the single layer nature of MoS2 on the electrical properties of metal-MoS2 contacts, an understanding of which is important from the perspective of basic physics and its applications.

  13. CHARACTERIZATION OF SURFACE OF THE (010 FACE OF BORAX CRYSTALS USING EX SITU ATOMIC FORCE MICROSCOPY (AFM:

    Directory of Open Access Journals (Sweden)

    Suharso Suharso

    2010-06-01

    Full Text Available The surface topology of borax crystals grown at a relative supersaturation of 0.21 has been investigated using ex situ atomic force microscopy (AFM. It was found that the cleavage of borax crystals along the (010 face planes has features of the cleavage of layered compounds, exhibiting cleavage steps of low heights. The step heights of the cleavage of the (010 face of borax crystal are from one unit cell to three unit cells of this face.   Keywords: AFM, cleavage, borax.

  14. AFM Imaging of Natural Optical Structures

    Directory of Open Access Journals (Sweden)

    Dinara Sultanovna Dallaeva

    2014-01-01

    Full Text Available The research in this field is focused to the investigation of biological structures with superior optical features. The study presents atomic force microscopy of biological optical structures on butterfly wings. The bright blue and dark black color scales exhibit the different topography. These scales were compared to the visually the same color scales of other two species of butterflies. The histograms of heights distribution are presented and show similar results for the scales of one color for different species.

  15. Vergelijkend AFM Onderzoek : Microstructuur van bitumen in relatie tot healing

    NARCIS (Netherlands)

    Schmets, A.J.M.; Nahar, S.N.; Dillingh, B.; Fischer, H.; Scarpas, A.; Erkens, S.

    2012-01-01

    In this report we present the background, the scientific and experimental approach and the results of AFM experiments performed on two different batches of bitumen. The specific bitumen researched in this project has also been studied in the context of the InfraQuest project ‘Pragmatisch Healing

  16. LLDPE and Natural Fiber Composites Characterization using AFM

    Science.gov (United States)

    Zelca, Z.; Kukle, S.; Kajaks, J.

    2017-10-01

    The research is focused on the characterization of matrix and filler adhesion, interfacial modifier effects on matrix crystalline formation with filler, depending on the filler modification strategies. Natural fiber filled linear low density polyethylene (LLDPE) composites made from surface modified hemp fiber and waste, zinc oxide, using matrix modifier were prepared by two rolls mill and characterize by Atomic Force Microscope (AFM).

  17. Nanoscale mechanical properties of single biomolecules by AFM

    NARCIS (Netherlands)

    Schön, Peter Manfred; Gosa, M.; Vancso, Gyula J.

    2013-01-01

    In the past 25 years the atomic force microscope (AFM) has become a true enabling platform in the life sciences opening entire novel avenues for structural and dynamic studies of biological systems. It enables visualization, probing and manipulation across the length scales, from single molecules to

  18. AFM tip-sample convolution effects for cylinder protrusions

    Science.gov (United States)

    Shen, Jian; Zhang, Dan; Zhang, Fei-Hu; Gan, Yang

    2017-11-01

    A thorough understanding about the AFM tip geometry dependent artifacts and tip-sample convolution effect is essential for reliable AFM topographic characterization and dimensional metrology. Using rigid sapphire cylinder protrusions (diameter: 2.25 μm, height: 575 nm) as the model system, a systematic and quantitative study about the imaging artifacts of four types of tips-two different pyramidal tips, one tetrahedral tip and one super sharp whisker tip-is carried out through comparing tip geometry dependent variations in AFM topography of cylinders and constructing the rigid tip-cylinder convolution models. We found that the imaging artifacts and the tip-sample convolution effect are critically related to the actual inclination of the working cantilever, the tip geometry, and the obstructive contacts between the working tip's planes/edges and the cylinder. Artifact-free images can only be obtained provided that all planes and edges of the working tip are steeper than the cylinder sidewalls. The findings reported here will contribute to reliable AFM characterization of surface features of micron or hundreds of nanometers in height that are frequently met in semiconductor, biology and materials fields.

  19. Nanoindentation and AFM studies of PECVD DLC and reactively ...

    Indian Academy of Sciences (India)

    Unknown

    microscopy (TEM), nanoindentation and by AFM. The results show that the PECVD DLC film has a higher elastic modulus, hardness and roughness than the UMSD Ti/a-C : H film. It also has a lower pull off force than Ti containing amorphous carbon film. Keywords. Carbon films; nanoindentation; topography. 1. Introduction.

  20. Modular design of AFM probe with sputtered silicon tip

    DEFF Research Database (Denmark)

    Rasmussen, Peter; Thaysen, Jacob; Bouwstra, Siebe

    2001-01-01

    of the thin films constituting the cantilever. The AFM probe has an integrated tip made of a thick sputtered silicon layer, which is deposited after the probe has been defined and just before the cantilevers are released. The tips are so-called rocket tips made by reactive ion etching. We present probes...

  1. AFM lithography of aluminum for fabrication of nanomechanical systems

    DEFF Research Database (Denmark)

    Davis, Zachary James; Abadal, G.; Hansen, Ole

    2003-01-01

    Nanolithography by local anodic oxidation of surfaces using atomic force microscopy (AFM) has proven to be more reproducible when using dynamic, non-contact mode. Hereby, the tip/sample interaction forces are reduced dramatically compared to contact mode, and thus tip wear is greatly reduced...

  2. Electrospray deposition from AFM probes with nanoscale apertures

    NARCIS (Netherlands)

    Geerlings, J.; Sarajlic, Edin; Berenschot, Johan W.; Sanders, Remco G.P.; Abelmann, Leon; Tas, Niels Roelof

    2014-01-01

    Electrospray deposition utilizes a high electric field to extract liquid droplets from a capillary nozzle. In this contribution we demonstrate non-contact droplet deposition by electrospray from atomic force microscopy (AFM) probes with a fully integrated microfluidic system, so called FluidFM

  3. AFM cantilever with in situ renewable mercury microelectrode

    NARCIS (Netherlands)

    Schön, Peter Manfred; Geerlings, J.; Tas, Niels Roelof; Sarajlic, Edin

    2013-01-01

    We report here first results obtained on a novel, in situ renewable mercury microelectrode integrated into an atomic force microscopy (AFM) cantilever. Our approach is based on a fountain pen probe with appropriate dimensions enabling reversible filling with(nonwetting) mercury under changing the

  4. Characterization of large area nanostructured surfaces using AFM measurements

    DEFF Research Database (Denmark)

    Calaon, Matteo; Hansen, Hans Nørgaard; Tosello, Guido

    2012-01-01

    magnitude of the 3D surface amplitude parameters chosen for the analysis, when increasing the Al purity from 99,5% to 99,999%. AFM was then employed to evaluate the periodical arrangements of the nano structured cells. Image processing was used to estimate the average areas value, the height variation...

  5. Proton conductance at elevated temperature:Formulation and investigation of poly(4-styrenesulfonic acid / 4-aminobenzylamine / phosphoric acid membranes

    Directory of Open Access Journals (Sweden)

    Jalal eJalili

    2014-07-01

    Full Text Available 4-aminobenzylamine and phosphoric acid were blended in various proportions with poly (4-styrenesulfonic acid to form a new group of membranes exhibiting proton conductance under water-free conditions. The 4-aminobenzylamine molecule, possessing an aniline-like and benzylamine-like functional group, can interact both with the phosphoric acid and the poly(4-styrenesulfonic acid via nucleophilic interaction, thereby allowing proton jumping in the structure. Physico-chemical and thermal characteristics of the prepared solid membranes were investigated by IR spectroscopy and thermo-gravimetric analysis, respectively. Electrochemical impedance spectroscopy was employed to investigate their proton-conductance properties. Transparent composite membranes were prepared. However, the membranes are opaque for relatively high content of phosphoric acid. These membranes are thermally stable up to 300°C. The proton conductivity increases with temperature and also with content of phosphoric acid. Values as high as 1.8×10–3 S cm–1 were measured at 190°C in fully anhydrous condition.

  6. Wind-tunnel investigation of an armed mini remotely piloted vehicle. [conducted in Langley V/STOL tunnel

    Science.gov (United States)

    Phelps, A. E., III

    1979-01-01

    A wind tunnel investigation of a full scale remotely piloted vehicle (RPV) armed with rocket launchers was conducted. The model had unacceptable longitudinal stability characteristics at negative angles of attack in the original design configuration. The addition of a pair of fins mounted in a V arrangement on the propeller shroud resulted in a configuration with acceptable longitudinal stability characteristics. The addition of wing mounted external stores to the modified configuration resulted in a slight reduction in the longitudinal stability. The lateral directional characteristics of the model were generally good, but the model had low directional stability at low angles of attack. Aerodynamic control power was very strong around all three axes.

  7. Ethyl(hydroxyethyl)cellulose-cationic surfactant interactions: Electrical conductivity, self-diffusion, and time-resolved fluorescence quenching investigations

    Energy Technology Data Exchange (ETDEWEB)

    Zana, R.; Binana-Limbele, W. [Institut Charles Sadron, Strasbourg (France); Kamenka, N. [CNRS URA, Montpellier (France)] [and others

    1992-06-25

    The interaction of EHEC with CTAC and CTAB in aqueous solution is investigated as a function of temperature, electrical conductivity, chloride ion self-diffusion (CTAC), and time-resolved fluorescence quenching (CTAC, CTAB). The EHEC-cationic surfactant strength increases with temperature, resulting in a decreased critical micellization concentration, increased micelle ionization degree, and decreased micelle aggregation number that can be used to explain the reaction with pyrene. The polymer-bound surfactant micelles may hinder the motion of probe and quencher more than free micelles. 36 refs., 5 figs., 1 tab.

  8. Nano-structure fabrication of GaAs using AFM tip-induced local oxidation method: different doping types and plane orientations

    Directory of Open Access Journals (Sweden)

    Moon Kyoung-Sook

    2011-01-01

    Full Text Available Abstract In this study, we have fabricated nano-scaled oxide structures on GaAs substrates that are doped in different conductivity types of p- and n-types and plane orientations of GaAs(100 and GaAs(711, respectively, using an atomic force microscopy (AFM tip-induced local oxidation method. The AFM-induced GaAs oxide patterns were obtained by varying applied bias from approximately 5 V to approximately 15 V and the tip loading forces from 60 to 180 nN. During the local oxidation, the humidity and the tip scan speed are fixed to approximately 45% and approximately 6.3 μm/s, respectively. The local oxidation rate is further improved in p-type GaAs compared to n-type GaAs substrates whereas the rate is enhanced in GaAs(100 compared to and GaAs(711, respectively, under the identical conditions. In addition, the oxide formation mechanisms in different doping types and plane orientations were investigated and compared with two-dimensional simulation results.

  9. Immobilizing live Escherichia coli for AFM studies of surface dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Lonergan, N.E.; Britt, L.D.; Sullivan, C.J., E-mail: sullivcj@evms.edu

    2014-02-01

    Atomic force microscopy (AFM) is a probe-based technique that permits high resolution imaging of live bacterial cells. However, stably immobilizing cells to withstand the probe-based lateral forces remains an obstacle in AFM mediated studies, especially those of live, rod shaped bacteria in nutrient media. Consequently, AFM has been under-utilized in the research of bacterial surface dynamics. The aim of the current study was to immobilize a less adherent Escherichia coli strain in a method that both facilitates AFM imaging in nutrient broth and preserves overall cell viability. Immobilization reagents and buffers were systematically evaluated and the cell membrane integrity was monitored in all sample preparations. As expected, the biocompatible gelatin coated surfaces facilitated stable cell attachment in lower ionic strength buffers, yet poorly immobilized cells in higher ionic strength buffers. In comparison, poly-L-lysine surfaces bound cells in both low and high ionic strength buffers. The benefit of the poly-L-lysine binding capacity was offset by the compromised membrane integrity exhibited by cells on poly-L-lysine surfaces. However, the addition of divalent cations and glucose to the immobilization buffer was found to mitigate this unfavorable effect. Ultimately, immobilization of E. coli cells on poly-L-lysine surfaces in a lower ionic strength buffer supplemented with Mg{sup 2+} and Ca{sup 2+} was determined to provide optimal cell attachment without compromising the overall cell viability. Cells immobilized in this method were stably imaged in media through multiple division cycles. Furthermore, permeability assays indicated that E. coli cells recover from the hypoosmotic stress caused by immobilization in low ionic strength buffers. Taken together, this data suggests that stable immobilization of viable cells on poly-L-lysine surfaces can be accomplished in lower ionic strength buffers that are supplemented with divalent cations for membrane

  10. Cellular transfer and AFM imaging of cancer cells using Bioimprint

    Directory of Open Access Journals (Sweden)

    Melville DOS

    2006-01-01

    Full Text Available Abstract A technique for permanently capturing a replica impression of biological cells has been developed to facilitate analysis using nanometer resolution imaging tools, namely the atomic force microscope (AFM. The method, termed Bioimprint™, creates a permanent cell 'footprint' in a non-biohazardous Poly (dimethylsiloxane (PDMS polymer composite. The transfer of nanometer scale biological information is presented as an alternative imaging technique at a resolution beyond that of optical microscopy. By transferring cell topology into a rigid medium more suited for AFM imaging, many of the limitations associated with scanning of biological specimens can be overcome. Potential for this technique is demonstrated by analyzing Bioimprint™ replicas created from human endometrial cancer cells. The high resolution transfer of this process is further detailed by imaging membrane morphological structures consistent with exocytosis. The integration of soft lithography to replicate biological materials presents an enhanced method for the study of biological systems at the nanoscale.

  11. LET spectrum measurements in Cr-39 PNTD with AFM

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Carl Edward [Los Alamos National Laboratory; De Witt, Joel M [OSU, PHYSICS; Benton, Eric R [OSU, PHYSICS; Yasuda, Nakahiro [NIRS, HIMAC; Benton, Eugene V [UNIV OF SAN FRANCISCO

    2010-01-01

    Energetic protons, neutrons, and heavy ions undergoing collisions with target nuclei of varying Z can produce residual heavy recoil fragments via intra-nuclear cascade/evaporation reactions. The particles produced in these non-elastic collisions generally have such extremely short range ({approx}< 10 {mu}m) that they cannot be directly observed by conventional detection methods including CR-39 plastic nuclear track detector (PNTD) that has been chemically etched for analysis by standard visible light microscopy. However, high-LET recoil fragments having range on the order of several cell diameters can be produced in tissue during radiotherapy using proton and carbon beams. We have developed a method to analyze short-range, high-LET tracks in CR-39 plastic nuclear track detector (PNTD) using short duration chemical etching ({approx}< 1 {mu}m) followed by automated atomic force microscope (AFM) scanning. The post-scan data processing used in this work was based on semi-automated matrix analysis opposed to traditional grey-scale image analysis. This method takes advantage of the 3-D data obtained via AFM to achieve robust discrimination of nuclear tracks from other features. Through automation of AFM scanning, sufficient AFM scan frames were obtained to attain an LET spectrum spanning the LET range from 200-1500 keV/{mu}m. In addition to our experiments, simulations were carried out with the Monte Carlo transport code, FLUKA. To demonstrate this method, CR-39 PNTD was exposed to the proton therapy beam at Loma Linda University Medical Center (LLUMC) at 60 and 230 MeV. Additionally, detectors were exposed to I GeV protons at the NASA Space Radiation Laboratory (NSRL) at Brookhaven National Laboratory (BNL). For these exposures CR-39 PNTD, Al and Cu target foils were used between detector layers.

  12. Quantitative nano-mechanics of biological cells with AFM

    Science.gov (United States)

    Sokolov, Igor

    2013-03-01

    The importance of study of living cells is hard to overestimate. Cell mechanics is a relatively young, yet not a well-developed area. Besides just a fundamental interest, large practical need has emerged to measure cell mechanics quantitatively. Recent studies revealed a significant correlation between stiffness of biological cells and various human diseases, such as cancer, malaria, arthritis, and even aging. However, really quantitative studies of mechanics of biological cells are virtually absent. It is not even clear if the cell, being a complex and heterogeneous object, can be described by the elastic modulus at all. Atomic force microscopy (AFM) is a natural instrument to study properties of cells in their native environments. Here we will demonstrate that quantitative measurements of elastic modulus of cells with AFM are possible. Specifically, we will show that the ``cell body'' (cell without ``brush'' surface layer, a non-elastic layer surrounding cells) typically demonstrates the response of a homogeneous elastic medium up to the deformation of 10-20%, but if and only if a) the cellular brush layer is taken into account, b) rather dull AFM probes are used. This will be justified with the help of the strong condition of elastic behavior of material: the elastic modulus is shown to be independent on the indentation depth. We will also demonstrate that an attempt either to ignore the brush layer or to use sharp AFM probes will result in the violation of the strong condition, which implies impossibility to use the concept of the elastic modulus to describe cell mechanics in such experiments. Examples of quantitative measurements of the Young's modulus of the cell body and the cell brush parameters will be given for various cells. Address when submitting: Clarkson University, Potsdam, NY 13699

  13. The Atomic Force Microscopic (AFM) Characterization of Nanomaterials

    Science.gov (United States)

    2009-06-01

    and then dried in air on aluminum foil before transfer into DMF for sonication. Figure 15 shows the AFM results after the XDCNTs/WC were tip...was tested to have a tensile strength of 63 gigapascals (GPa), which translates into the CNT’s ability to endure the weight of 6300 kg on a cable with...separate layers by their buoyancy differences. The author suggested that this might be caused by the surfactants’ organization around SWNTs comprising

  14. Forsmark site investigation. Monitoring of brook water levels, electrical conductivities, temperatures and discharges January-December 2010

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, Per-Olof (Artesia Grundvattenkonsult (Sweden)); Juston, John (Juston Konsult (Sweden))

    2011-06-15

    This document reports the monitoring of water levels, electrical conductivities, temperatures and discharges at four brook discharge gauging stations, and the monitoring of water electrical conductivity at the outlet of Lake Bolundsfjaerden in the Forsmark area. The report presents data from 1 January through 31 December 2010 and is a continuation of reporting from Johansson and Juston (2007, 2009, 2011), which covered the periods from 1 April 2004 through 31 March 2007, 1 April 2007 through 31 December 2008, and 1 January through 31 December 2009, respectively. Long-throated flumes equipped with automatically recording devices were used for the discharge measurements. Every c. 14 days the water depths at the upstream edge of the flumes were measured manually by a ruler as a check. Electrical conductivity and temperature were automatically recorded and these parameters were also measured manually every c. 14 days with the site investigation field devices. SKB's Hydro Monitoring System (HMS) was used to collect and store all data. From HMS quality assured data were transferred to SKB's primary database Sicada. Measurements of levels, electrical conductivities and temperatures were made every 10 minutes (every 30 minutes for electrical conductivity at the outlet of Lake Bolundsfjaerden). For the calculation of discharge, quality assured water level data from the flumes were used. The calculation procedure included consolidation of the time series to hourly averages, screening of data for removal of short-term spikes, noise and other data that were judged erroneous. After the calculations were performed, the results were delivered to Sicada. The amplitudes of water level variations during this reporting period were 0.41-0.55 m and the mean electrical conductivities varied between 23 and 39 mS/m at the four discharge stations. However, due to mal-function of measuring devices for electrical conductivity, data were missing for relatively long time periods. Due

  15. In situ hydrodynamic lateral force calibration of AFM colloidal probes.

    Science.gov (United States)

    Ryu, Sangjin; Franck, Christian

    2011-11-01

    Lateral force microscopy (LFM) is an application of atomic force microscopy (AFM) to sense lateral forces applied to the AFM probe tip. Recent advances in tissue engineering and functional biomaterials have shown a need for the surface characterization of their material and biochemical properties under the application of lateral forces. LFM equipped with colloidal probes of well-defined tip geometries has been a natural fit to address these needs but has remained limited to provide primarily qualitative results. For quantitative measurements, LFM requires the successful determination of the lateral force or torque conversion factor of the probe. Usually, force calibration results obtained in air are used for force measurements in liquids, but refractive index differences between air and liquids induce changes in the conversion factor. Furthermore, in the case of biochemically functionalized tips, damage can occur during calibration because tip-surface contact is inevitable in most calibration methods. Therefore, a nondestructive in situ lateral force calibration is desirable for LFM applications in liquids. Here we present an in situ hydrodynamic lateral force calibration method for AFM colloidal probes. In this method, the laterally scanned substrate surface generated a creeping Couette flow, which deformed the probe under torsion. The spherical geometry of the tip enabled the calculation of tip drag forces, and the lateral torque conversion factor was calibrated from the lateral voltage change and estimated torque. Comparisons with lateral force calibrations performed in air show that the hydrodynamic lateral force calibration method enables quantitative lateral force measurements in liquid using colloidal probes.

  16. Structural Basis for Asymmetric Conductance of the Influenza M2 Proton Channel Investigated by Solid-State NMR Spectroscopy.

    Science.gov (United States)

    Mandala, Venkata S; Liao, Shu-Yu; Kwon, Byungsu; Hong, Mei

    2017-07-07

    The influenza M2 protein forms an acid-activated proton channel that is essential for virus replication. The transmembrane H37 selects for protons under low external pH while W41 ensures proton conduction only from the N terminus to the C terminus and prevents reverse current under low internal pH. Here, we address the molecular basis for this asymmetric conduction by investigating the structure and dynamics of a mutant channel, W41F, which permits reverse current under low internal pH. Solid-state NMR experiments show that W41F M2 retains the pH-dependent α-helical conformations and tetrameric structure of the wild-type (WT) channel but has significantly altered protonation and tautomeric equilibria at H37. At high pH, the H37 structure is shifted toward the π tautomer and less cationic tetrads, consistent with faster forward deprotonation to the C terminus. At low pH, the mutant channel contains more cationic tetrads than the WT channel, consistent with faster reverse protonation from the C terminus. 15N NMR spectra allow the extraction of four H37 pKas and show that the pKas are more clustered in the mutant channel compared to WT M2. Moreover, binding of the antiviral drug, amantadine, at the N-terminal pore at low pH did not convert all histidines to the neutral state, as seen in WT M2, but left half of all histidines cationic, unambiguously demonstrating C-terminal protonation of H37 in the mutant. These results indicate that asymmetric conduction in WT M2 is due to W41 inhibition of C-terminal acid activation by H37. When Trp is replaced by Phe, protons can be transferred to H37 bidirectionally with distinct rate constants. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Investigation of Thermal Conductivity and Heat Characteristics of Oil Sands Using Ultrasound Irradiation for Shortening the Preheating Time

    Science.gov (United States)

    Kamagata, Shingo; Kawamura, Youhei; Okawa, Hirokazu; Mizutani, Koichi

    2012-07-01

    Oil sands are attractive as an energy resource. Bitumen, which is found in oil sands, has high viscosity, so that it does not flow. Most oil sands are underground and are developed with a method called steam-assisted gravity drainage (SAGD). Hot steam is injected underground to fluidize bitumen and promote its recovery. However, the preheating time is too long. One way of reducing running costs is by shortening the preheating time. Previous studies have found that bitumen can be extracted from oil sands efficiently by applying ultrasonic irradiation, but SAGD was not applied directly in these cases. Thus, the purpose of this study is to apply ultrasonic irradiation to SAGD, thereby shortening the preheating time of oil sands. As a model experiment for SAGD, heat transfer experiments in a sand layer made with Toyoura sand and silicone oil were conducted and the thermal effect with ultrasound was investigated.

  18. Investigation of plasmon resonance tunneling through subwavelength hole arrays in highly doped conductive ZnO films

    Science.gov (United States)

    Nader, Nima; Vangala, Shivashankar; Hendrickson, Joshua R.; Leedy, Kevin D.; Look, David C.; Guo, Junpeng; Cleary, Justin W.

    2015-11-01

    Experimental results pertaining to plasmon resonance tunneling through a highly conductive zinc oxide (ZnO) layer with subwavelength hole-arrays is investigated in the mid-infrared regime. Gallium-doped ZnO layers are pulsed-laser deposited on a silicon wafer. The ZnO has metallic optical properties with a bulk plasma frequency of 214 THz, which is equivalent to a free space wavelength of 1.4 μm. Hole arrays with different periods and hole shapes are fabricated via a standard photolithography process. Resonant mode tunneling characteristics are experimentally studied for different incident angles and compared with surface plasmon theoretical calculations and finite-difference time-domain simulations. Transmission peaks, higher than the baseline predicted by diffraction theory, are observed in each of the samples at wavelengths that correspond to the excitation of surface plasmon modes.

  19. Investigation of plasmon resonance tunneling through subwavelength hole arrays in highly doped conductive ZnO films

    Energy Technology Data Exchange (ETDEWEB)

    Nader, Nima, E-mail: nima.nader@nist.gov; Vangala, Shivashankar [Solid State Scientific Corporation, 12 Simon St., Nashua, New Hampshire 03060 (United States); Air Force Research Laboratory, Sensors Directorate, 2241 Avionics Circle, Wright Patterson AFB, Ohio 45433 (United States); Hendrickson, Joshua R.; Leedy, Kevin D.; Cleary, Justin W. [Air Force Research Laboratory, Sensors Directorate, 2241 Avionics Circle, Wright Patterson AFB, Ohio 45433 (United States); Look, David C. [Air Force Research Laboratory, Sensors Directorate, 2241 Avionics Circle, Wright Patterson AFB, Ohio 45433 (United States); Wyle Laboratories, Inc., 2601 Mission Point Blvd., Suite 300, Dayton, Ohio 45435 (United States); Semiconductor Research Center, Wright State University, Dayton, Ohio 45435 (United States); Guo, Junpeng [Department of Electrical and Computer Engineering, University of Alabama in Huntsville, 301 Sparkman Drive, Huntsville, Alabama 35899 (United States)

    2015-11-07

    Experimental results pertaining to plasmon resonance tunneling through a highly conductive zinc oxide (ZnO) layer with subwavelength hole-arrays is investigated in the mid-infrared regime. Gallium-doped ZnO layers are pulsed-laser deposited on a silicon wafer. The ZnO has metallic optical properties with a bulk plasma frequency of 214 THz, which is equivalent to a free space wavelength of 1.4 μm. Hole arrays with different periods and hole shapes are fabricated via a standard photolithography process. Resonant mode tunneling characteristics are experimentally studied for different incident angles and compared with surface plasmon theoretical calculations and finite-difference time-domain simulations. Transmission peaks, higher than the baseline predicted by diffraction theory, are observed in each of the samples at wavelengths that correspond to the excitation of surface plasmon modes.

  20. Investigation of phonon transport and thermal boundary conductance at the interface of functionalized SWCNT and poly (ether-ketone)

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Haoxiang; Kumar, Satish, E-mail: satish.kumar@me.gatech.edu [G.W. Woodruff School of Mechanical Engineering, Georgia Institute of Technology, Atlanta, Georgia 30332 (United States); Chen, Liang [School of Energy and Power Engineering, Xi' an Jiaotong University, Xi' an, Shaanxi (China); Varshney, Vikas [Materials and Manufacturing Directorate, Air Force Research Laboratory, Wright-Patterson Air Force Base, Dayton, Ohio 45433 (United States); Universal Technology Corporation, Dayton, Ohio 45432 (United States); Roy, Ajit K. [Materials and Manufacturing Directorate, Air Force Research Laboratory, Wright-Patterson Air Force Base, Dayton, Ohio 45433 (United States)

    2016-09-07

    Carbon nanostructures such as carbon nanotube (CNT), graphene, and carbon fibers can be used as fillers in amorphous polymers to improve their thermal properties. In this study, the effect of covalent bonding of CNT with poly(ether ketone) (PEK) on interfacial thermal interactions is investigated using non-equilibrium molecular dynamics simulations. The number of covalent bonds between (20, 20) CNT and PEK is varied in the range of 0–80 (0%–6.25%), and the thermal boundary conductance is computed. The analysis reveals that covalent functionalization of CNT atoms can enhance the thermal boundary conductance by an order of magnitude compared to the non-functionalized CNT-PEK interface at a high degree of CNT functionalization. Besides strengthening the thermal coupling, covalent functionalization is also shown to modify the phonon spectra of CNT. The transient spectral energy analysis shows that the crosslinks cause faster energy exchange from CNT to PEK in different frequency bands. The oxygen atom of hydroxyl group of PEK contributes energy transfer in the low frequency band, while aromatic and carbonyl carbon atoms play a more significant role in high frequency bands. In addition, by analyzing the relaxation time of the spectral temperature of different frequency bands of CNT, it is revealed that with increasing number of bonds, both lower frequency vibrational modes and higher frequency modes efficiently couple across the CNT-PEK interface and contribute in thermal energy transfer from CNT to the matrix.

  1. Forsmark site investigation. Monitoring of brook water levels, electrical conductivities, temperatures and discharges January-December 2009

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, Per-Olof (Artesia Grundvattenkonsult (Sweden)); Juston, John (Juston Konsult (Sweden))

    2011-03-15

    This document reports the monitoring of water levels, electrical conductivities, temperatures and discharges at four brook discharge gauging stations, and the monitoring of water electrical conductivity at the outlet of Lake Bolundsfjaerden in the Forsmark area. The report presents data from 1 January through 31 December 2009 and is a continuation of reporting from Johansson and Juston (2007, 2009), which covered the periods from 1 April 2004 through 31 March 2007 and 1 April 2007 through 31 December 2008, respectively. Long-throated flumes equipped with automatically recording devices were used for the discharge measurements. Every c. 14 days the water depths at the upstream edge of the flumes were measured manually by a ruler as a check. Electrical conductivity and temperature were automatically recorded and these parameters were also measured manually every c. 14 days with the site investigation field devices. SKB's Hydro Monitoring System (HMS) was used to collect and store all data. From HMS quality assured data were transferred to SKB's primary database Sicada. Measurements of levels, electrical conductivities and temperatures were made every 10 minutes (every 30 minutes for electrical conductivity at the outlet of Lake Bolundsfjaerden). For the calculation of discharge, quality assured water level data from the flumes were used. The calculation procedure included consolidation of the time series to hourly averages, screening of data for removal of short-term spikes, noise and other data that were judged erroneous. After the calculations were performed, the results were delivered to Sicada. The amplitudes of water level variations during this reporting period were 0.26-0.33 m at the four stations. The mean electrical conductivities varied between 26 and 41 mS/m at the four discharge stations. The electrical conductivity at the outlet of Lake Bolundsfjaerden varied between 53 and 188 mS/m during the period with the higher values at the end of the

  2. Cell visco-elasticity measured with AFM and optical trapping at sub-micrometer deformations.

    Directory of Open Access Journals (Sweden)

    Schanila Nawaz

    Full Text Available The measurement of the elastic properties of cells is widely used as an indicator for cellular changes during differentiation, upon drug treatment, or resulting from the interaction with the supporting matrix. Elasticity is routinely quantified by indenting the cell with a probe of an AFM while applying nano-Newton forces. Because the resulting deformations are in the micrometer range, the measurements will be affected by the finite thickness of the cell, viscous effects and even cell damage induced by the experiment itself. Here, we have analyzed the response of single 3T3 fibroblasts that were indented with a micrometer-sized bead attached to an AFM cantilever at forces from 30-600 pN, resulting in indentations ranging from 0.2 to 1.2 micrometer. To investigate the cellular response at lower forces up to 10 pN, we developed an optical trap to indent the cell in vertical direction, normal to the plane of the coverslip. Deformations of up to two hundred nanometers achieved at forces of up to 30 pN showed a reversible, thus truly elastic response that was independent on the rate of deformation. We found that at such small deformations, the elastic modulus of 100 Pa is largely determined by the presence of the actin cortex. At higher indentations, viscous effects led to an increase of the apparent elastic modulus. This viscous contribution that followed a weak power law, increased at larger cell indentations. Both AFM and optical trapping indentation experiments give consistent results for the cell elasticity. Optical trapping has the benefit of a lower force noise, which allows a more accurate determination of the absolute indentation. The combination of both techniques allows the investigation of single cells at small and large indentations and enables the separation of their viscous and elastic components.

  3. Investigating the Relationship Among Religious Group Attachement and Consumer Preferences: A Field Research Conducted in the Province of Kirikkale

    Directory of Open Access Journals (Sweden)

    İbrahim BOZACI

    2015-07-01

    Full Text Available The effects of social environment in which individual exists on consumption cannot be ignored. These effects are higher in collectivist cultures where interactions among people are high like Turkey. But studies are too lack which investigates the relationships among religious group and consumer preferences which is one of the important type of social set. People tend to behave suitable with the ex pectancies of religious groups and group members that they participate in or sympathize. The g oal of this research is pointing out the relationships among connection level with religious groups and consumer choices. Under this framework, extend literature investigation is made and relationships among religious groups and consumer choices is tried to be explained theoretically. After that, these relationships are tested with initial data which is collected by survey method that is conducted with 452 consumer s in Kirikkale. To reach research goals, difference and correlation analyses are made. According to research results, it is seen that religious group driven consumption behavior varies in terms of membership condition and religious group sympathy. Moreover , it is understood that, religious group attachment, which has individual and social dimensions, is meaningfully related with sensitive consumption to group relations, suitable product preference to religion and preference of firm that suitable with politi cal view.

  4. Stress vulnerability in adolescents with chronic fatigue syndrome: experimental study investigating heart rate variability and skin conductance responses.

    Science.gov (United States)

    Rimes, Katharine A; Lievesley, Kate; Chalder, Trudie

    2017-07-01

    Stress vulnerability has been implicated in adolescent chronic fatigue syndrome (CFS), but has rarely been investigated directly. This study compared psychological and physiological responses to a laboratory social performance task in adolescents with CFS with chronic illness (asthma) and healthy control groups. Adolescents with CFS (n = 60), adolescents with asthma (n = 31) and healthy adolescents (n = 78) completed questionnaires before and after a social performance task. Skin conductance responses (SCR; mean SCR and Max-Min) and heart rate variability (low frequency/high frequency; LF/HF and root mean square difference of successive RR intervals; RMSSD) was measured before, during and after the task. Baseline heart rate variability (HRV) (RMSSD) was significantly lower in the CFS and Asthma groups than the HC. During the speech, the CFS and Asthma groups had higher HRV (LF/HF) than the HC, adjusting for baseline LF/HF. Although the asthma group showed a subsequent reduction in HRV during recovery, the CFS group did not. Similarly, during recovery after the task, the CFS group showed a continued increase in skin conductance (Min-Max), unlike the Asthma and HC groups. Compared to control groups, adolescents with CFS expected to find the task more difficult, were more anxious beforehand and afterwards, rated it as more difficult, evaluated their performance more negatively and had lower observer ratings of performance. Parents of adolescents with CFS expected that their child would perform less well in the task than parents of control participants. Adolescents with CFS showed autonomic nervous system responses that are consistent with chronic stress vulnerability, difficulty coping with acute stress and slower recovery after acute stress. Self-report measures also indicated greater trait, pre- and posttask anxiety in the CFS group. © 2017 Association for Child and Adolescent Mental Health.

  5. Mössbauer and electrical conduction investigations of LiFe(BaTi)(PO{sub 4}) NASICON nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Hassaan, M. Y. [Al-Azhar University, Physics Department, Faculty of Science (Egypt); Kaixin, Zhu; Wang, Junhu [Academy of Sciences, Laboratory of Catalysts and New Materials for Aerospace, Dalian Institute of Chemical Physics Chinese (China); Moustafa, M. G., E-mail: myhassaan@yahoo.com [Al-Azhar University, Physics Department, Faculty of Science (Egypt)

    2016-12-15

    NASICON glass sample with a composition of Li {sub 1.3}Fe {sub 0.3}(BaTi) {sub 1.7}(PO {sub 4}) {sub 3} was prepared using the conventional melt-quenching technique at 1300 {sup ∘}C for one hour after two stages of calcination process at 300 {sup ∘}C and 600 {sup ∘}C respectively. DTA was used to determine (T {sub g}) and (T {sub c}) of the as-quenched glass sample. XRD was used to confirm the glassy state of the prepared sample. The as-quenched glass sample was heat treated near its onset crystallization temperature for different times 1, 2, 3, 4, and 5 hours. The gradual precipitation of the crystalline nano-particles with NASICON type structure was also confirmed using XRD. The as-prepared sample and the five heat treated (HT) samples were investigated using Mössbauer spectroscopy, DC and AC conductivities and dielectric permittivity. FTIR, density, and TEM measurements were also performed. After HT, XRD and FTIR measurements conformed the formation of NASICON phase. The results of the dielectric permittivity showed no maximum peak in the studied temperature and frequency ranges, which indicates the absence of ferroelectric behavior of the HT glass sample. Mössbauer data showed that the iron in the glass and its HT samples include two ionic states, Fe {sup 3+} (O {sub h}) and Fe {sup 2+} (O {sub h}) ions. It is observed that the DC conductivity of the HT glass for 5 h was almost two orders of magnitude higher than that of the parent glass.

  6. Transport properties investigation of aqueous protic ionic liquid solutions through conductivity, viscosity, and NMR self-diffusion measurements.

    Science.gov (United States)

    Anouti, Mérièm; Jacquemin, Johan; Porion, Patrice

    2012-04-12

    We present a study on the transport properties through conductivity (σ), viscosity (η), and self-diffusion coefficient (D) measurements of two pure protic ionic liquids--pyrrolidinium hydrogen sulfate, [Pyrr][HSO(4)], and pyrrolidinium trifluoroacetate, [Pyrr][CF(3)COO]--and their mixtures with water over the whole composition range at 298.15 K and atmospheric pressure. Based on these experimental results, transport mobilities of ions have been then investigated in each case through the Stokes-Einstein equation. From this, the proton conduction in these PILs follows a combination of Grotthuss and vehicle-type mechanisms, which depends also on the water composition in solution. In each case, the displacement of the NMR peak attributed to the labile proton on the pyrrolidinium cation with the PILs concentration in aqueous solution indicates that this proton is located between the cation and the anion for a water weight fraction lower than 8%. In other words, for such compositions, it appears that this labile proton is not solvated by water molecules. However, for higher water content, the labile protons are in solution as H(3)O(+). This water weight fraction appears to be the solvation limit of the H(+) ions by water molecules in these two PILs solutions. However, [Pyrr][HSO(4)] and [Pyrr][CF(3)COO] PILs present opposed comportment in aqueous solution. In the case of [Pyrr][CF(3)COO], η, σ, D, and the attractive potential, E(pot), between ions indicate clearly that the diffusion of each ion is similar. In other words, these ions are tightly bound together as ion pairs, reflecting in fact the importance of the hydrophobicity of the trifluoroacetate anion, whereas, in the case of the [Pyrr][HSO(4)], the strong H-bond between the HSO(4)(-) anion and water promotes a drastic change in the viscosity of the aqueous solution, as well as on the conductivity which is up to 187 mS·cm(-1) for water weight fraction close to 60% at 298 K.

  7. Adsorption and conformation of carboxymethyl cellulose at solid-liquid interfaces using spectroscopic, AFM and allied techniques.

    Science.gov (United States)

    Wang, Jing; Somasundaran, P

    2005-11-01

    Carboxymethyl cellulose (CMC) is a polysaccharide which is widely used in many industrial sectors including food, textiles, paper, adhesives, paints, pharmaceutics, cosmetics and mineral processing. It is a natural organic polymer that is non-toxic and biodegradable. These properties make it ideal for industrial applications. However, a general lack of understanding of the interaction mechanism between the polysaccharides and solid surfaces has hindered the application of this polymer. In this work, adsorption of CMC at the solid-liquid interface is investigated using adsorption and electrophoretic mobility measurements, FTIR, fluorescence spectroscopy, AFM and molecular modeling. CMC adsorption on talc was found to be affected significantly by changes in solution conditions such as pH and ionic strength, which indicates the important role of electrostatic force in adsorption. The pH effect on adsorption was further proven by AFM imaging. Electrokinetic studies showed that the adsorption of CMC on talc changed its isoelectric point. Further, molecular modeling suggests a helical structure of CMC in solution while it is found to adsorb flat on the solid surface to allow its OH groups to be in contact with the surface. Fluorescence spectroscopy studies conducted to investigate the role of hydrophobic bonding using pyrene probe showed no evidence of the formation of hydrophobic domains at talc-aqueous interface. Urea, a hydrogen bond breaker, markedly reduced the adsorption of CMC on talc, supports hydrogen bonding as an important factor. In FTIR study, the changes to the infrared bands, associated with the CO stretch coupled to the CC stretch and OH deformation, were significant and this further supports the strong hydrogen bonding of CMC to the solid surface. In addition, Langmuir modeling of the adsorption isotherm suggests hydrogen bonding to be a dominant force for polysaccharide adsorption since the adsorption free energy of this polymer was close to that for

  8. Magnetic resonance imaging investigation of the bone conduction implant - a pilot study at 1.5 Tesla.

    Science.gov (United States)

    Jansson, Karl-Johan Fredén; Håkansson, Bo; Reinfeldt, Sabine; Rigato, Cristina; Eeg-Olofsson, Måns

    2015-01-01

    The objective of this pilot study was to investigate if an active bone conduction implant (BCI) used in an ongoing clinical study withstands magnetic resonance imaging (MRI) of 1.5 Tesla. In particular, the MRI effects on maximum power output (MPO), total harmonic distortion (THD), and demagnetization were investigated. Implant activation and image artifacts were also evaluated. One implant was placed on the head of a test person at the position corresponding to the normal position of an implanted BCI and applied with a static pressure using a bandage and scanned in a 1.5 Tesla MRI camera. Scanning was performed both with and without the implant, in three orthogonal planes, and for one spin-echo and one gradient-echo pulse sequence. Implant functionality was verified in-between the scans using an audio processor programmed to generate a sequence of tones when attached to the implant. Objective verification was also carried out by measuring MPO and THD on a skull simulator as well as retention force, before and after MRI. It was found that the exposure of 1.5 Tesla MRI only had a minor effect on the MPO, ie, it decreased over all frequencies with an average of 1.1±2.1 dB. The THD remained unchanged above 300 Hz and was increased only at lower frequencies. The retention magnet was demagnetized by 5%. The maximum image artifacts reached a distance of 9 and 10 cm from the implant in the coronal plane for the spin-echo and the gradient-echo sequence, respectively. The test person reported no MRI induced sound from the implant. This pilot study indicates that the present BCI may withstand 1.5 Tesla MRI with only minor effects on its performance. No MRI induced sound was reported, but the head image was highly distorted near the implant.

  9. Magnetic resonance imaging investigation of the bone conduction implant – a pilot study at 1.5 Tesla

    Science.gov (United States)

    Jansson, Karl-Johan Fredén; Håkansson, Bo; Reinfeldt, Sabine; Rigato, Cristina; Eeg-Olofsson, Måns

    2015-01-01

    Purpose The objective of this pilot study was to investigate if an active bone conduction implant (BCI) used in an ongoing clinical study withstands magnetic resonance imaging (MRI) of 1.5 Tesla. In particular, the MRI effects on maximum power output (MPO), total harmonic distortion (THD), and demagnetization were investigated. Implant activation and image artifacts were also evaluated. Methods and materials One implant was placed on the head of a test person at the position corresponding to the normal position of an implanted BCI and applied with a static pressure using a bandage and scanned in a 1.5 Tesla MRI camera. Scanning was performed both with and without the implant, in three orthogonal planes, and for one spin-echo and one gradient-echo pulse sequence. Implant functionality was verified in-between the scans using an audio processor programmed to generate a sequence of tones when attached to the implant. Objective verification was also carried out by measuring MPO and THD on a skull simulator as well as retention force, before and after MRI. Results It was found that the exposure of 1.5 Tesla MRI only had a minor effect on the MPO, ie, it decreased over all frequencies with an average of 1.1±2.1 dB. The THD remained unchanged above 300 Hz and was increased only at lower frequencies. The retention magnet was demagnetized by 5%. The maximum image artifacts reached a distance of 9 and 10 cm from the implant in the coronal plane for the spin-echo and the gradient-echo sequence, respectively. The test person reported no MRI induced sound from the implant. Conclusion This pilot study indicates that the present BCI may withstand 1.5 Tesla MRI with only minor effects on its performance. No MRI induced sound was reported, but the head image was highly distorted near the implant. PMID:26604836

  10. Capillary force on a tilted cylinder: Atomic Force Microscope (AFM) measurements.

    Science.gov (United States)

    Kosgodagan Acharige, Sébastien; Laurent, Justine; Steinberger, Audrey

    2017-11-01

    The capillary force in situations where the liquid meniscus is asymmetric, such as the one around a tilted object, has been hitherto barely investigated even though these situations are very common in practice. In particular, the capillary force exerted on a tilted object may depend on the dipping angle i. We investigate experimentally the capillary force that applies on a tilted cylinder as a function of its dipping angle i, using a home-built tilting Atomic Force Microscope (AFM) with custom made probes. A micrometric-size rod is glued at the end of an AFM cantilever of known stiffness, whose deflection is measured when the cylindrical probe is dipped in and retracted from reference liquids. We show that a torque correction is necessary to understand the measured deflection. We give the explicit expression of this correction as a function of the probes' geometrical parameters, so that its magnitude can be readily evaluated. The results are compatible with a vertical capillary force varying as 1/cosi, in agreement with a recent theoretical prediction. Finally, we discuss the accuracy of the method for measuring the surface tension times the cosine of the contact angle of the liquid on the probe. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. AFM Surface Roughness and Topography Analysis of Lithium Disilicate Glass Ceramic

    Directory of Open Access Journals (Sweden)

    M. Pantić

    2015-12-01

    Full Text Available The aim of this study is presenting AFM analysis of surface roughness of Lithium disilicate glass ceramic (IPS e.max CAD under different finishing procedure (techniques: polishing, glazing and grinding. Lithium disilicate glass ceramics is all-ceramic dental system which is characterized by high aesthetic quality and it can be freely said that properties of material provide all prosthetic requirements: function, biocompatibility and aesthetic. Experimental tests of surface roughness were investigated on 4 samples with dimensions: 18 mm length, 14 mm width and 12 mm height. Contact surfaces of three samples were treated with different finishing procedure (polishing, glazing and grinding, and the contact surface of the raw material is investigated as a fourth sample. Experimental measurements were done using the Atomic Force Microscopy (AFM of NT-MDT manufacturers, in the contact mode. All obtained results of different prepared samples are presented in the form of specific roughness parameters (Rа, Rz, Rmax, Rq and 3D surface topography.

  12. AFM characterization of protein net formation on a fibrous medium

    Directory of Open Access Journals (Sweden)

    Assis O.B.G.

    2000-01-01

    Full Text Available Lysozyme protein net is set on a glass fiber support using the self-assembly technique. Enzymatic film formation is followed by surface imaging via atomic force microscopy (AFM. Change in roughness as a function of deposition time is used as an indirect indicator of film formation. The objective was to form a protein film that would have no effect on the permeability of the medium, aiming at its application as a bioactive membrane or reactor suitable for bacteria and chemical interactions in aqueous media.

  13. Optical fiber fluorescence spectroscopy for detecting AFM1 in milk

    Science.gov (United States)

    Mignani, A. G.; Cucci, C.; Ciaccheri, L.; Dall'Asta, C.; Galaverna, G.; Dossena, A.; Marchelli, R.

    2008-04-01

    Fluorescence spectroscopy carried out by means of optical fibers was used for the rapid screening of M1 aflatoxin in milk, enabling the detection of concentrations up to the legal limit, which is 50 ppt. A compact fluorometric device equipped with a LED source, a miniaturized spectrometer, and optical fibers for illumination/detection of the measuring micro-cell was tested for measuring threshold values of AFM1 in pre-treated milk samples. Multivariate processing of the spectral data made it possible to obtain a preliminary screening at the earlier stages of the industrial process, as well as to discard contaminated milk stocks before their inclusion in the production chain.

  14. Automated handling and assembly of customizable AFM-tips

    DEFF Research Database (Denmark)

    Bartenwerfer, M.; Eichhorn, V.; Jasper, D.

    2011-01-01

    for metrology are required. Two of the most important parameters are the line width and sidewall roughness of vertical interconnects and nanooptical structures. The measurement of these parameters becomes increasingly challenging as the continuous shrinking of dimensions requires higher lateral resolution....... The AFM has become a standard and widely spread instrument for characterizing such nanoscale devices and can be found in most of today's research and development areas. However, the characterization of three dimensional high-aspect ratio and sidewall structures is still a bottleneck. Novel exchangeable...

  15. Lateral Tip Control Effects in CD-AFM Metrology: The Large Tip Limit.

    Science.gov (United States)

    Dixson, Ronald G; Orji, Ndubuisi G; Goldband, Ryan S

    2016-01-25

    Sidewall sensing in critical dimension atomic force microscopes (CD-AFMs) usually involves continuous lateral dithering of the tip or the use of a control algorithm and fast response piezo actuator to position the tip in a manner that resembles touch-triggering of coordinate measuring machine (CMM) probes. All methods of tip position control, however, induce an effective tip width that may deviate from the actual geometrical tip width. Understanding the influence and dependence of the effective tip width on the dither settings and lateral stiffness of the tip can improve the measurement accuracy and uncertainty estimation for CD-AFM measurements. Since CD-AFM typically uses tips that range from 15 nm to 850 nm in geometrical width, the behavior of effective tip width throughout this range should be understood. The National Institute of Standards and Technology (NIST) has been investigating the dependence of effective tip width on the dither settings and lateral stiffness of the tip, as well as the possibility of material effects due to sample composition. For tip widths of 130 nm and lower, which also have lower lateral stiffness, the response of the effective tip width to lateral dither is greater than for larger tips. However, we have concluded that these effects will not generally result in a residual bias, provided that the tip calibration and sample measurement are performed under the same conditions. To validate that our prior conclusions about the dependence of effective tip width on lateral stiffness are valid for large CD-tips, we recently performed experiments using a very large non-CD tip with an etched plateau of approximately 2 μm width. The effective lateral stiffness of these tips is at least 20 times greater than typical CD-AFM tips, and these results supported our prior conclusions about the expected behavior for larger tips. The bottom-line importance of these latest observations is that we can now reasonably conclude that a dither slope of 3 nm

  16. Comorbidity of conduct disorder symptoms and internalising problems in children: investigating a community and a clinical sample.

    Science.gov (United States)

    Polier, Georg G; Vloet, Timo D; Herpertz-Dahlmann, Beate; Laurens, Kristin R; Hodgins, Sheilagh

    2012-01-01

    Previous studies have demonstrated that many children with conduct problems (CP) also show internalising psychopathology (IP). However, it remains unclear whether the presence of IP serves as a protective or risk factor for the severity and development of CP. The aim of the present study was to assess the prevalence and associations of comorbid IP in children with CP in a community and a clinical sample. Data from boys as well as girls with CP in the clinical range were obtained from a community sample (n = 1,160) and a clinical sample diagnosed with disruptive behaviour disorder (n = 193) from two European countries. In the community sample, information was obtained using the strengths and difficulties questionnaire, whereas in the clinical sample, the child behaviour checklist was used. Internalising disorders, according to ICD-10, were also assessed in the clinical sample. For both samples, age, gender, and impact of comorbid IP in the clinical range (above 90th percentile) for CP were explored. Results revealed that in both samples, participants with CP showed a high rate of comorbid IP (community sample: 35%; clinical sample: 78%). Participants with comorbid IP were more likely to experience social problems with peers. In the clinical sample, comorbid IP rated by the parents was more prevalent than internalising disorders according to ICD-10. Boys with CP and comorbid IP demonstrated a higher severity of externalising behaviour than boys without comorbid IP in the clinical sample. We concluded that in both samples, we found a high co-occurrence of CP and IP. Based on the idea that the co-occurrence of IP and CP in children and adolescents may potentially lead to increased antisocial behaviour, internalising psychopathology should be carefully investigated. Effective strategies and specific risk factors must be evaluated to treat comorbidity as early as possible in children with CP and IP.

  17. Interactions between chitosan and cells measured by AFM

    Energy Technology Data Exchange (ETDEWEB)

    Hsiao, Sheng-Wen; Thien, Doan Van Hong; Ho, Ming-Hua [Department of Chemical Engineering, National Taiwan University of Science and Technology, Taipei 10617, Taiwan (China); Hsieh, Hsyue-Jen [Department of Chemical Engineering, National Taiwan University, Taipei 10617, Taiwan (China); Li, Chung-Hsing [Division of Orthodontics and Pediatric Dentistry, Department of Dentistry, Tri-Service General Hospital, Taipei, Taiwan (China); Hung, Chang-Hsiang [Department of Dentistry, Kinmen Hospital Department of Health, Taiwan (China); Li, Hsi-Hsin, E-mail: mhho@mail.ntust.edu.t [Deputy Superintendent, Kinmen Hospital Department of Health, Taiwan (China)

    2010-10-01

    Chitosan, a biocompatible material that has been widely used in bone tissue engineering, is believed to have a high affinity to osteoblastic cells. This research is the first to prove this hypothesis. By using atomic force microscopy (AFM) with a chitosan-modified cantilever, quantitative evaluation of the interforce between chitosan and cells was carried out. A chitosan tip functionalized with Arg-Gly-Asp (RGD) was also used to measure the interforce between RGD-chitosan and osteoblastic cells. This research concluded by examining cell adhesion and spreading of chitosan substrates as further characterization of the interactions between cells and chitosan. The force measured by AFM showed that the interforce between chitosan and osteoblasts was the highest (209 nN). The smallest adhesion force (61.8 nN) appeared between chitosan and muscle fibroblasts, which did not demonstrate any osteoblastic properties. This result proved that there was a significant interaction between chitosan and bone cells, and correlated with the observations of cell attachment and spreading. The technique developed in this research directly quantified the adhesion between chitosan and cells. This is the first study to demonstrate that specific interaction exists between chitosan and osteoblasts.

  18. AFM analysis of bleaching effects on dental enamel microtopography

    Energy Technology Data Exchange (ETDEWEB)

    Pedreira de Freitas, Ana Carolina, E-mail: anacarolfreitas@usp.br [Departamento de Dentistica, Faculdade de Odontologia da Universidade de Sao Paulo, Av. Prof. Lineu Prestes, 2227 - Cidade Universitaria, CEP 05508-000, Sao Paulo (Brazil); Cardoso Espejo, Luciana, E-mail: luespejo@hotmail.com [Departamento de Dentistica, Faculdade de Odontologia da Universidade de Sao Paulo, Av. Prof. Lineu Prestes, 2227 - Cidade Universitaria, CEP 05508-000, Sao Paulo (Brazil); Brossi Botta, Sergio, E-mail: sbbotta@usp.br [Departamento de Dentistica, Faculdade de Odontologia da Universidade de Sao Paulo, Av. Prof. Lineu Prestes, 2227 - Cidade Universitaria, CEP 05508-000, Sao Paulo (Brazil); Sa Teixeira, Fernanda de, E-mail: nandast@if.usp.br [Laboratorio de Filmes Finos, Instituto de Fisica da Universidade de Sao Paulo, Rua do Matao, Travessa R, 187 - Cidade Universitaria, CEP 05314-970, Sao Paulo (Brazil); Cerqueira, Luz Maria Aparecida A., E-mail: maacluz@usp.br [Departamento de Dentistica, Faculdade de Odontologia da Universidade de Sao Paulo, Av. Prof. Lineu Prestes, 2227 - Cidade Universitaria, CEP 05508-000, Sao Paulo (Brazil); Garone-Netto, Narciso, E-mail: ngarone@usp.br [Departamento de Dentistica, Faculdade de Odontologia da Universidade de Sao Paulo, Av. Prof. Lineu Prestes, 2227 - Cidade Universitaria, CEP 05508-000, Sao Paulo (Brazil); Bona Matos, Adriana, E-mail: bona@usp.br [Departamento de Dentistica, Faculdade de Odontologia da Universidade de Sao Paulo, Av. Prof. Lineu Prestes, 2227 - Cidade Universitaria, CEP 05508-000, Sao Paulo (Brazil); Barbosa da Silveira Salvadori, Maria Cecilia, E-mail: mcsalva@if.usp.br [Laboratorio de Filmes Finos, Instituto de Fisica da Universidade de Sao Paulo, Rua do Matao, Travessa R, 187 - Cidade Universitaria, CEP 05314-970, Sao Paulo (Brazil)

    2010-02-15

    The purpose of this in vitro study was to test a new methodology to evaluate the effects of 35% hydrogen peroxide agent on the microtopography of sound enamel using an atomic force microscope (AFM). The buccal sound surfaces of three extracted human lower incisors were used, without polishing the surfaces to maintain them with natural morphology. These unpolished surfaces were subjected to bleaching procedure with 35% hydrogen peroxide that consisted of 4 applications of the bleaching agent on enamel surfaces for 10 min each application. Surface images were obtained in a 15 {mu}m x 15 {mu}m area using an AFM. The roughness (Ra and RMS) and the power spectral density (PSD) were obtained before and after the bleaching treatment. As results we could inquire that the PSD analyses were very suitable to identifying the morphological changes on the surfaces, while the Ra and RMS parameters were insufficient to represent the morphological alterations promoted by bleaching procedure on enamel. The morphological wavelength in the range of visible light spectrum (380-750 nm) was analyzed, showing a considerable increase of the PSD with the bleaching treatment.

  19. In-situ AFM and EIS study of a solventborne alkyd coating with nanoclay for corrosion protection of carbon steel

    OpenAIRE

    Jing, Li; Ecco, Luiz; Fedel, Michele; Ermini, Valentina; Delmas, Gregory; Pan, Jinshan

    2015-01-01

    A solventborne alkyd composite coating containing modified montmorillonite (MMT) nanoclay was made on carbon steel, and its corrosion protection was investigated by in-situ atomic force microscopy (AFM) and electrochemical impedance spectroscopy (EIS) measurements in 3 wt.% NaCl solution. X-ray diffraction (XRD) analysis indicated intercalation of the MMT sheets in the composite coating. Thermo-gravimetric analysis (TGA) demonstrated improved thermal stability of the composite coating due to ...

  20. Analysis of local deformation effects in resistive strain sensing of a submicron-thickness AFM cantilever

    Science.gov (United States)

    Adams, Jonathan D.; Schwalb, Christian H.; Winhold, Marcel; Šńukić, Maja; Huth, Michael; Fantner, Georg E.

    2013-05-01

    Incorporating resistive strain-sensing elements into MEMS devices is a long-standing approach for electronic detection of the device deformation. As the need for more sensitivity trends the device dimensions downwards, the size of the strain-sensor may become comparable to the device size, which can have significant impact on the mechanical behaviour of the device. To study this effect, we modelled a submicron-thickness silicon nitride AFM cantilever with strain-sensing element. Using finite element analysis, we calculated the strain in the sensor elements for a deflected cantilever. The sensor element contributes to a local stiffening effect in the device structure which lowers the strain in the sensor. By varying the sensor geometry, we investigated the degree to which this effect impacts the strain. Minimizing the sensor size increases the strain, but the reduction in sensor cross-sectional area increases the resistance and expected sensor noise. The optimal sensor geometry must therefore account for this effect. We used our analysis to optimize geometric variations of nanogranular tunnelling resistor (NTR) strain sensors arranged in a Wheatstone bridge on a silicon nitride AFM cantilever. We varied the dimensions of each sensor element to maintain a constant cross-sectional area but maximize the strain in the sensor element. Through this approach, we expect a 45% increase in strain in the sensor and corresponding 20% increase in the Wheatstone bridge signal. Our results provide an important consideration in the design geometry of resistive strainsensing elements in MEMS devices.

  1. Adhesive interaction measured between AFM probe and lung epithelial type II cells.

    Science.gov (United States)

    Leonenko, Zoya; Finot, Eric; Amrein, Matthias

    2007-10-01

    The toxicity of inhaled nanoparticles entering the body through the lung is thought to be initially defined by the electrostatic and adhesive interaction of the particles with lung's wall. Here, we investigated the first step of the interaction of nanoparticles with lung epithelial cells using atomic force microscope (AFM) as a force apparatus. Nanoparticles were modeled by the apex of the AFM tip and the forces of interaction between the tip and the cell analyzed over time. The adhesive force and work of adhesion strongly increased for the first 100s of contact and then leveled out. During this time, the tip was penetrating deeply into the cell. It first crossed a stiff region of the cell and then entered a much more compliant cell region. The work of adhesion and its progression over time were not dependent on the load with which the tip was brought into contact with the cell. We conclude that the initial thermodynamic aspects and the time course of the uptake of nanoparticles by lung epithelial cells can be studied using our experimental approach. It is discussed how the potential health threat posed by nanoparticles of different size and surface characteristics can be evaluated using the method presented.

  2. Acquire an Bruker Dimension FastScan (trademark) Atomic Force Microscope (AFM) for Materials, Physical and Biological Science Research and Education

    Science.gov (United States)

    2016-04-14

    property information (deformation, adhesion, DMT modulus, and dissipation). Most AFM studies to date have been conducted at ambient temperature...shape of particles. Four different solvent systems, namely, Et2O, THF, Acetone and THF-Et2O mixture, were used to prepare a series of Sample Code

  3. Device level 3D characterization using PeakForce AFM

    Science.gov (United States)

    Timoney, Padraig; Zhang, Xiaoxiao; Vaid, Alok; Hand, Sean; Osborne, Jason; Milligan, Eric; Feinstein, Adam

    2016-03-01

    Traditional metrology solutions face a range of challenges at the 1X node such as three dimensional (3D) measurement capabilities, shrinking overlay and critical dimension (CD) error budgets driven by multi-patterning and via in trench CD measurements. With advent of advanced technology nodes and 3D processing, an increasing need is emerging for in-die metrology including across-structure and structure-to-structure characterization. A myriad of work has emerged in the past few years intending to address these challenges from various aspects; in-die OCD with reduced spot size and tilt beam on traditional critical dimension scanning electron microscopy (CDSEM) for height measurements. This paper explores the latest capability offered by PeakForceTM Tapping Atomic Force Microscopy (PFT-AFM). The use of traditional harmonic tapping mode for scanning high aspect ratio, and complex "3D" wafer structures, results in limited depth probing capability as well as excessive tip wear. These limitations arise due to the large tip-sample interaction volume in such confined spaces. PeakForce Tapping eliminates these limitations through direct real time control of the tip-sample interaction contact force. The ability of PeakForce to measure, and respond directly to tip- sample interaction forces results in more detailed feature resolution, reduced tip wear, and improved depth capability. In this work, the PFT-AFM tool was applied for multiple applications, including the 14nm fin and replacement metal gate (RMG) applications outlined below. Results from DOE wafers, detailed measurement precision studies and correlation to reference metrology are presented for validation of this methodology. With the fin application, precision of 0.3nm is demonstrated by measuring 5 dies with 10 consecutive runs. Capability to resolve within-die and localized within-macro height variation is also demonstrated. Results obtained from the fin measurements support the increasing trend that measurements

  4. Electronic structure and self-assembling processes in platinum metalloporphyrins: photoemission and AFM studies

    Science.gov (United States)

    Belogorokhov, A. I.; Bozhko, S. I.; Chaika, A. N.; Ionov, A. M.; Trophimov, S. A.; Rumiantseva, V. D.; Vyalikh, D.

    2009-03-01

    The main goal of this paper is to investigate the electronic structure of valence band and core levels as well as surface topography of pristine tetraphenylporphyrin and Pt-based compounds Pt-TPP(p-COOH3)4, Pt-TPP(m-OCH3)4, PtCl2-TPP(m-OCH3)4 thin films. The electronic structure of various Pt-based metalloporphyrins which were investigated in dependence on their chemical structure and spectra were measured by high-resolution X-ray photoelectron spectroscopy (XPS) of valence band and Pt4f, Pt4d, C1s, O1s, N1s core levels. Results of atomic force microscopy (AFM) studies of topography and self-assembling processes in thin films of porphyrines are presented and discussed.

  5. Application of focused ion beam for the fabrication of AFM probes

    Science.gov (United States)

    Kolomiytsev, A. S.; Lisitsyn, S. A.; Smirnov, V. A.; Fedotov, A. A.; Varzarev, Yu N.

    2017-10-01

    The results of an experimental study of the probe tips fabrication for critical-dimension atomic force microscopy (CD-AFM) using the focused ion beam (FIB) induced deposition are presented. Methods of the FIB-induced deposition of tungsten and carbon onto the tip of an AFM probe are studied. Based on the results obtained in the study, probes for the CD-AFM technique with a tip height about 1 μm and radius of 20 nm were created. The formation of CD-AFM probes by FIB-induced deposition allows creating a high efficiency tool for nanotechnology and nanodiagnostics. The use of modified cantilevers allows minimizing the artefacts of AFM images and increasing the accuracy of the relief measurement. The obtained results can be used for fabrication of AFM probes for express monitoring of the technological process in the manufacturing of the elements for micro- and nanoelectronics.

  6. Is ADHD a Risk Factor Independent of Conduct Disorder for Illicit Substance Use? A Meta-Analysis and Meta-Regression Investigation

    Science.gov (United States)

    Serra-Pinheiro, Maria Antonia; Coutinho, Evandro S. F.; Souza, Isabella S.; Pinna, Camilla; Fortes, Didia; Araujo, Catia; Szobot, Claudia M.; Rohde, Luis A.; Mattos, Paulo

    2013-01-01

    Objective: To investigate meta-analytically if the association between ADHD and illicit substance use (ISU) is maintained when controlling for conduct disorder/oppositional-defiant disorder (CD/ODD). Method: A systematic literature review was conducted through Medline from 1980 to 2008. Data extracted and selections made by one author were…

  7. Investigation of the Effect of Mixing Methods and Chemical Treatments on the Conductivity of the CNT/PLA Based Composites

    Science.gov (United States)

    Talwar, Brijpal Singh

    The growing popularity of Poly lactic acid (PLA) is mainly due to its biocompatibility, good mechanical properties, and its synthesis from renewable resources. PLA can be compounded with electrically conductive fillers (e.g., carbon nanotubes (CNTs)) to form conductive polymer composites (CPCs). These fillers provide conductive functionality to the composite material by forming percolation paths. Featuring very low weight densities, CPCs have the potential to replace metals in the electronic industry, if they exhibit similar electrical conductivities to that of the metals. The current challenges being faced during the mixing of CNTs in the polymer matrix are: formation of aggregates due to strong van der Waals forces and breakage of CNTs during dispersion. In this study, we compare: (1) two fabrication methods to create CPCs (i.e., solution mixing by sonication and melt extrusion) (2) effect of various CNT functionalization techniques (i.e., acid and plasma treatments) on the conductivity of CPCs and (3) effect of using binding molecules like para-phenylenediamine, that act as bridges in between the CNTs in the CPCs and its effect on the conductivity of CPCs. Such conductive composite materials find widespread technological applications which either require, or could benefit from, the ability to pattern micro-sized features in two-dimensional (2D) and three-dimensional (3D) architectures. Direct-write fabrication technique is used to realise these printed patterns, using the CPC solution as ink. First, the composites comprising of 30% PLA by weight in Dichloromethane (DCM) and CNTs in different concentrations (up to 5wt. %) are fabricated using a two-step sonication method (i.e., dissolving PLA in DCM and then dispersing the CNTs in this polymer solution). Second, CPCs are fabricated using a twin screw micro extruder operating at 180°C. To verify the effects of functionalization of the CNTs on the conductivity of composites, the CNTs are functionalized by three

  8. Optimization of functionalization conditions for protein analysis by AFM

    Energy Technology Data Exchange (ETDEWEB)

    Arroyo-Hernández, María, E-mail: maria.arroyo@ctb.upm.es [Centro de Tecnología Biomédica, Universidad Politécnica de Madrid, 28223 Pozuelo de Alarcón, Madrid (Spain); Departamento de Ciencia de Materiales, ETSI Caminos, Canales y Puertos, Universidad Politécnica de Madrid, 28040 Madrid (Spain); Daza, Rafael; Pérez-Rigueiro, Jose; Elices, Manuel; Nieto-Márquez, Jorge; Guinea, Gustavo V. [Centro de Tecnología Biomédica, Universidad Politécnica de Madrid, 28223 Pozuelo de Alarcón, Madrid (Spain); Departamento de Ciencia de Materiales, ETSI Caminos, Canales y Puertos, Universidad Politécnica de Madrid, 28040 Madrid (Spain)

    2014-10-30

    Highlights: • Highest fluorescence is obtained for central conditions. • Largest primary amine contribution is obtained for central conditions. • RMS roughness is smaller than 1 nm for all functional films. • Selected deposition conditions lead to proper RMS and functionality values. • LDH proteins adsorbed on AVS-films were observed by AFM. - Abstract: Activated vapor silanization (AVS) is used to functionalize silicon surfaces through deposition of amine-containing thin films. AVS combines vapor silanization and chemical vapor deposition techniques and allows the properties of the functionalized layers (thickness, amine concentration and topography) to be controlled by tuning the deposition conditions. An accurate characterization is performed to correlate the deposition conditions and functional-film properties. In particular, it is shown that smooth surfaces with a sufficient surface density of amine groups may be obtained with this technique. These surfaces are suitable for the study of proteins with atomic force microscopy.

  9. Single molecule dynamics of polyproline by using AFM

    Science.gov (United States)

    Tamamushi, Hironori; Kawakami, Masaru; Furukawa, Hidemitsu

    2017-04-01

    Polyproline forms a unique structure, called polyproline helix. It takes polyproline II helix in water and Polyproline I helix in n-propanol. PP II is known to be a rigid molecule in spite of no hydrogen bonds between backbone atoms, and to play an important role in biological functions such as formation of collagen structure and in the cell-adhesion. In this study, we carried out single molecule force spectroscopy of polyproline with AFM(Atomic Force Microscope) and covalent immobilization of polyproline molecule on gold substrate to evaluate the rigidity of PP II at single molecule level. We found that the force-extension curve of polyproline shows a linear increase, which is unusual and not seen with others homo-polypeptide molecules. These results indicate that the high rigidity of polyproline II helix can be explained by "enthalpic", not "entropic" driven elasticity.

  10. Molecular motion in polymer electrolytes. An investigation of methods for improving the conductivity of solid polymer electrolytes

    CERN Document Server

    Webster, M I

    2002-01-01

    Three methods were explored with a view to enhancing the ionic conductivity of polymer electrolytes; namely the addition of an inert, inorganic filler, the addition of a plasticizer and the incorporation of the electrolyte in the pores of silica matrices. There have been a number of reports, which suggest the addition of nanocrystalline oxides to polymer electrolytes increases the ionic conductivities by about a factor of two. In this thesis studies of the polymer electrolyte NaSCN.P(EO) sub 8 with added nanocrystalline alumina powder are reported which show no evidence of enhanced conductivity. The addition of a plasticizer to polymer electrolytes will increase the ionic conductivity. A detailed study was made of the polymer electrolytes LiT.P(EO) sub 1 sub 0 and LiClO sub 4.P(EO) sub 1 sub 0 with added ethylene carbonate plasticizer. The conductivities showed an enhancement, however this disappeared on heating under vacuum. The present work suggests that the plasticised system is not thermodynamically stabl...

  11. Understanding the mechanisms that change the conductivity of damaged ITO-coated polymeric films: A micro-mechanical investigation

    KAUST Repository

    Nasr Saleh, Mohamed

    2014-11-01

    Degradation from mechanical loading of transparent electrodes made of indium tin oxide (ITO) endangers the integrity of any material based on these electrodes, including flexible organic solar cells. However, how different schemes of degradation change the conductivity of ITO devices remains unclear. We propose a systematic micro-mechanics-based approach to clarify the relationship between degradation and changes in electrical resistance. By comparing experimentally measured channel crack densities to changes in electrical resistance returned by the different micro-mechanical schemes, we highlight the key role played by the residual conductivity in the interface between the ITO electrode and its substrate after delamination. We demonstrate that channel cracking alone does not explain the experimental observations. Our results indicate that delamination has to take place between the ITO electrode and the substrate layers and that the residual conductivity of this delaminated interface plays a major role in changes in electrical resistance of the degraded device. © 2014 Elsevier B.V.

  12. Investigation of the effect of laponite and crosslinkers on thermal, mechanical, swelling and conductive properties of the phtagel composite films

    Science.gov (United States)

    Ekici, Sema; Gungor, Gizem

    2017-03-01

    Phytagel (PHG)-laponite (L) composites were prepared in the form of films by using PHG known to be biocompatible with the body, L clay which has electrical conductivity, and weak and strong crosslinkers, i.e., 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (E) and Cu2+, respectively. Composites were obtained by using laponite in two different ratios and only one concentration of Cu2+. Bare PHG and PHG films crosslinked with E were also prepared simultaneously and characterization of all the films are presented comparatively. Cu2+ ions are more effective crosslinkers than E molecules for PHG chains and increased the mechanical strength of composites as revealed in swelling studies and differential scanning calorimetry analysis. It was determined that laponite and Cu2+ ions increased the conductivity of PHG hydrogel and conductivity decreased when the amount of laponite is increased. Wet film samples had conductivity between 0.95 × 10-8 and 5.94 × 10-8 S cm-1 values, while dry films were not conductive. Wet PHG, PHG-E, PHG-E-L1, and PHG-E-L2 films showed bending deformation towards the anode under electric field of 25 V in magnitude, while wet PHG-Cu-L2 films tended to bend towards the cathode side. It was concluded that these composites are intelligent hydrogel composites which can respond to stimuli such as environmental pH and electric field changes and can be considered for use in studies involving low electrical conductivity.

  13. Multiple regimes of operation in bimodal AFM: understanding the energy of cantilever eigenmodes

    Directory of Open Access Journals (Sweden)

    Daniel Kiracofe

    2013-06-01

    Full Text Available One of the key goals in atomic force microscopy (AFM imaging is to enhance material property contrast with high resolution. Bimodal AFM, where two eigenmodes are simultaneously excited, confers significant advantages over conventional single-frequency tapping mode AFM due to its ability to provide contrast between regions with different material properties under gentle imaging conditions. Bimodal AFM traditionally uses the first two eigenmodes of the AFM cantilever. In this work, the authors explore the use of higher eigenmodes in bimodal AFM (e.g., exciting the first and fourth eigenmodes. It is found that such operation leads to interesting contrast reversals compared to traditional bimodal AFM. A series of experiments and numerical simulations shows that the primary cause of the contrast reversals is not the choice of eigenmode itself (e.g., second versus fourth, but rather the relative kinetic energy between the higher eigenmode and the first eigenmode. This leads to the identification of three distinct imaging regimes in bimodal AFM. This result, which is applicable even to traditional bimodal AFM, should allow researchers to choose cantilever and operating parameters in a more rational manner in order to optimize resolution and contrast during nanoscale imaging of materials.

  14. High-frequency conductivity of optically excited charge carriers in hydrogenated nanocrystalline silicon investigated by spectroscopic femtosecond pump–probe reflectivity measurements

    Energy Technology Data Exchange (ETDEWEB)

    He, Wei [University of Birmingham, School of Physics and Astronomy, Birmingham B15 2TT (United Kingdom); Yurkevich, Igor V. [Aston University, Nonlinearity and Complexity Research Group, Birmingham B4 7ET (United Kingdom); Zakar, Ammar [University of Birmingham, School of Physics and Astronomy, Birmingham B15 2TT (United Kingdom); Kaplan, Andrey, E-mail: a.kaplan.1@bham.ac.uk [University of Birmingham, School of Physics and Astronomy, Birmingham B15 2TT (United Kingdom)

    2015-10-01

    We report an investigation into the high-frequency conductivity of optically excited charge carriers far from equilibrium with the lattice. The investigated samples consist of hydrogenated nanocrystalline silicon films grown on a thin film of silicon oxide on top of a silicon substrate. For the investigation, we used an optical femtosecond pump–probe setup to measure the reflectance change of a probe beam. The pump beam ranged between 580 and 820 nm, whereas the probe wavelength spanned 770 to 810 nm. The pump fluence was fixed at 0.6 mJ/cm{sup 2}. We show that at a fixed delay time of 300 fs, the conductivity of the excited electron–hole plasma is described well by a classical conductivity model of a hot charge carrier gas found at Maxwell–Boltzmann distribution, while Fermi–Dirac statics is not suitable. This is corroborated by values retrieved from pump–probe reflectance measurements of the conductivity and its dependence on the excitation wavelength and carrier temperature. The conductivity decreases monotonically as a function of the excitation wavelength, as expected for a nondegenerate charge carrier gas. - Highlights: • We study high‐frequency conductivity of excited hydrogenated nanocrystalline silicon. • Reflectance change was measured as a function of pump and probe wavelength. • Maxwell–Boltzmann transport theory was used to retrieve the conductivity. • The conductivity decreases monotonically as a function of the pump wavelength.

  15. 25 CFR 900.196 - Do covered services include the conduct of clinical studies and investigations and the provision...

    Science.gov (United States)

    2010-04-01

    ..., AND INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF..., whether government, contractor, or employee-owned, used to transport passengers for medical services.) ... 25 Indians 2 2010-04-01 2010-04-01 false Do covered services include the conduct of clinical...

  16. Investigation on the Effect of NiZn Ferrite on the Mechanical and Thermal Conductivity of PLA/LNR Nanocomposites

    Directory of Open Access Journals (Sweden)

    Mou’ad A. Tarawneh

    2013-01-01

    Full Text Available The mechanical and conductivity of magnetic polymer nanocomposite (MPNC of nickel zinc (NiZn ferrite nanoparticles incorporated with poly(lactic acid (PLA and liquid natural rubber (LNR as compatibilizer is reported. The matrix was prepared from PLA and LNR in the ratio of 90 : 10. The MPNC of PLA/LNR/NiZn ferrite then was prepared via Thermo Haake internal mixer using melt-blending method from different filler loading from 1–5 wt% NiZn ferrite. The result of tensile tests showed that as the filler loading increases, the tensile strength also increases until an optimum value of filler loading was reached. Young’s modulus, tensile strength, and elongation at break have also increased. The study proves that NiZn ferrite is an excellent reinforcement filler in PLA/LNR matrix. The optimum thermal conductivity of PLA/LNR composites achieved with (4 wt% NiZn due to the effective combination of NiZn-NiZn conductive networks. The scanning electron micrograph (SEM reveal that the aspect ratio and filler orientation in the PLA/LNR matrix also strongly promoted interfacial adhesion between the filler and the matrix to control its properties.

  17. AFM studies of DNA structures extracted from adriamycin treated and non-treated Ehrlich tumor cells

    Directory of Open Access Journals (Sweden)

    M. AVRAMOV IVIC

    2005-06-01

    Full Text Available Atomic force microscopy (AFM, a unique tool to investigate drug treatment of cancer cells, was used to analyze the anti-neoplastic activity of adriamycin by comparing DNA structures of non-treated and adriamycin-treated Ehrlich tumor cells. The non-treated cells exhibited a highly branched intact chromatin structure, related to the intensive DNA replication in cancer cells. Images from adriamycin-treated tumor cells showed that the DNA chains were broken and the chromatin structure had been destroyed. Possible explanations for these effects of adriamycin are considered: breakage of hydrogen bonding, oxidation and intercalation effects, as well as the poisoning of topoisomerase enzyme. DNA fractal andmultifractal analyses, performed in order to evaluate the degree of bond scission, showed that the treated DNA had become more fractal compared to non-treated DNA.

  18. AFM and SEM characterization of non-toxic vanadium-free Ti alloys used as biomaterials

    Energy Technology Data Exchange (ETDEWEB)

    Morant, C.; Lopez, M.F.; Gutierrez, A.; Jimenez, J.A

    2003-12-30

    In this work, three titanium alloys have been studied by means of atomic force microscopy (AFM) and scanning electron microscopy (SEM) to determine their surface topography. The alloys investigated were Ti-6Al-7Nb, Ti-13Nb-13Zr, and Ti-15Zr-4Nb, with no presence of the toxic element V, and with a possible use as biomaterials for osteoarticular prostheses. These alloys were studied at room temperature and also after a thermal treatment at 750 deg. C during 24 h, which produces a protective surface oxide layer. The aim of the present work is to compare the surface structure and morphology of the alloys, both as-received and after the oxide layer was formed at elevated temperature.

  19. Quantitative mapping of the elastic modulus of soft materials with HarmoniX and PeakForce QNM AFM modes.

    Science.gov (United States)

    Dokukin, Maxim E; Sokolov, Igor

    2012-11-20

    The modulus of elasticity of soft materials on the nanoscale is of interest when studying thin films, nanocomposites, and biomaterials. Two novel modes of atomic force microscopy (AFM) have been introduced recently: HarmoniX and PeakForce QNM. Both modes produce distribution maps of the elastic modulus over the sample surface. Here we investigate the question of how quantitative these maps are when studying soft materials. Three different polymers with a macroscopic Young's modulus of 0.6-0.7 GPa (polyurethanes) and 2.7 GPa (polystyrene) are analyzed using these new modes. The moduli obtained are compared to the data measured with the other commonly used techniques, dynamic mechanical analyzer (DMA), regular AFM, and nanoindenter. We show that the elastic modulus is overestimated in both the HarmoniX and PeakForce QNM modes when using regular sharp probes because of excessively overstressed material in the samples. We further demonstrate that both AFM modes can work in the linear stress-strain regime when using a relatively dull indentation probe (starting from ~210 nm). The analysis of the elasticity models to be used shows that the JKR model should be used for the samples considered here instead of the DMT model, which is currently implemented in HarmoniX and PeakForce QNM modes. Using the JKR model and ~240 nm AFM probe in the PeakForce QNM mode, we demonstrate that a quantitative mapping of the elastic modulus of polymeric materials is possible. A spatial resolution of ~50 nm and a minimum 2 to 3 nm indentation depth are achieved.

  20. Determination of Morphological Parameters of Supported Gold Nanoparticles: Comparison of AFM Combined with Optical Spectroscopy and Theoretical Modeling versus TEM

    Directory of Open Access Journals (Sweden)

    Frank Hubenthal

    2012-07-01

    Full Text Available The morphology of small gold particles prepared by Volmer–Weber growth on sapphire substrates have been investigated by two different characterization techniques. First, by non-extensive atomic force microscopy (AFM in combination with optical spectroscopy and modeling of the optical properties using a theoretical model, recently developed in our group. Second, by extensive transmission electron microscopy (TEM. Comparing the results obtained with both techniques demonstrate that for small gold nanoparticles within the quasistatic limit, the morphological properties can be precisely determined by an appropriate theoretical modeling of the optical properties in combination with simple AFM measurements. The apparent mean axial ratio of the nanoparticles, i.e., the axial ratio that corresponds to the center frequency of the ensemble plasmon resonance, is obtained easily from the extinction spectrum. The mean size is determined by the nanoparticle number density and the amount of deposited material, measured by AFM and a quartz micro balance, respectively. To extract the most probable axial ratio of the nanoparticle ensemble, i.e., the axial ratio that corresponds to the most probable nanoparticle size in the ensemble, we apply the new theoretical model, which allows to extract the functional dependence of the nanoparticle shape on its size. The morphological parameters obtained with this procedure will be afterwards compared to extensive TEM measurements. The results obtained with both techniques yield excellent agreement. For example, the lateral dimensions of the nanoparticles after deposition of 15.2 × 1015 atoms/cm2 of gold has been compared. While a mean lateral diameter of (13 ± 2 nm has been extracted from AFM, optical spectroscopy and modeling, a value of (12 ± 2 nm is derived from TEM. The consistency of the results demonstrate the precision of our new model. Moreover, since our theoretical model allows to extract the functional

  1. Understanding Pt-ZnO:In Schottky nanocontacts by conductive atomic force microscopy

    Science.gov (United States)

    Chirakkara, Saraswathi; Choudhury, Palash Roy; Nanda, K. K.; Krupanidhi, S. B.

    2016-04-01

    Undoped and In doped ZnO (IZO) thin films are grown on Pt coated silicon substrates Pt/Si by pulsed laser deposition to fabricate Pt/ZnO:In Schottky diodes. The Schottky diodes were investigated by conventional two-probe current-voltage (I-V) measurements and by the I-V spectroscopy tool of conductive atomic force microscopy (C-AFM). The large deviation of the ideality factor from unity and the temperature dependent Schottky barrier heights (SBHs) obtained from the conventional method imply the presence of inhomogeneous interfaces. The inhomogeneity of SBHs is confirmed by C-AFM. Interestingly, the I-V curves at different points are found to be different, and the SBHs deduced from the point diodes reveal inhomogeneity at the nanoscale at the metal-semiconductor interface. A reduction in SBH and turn-on voltage along with enhancement in forward current are observed with increasing indium concentration.

  2. Nanoscale control of oxide interface conduction in graphene-complex-oxide heterostructures

    Science.gov (United States)

    Huang, Mengchen; Ryu, Sangwoo; Ghahari, Fereshte; Jnawali, Giriraj; Ravichandran, Jayakanth; Irvin, Patrick; Kim, Philip; Eom, Chang-Beom; Levy, Jeremy

    2014-03-01

    Graphene is a promising material for high-speed optoelectronic devices such as THz modulators and detectors. Recently, broadband THz emission and detection can be achieved with nanostructures at the LaAlO3/SrTiO3 interface [2]. We have mechanically exfoliated single layer and multilayer graphene on top of 3.4 unit cell LaAlO3/SrTiO3 and successfully sketched nanowires in the 2DEG underneath graphene using conductive AFM lithgraphy [3]. Raman and AFM investigations confirm that the graphene quality and surface morphology remain unaltered by the writing process. These first experimental demonstrations of integrating graphene and LaAlO3/SrTiO3 are promising for future DC-THz photonic applications. We gratefully acknowledge support for this work from ONR (N00014-13-1-0806), NSF(DMR-1124131, DMR-1104191), and AFOSR (FA9550-12-1-0342).

  3. Hematite/silver nanoparticle bilayers on mica--AFM, SEM and streaming potential studies.

    Science.gov (United States)

    Morga, Maria; Adamczyk, Zbigniew; Oćwieja, Magdalena; Bielańska, Elżbieta

    2014-06-15

    Bilayers of hematite/silver nanoparticles were obtained in the self-assembly process and thoroughly characterized using scanning electron microscopy (SEM), atomic force microscopy (AFM), and in situ streaming potential measurements. The hematite nanoparticles, forming a supporting layer, were 22 nm in diameter, exhibiting an isoelectric point at pH 8.9. The silver nanoparticles, used to obtain an external layer, were 29 nm in diameter, and remained negative within the pH range 3 to 11. In order to investigate the particle deposition, mica sheets were used as a model solid substrate. The coverage of the supporting layer was adjusted by changing the bulk concentration of the hematite suspension and the deposition time. Afterward, silver nanoparticle monolayers of controlled coverage were deposited under the diffusion-controlled transport. The coverage of bilayers was determined by a direct enumeration of deposited particles from SEM micrographs and AFM images. Additionally, the formation of the hematite/silver bilayers was investigated by streaming potential measurements carried out under in situ conditions. The effect of the mica substrate and the coverage of a supporting layer on the zeta potential of bilayers was systematically studied. It was established that for the coverage exceeding 0.20, the zeta potential of bilayers was independent on the substrate and the supporting layer coverage. This behavior was theoretically interpreted in terms of the 3D electrokinetic model. Beside significance for basic sciences, these measurements allowed to develop a robust method of preparing nanoparticle bilayers of controlled properties, having potential applications in catalytic processes. Copyright © 2014 Elsevier Inc. All rights reserved.

  4. 3D simulation of AFM non-uniform piezoelectric micro-cantilever with various geometries subjected to the tip-sample forces

    Science.gov (United States)

    Korayem, Alireza Habibnejad; Abdi, Moein

    2017-03-01

    Atomic force microscope (AFM) is a powerful instrument for investigation of surface topography at different workspaces. It is important to understand the dynamic behavior of AFM to improve its performance. 3D numerical method is suitable in order to simulate experimental conditions. This paper has investigated modeling and dynamic simulation of rectangular, Dagger and V-shaped geometries of AFM piezoelectric micro-cantilever (MC) with two electrode layers in the air environment. For a better understanding of the system dynamic, multi-layer MC dynamic equation has been derived. Euler-Bernoulli beam theory has been used for modeling the AFM cantilever. Hamilton's principle has been used for the MC modeling and the finite element method (FEM) has been applied for its discretization. In 3D, with respect to the tip-sample forces piezoelectric MC has been simulated via the COMSOL software. The frequency and time responses have been also investigated. The topographies have been performed on different surfaces with various roughness's types in the tapping and non-contact mode. The results of these two methods have been compared with experimental results. Moreover, the effects of MC geometrical parameters on surfaces topography and frequency responses have been studied and optimal dimensions of topographies have been obtained for each of the beam geometries. Simulations of various tip geometries have been performed in order to examine the effects of tip dimensions on the frequency and time responses. Furthermore, the effect of tip displacement on the frequency response has been investigated for different MC lengths.

  5. Investigation of effective thermal conductivity for pebble beds by one-way coupled CFD-DEM method for CFETR WCCB

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Lei [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); University of Science and Technology of China, Hefei, Anhui 230027 (China); Chen, Youhua [University of Science and Technology of China, Hefei, Anhui 230027 (China); Huang, Kai [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); Liu, Songlin, E-mail: slliu@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); University of Science and Technology of China, Hefei, Anhui 230027 (China)

    2016-05-15

    Highlights: • A CFD-DEM coupled numerical model is built based on the prototypical blanket pebble bed. • The numerical model can be applied to simulate heat transfer of a pebble bed and estimate effective thermal conductivity. • The numerical model agrees well with the theoretical SZB model. • Effective thermal conductivity of pebble beds for WCCB is estimated by the current model. - Abstract: The mono-sized beryllium pebble bed and the multi-sized Li{sub 2}TiO{sub 3}/Be{sub 12}Ti mixed pebble bed are the main schemes for the Water-cooled ceramic breeder blanket (WCCB) of China Fusion Engineering Test Reactor (CFETR). And the effective thermal conductivity (k{sub eff}) of the pebble beds is important to characterize the thermal performance of WCCB. In this study, a one-way coupled CFD-DEM method was employed to simulate heat transfer and estimate k{sub eff}. The geometric topology of a prototypical blanket pebble bed was produced by the discrete element method (DEM). Based on the geometric topology, the temperature distribution and the k{sub eff} were obtained by the computational fluid dynamics (CFD) analysis. The current numerical model presented a good performance to calculate k{sub eff} of the beryllium pebble bed, and according to the modeling of the Li{sub 2}TiO{sub 3}/Be{sub 12}Ti mixed pebble bed, k{sub eff} was estimated with values ranged between 2.0 and 4.0 W/(m∙K).

  6. Ab Initio -Based Bond Order Potential to Investigate Low Thermal Conductivity of Stanene Nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Cherukara, Mathew J. [Argonne National Lab. (ANL), Argonne, IL (United States). X-ray Sciences Division; Narayanan, Badri [Argonne National Lab. (ANL), Argonne, IL (United States). Center for Nanoscale Materials; Kinaci, Alper [Argonne National Lab. (ANL), Argonne, IL (United States). Center for Nanoscale Materials; Sasikumar, Kiran [Argonne National Lab. (ANL), Argonne, IL (United States). Center for Nanoscale Materials; Gray, Stephen K. [Argonne National Lab. (ANL), Argonne, IL (United States). Center for Nanoscale Materials; Univ. of Chicago, IL (United States). Computation Inst.; Chan, Maria K. Y. [Argonne National Lab. (ANL), Argonne, IL (United States). Center for Nanoscale Materials; Univ. of Chicago, IL (United States). Computation Inst.; Sankaranarayanan, Subramanian K. R. S. [Argonne National Lab. (ANL), Argonne, IL (United States). Center for Nanoscale Materials; Univ. of Chicago, IL (United States). Computation Inst.

    2016-08-28

    We introduce a bond order potential (BOP) for stanene based on an ab initio derived training data set. The potential is optimized to accurately describe the energetics, as well as thermal and mechanical properties of a free-standing sheet, and used to study diverse nanostructures of stanene, including tubes and ribbons. As a representative case study, using the potential, we perform molecular dynamics simulations to study stanene’s structure and temperature-dependent thermal conductivity. We find that the structure of stanene is highly rippled, far in excess of other 2-D materials (e.g., graphene), owing to its low in-plane stiffness (stanene: ~ 25 N/m; graphene: ~ 480 N/ m). The extent of stanene’s rippling also shows stronger temperature dependence compared to that in graphene. Furthermore, we find that stanene based nanostructures have significantly lower thermal conductivity compared to graphene based structures owing to their softness (i.e., low phonon group velocities) and high anharmonic response. Our newly developed BOP will facilitate the exploration of stanene based low dimensional heterostructures for thermoelectric and thermal management applications.

  7. An Investigation of Proton Conductivity of Vinyltriazole-Grafted PVDF Proton Exchange Membranes Prepared via Photoinduced Grafting

    Directory of Open Access Journals (Sweden)

    Sinan Sezgin

    2014-01-01

    Full Text Available Proton exchange membrane fuel cells (PEMFCs are considered to be a promising technology for clean and efficient power generation in the twenty-first century. In this study, high performance of poly(vinylidene fluoride (PVDF and proton conductivity of poly(1-vinyl-1,2,4-triazole (PVTri were combined in a graft copolymer, PVDF-g-PVTri, by the polymerization of 1-vinyl-1,2,4-triazole on a PVDF based matrix under UV light in one step. The polymers were doped with triflic acid (TA at different stoichiometric ratios with respect to triazole units and the anhydrous polymer electrolyte membranes were prepared. All samples were characterized by FTIR and 1H-NMR spectroscopies. Their thermal properties were examined by thermogravimetric analysis (TGA and differential scanning calorimetry (DSC. TGA demonstrated that the PVDF-g-PVTri and PVDF-g-PVTri-(TAx membranes were thermally stable up to 390°C and 330°C, respectively. NMR and energy dispersive X-ray spectroscopy (EDS results demonstrated that PVDF-g-PVTri was successfully synthesized with a degree of grafting of 21%. PVDF-g-PVTri-(TA3 showed a maximum proton conductivity of 6×10-3 Scm−1 at 150°C and anhydrous conditions. CV study illustrated that electrochemical stability domain for PVDF-g-PVTri-(TA3 extended over 4.0 V.

  8. Conductive-probe atomic force microscopy characterization of silicon nanowire

    Directory of Open Access Journals (Sweden)

    Yu Linwei

    2011-01-01

    Full Text Available Abstract The electrical conduction properties of lateral and vertical silicon nanowires (SiNWs were investigated using a conductive-probe atomic force microscopy (AFM. Horizontal SiNWs, which were synthesized by the in-plane solid-liquid-solid technique, are randomly deployed into an undoped hydrogenated amorphous silicon layer. Local current mapping shows that the wires have internal microstructures. The local current-voltage measurements on these horizontal wires reveal a power law behavior indicating several transport regimes based on space-charge limited conduction which can be assisted by traps in the high-bias regime (> 1 V. Vertical phosphorus-doped SiNWs were grown by chemical vapor deposition using a gold catalyst-driving vapor-liquid-solid process on higly n-type silicon substrates. The effect of phosphorus doping on the local contact resistance between the AFM tip and the SiNW was put in evidence, and the SiNWs resistivity was estimated.

  9. Tunnel transport through CoFe{sub 2}O{sub 4} barriers investigated by conducting atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Foerster, M; Rigato, F; Fontcuberta, J [Institut de Ciencia de Materials de Barcelona (ICMAB-CSIC), Campus UAB, 08193 Bellaterra (Spain); Bouzehouane, K, E-mail: mfoerster@icmab.e [Unite Mixte de Physique CNRS/Thales, Route Departementale 128, 91767 Orsay (France)

    2010-07-28

    Conducting atomic force microscopy has been used to monitor the quality of spin-filtering CoFe{sub 2}O{sub 4} tunnel barriers by mapping current as a function of their thickness. We show that appropriate film annealing leads to a substantial improvement of their tunnelling properties. The contact force between tip and sample was identified to have a determining influence on the width of the distribution P(I) in current maps, thus precluding its reliable use to infer barrier characteristics. Therefore, assessment of tunnel transport should be done by means of the typical current which is a well-defined parameter at a given contact force, rather than by the current distribution width.

  10. Investigation of high thermal contact conductance at low contact pressure for high-heat-load optical elements of synchrotron radiation

    Science.gov (United States)

    Takeuchi, T.; Tanaka, M.; Ohashi, H.; Goto, S.

    2013-09-01

    We measured the thermal-contact-conductance (TCC) of indirect cooling components in synchrotron radiation beamlines. To reduce the strain on the optical element, we explored conditions for insertion materials with a high TCC in region with low contact pressures of 0.1-1.0 MPa. We examined the TCC at the interface between oxygen-free copper (OFC) and insertion materials such as indium, graphite, and gold foil. The TCC depended on the hardness and thickness of the insertion material. Thin indium (20 μm thick) showed the highest TCC. Nickel and gold passivation on the OFC surface reduced the TCC to 30% of that for the bare OFC. Future work will involve exploring the passivation conditions of OFC for higher TCC is and measuring the TCC under cryogenic-cooling conditions.

  11. Modelling and Measurement Uncertainty Estimation for Integrated AFM-CMM Instrument

    DEFF Research Database (Denmark)

    Hansen, Hans Nørgaard; Bariani, Paolo; De Chiffre, Leonardo

    2005-01-01

    This paper describes modelling of an integrated AFM - CMM instrument, its calibration, and estimation of measurement uncertainty. Positioning errors were seen to limit the instrument performance. Software for off-line stitching of single AFM scans was developed and verified, which allows compensa......This paper describes modelling of an integrated AFM - CMM instrument, its calibration, and estimation of measurement uncertainty. Positioning errors were seen to limit the instrument performance. Software for off-line stitching of single AFM scans was developed and verified, which allows...... uncertainty of 0.8% was achieved for the case of surface mapping of 1.2*1.2 mm2 consisting of 49 single AFM scanned areas....

  12. Implementing atomic force microscopy (AFM) for studying kinetics of gold nanoparticle's growth

    DEFF Research Database (Denmark)

    Georgiev, P.; Bojinova, A.; Kostova, B.

    2013-01-01

    In a novel experimental approach Atomic Force Microscopy (AFM) was applied as a tool for studying the kinetics of gold nanoparticle growth. The gold nanoparticles were obtained by classical Turkevich citrate synthesis at two different temperatures. From the analysis of AFM images during the synth......In a novel experimental approach Atomic Force Microscopy (AFM) was applied as a tool for studying the kinetics of gold nanoparticle growth. The gold nanoparticles were obtained by classical Turkevich citrate synthesis at two different temperatures. From the analysis of AFM images during...... approach. We also compared AFM experimental data with Dynamic Light Scattering (DLS) and with Transmission Electron Microscopy (TEM) data. The experimental data from all the applied methods were fitted with two step Finke-Watzky kinetics model and the corresponding kinetics constants were obtained...

  13. AFM study of the thrombogenicity of carbon-based coatings for cardiovascular applications

    Energy Technology Data Exchange (ETDEWEB)

    Karagkiozaki, V. [Department of Physics, Laboratory for Thin Films-Nanosystems and Nanometrology (LTFN), Aristotle University of Thessaloniki, Thessaloniki GR-54124 (Greece); AHEPA Hospital, 1st Cardiology Department, Aristotle University of Thessaloniki, Thessaloniki GR-54124 (Greece); Logothetidis, S. [Department of Physics, Laboratory for Thin Films-Nanosystems and Nanometrology (LTFN), Aristotle University of Thessaloniki, Thessaloniki GR-54124 (Greece)], E-mail: logot@auth.gr; Laskarakis, A. [Department of Physics, Laboratory for Thin Films-Nanosystems and Nanometrology (LTFN), Aristotle University of Thessaloniki, Thessaloniki GR-54124 (Greece); Giannoglou, G. [AHEPA Hospital, 1st Cardiology Department, Aristotle University of Thessaloniki, Thessaloniki GR-54124 (Greece); Lousinian, S. [Department of Physics, Laboratory for Thin Films-Nanosystems and Nanometrology (LTFN), Aristotle University of Thessaloniki, Thessaloniki GR-54124 (Greece)

    2008-08-25

    The new nanotechnologies in biomaterials for cardiovascular applications target at surface alterations for prevention of platelets aggregation and subsequent clotting as their usual failure arises from thrombogenicity. Knowledge of structural properties of platelets during their adhesion on nanostructure materials is required to obtain a comprehensive understanding of their activation and the conventional imaging tools require special preparation of the samples and does not guarantee the viability of the cells. Thus, in this study, the atomic force microscope (AFM) which is a non-destructive and nanoscale precision technique is implemented for the study of platelets' adhesion onto amorphous hydrogenated carbon (a-C:H) thin films and a methodology is developed. Carbon-based thin films grown by magnetron sputtering under different deposition conditions are considered to meet the requirements for biomedical applications and were selected as well-characterized, case study materials. Platelet rich plasma drawn from healthy donors was used for the study of platelets adhesion onto the a-C:H films. The fourier transform IR phase modulated spectroscopic ellipsometry (FTIRSE) (900-3500 cm{sup -1}) being a powerful, non-destructive, optical technique was used for the investigation of bonding structure of the adherent platelets onto the a-C:H materials and the contribution of the different vibration bands of the platelet bonding groups was shown and discussed. The effect of nanostructure, surface properties and wettability of the carbon thin films on their thrombogenic potential was verified and it was found that the different deposition conditions determine their structural, surface and biological properties. Thus, the tailoring of surface properties of biomaterials and the informative study of platelets-nanomaterials interactions with AFM and FTIRSE will revolutionize the development of less thrombogenic biomaterials.

  14. Adsorption of albumin and sodium hyaluronate on UHMWPE: a QCM-D and AFM study.

    Science.gov (United States)

    Serro, A P; Degiampietro, K; Colaço, R; Saramago, B

    2010-06-15

    The biotribological properties of artificial joints, in particular the efficiency of the lubrication, strongly determine their lifetime. The most commonly used artificial joints combine a metallic or ceramic part articulating against a ultra high molecular weight polyethylene (UHMWPE) counterface, and are lubricated by the periprosthetic fluid. This fluid contains several macromolecules, namely albumin and sodium hyaluronate (NaHA), that are known to be involved in the lubrication process. There are several studies in the literature concerning the interaction of the referred macromolecules with ceramic or metallic prosthetic materials. However, to our knowledge, information about their binding to the polymeric surface is practically inexistent. The objective of this work is to contribute to clarify the role played by albumin and NaHA on the biolubrication process, through the investigation of their interaction with the UHMWPE surface. The study involves adsorption measurements using a quartz crystal microbalance with dissipation (QCM-D), the characterization of the adsorbed films by atomic force microscopy (AFM) and wettability determinations. Albumin was found to adsorb strongly and extensively to the polymer, while NaHA led to a very low adsorption. In both cases rigid films were obtained, but with different morphology and porosity. The high binding affinity of the protein to the polymer was demonstrated both by the results of the fittings to Langmuir and Freundlich models and by the values of the adhesion forces determined by AFM. In the simultaneous adsorption of albumin and NaHA, protein adsorption is predominant and determines the surface properties. Copyright 2010 Elsevier B.V. All rights reserved.

  15. Characterization of mineral-associated organic matter: a combined approach of AFM and NanoSIMS

    Science.gov (United States)

    Pohl, Lydia; Schurig, Christian; Eusterhues, Karin; Mueller, Carsten W.; Höschen, Carmen; Totsche, Kai-Uwe; Kögel-Knabner, Ingrid

    2016-04-01

    The heterogeneous spatial distribution and amount of organic matter (OM) in soils, especially at the micro- or submicron-scale, has major consequences for the soil microstructure and for the accessibility of OM to decomposing microbial communities. Processes occurring at the microscale control soil properties and processes at larger scales, such as macro-aggregation and carbon turnover. Since OM acts as substrate and most important driver for biogeochemical processes, particular attention should be paid to its spatial interaction with soil minerals. In contrast to bulk analysis, Nanoscale Secondary Ion Mass Spectrometry (NanoSIMS) offers the possibility to examine the composition and spatial distribution of OM within the intact organo-mineral matrix. Nevertheless, the yield of secondary electrons is influenced by the individual topography of the analysed particles, which aggravated the quantitative interpretation of the data. A combination of NanoSIMS and Atomic Force Microscopy (AFM), enabled us to visualize and quantify the topographical features of individual particles and correct the NanoSIMS data for this effect. We performed adsorption experiments with water-soluble soil OM in 6 concentration steps, which was extracted from forest floor layer of a Podzol, and adsorbed to illite. Upon the end of the sorption experiments the liquid phase and the solid phase were separated and the carbon content was analysed with TOC- and C/N-measurement, respectively. For the spatially resolved analyses, the samples were applied as thin layers onto silicon wafers and individual particles were chosen by means of the AFM. Subsequently, the identical particles were analysed with NanoSIMS to investigate the distribution of C, N, O, Si, P and Al. The recorded data were analysed for differences in elemental distribution between the different concentration steps. Additionally, we performed a correlation of the detectable counts with the topography of the particle within one

  16. Scanning probe microscopy investigation of complex-oxide heterostructures

    Science.gov (United States)

    Bi, Feng

    Advances in the growth of precisely tailored complex-oxide heterostructures have led to new emergent behavior and associated discoveries. One of the most successful examples consists of an ultrathin layer of LaAlO 3 (LAO) deposited on TiO2-terminated SrTiO3 (STO), where a high mobility quasi-two dimensional electron liquid (2DEL) is formed at the interface. Such 2DEL demonstrates a variety of novel properties, including field tunable metal-insulator transition, superconductivity, strong spin-orbit coupling, magnetic and ferroelectric like behavior. Particularly, for 3-unit-cell (3 u.c.) LAO/STO heterostructures, it was demonstrated that a conductive atomic force microscope (c-AFM) tip can be used to "write" or "erase" nanoscale conducting channels at the interface, making LAO/STO a highly flexible platform to fabricate novel nanoelectronics. This thesis is focused on scanning probe microscopy studies of LAO/STO properties. We investigate the mechanism of c-AFM lithography over 3 u.c. LAO/STO in controlled ambient conditions by using a vacuum AFM, and find that the water molecules dissociated on the LAO surface play a critical role during the c-AFM lithography process. We also perform electro-mechanical response measurements over top-gated LAO/STO devices. Simultaneous piezoresponse force microscopy (PFM) and capacitance measurements reveal a correlation between LAO lattice distortion and interfacial carrier density, which suggests that PFM could not only serve as a powerful tool to map the carrier density at the interface but also provide insight into previously reported frequency dependence of capacitance enhancement of top-gated LAO/STO structures. To study magnetism at the LAO/STO interface, magnetic force microscopy (MFM) and magnetoelectric force microscopy (MeFM) are carried out to search for magnetic signatures that depend on the carrier density at the interface. Results demonstrate an electronicallycontrolled ferromagnetic phase on top-gated LAO

  17. Theoretical Investigation by Quantum Mechanics on the Tunnel Diode Effect of Electric Conductive Characteristics and Haptic Sensing in MCF Rubber

    Directory of Open Access Journals (Sweden)

    Kunio Shimada

    2010-01-01

    Full Text Available By applying our developed intelligent fluid, magnetic compound fluid (MCF, to silicon oil rubber, we have made the MCF rubber highly sensitive to temperature and electric conduction. MCF is useful as the element material in haptic robot sensors and other related devices. In the present paper, we clarified the relationship between the electric current and the voltage under a tensile strain by utilizing the quantum mechanics theory on the multibarrier potential problem. The experimental results could be qualitatively explained by our proposed theory. The electrons can be moved between the solid materials by the tunnel effect. The relation between voltage and electric current is affected by the formation of the clusters, and it is changed by the application of heat. We also clarified experimentally the present MCF rubber useful in haptic sensors. Because the motions of humans and robots are different, the sensing of the rubber is different, depending on the placement. However, as for both motions of human and robot, there is no quantitative difference in the electric resistance among kinetic energy, momentum, and force. The sensing is also different based on the stiffness of the surface to which the sensor is adhered.

  18. DSM-IV defined conduct disorder and oppositional defiant disorder: an investigation of shared liability in female twins.

    Science.gov (United States)

    Knopik, V S; Bidwell, L C; Flessner, C; Nugent, N; Swenson, L; Bucholz, K K; Madden, P A F; Heath, A C

    2014-04-01

    DSM-IV specifies a hierarchal diagnostic structure such that an oppositional defiant disorder (ODD) diagnosis is applied only if criteria are not met for conduct disorder (CD). Genetic studies of ODD and CD support a combination of shared genetic and environmental influences but largely ignore the imposed diagnostic structure. We examined whether ODD and CD share an underlying etiology while accounting for DSM-IV diagnostic specifications. Data from 1446 female twin pairs, aged 11-19 years, were fitted to two-stage models adhering to the DSM-IV diagnostic hierarchy. The models suggested that DSM-IV ODD-CD covariation is attributed largely to shared genetic influences. This is the first study, to our knowledge, to examine genetic and environmental overlap among these disorders while maintaining a DSM-IV hierarchical structure. The findings reflect primarily shared genetic influences and specific (i.e. uncorrelated) shared/familial environmental effects on these DSM-IV-defined behaviors. These results have implications for how best to define CD and ODD for future genetically informed analyses.

  19. Ten Steps to Conducting a Large, Multi-Site, Longitudinal Investigation of Language and Reading in Young Children

    Science.gov (United States)

    Farquharson, Kelly; Murphy, Kimberly A.

    2016-01-01

    Purpose: This paper describes methodological procedures involving execution of a large-scale, multi-site longitudinal study of language and reading comprehension in young children. Researchers in the Language and Reading Research Consortium (LARRC) developed and implemented these procedures to ensure data integrity across multiple sites, schools, and grades. Specifically, major features of our approach, as well as lessons learned, are summarized in 10 steps essential for successful completion of a large-scale longitudinal investigation in early grades. Method: Over 5 years, children in preschool through third grade were administered a battery of 35 higher- and lower-level language, listening, and reading comprehension measures (RCM). Data were collected from children, their teachers, and their parents/guardians at four sites across the United States. Substantial and rigorous effort was aimed toward maintaining consistency in processes and data management across sites for children, assessors, and staff. Conclusion: With appropriate planning, flexibility, and communication strategies in place, LARRC developed and executed a successful multi-site longitudinal research study that will meet its goal of investigating the contribution and role of language skills in the development of children's listening and reading comprehension. Through dissemination of our design strategies and lessons learned, research teams embarking on similar endeavors can be better equipped to anticipate the challenges. PMID:27064308

  20. Ten Steps to a Conducting Large, Multi-site, Longitudinal Investigation of Language and Reading in Young Children

    Directory of Open Access Journals (Sweden)

    Language and Reading Research eConsortium

    2016-03-01

    Full Text Available Purpose: This paper describes methodological procedures involving execution of a large-scale, multi-site longitudinal study of language and reading comprehension in young children. Researchers in the Language and Reading Research Consortium (LARRC developed and implemented these procedures to ensure data integrity across multiple sites, schools, and grades. Specifically, major features of our approach, as well as lessons learned, are summarized in ten steps essential for successful completion of a large-scale longitudinal investigation in early grades. Method: Over five years, children in preschool through third grade were administered a battery of 35 higher- and lower-level language, listening, and reading comprehension measures. Data were collected from children, their teachers, and their parents/guardians at four sites across the United States. Substantial and rigorous effort was aimed toward maintaining consistency in processes and data management across sites for children, assessors, and staff. Conclusion: With appropriate planning, flexibility, and communication strategies in place, LARRC developed and executed a successful multi-site longitudinal research study that will meet its goal of investigating the contribution and role of language skills in the development of children’s listening and reading comprehension. Through dissemination of our design strategies and lessons learned, research teams embarking on similar endeavors can be better equipped to anticipate the challenges.

  1. A low cost sensor network approach to investigate spatio-temporal patterns of stream temperatures and electrical conductivity

    Science.gov (United States)

    Lieder, Ernestine; Weiler, Markus; Blume, Theresa

    2016-04-01

    Understanding water and energy fluxes at the stream and catchment scale remains a challenging task. Within the CAOS-project-framework it is our aim to investigate spatiotemporal patterns of stream temperature and to deduce understanding about the underlying hydrological system. A low cost sensor network was installed in summer 2015 to monitor stream temperature and EC patterns in time and space. 90 HOBO temperature sensors, which were modified to additionally measure EC, were installed at 30 confluences across the Attert catchment (288 km²) in Luxembourg. The design of the sensor network allows for the investigation of three research questions: a) spatial patterns of stream temperatures and EC and their dynamics across the region b) estimation of relative streamflow contributions and their temporal dynamics by using simple mixing models and c) estimation of heat transport. The data will thus provide valuable insight in runoff contributions from different sub-catchments, and a combined analysis with distributed measurements of soil moisture and shallow groundwater will improve our process understanding by linking hillslope scale processes with stream responses. First results indicate that streams in different geologies show distinct temperature and EC patterns throughout the observation period. Differences are also found with respect to temporal dynamics both for longer periods as well as diurnal fluctuations. These differences are likely to be caused by differences in flow paths on the one hand (e.g. amount of groundwater contribution) and exposure to direct radiation on the other hand.

  2. Investigation of thermoelectric power with modification of two band model with linear T term for superconductors and thermal conductivity study of Se added YBCO samples

    Energy Technology Data Exchange (ETDEWEB)

    Altin, S., E-mail: serdar.altin@inonu.edu.tr; Aksan, M.A.; Yakinci, M.E.

    2014-01-25

    Highlights: • We investigated thermoelectric power data by modification of two band model with linear T-term for superconductors. • κ(T) data were analyzed by Callaway model and the Wiedemann Franz law. • We investigated Se addition on YBCO. -- Abstract: In this study, the electrical and thermal transport properties such as thermoelectric power and thermal conductivity of the Se added YBCO system was investigated. The samples fabricated under different heat treatment conditions exhibited the T{sub c} value between 90.1 K and 80.6 K. Positive thermoelectric power for all the samples was obtained over all measurement temperature range which indicates the hole type conductivity. Thermoelectric power data was analyzed by replacing term (T–T{sup *}) by T in “Modified two band model with linear T-term” which is good agreement with experimental TEP data for all the samples. T{sup *} obtained by fitting corresponds to a temperature close to T{sub 0} obtained from resistivity measurement. Temperature dependence of thermal conductivity of the samples showed small peak with broad maximum just below T{sub c}. Thermal conductivity of the samples prepared was analyzed by the lattice thermal conductivity component by “The modified Callaway model” and the electronic component by “Wiedemann–Franz law”.

  3. Prospective Investigation of Video Game Use in Children and Subsequent Conduct Disorder and Depression Using Data from the Avon Longitudinal Study of Parents and Children.

    Directory of Open Access Journals (Sweden)

    Peter J Etchells

    Full Text Available There is increasing public and scientific concern regarding the long-term behavioural effects of video game use in children, but currently little consensus as to the nature of any such relationships. We investigated the relationship between video game use in children, degree of violence in games, and measures of depression and a 6-level banded measure of conduct disorder. Data from the Avon Longitudinal Study of Parents and Children were used. A 3-level measure of game use at age 8/9 years was developed, taking into account degree of violence based on game genre. Associations with conduct disorder and depression, measured at age 15, were investigated using ordinal logistic regression, adjusted for a number of potential confounders. Shoot-em-up games were associated with conduct disorder bands, and with a binary measure of conduct disorder, although the strength of evidence for these associations was weak. A sensitivity analysis comparing those who play competitive games to those who play shoot-em-ups found weak evidence supporting the hypothesis that it is violence rather than competitiveness that is associated with conduct disorder. However this analysis was underpowered, and we cannot rule out the possibility that increasing levels of competition in games may be just as likely to account for the observed associations as violent content. Overall game exposure as indicated by number of games in a household was not related to conduct disorder, nor was any association found between shoot-em-up video game use and depression.

  4. Prospective Investigation of Video Game Use in Children and Subsequent Conduct Disorder and Depression Using Data from the Avon Longitudinal Study of Parents and Children.

    Science.gov (United States)

    Etchells, Peter J; Gage, Suzanne H; Rutherford, Adam D; Munafò, Marcus R

    2016-01-01

    There is increasing public and scientific concern regarding the long-term behavioural effects of video game use in children, but currently little consensus as to the nature of any such relationships. We investigated the relationship between video game use in children, degree of violence in games, and measures of depression and a 6-level banded measure of conduct disorder. Data from the Avon Longitudinal Study of Parents and Children were used. A 3-level measure of game use at age 8/9 years was developed, taking into account degree of violence based on game genre. Associations with conduct disorder and depression, measured at age 15, were investigated using ordinal logistic regression, adjusted for a number of potential confounders. Shoot-em-up games were associated with conduct disorder bands, and with a binary measure of conduct disorder, although the strength of evidence for these associations was weak. A sensitivity analysis comparing those who play competitive games to those who play shoot-em-ups found weak evidence supporting the hypothesis that it is violence rather than competitiveness that is associated with conduct disorder. However this analysis was underpowered, and we cannot rule out the possibility that increasing levels of competition in games may be just as likely to account for the observed associations as violent content. Overall game exposure as indicated by number of games in a household was not related to conduct disorder, nor was any association found between shoot-em-up video game use and depression.

  5. Prospective Investigation of Video Game Use in Children and Subsequent Conduct Disorder and Depression Using Data from the Avon Longitudinal Study of Parents and Children

    Science.gov (United States)

    Rutherford, Adam D.; Munafò, Marcus R.

    2016-01-01

    There is increasing public and scientific concern regarding the long-term behavioural effects of video game use in children, but currently little consensus as to the nature of any such relationships. We investigated the relationship between video game use in children, degree of violence in games, and measures of depression and a 6-level banded measure of conduct disorder. Data from the Avon Longitudinal Study of Parents and Children were used. A 3-level measure of game use at age 8/9 years was developed, taking into account degree of violence based on game genre. Associations with conduct disorder and depression, measured at age 15, were investigated using ordinal logistic regression, adjusted for a number of potential confounders. Shoot-em-up games were associated with conduct disorder bands, and with a binary measure of conduct disorder, although the strength of evidence for these associations was weak. A sensitivity analysis comparing those who play competitive games to those who play shoot-em-ups found weak evidence supporting the hypothesis that it is violence rather than competitiveness that is associated with conduct disorder. However this analysis was underpowered, and we cannot rule out the possibility that increasing levels of competition in games may be just as likely to account for the observed associations as violent content. Overall game exposure as indicated by number of games in a household was not related to conduct disorder, nor was any association found between shoot-em-up video game use and depression. PMID:26820149

  6. Investigation of Parallel Radiofrequency Transmission for the Reduction of Heating in Long Conductive Leads in 3 Tesla Magnetic Resonance Imaging.

    Science.gov (United States)

    McElcheran, Clare E; Yang, Benson; Anderson, Kevan J T; Golenstani-Rad, Laleh; Graham, Simon J

    2015-01-01

    Deep Brain Stimulation (DBS) is increasingly used to treat a variety of brain diseases by sending electrical impulses to deep brain nuclei through long, electrically conductive leads. Magnetic resonance imaging (MRI) of patients pre- and post-implantation is desirable to target and position the implant, to evaluate possible side-effects and to examine DBS patients who have other health conditions. Although MRI is the preferred modality for pre-operative planning, MRI post-implantation is limited due to the risk of high local power deposition, and therefore tissue heating, at the tip of the lead. The localized power deposition arises from currents induced in the leads caused by coupling with the radiofrequency (RF) transmission field during imaging. In the present work, parallel RF transmission (pTx) is used to tailor the RF electric field to suppress coupling effects. Electromagnetic simulations were performed for three pTx coil configurations with 2, 4, and 8-elements, respectively. Optimal input voltages to minimize coupling, while maintaining RF magnetic field homogeneity, were determined for all configurations using a Nelder-Mead optimization algorithm. Resulting electric and magnetic fields were compared to that of a 16-rung birdcage coil. Experimental validation was performed with a custom-built 4-element pTx coil. In simulation, 95-99% reduction of the electric field at the tip of the lead was observed between the various pTx coil configurations and the birdcage coil. Maximal reduction in E-field was obtained with the 8-element pTx coil. Magnetic field homogeneity was comparable to the birdcage coil for the 4- and 8-element pTx configurations. In experiment, a temperature increase of 2±0.15°C was observed at the tip of the wire using the birdcage coil, whereas negligible increase (0.2±0.15°C) was observed with the optimized pTx system. Although further research is required, these initial results suggest that the concept of optimizing pTx to reduce DBS

  7. Investigation of Parallel Radiofrequency Transmission for the Reduction of Heating in Long Conductive Leads in 3 Tesla Magnetic Resonance Imaging.

    Directory of Open Access Journals (Sweden)

    Clare E McElcheran

    Full Text Available Deep Brain Stimulation (DBS is increasingly used to treat a variety of brain diseases by sending electrical impulses to deep brain nuclei through long, electrically conductive leads. Magnetic resonance imaging (MRI of patients pre- and post-implantation is desirable to target and position the implant, to evaluate possible side-effects and to examine DBS patients who have other health conditions. Although MRI is the preferred modality for pre-operative planning, MRI post-implantation is limited due to the risk of high local power deposition, and therefore tissue heating, at the tip of the lead. The localized power deposition arises from currents induced in the leads caused by coupling with the radiofrequency (RF transmission field during imaging. In the present work, parallel RF transmission (pTx is used to tailor the RF electric field to suppress coupling effects. Electromagnetic simulations were performed for three pTx coil configurations with 2, 4, and 8-elements, respectively. Optimal input voltages to minimize coupling, while maintaining RF magnetic field homogeneity, were determined for all configurations using a Nelder-Mead optimization algorithm. Resulting electric and magnetic fields were compared to that of a 16-rung birdcage coil. Experimental validation was performed with a custom-built 4-element pTx coil. In simulation, 95-99% reduction of the electric field at the tip of the lead was observed between the various pTx coil configurations and the birdcage coil. Maximal reduction in E-field was obtained with the 8-element pTx coil. Magnetic field homogeneity was comparable to the birdcage coil for the 4- and 8-element pTx configurations. In experiment, a temperature increase of 2±0.15°C was observed at the tip of the wire using the birdcage coil, whereas negligible increase (0.2±0.15°C was observed with the optimized pTx system. Although further research is required, these initial results suggest that the concept of optimizing p

  8. Structural morphology of amorphous conducting carbon film

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 28; Issue 6. Structural ... Amorphous conducting carbon films deposited over quartz substrates were analysed using X-ray diffraction and AFM technique. X-ray diffraction data reveal disorder and roughness in the plane of graphene sheet as compared to that of graphite.

  9. Structural morphology of amorphous conducting carbon film

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Amorphous conducting carbon films deposited over quartz substrates were analysed using X-ray diffraction and AFM technique. X-ray diffraction data reveal disorder and roughness in the plane of graphene sheet as compared to that of graphite. This roughness increases with decrease in preparation temperature.

  10. Optimization of Easy Atomic Force Microscope (ezAFM) Controls for Semiconductor Nanostructure Profiling

    Science.gov (United States)

    2017-09-01

    Laboratory recently procured an Easy Atomic Force Microscope (ezAFM), from a NanoMagnetics vendor. The ezAFM can profile nanostructures on the order of 2.0 Å...just as previous AFMs do. This allows for scans of possible defects of sample surfaces, as well as displays of changes in topography. In using the...the cross-sectional graph provides an approximation of the noise. Less than 2 Å is ideal. It is possible to observe relative noise by observing the

  11. Application of AFM Measurement and Fractal Analysis to Study the Surface of Natural Optical Structures

    Directory of Open Access Journals (Sweden)

    Dinara Sobola

    2017-01-01

    Full Text Available The wings scales of the butterflies were studied by Atomic Force Microscopy (AFM in the air. Measurements were done without special preparation of species in order to observe the surface in real conditions. The data of probe microscopy (figures confirm AFM to be a powerful technique for determining features of the insects' wings. These features play a key role in optical phenomena which makes fascinating wings coloration. The structure determines light reflection, propagation, and diffraction. AFM imaging was done at the areas of specific colors without scale separation.

  12. Micromechanical Characterization of Complex Polypropylene Morphologies by HarmoniX AFM

    Directory of Open Access Journals (Sweden)

    S. Liparoti

    2017-01-01

    Full Text Available This paper examines the capability of the HarmoniX Atomic Force Microscopy (AFM technique to draw accurate and reliable micromechanical characterization of complex polymer morphologies generally found in conventional thermoplastic polymers. To that purpose, injection molded polypropylene samples, containing representative morphologies, have been characterized by HarmoniX AFM. Mapping and distributions of mechanical properties of the samples surface are determined and analyzed. Effects of sample preparation and test conditions are also analyzed. Finally, the AFM determination of surface elastic moduli has been compared with that obtained by indentation tests, finding good agreement among the results.

  13. X-ray photoelectron spectroscopy and conducting atomic force microscopy investigations on dual ion beam sputtered MgO ultrathin films

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Braj Bhusan [Thin Film Laboratory, Department of Physics, Indian Institute of Technology Delhi, New Delhi 110 016 (India); Agrawal, Vikash; Joshi, Amish G. [CSIR-National Physical Laboratory, Dr. K. S. Krishnan Road, New Delhi 110 012 (India); Chaudhary, Sujeet, E-mail: sujeetc@physics.iitd.ac.in [Thin Film Laboratory, Department of Physics, Indian Institute of Technology Delhi, New Delhi 110 016 (India)

    2012-09-01

    Ultrathin films of MgO ({approx} 6 nm) were deposited on Si(100) using dual ion beam sputtering in different partial pressures of oxygen. These thin films were characterized by X-ray photoelectron spectroscopy (XPS) for chemical state analysis and conducting atomic force microscopy for topography and local conductivity map. No trace of metal Mg was evidenced in these MgO films. The XPS analysis clearly brought out the formation of oxygen interstitials and Mg(OH){sub 2} primarily due to the presence of residual water vapors in the chamber. An optimum value of oxygen partial pressure of {approx} 4.4 Multiplication-Sign 10{sup -2} Pa is identified with regard to homogeneity of film and stoichiometry across the film thickness (O:Mg::0.93-0.97). The local conductivity mapping investigations also established the film homogeneity in respect of electrical resistivity. Non-linear local current-voltage curves revealed typical tunneling characteristics with barrier width of {approx} 5.6 nm and barrier height of {approx} 0.92 eV. - Highlights: Black-Right-Pointing-Pointer Ultra-thin films ({approx} 6 nm) of MgO were deposited at different oxygen partial pressures. Black-Right-Pointing-Pointer Chemical state of MgO thin films is investigated by X-ray photoelectron spectroscopy. Black-Right-Pointing-Pointer Local conductivity map was investigated using conducting atomic force microscopy. Black-Right-Pointing-Pointer Current-voltage characteristics at local points showed tunneling like behavior.

  14. Fabrication of cone-shaped boron doped diamond and gold nanoelectrodes for AFM-SECM.

    Science.gov (United States)

    Avdic, A; Lugstein, A; Wu, M; Gollas, B; Pobelov, I; Wandlowski, T; Leonhardt, K; Denuault, G; Bertagnolli, E

    2011-04-08

    We demonstrate a reliable microfabrication process for a combined atomic force microscopy (AFM) and scanning electrochemical microscopy (SECM) measurement tool. Integrated cone-shaped sensors with boron doped diamond (BDD) or gold (Au) electrodes were fabricated from commercially available AFM probes. The sensor formation process is based on mature semiconductor processing techniques, including focused ion beam (FIB) machining, and highly selective reactive ion etching (RIE). The fabrication approach preserves the geometry of the original AFM tips resulting in well reproducible nanoscaled sensors. The feasibility and functionality of the fully featured tips are demonstrated by cyclic voltammetry, showing good agreement between the measured and calculated currents of the cone-shaped AFM-SECM electrodes.

  15. BOREAS AFM-06 NOAA/ETL 35 GHz Cloud/Turbulence Radar GIF Images

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: The BOREAS AFM-06 team from the National Oceanic and Atmospheric Administration Environmental Technology Laboratory (NOAA/ETL) operated a 35 GHz...

  16. BOREAS AFM-06 NOAA/ETL 35 GHz Cloud/Turbulence Radar GIF Images

    Data.gov (United States)

    National Aeronautics and Space Administration — The BOREAS AFM-06 team from the National Oceanic and Atmospheric Administration Environmental Technology Laboratory (NOAA/ETL) operated a 35 GHz cloud-sensing radar...

  17. Investigating the source of contaminated plumes downstream of the Alborz Sharghi coal washing plant using EM34 conductivity data, VLF-EM and DC-resistivity geophysical methods

    Science.gov (United States)

    Shiraz, Farzin Amirkhani; Ardejani, Faramarz Doulati; Moradzadeh, Ali; Arab-Amiri, Ali Reza

    2013-01-01

    Coal washing factories may create serious environmental problems due to pyrite oxidation and acid mine drainage generation from coal waste piles on nearby land. Infiltration of pyrite oxidation products through the porous materials of the coal waste pile by rainwater cause changes in the conductivity of underground materials and groundwater downstream of the pile. Electromagnetic and electrical methods are effective for investigation and monitoring of the contaminated plumes caused by coal waste piles and tailings impoundments. In order to investigate the environmental impact from a coal waste pile at the Alborz Sharghi coal washing plant, an EM34 ground conductivity meter was used on seven parallel lines in an E-W direction, downstream of the waste pile. Two-dimensional resistivity models obtained by the inversion of EM34 conductivity data identified conductive leachate plumes. In addition, quasi-3D inversion of EM34 data has confirmed the decreasing resistivity at depth due to the contaminated plumes. Comparison between EM34, VLF and DC-resistivity datasets, which were acquired for similar survey lines, agree well in identifying changes in the resistivity trend. The EM34 and DC-resistivity sections have greater similarity and better smoothness rather than those of the VLF model. Two-dimensional inversion models of these methods have shown some contaminated plumes with low resistivity.

  18. Morphological analysis of polymers on hair fibers by SEM and AFM

    OpenAIRE

    Valéria Fernandes Monteiro; Aline Martins Duboc Natal; Luís Edmundo Bastos Soledade; Elson Longo

    2003-01-01

    The polyquaternium 7® polymer is widely used in cosmetic formulations. Morphologic alterations in hair fibers were observed after the application of the polyquaternium 7® polymer, using SEM and AFM. Continuous applications of this product indicated that it accumulates on the fibers, improving the aspect of the hair surface. Quantitative analysis of the images obtained by AFM was undertaken. The data obtained for the hair surface roughness indicates that the fibers treated with the polymer pre...

  19. A Multifunctional Frontloading Approach for Repeated Recycling of a Pressure-Controlled AFM Micropipette.

    Directory of Open Access Journals (Sweden)

    Phillip Roder

    Full Text Available Fluid force microscopy combines the positional accuracy and force sensitivity of an atomic force microscope (AFM with nanofluidics via a microchanneled cantilever. However, adequate loading and cleaning procedures for such AFM micropipettes are required for various application situations. Here, a new frontloading procedure is described for an AFM micropipette functioning as a force- and pressure-controlled microscale liquid dispenser. This frontloading procedure seems especially attractive when using target substances featuring high costs or low available amounts. Here, the AFM micropipette could be filled from the tip side with liquid from a previously applied droplet with a volume of only a few μL using a short low-pressure pulse. The liquid-loaded AFM micropipettes could be then applied for experiments in air or liquid environments. AFM micropipette frontloading was evaluated with the well-known organic fluorescent dye rhodamine 6G and the AlexaFluor647-labeled antibody goat anti-rat IgG as an example of a larger biological compound. After micropipette usage, specific cleaning procedures were tested. Furthermore, a storage method is described, at which the AFM micropipettes could be stored for a few hours up to several days without drying out or clogging of the microchannel. In summary, the rapid, versatile and cost-efficient frontloading and cleaning procedure for the repeated usage of a single AFM micropipette is beneficial for various application situations from specific surface modifications through to local manipulation of living cells, and provides a simplified and faster handling for already known experiments with fluid force microscopy.

  20. Influence of the surface chemistry on the nanotribological behaviour of (AFM tip/graphite) couples

    Energy Technology Data Exchange (ETDEWEB)

    Jradi, Khalil [Universite du Quebec a Trois Rivieres, Centre Integre en pates et papiers, 3351 boulevard des forges, Trois Rivieres, Quebec G9A 5H7 (Canada); Schmitt, Marjorie, E-mail: Marjorie.Schmitt@uha.fr [Laboratoire de Chimie Organique et Bioorganique, Ecole Nationale Superieure de Chimie de Mulhouse - CNRS, 3, rue Alfred Werner, 68093 Mulhouse Cedex (France); Bistac, Sophie [Laboratoire de Photochimie et d' Ingenierie Macromoleculaires, 3, rue Alfred Werner, 68093 Mulhouse Cedex (France)

    2012-03-01

    The development of the nanotechnology has made essential the knowledge of the tribological behaviour of carbonaceous materials, and more particularly of graphite. Atomic force microscopy (AFM) is thus used to study the friction properties at this nanoscopic scale. In this work, results concerning the friction of AFM tips against graphite pins are presented, with a particular emphasis on the effect of the chemical modification of these tips on the tribological behaviour of graphite.

  1. AFM-based force spectroscopy measurements of mature amyloid fibrils of the peptide glucagon

    DEFF Research Database (Denmark)

    Dong, M. D.; Hovgaard, M. B.; Mamdouh, W.

    2008-01-01

    We report on the mechanical characterization of individual mature amyloid fibrils by atomic force microscopy (AFM) and AFM-based single-molecule force spectroscopy (SMFS). These self-assembling materials, formed from the 29-residue amphiphatic peptide hormone glucagon, were found to display a rev....... In addition, such biological amyloid fibril structures with highly stable mechanical properties can potentially be used to produce nanofibres (nanowires) that may be suitable for nanotechnological applications....

  2. Characterization study on machining PMMA thin-film using AFM tip-based dynamic plowing lithography.

    Science.gov (United States)

    Yan, Yongda; He, Yang; Geng, Yanquan; Hu, Zhenjiang; Zhao, Xuesen

    2016-11-01

    This paper presents a reliable nanolithography technique, namely dynamic plowing lithography (DPL) based on a commercial atomic force microscope (AFM). The poly(methyl methacrylate) (PMMA) solution spinning on a silicon substrate is utilized to be scratched directly with an oscillating tip at its resonance frequency. The films with different thickness are obtained by adjusting the concentration of solution and post baked time. A new silicon tip is employed to conduct DPL on PMMA film surface. The geometry of nano-line structure scratched on the film with high adhesion force is shown with a transition process, including total protuberance, protuberance with groove and groove with pile-up. The scratching direction has less influence on the scratched depth of groove, while the shape of pile-up is varied with directions. The depth of groove on thin films is increasing with the drive amplitude until the value of the depth reaches to the threshold value. Moreover, owing to smaller elastic modulus, the film with relatively large thickness could be modified by the tip more easily using this DPL method. SCANNING 38:612-618, 2016. © 2016 Wiley Periodicals, Inc. © Wiley Periodicals, Inc.

  3. AFM capabilities in characterization of particles and surfaces: from angstroms to microns.

    Science.gov (United States)

    Starostina, N; Brodsky, M; Prikhodko, S; Hoo, C M; Mecartney, M L; West, P

    2008-01-01

    Scanning probe microscopy (SPM), invented 25 years ago, is now routinely employed as a surface characterization technique. Atomic force microscopy (AFM) is the most widely used form of SPM, since AFM can be used in ambient conditions with minimal sample preparation. Examples of applications relevant to cosmetics include, but are not limited to, hair and skin roughness measurements and powder particle and nano-emulsion characterization. AFM is well suited for individual particle characterization, especially for measurements of volume, height, size, shape, aspect ratio, and particle surface morphology. Statistical distributions for a large set of particles can be generated through single-particle analysis techniques (i.e., ensemble-like information). AFM is better capable of resolving complex particle-size distributions than dynamic light-scattering (DLS). Single-particle analysis techniques with AFM can be more cost- and time-effective than analyses using scanning electron microscopy (SEM). However, AFM offers resolution that is comparable to or greater than SEM or transmission electron microscopy (TEM) and routinely allows direct measurements of the particle height and volume and produces images easily displayed in a quantified 3D format.

  4. Measurement of cluster-cluster interaction in liquids by deposition and AFM of silicon clusters onto HOPG surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Galinis, Gediminas; Torricelli, Gauthier; Akraiam, Atea; Haeften, Klaus von, E-mail: kvh6@le.ac.uk [University of Leicester, Department of Physics and Astronomy (United Kingdom)

    2012-08-15

    We have investigated the interaction and aggregation of novel fluorescent silicon nanoclusters in liquids by measuring the size distribution of dried clusters on graphite. The clusters were produced by gas aggregation and co-deposition with a beam of water vapour. Drops of the solutions were placed on freshly cleaved highly oriented pyrolitic graphite, subsequently vacuum dried and investigated by atomic force microscopy (AFM) in ultra high vacuum. The AFM images show single clusters and agglomerates. The height distributions are Gaussian-shaped with average heights of 1 nm and widths of 1 nm. The heights never exceed 3 nm. In some regions a second cluster layer is observed. In all samples the separation between first and second layers is larger than the separation between the first layer and the graphite substrate, which we attribute to a stronger interaction between clusters and surface than the cluster self-interaction. We conclude that the separation between first and second layer represents a much better fingerprint of the original size distribution of the clusters in solution than the height of the first layer. The observation of a second cluster layer is important for using silicon clusters as building blocks for cluster-assembled materials.

  5. Effect of different AFM micro cantilever in fluid on the rough surface topography quality close to the surface

    Science.gov (United States)

    H. Korayem, A.; H. Korayem, M.

    2017-08-01

    The use of higher vibration modes and different geometries of the AFM piezoelectric micro cantilever (MC) is affected by the surface topography quality in a liquid medium. Therefore, utilizing an appropriate geometry and vibration mode is of a great importance. This paper analyzes AFM MC types with rectangular, dagger and V-shaped geometries in the noncontact and tapping modes in a liquid medium for rough surfaces in Nanoscale. The modified couple stress theory (MCS) in a liquid medium according to Timoshenko beam theory is used in order to enhance the accuracy of equations. In addition, the differential quadrature (DQ) method has been used to solve the equations. Identification of environmental forces helps an exact investigation of the system vibration amplitude. Investigating the effect of geometric and force parameters on the MC vibration behavior leads to understanding the system and to design it properly in a liquid medium. Also, due to oscillating the MC near the sample surface, the effect of interaction forces between the sample surface and the MC, including van der Waals, contact and squeeze forces is analyzed in a liquid medium in addition to the hydrodynamic forces. Furthermore, due to the sever reduction of the MC amplitude caused by the squeeze force; the MC is angled in comparison with the horizontal surface.

  6. Nanoscale multilevel switching in Ge2Sb2Te5 thin film with conductive atomic force microscopy

    Science.gov (United States)

    Yang, Fei; Xu, Ling; Chen, Jing; Xu, Jun; Yu, Yao; Ma, Zhongyuan; Chen, Kunji

    2016-01-01

    We demonstrate three-level data storage in amorphous Ge2Sb2Te5 (GST) thin film by conductive atomic force microscopy (C-AFM). Due to the high resolution and current sensitivity of AFM, the electrical properties of GST are investigated in the nanoscale. By applying an electric field between an AFM probe tip and the GST surface, well-resolved threshold switching and memory switching are obtained successively in a current-voltage sweeping. Correspondingly, three states with high, intermediate and low resistances, which are assigned data values ‘0’, ‘1’ and ‘2’ respectively, are observed in an IV-spectrum. The electrical resistance of GST thin film decreases by over two orders of magnitude in both switching processes, which provides a clear contrast to distinguish the three logical states. We also discuss the threshold electrical field of threshold switching in the amorphous GST thin film. Nanoscale conductive marks in the amorphous ON state and crystalline state are successfully fabricated by applying IV-spectra with different voltage ranges on the GST thin films.

  7. Improving the lateral resolution of quartz tuning fork-based sensors in liquid by integrating commercial AFM tips into the fiber end.

    Science.gov (United States)

    Gonzalez, Laura; Martínez-Martín, David; Otero, Jorge; de Pablo, Pedro José; Puig-Vidal, Manel; Gómez-Herrero, Julio

    2015-01-14

    The use of quartz tuning fork sensors as probes for scanning probe microscopy is growing in popularity. Working in shear mode, some methods achieve a lateral resolution comparable with that obtained with standard cantilevered probes, but only in experiments conducted in air or vacuum. Here, we report a method to produce and use commercial AFM tips in electrically driven quartz tuning fork sensors operating in shear mode in a liquid environment. The process is based on attaching a standard AFM tip to the end of a fiber probe which has previously been sharpened. Only the end of the probe is immersed in the buffer solution during imaging. The lateral resolution achieved is about 6 times higher than that of the etched microfiber on its own.

  8. Nonlinear Dynamics and Chaos of Microcantilever-Based TM-AFMs with Squeeze Film Damping Effects

    Directory of Open Access Journals (Sweden)

    Jie-Yu Chen

    2009-05-01

    Full Text Available In Atomic force microscope (AFM examination of a vibrating microcantilever, the nonlinear tip-sample interaction would greatly influence the dynamics of the cantilever. In this paper, the nonlinear dynamics and chaos of a tip-sample dynamic system being run in the tapping mode (TM were investigated by considering the effects of hydrodynamic loading and squeeze film damping. The microcantilever was modeled as a spring-mass-damping system and the interaction between the tip and the sample was described by the Lennard-Jones (LJ potential. The fundamental frequency and quality factor were calculated from the transient oscillations of the microcantilever vibrating in air. Numerical simulations were carried out to study the coupled nonlinear dynamic system using the bifurcation diagram, Poincaré maps, largest Lyapunov exponent, phase portraits and time histories. Results indicated the occurrence of periodic and chaotic motions and provided a comprehensive understanding of the hydrodynamic loading of microcantilevers. It was demonstrated that the coupled dynamic system will experience complex nonlinear oscillation as the system parameters change and the effect of squeeze film damping is not negligible on the micro-scale.

  9. A software tool for STED-AFM correlative super-resolution microscopy

    Science.gov (United States)

    Koho, Sami; Deguchi, Takahiro; Löhmus, Madis; Näreoja, Tuomas; Hänninen, Pekka E.

    2015-03-01

    Multi-modal correlative microscopy allows combining the strengths of several imaging techniques to provide unique contrast. However it is not always straightforward to setup instruments for such customized experiments, as most microscope manufacturers use their own proprietary software, with limited or no capability to interface with other instruments - this makes correlation of the multi-modal data extremely challenging. We introduce a new software tool for simultaneous use of a STimulated Emission Depletion (STED) microscope with an Atomic Force Microscope (AFM). In our experiments, a Leica TCS STED commercial super-resolution microscope, together with an Agilent 5500ilm AFM microscope was used. With our software, it is possible to synchronize the data acquisition between the STED and AFM instruments, as well as to perform automatic registration of the AFM images with the super-resolution STED images. The software was realized in LabVIEW; the registration part was also implemented as an ImageJ script. The synchronization was realized by controlling simple trigger signals, also available in the commercial STED microscope, with a low-cost National Instruments USB-6501 digital I/O card. The registration was based on detecting the positions of the AFM tip inside the STED fieldof-view, which were then used as registration landmarks. The registration should work on any STED and tip-scanning AFM microscope combination, at nanometer-scale precision. Our STED-AFM correlation method has been tested with a variety of nanoparticle and fixed cell samples. The software will be released under BSD open-source license.

  10. Prospective Investigation of Video Game Use in Children and Subsequent Conduct Disorder and Depression Using Data from the Avon Longitudinal Study of Parents and Children

    OpenAIRE

    Etchells, P.J; Gage, S H; Rutherford, A.D; Munafò, M R

    2016-01-01

    There is increasing public and scientific concern regarding the long-term behavioural effects of video game use in children, but currently little consensus as to the nature of any such relationships. We investigated the relationship between video game use in children, degree of violence in games, and measures of depression and a 6-level banded measure of conduct disorder. Data from the Avon Longitudinal Study of Parents and Children were used. A 3-level measure of game use at age 8/9 years wa...

  11. Electric transport through nanometric CoFe{sub 2}O{sub 4} thin films investigated by conducting atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Foerster, M.; Gutierrez, D. F.; Rigato, F.; Fontcuberta, J. [Institut de Ciencia de Materials de Barcelona (ICMAB - CSIC), Campus UAB, Bellaterra 08193 (Spain); Rebled, J. M. [Institut de Ciencia de Materials de Barcelona (ICMAB - CSIC), Campus UAB, Bellaterra 08193 (Spain); LENS - MIND/IN2UB, Department d' Electronica, Universitat de Barcelona, c/Marti Franques 1, Barcelona 08028 (Spain); Arbelo, E.; Jourdan, M. [Insitut fuer Physik, Johannes Gutenberg-Universitaet, Staudinger Weg 7, Mainz 55128 (Germany); Peiro, F. [LENS - MIND/IN2UB, Department d' Electronica, Universitat de Barcelona, c/Marti Franques 1, Barcelona 08028 (Spain)

    2012-01-01

    A systematic study of electric transport through thin (2-8 nm) CoFe{sub 2}O{sub 4} films deposited on epitaxial SrRuO{sub 3} bottom electrodes was performed by conducting atomic force microscopy (CAFM). Experimental procedures to investigate transport through thin insulating films by CAFM are critically revised, and the potential of CoFe{sub 2}O{sub 4} films for the use as spin-filtering barriers is assessed. It is concluded that, at room-temperature, a non-tunnel channel significantly contributes to the electric transport, thus limiting the spin-filtering efficiency.

  12. Methods and apparatus of spatially resolved electroluminescence of operating organic light-emitting diodes using conductive atomic force microscopy

    Science.gov (United States)

    Hersam, Mark C. (Inventor); Pingree, Liam S. C. (Inventor)

    2008-01-01

    A conductive atomic force microscopy (cAFM) technique which can concurrently monitor topography, charge transport, and electroluminescence with nanometer spatial resolution. This cAFM approach is particularly well suited for probing the electroluminescent response characteristics of operating organic light-emitting diodes (OLEDs) over short length scales.

  13. Investigation of Amyloid Structures at Nanoscale via AFM based Dynamic Nanomechncial Microscopy

    DEFF Research Database (Denmark)

    Zhang, Shuai

    2014-01-01

    Amyloid structures are one important kind of protein aggregations. They are a group of stable misfolded species, other than native states, which have been found to accumulate as plaques on neuron cells. This behavior is considered to associate with tens of human neurodegenerative diseases...... nanomechnical microscopy (DNM) provides the availability to link topography and corresponding nanomechnical properties. This nanomechnical mapping improves the understanding of amyloid self-assembly mechanisms, and it also assists to design the amyloid structure based nanomaterials. In my PhD thesis, I...

  14. Investigation of Streptococcus mutans biofilm growth on modified Au(111)-surfaces using AFM and electrochemistry

    DEFF Research Database (Denmark)

    Hu, Yifan; Zhang, Jingdong; Ulstrup, Jens

    2011-01-01

    similar in the absence and presence of the biofilms and growth medium. RD in strongly alkaline solution where RD peak resolution is higher was also addressed. Most notably, the strong RD peaks of the long pure and functionalized MHD and MHDA in 0.1M NaOH remained in the presence either of biofilm together...

  15. Evaluating interaction forces between BSA and rabbit anti-BSA in sulphathiazole sodium, tylosin and levofloxacin solution by AFM

    Science.gov (United States)

    Wang, Congzhou; Wang, Jianhua; Deng, Linhong

    2011-11-01

    Protein-protein interactions play crucial roles in numerous biological processes. However, it is still challenging to evaluate the protein-protein interactions, such as antigen and antibody, in the presence of drug molecules in physiological liquid. In this study, the interaction between bovine serum albumin (BSA) and rabbit anti-BSA was investigated using atomic force microscopy (AFM) in the presence of various antimicrobial drugs (sulphathiazole sodium, tylosin and levofloxacin) under physiological condition. The results show that increasing the concentration of tylosin decreased the single-molecule-specific force between BSA and rabbit anti-BSA. As for sulphathiazole sodium, it dramatically decreased the specific force at a certain critical concentration, but increased the nonspecific force as its concentration increasing. In addition, the presence of levofloxacin did not greatly influence either the specific or nonspecific force. Collectively, these results suggest that these three drugs may adopt different mechanisms to affect the interaction force between BSA and rabbit anti-BSA. These findings may enhance our understanding of antigen/antibody binding processes in the presence of drug molecules, and hence indicate that AFM could be helpful in the design and screening of drugs-modulating protein-protein interaction processes.

  16. A methodology to investigate the intrinsic effect of the pulsed electric current during the spark plasma sintering of electrically conductive powders

    Directory of Open Access Journals (Sweden)

    Antonio Mario Locci, Alberto Cincotti, Sara Todde, Roberto Orrù and Giacomo Cao

    2010-01-01

    Full Text Available A novel methodology is proposed for investigating the effect of the pulsed electric current during the spark plasma sintering (SPS of electrically conductive powders without potential misinterpretation of experimental results. First, ensemble configurations (geometry, size and material of the powder sample, die, plunger and spacers are identified where the electric current is forced to flow only through either the sample or the die, so that the sample is heated either through the Joule effect or by thermal conduction, respectively. These ensemble configurations are selected using a recently proposed mathematical model of an SPS apparatus, which, once suitably modified, makes it possible to carry out detailed electrical and thermal analysis. Next, SPS experiments are conducted using the ensemble configurations theoretically identified. Using aluminum powders as a case study, we find that the temporal profiles of sample shrinkage, which indicate densification behavior, as well as the final density of the sample are clearly different when the electric current flows only through the sample or through the die containing it, whereas the temperature cycle and mechanical load are the same in both cases.

  17. Thermal enhancement of AFM phase contrast for imaging diblock copolymer thin film morphology.

    Science.gov (United States)

    Fasolk, M J; Mayes, A M; Magonov, N

    2001-11-01

    A simple and effective means of increasing the morphological detail in AFM phase micrographs of microphase separated block copolymer films is presented. Effective AFM phase imaging of microphase separated systems hinges upon the existence of appropriate contrast mechanisms such as differences in elasticity between the microphase separated domains. For some systems, AFM phase imaging at room temperature results in low contrast images due to a paucity of differential mechanical behavior between the microphase domains, e.g. at room temperature both species are glassy. Through the use of a heating apparatus custom-designed for AFM, an elastic contrast mechanism can be created in some systems by raising the specimen to a temperature between the glass transitions of the constituent polymer species. This serves to preferentially soften one species with respect to the other, thus enhancing the phase contrast mechanism, which results in micrographs with superior detail. This simple technique is demonstrated using films of a series of polystyrene-b-poly(n-alkyl methacrylate) diblock copolymers and both commercial and custom-built heating stages. By choosing appropriate measurement temperatures, AFM phase contrast could be greatly enhanced, or indeed created, when compared to room temperature images of these specimens. For these materials, contrast enhancement required that the sample be heated roughly 20 degrees C above the glass transition of the lower-Tg species.

  18. Optical Beam Deflection Based AFM with Integrated Hardware and Software Platform for an Undergraduate Engineering Laboratory

    Directory of Open Access Journals (Sweden)

    Siu Hong Loh

    2017-02-01

    Full Text Available Atomic force microscopy (AFM has been used extensively in nanoscience research since its invention. Recently, many teaching laboratories in colleges, undergraduate institutions, and even high schools incorporate AFM as an effective teaching tool for nanoscience education. This paper presents an optical beam deflection (OBD based atomic force microscope, designed specifically for the undergraduate engineering laboratory as a teaching instrument. An electronic module for signal conditioning was built with components that are commonly available in an undergraduate electronic laboratory. In addition to off-the-shelf mechanical parts and optics, the design of custom-built mechanical parts waskept as simple as possible. Hence, the overall cost for the setup is greatly reduced. The AFM controller was developed using National Instruments Educational Laboratory Virtual Instrumentation Suite (NI ELVIS, an integrated hardware and software platform which can be programmed in LabVIEW. A simple yet effective control algorithm for scanning and feedback control was developed. Despite the use of an educational platform and low-cost components from the undergraduate laboratory, the developed AFM is capable of performing imaging in constant-force mode with submicron resolution and at reasonable scanning speed (approximately 18 min per image. Therefore, the AFM is suitable to be used as an educational tool for nanoscience. Moreover, the construction of the system can be a valuable educational experience for electronic and mechanical engineering students.

  19. Visualising the Micro World of Chemical/Geochemical Interactions Using Atomic Force Microscopy (AFM)

    Energy Technology Data Exchange (ETDEWEB)

    Graham, G.M.; Sorbie, K.S.

    1996-12-31

    Scanning force microscopy, in particular AFM (Atomic Force Microscopy), provides a particular useful and interesting tool for the examination of surface structure at the near-atomic level. AFM is particularly well suited to the study of interactions at the surface in aqueous solutions using real time in-situ measurements. In this paper there is presented AFM images showing in situ crystal growth from supersaturated BaSO{sub 4} solutions onto the surface of barite. Growth structures in the form of spiral crystal growth features, presumably originating from screw dislocations, are illustrated. AFM images of novel scale crystal growth inhibition experiments are presented. Examination of the manner in which generically different species adsorb onto growth structures may help to explain mechanistic differences in the way which different inhibitor species perform against barium sulphate scale formation. Adsorption of polyacrylamide species onto mica surfaces have been viewed. The general utility of AFM to a number of other common surface interactions in oil field chemistry will be discussed. 17 refs., 3 figs.

  20. Current mapping of nonpolar a-plane and polar c-plane GaN films by conductive atomic force microscopy

    Science.gov (United States)

    Xu, Shengrui; Jiang, Teng; Lin, Zhiyu; Zhao, Ying; Yang, Linan; Zhang, Jincheng; Li, Peixian; Hao, Yue

    2016-10-01

    Nonpolar (11-20) a-plane GaN and polar (0001) c-plane GaN films have been grown by metal organic chemical vapor deposition on r-plane (1-102) and c-plane (0001) sapphire substrates, respectively. Conductive atomic force microscopy (C-AFM) has been used to investigate the local conductivity of the films. C-AFM shows enhanced current conduction within the etch pits of c-plane GaN and triangular pits of a-plane GaN. The results indicate that the off-axis planes are more electrically active than c-plane and a-plane. Surprisingly, the C-AFM values in triangular pit of the a-plane GaN are much smaller than that in etch pits of the c-plane GaN. The dislocations type related current leakage mechanism is revealed for polar c-plane and nonpolar a-plane GaN films.

  1. [Coupling AFM fluid imaging with micro-flocculation filtration process for the technological optimization].

    Science.gov (United States)

    Zheng, Bei; Ge, Xiao-peng; Yu, Zhi-yong; Yuan, Sheng-guang; Zhang, Wen-jing; Sun, Jing-fang

    2012-08-01

    Atomic force microscope (AFM) fluid imaging was applied to the study of micro-flocculation filtration process and the optimization of micro-flocculation time and the agitation intensity of G values. It can be concluded that AFM fluid imaging proves to be a promising tool in the observation and characterization of floc morphology and the dynamic coagulation processes under aqueous environmental conditions. Through the use of AFM fluid imaging technique, optimized conditions for micro-flocculation time of 2 min and the agitation intensity (G value) of 100 s(-1) were obtained in the treatment of dye-printing industrial tailing wastewater by the micro-flocculation filtration process with a good performance.

  2. Live cell imaging and determination of protein-protein rupture force with AFM

    Science.gov (United States)

    Sarkar, Anwesha; Kramkowski, Edward; Varughese, Elsa; Mayyas, Essa; Hoffmann, Peter

    2012-10-01

    Atomic Force Microscopy (AFM) provides superior imaging resolution and the ability to measure forces at the nanoscale. It is an important tool for studying a wide range of biomolecular samples from proteins, DNA to living cells. We are developing AFM measurement procedures to measure protein interactions on live cells at the single molecular level. To achieve this goal, a number of challenging problems need to be overcome. These include live cell imaging, lever functionalization, localizing single proteins on the cell surface, taking the effect of cell membrane deformation into account, developing data analysis methods to determine the protein-protein rupture force (subtracting out cell deformation) and determining bond characteristics and kinetic parameters for the protein interaction. This poster presents preliminary results obtained with AFM and addresses these various aspects.

  3. Accuracy optimization of high-speed AFM measurements using Design of Experiments

    DEFF Research Database (Denmark)

    Tosello, Guido; Marinello, F.; Hansen, Hans Nørgaard

    2010-01-01

    Atomic Force Microscopy (AFM) is being increasingly employed in industrial micro/nano manufacturing applications and integrated into production lines. In order to achieve reliable process and product control at high measuring speed, instrument optimization is needed. Quantitative AFM measurement......, the estimated dimensions of measured features. The definition of scan settings is based on a comprehensive optimization that targets maximization of information from collected data and minimization of measurement uncertainty and scan time. The Design of Experiments (DOE) technique is proposed and applied...... to perform the optimization of AFM measurements on calibrated one-dimensional silicon grating featuring a triangular periodical profile (slopes of 54.7 degrees, period of 3 μm)....

  4. Highly sensitive protein detection by biospecific AFM-based fishing with pulsed electrical stimulation.

    Science.gov (United States)

    Pleshakova, Tatyana O; Malsagova, Kristina A; Kaysheva, Anna L; Kopylov, Arthur T; Tatur, Vadim Yu; Ziborov, Vadim S; Kanashenko, Sergey L; Galiullin, Rafael A; Ivanov, Yuri D

    2017-08-01

    We report here the highly sensitive detection of protein in solution at concentrations from 10-15 to 10-18 m using the combination of atomic force microscopy (AFM) and mass spectrometry. Biospecific detection of biotinylated bovine serum albumin was carried out by fishing out the protein onto the surface of AFM chips with immobilized avidin, which determined the specificity of the analysis. Electrical stimulation was applied to enhance the fishing efficiency. A high sensitivity of detection was achieved by application of nanosecond electric pulses to highly oriented pyrolytic graphite placed under the AFM chip. A peristaltic pump-based flow system, which is widely used in routine bioanalytical assays, was employed throughout the analysis. These results hold promise for the development of highly sensitive protein detection methods using nanosensor devices.

  5. Structure and permeability of ion-channels by integrated AFM and waveguide TIRF microscopy.

    Science.gov (United States)

    Ramachandran, Srinivasan; Arce, Fernando Teran; Patel, Nirav R; Quist, Arjan P; Cohen, Daniel A; Lal, Ratnesh

    2014-03-21

    Membrane ion channels regulate key cellular functions and their activity is dependent on their 3D structure. Atomic force microscopy (AFM) images 3D structure of membrane channels placed on a solid substrate. Solid substrate prevents molecular transport through ion channels thus hindering any direct structure-function relationship analysis. Here we designed a ~70 nm nanopore to suspend a membrane, allowing fluidic access to both sides. We used these nanopores with AFM and total internal reflection fluorescence microscopy (TIRFM) for high resolution imaging and molecular transport measurement. Significantly, membranes over the nanopore were stable for repeated AFM imaging. We studied structure-activity relationship of gap junction hemichannels reconstituted in lipid bilayers. Individual hemichannels in the membrane overlying the nanopore were resolved and transport of hemichannel-permeant LY dye was visualized when the hemichannel was opened by lowering calcium in the medium. This integrated technique will allow direct structure-permeability relationship of many ion channels and receptors.

  6. Effect of tetramethylammonium hydroxide/isopropyl alcohol wet etching on geometry and surface roughness of silicon nanowires fabricated by AFM lithography

    Directory of Open Access Journals (Sweden)

    Siti Noorhaniah Yusoh

    2016-10-01

    Full Text Available The optimization of etchant parameters in wet etching plays an important role in the fabrication of semiconductor devices. Wet etching of tetramethylammonium hydroxide (TMAH/isopropyl alcohol (IPA on silicon nanowires fabricated by AFM lithography is studied herein. TMAH (25 wt % with different IPA concentrations (0, 10, 20, and 30 vol % and etching time durations (30, 40, and 50 s were investigated. The relationships between etching depth and width, and etching rate and surface roughness of silicon nanowires were characterized in detail using atomic force microscopy (AFM. The obtained results indicate that increased IPA concentration in TMAH produced greater width of the silicon nanowires with a smooth surface. It was also observed that the use of a longer etching time causes more unmasked silicon layers to be removed. Importantly, throughout this study, wet etching with optimized parameters can be applied in the design of the devices with excellent performance for many applications.

  7. Quantification of the electrostatic forces involved in the directed assembly of colloidal nanoparticles by AFM nanoxerography

    Science.gov (United States)

    Palleau, E.; Sangeetha, N. M.; Ressier, L.

    2011-08-01

    Directed assembly of 10 nm dodecanethiol stabilized silver nanoparticles in hexane and 14 nm citrate stabilized gold nanoparticles in ethanol was performed by AFM nanoxerography onto charge patterns of both polarities written into poly(methylmethacrylate) thin films. The quasi-neutral silver nanoparticles were grafted on both positive and negative charge patterns while the negatively charged gold nanoparticles were selectively deposited on positive charge patterns only. Numerical simulations were conducted to quantify the magnitude, direction and spatial range of the electrophoretic and dielectrophoretic forces exerted by the charge patterns on these two types of nanoparticles in suspension taken as models. The simulations indicate that the directed assembly of silver nanoparticles on both charge patterns is due to the predominant dielectrophoretic forces, while the selective assembly of gold nanoparticles only on positive charge patterns is due to the predominant electrophoretic forces. The study also suggests that the minimum surface potential of charge patterns required for obtaining effective nanoparticle assembly depends strongly on the charge and polarizability of the nanoparticles and also on the nature of the dispersing solvent. Attractive electrostatic forces of about 2 × 10 - 2 pN in magnitude just above the charged surface appear to be sufficient to trap silver nanoparticles in hexane onto charge patterns and the value is about 2 pN for gold nanoparticles in ethanol, under the present experimental conditions. The numerical simulations used in this work to quantify the electrostatic forces operating in the directed assembly of nanoparticles from suspensions onto charge patterns can easily be extended to any kind of colloid and serve as an effective tool for a better comprehension and prediction of liquid-phase nanoxerography processes.

  8. Conducted Vasoreactivity

    DEFF Research Database (Denmark)

    Postnov, D. E.; Neganova, A Y; Sosnovtseva, Olga

    2015-01-01

    Conducted vasodilation is part of the physiological response to increasing metabolic demand of the tissue. Similar responses can be elicited by focal electrical or chemical stimulation. Some evidence suggests an endothelial pathway for nondecremental transmission of hyperpolarizing pulses. However...... a theoretical analysis as well as numerical simulations of both single- and multiunit bistable systems mimicking endothelial cells to investigate the self-consistence and stability of the proposed mechanism. We find that the individual cell may switch readily between two stable potentials. An array of coupled...

  9. Gold-coated conducting-atomic force microscopy probes.

    Science.gov (United States)

    John, Neena Susan; Kulkarni, G U

    2005-04-01

    Some aspects of the performance of gold-coated conductive probes used in conducting atomic force microscopy (C-AFM) technique are discussed. The resistance of the nanocontact between the gold-coated AFM tip and the graphite substrate has been monitored at various applied forces. For small forces (forces in the range 100-150 nN, beyond which the tip seems to undergo plastic deformation. The resistance of the nanocontact increased when current on the order of 100 microA was allowed to pass through, finally resulting in melting of the gold coating.

  10. Morphological analysis of polymers on hair fibers by SEM and AFM

    Directory of Open Access Journals (Sweden)

    Valéria Fernandes Monteiro

    2003-12-01

    Full Text Available The polyquaternium 7® polymer is widely used in cosmetic formulations. Morphologic alterations in hair fibers were observed after the application of the polyquaternium 7® polymer, using SEM and AFM. Continuous applications of this product indicated that it accumulates on the fibers, improving the aspect of the hair surface. Quantitative analysis of the images obtained by AFM was undertaken. The data obtained for the hair surface roughness indicates that the fibers treated with the polymer presented higher roughness than the untreated hair fibers.

  11. Coexistence of orbital and CE-AFM orders in colossal magnetoresistance manganites: A symmetry perspective

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, J.L., E-mail: jlr@fisica.uminho.pt

    2016-07-01

    The complex interplay between order parameters of different nature that dominates the physics of colossal magnetoresistance manganites is analysed from a symmetry based perspective. Phenomenological energies are given for the different competing phases. It is shown that the general trends observed in different systems, such as the mutual exclusion of orbital order and A-AFM order and the related stabilization of the CE-AFM order, stem to large extend from the symmetry of the parameters involved. The possible stabilization of complex phases where charge and orbital order coexist with magnetic and ferroelectric states is also anticipated.

  12. AFM multilayered Bi-2223 conductors for 13,000 A current leads for CERN

    CERN Document Server

    Martini, L; Berti, R; Volpini, G; Bigoni, L; Curcio, F

    2000-01-01

    Large current carrying capacity multilayered Bi-2223 conductors are reproducibly prepared by means of the "Accordion-Folding Method" and suitably used to manufacture the low temperature stage of 13,000 A hybrid metal-HTS current lead prototypes for CERN. In this work, we report on the electrical characterisation of AFM multilayered Bi-2223 conductors having critical current as high as 400 A at 77 K and on a specific experimental set-up that has been developed to study the thermo-electrical performances of the AFM Bi-2223 composite conductors during the sudden resistive transition of the HTS: quench event. (4 refs).

  13. Ultra-high aspect ratio replaceable AFM tips using deformation-suppressed focused ion beam milling

    DEFF Research Database (Denmark)

    Savenko, Alexey; Yildiz, Izzet; Petersen, Dirch Hjorth

    2013-01-01

    Fabrication of ultra-high aspect ratio exchangeable and customizable tips for atomic force microscopy (AFM) using lateral focused ion beam (FIB) milling is presented. While on-axis FIB milling does allow high aspect ratio (HAR) AFM tips to be defined, lateral milling gives far better flexibility...... in terms of defining the shape and size of the tip. Due to beam-induced deformation, it has so far not been possible to define HAR structures using lateral FIB milling. In this work we obtain aspect ratios of up to 45, with tip diameters down to 9 nm, by a deformation-suppressing writing strategy. Several...

  14. Quantitative Study of the Elastic Modulus of Loosely Attached Cells in AFM Indentation Experiments

    OpenAIRE

    Dokukin, Maxim E.; Guz, Nataliia V.; Sokolov, Igor

    2013-01-01

    When measuring the elastic (Young’s) modulus of cells using AFM, good attachment of cells to a substrate is paramount. However, many cells cannot be firmly attached to many substrates. A loosely attached cell is more compliant under indenting. It may result in artificially low elastic modulus when analyzed with the elasticity models assuming firm attachment. Here we suggest an AFM-based method/model that can be applied to extract the correct Young’s modulus of cells loosely attached to a subs...

  15. Amyloid–β peptides time-dependent structural modifications: AFM and voltammetric characterization

    Energy Technology Data Exchange (ETDEWEB)

    Enache, Teodor Adrian; Chiorcea-Paquim, Ana-Maria; Oliveira-Brett, Ana Maria, E-mail: brett@ci.uc.pt

    2016-07-05

    The human amyloid beta (Aβ) peptides, Aβ{sub 1-40} and Aβ{sub 1-42}, structural modifications, from soluble monomers to fully formed fibrils through intermediate structures, were investigated, and the results were compared with those obtained for the inverse Aβ{sub 40-1} and Aβ{sub 42-1}, mutant Aβ{sub 1-40}Phe{sup 10} and Aβ{sub 1-40}Nle{sup 35}, and rat Aβ{sub 1-40}Rat peptide sequences. The aggregation was followed at a slow rate, in chloride free media and room temperature, and revealed to be a sequence-structure process, dependent on the physicochemical properties of each Aβ peptide isoforms, and occurring at different rates and by different pathways. The fibrilization process was investigated by atomic force microscopy (AFM), via changes in the adsorption morphology from: (i) initially random coiled structures of ∼0.6 nm height, corresponding to the Aβ peptide monomers in random coil or in α-helix conformations, to (ii) aggregates and protofibrils of 1.5–6.0 nm height and (iii) two types of fibrils, corresponding to the Aβ peptide in a β-sheet configuration. The reactivity of the carbon electrode surface was considered. The hydrophobic surface induced rapid changes of the Aβ peptide conformations, and differences between the adsorbed fibrils, formed at the carbon surface (beaded, thin, <2.0 nm height) or in solution (long, smooth, thick, >2.0 nm height), were detected. Differential pulse voltammetry showed that, according to their primary structure, the Aβ peptides undergo oxidation in one or two steps, the first step corresponding to the tyrosine amino acids oxidation, and the second one to the histidine and methionine amino acids oxidation. The fibrilization process was electrochemically detected via the decrease of the Aβ peptide oxidation peak currents that occurred in a time dependent manner. - Highlights: • The Aβ peptide fibrilization process was followed by AFM and DP voltammetry. • The human Aβ{sub 1-40} and Aβ{sub 1

  16. High Throughput Nanofabrication of Silicon Nanowire and Carbon Nanotube Tips on AFM Probes by Stencil-Deposited Catalysts

    DEFF Research Database (Denmark)

    Engstrøm, Daniel Southcott; Savu, Veronica; Zhu, Xueni

    2011-01-01

    A new and versatile technique for the wafer scale nanofabrication of silicon nanowire (SiNW) and multiwalled carbon nanotube (MWNT) tips on atomic force microscope (AFM) probes is presented. Catalyst material for the SiNW and MWNT growth was deposited on prefabricated AFM probes using aligned wafer...... scale nanostencil lithography. Individual vertical SiNWs were grown epitaxially by a catalytic vapor−liquid−solid (VLS) process and MWNTs were grown by a plasma-enhanced chemical vapor (PECVD) process on the AFM probes. The AFM probes were tested for imaging micrometers-deep trenches, where...

  17. Proton conducting system (ImH2)2SeO4·2H2O investigated with vibrational spectroscopy

    Science.gov (United States)

    Zięba, Sylwia; Mizera, Adam; Pogorzelec-Glaser, Katarzyna; Łapiński, Andrzej

    2017-06-01

    Imidazolium selenate dihydrate (ImH2)2SeO4·2H2O crystals have been investigated using Raman and IR spectroscopy. Experimental data were supported by the quantum-chemical calculations (DFT), Hirshfield surfaces and fingerprint plots analysis, and Bader theory calculations. The imidazolium selenate dihydrate crystal exhibits high proton conductivity of the order of 10- 1 S/m at T = 333 K. The spectra of this compound are dominated by bands related to the lattice modes, the internal vibrations of the protonated imidazole cation, selenate anion, water molecules, and hydrogen bonds network. For the imidazolium selenate dihydrate crystal, the formal classification of the fundamental modes has been carried out.

  18. Numerical investigation of magnetohydrodynamic slip flow of power-law nanofluid with temperature dependent viscosity and thermal conductivity over a permeable surface

    Directory of Open Access Journals (Sweden)

    Hussain Sajid

    2017-12-01

    Full Text Available In this paper, a numerical investigation is carried out to study the effect of temperature dependent viscosity and thermal conductivity on heat transfer and slip flow of electrically conducting non-Newtonian nanofluids. The power-law model is considered for water based nanofluids and a magnetic field is applied in the transverse direction to the flow. The governing partial differential equations(PDEs along with the slip boundary conditions are transformed into ordinary differential equations(ODEs using a similarity technique. The resulting ODEs are numerically solved by using fourth order Runge-Kutta and shooting methods. Numerical computations for the velocity and temperature profiles, the skin friction coefficient and the Nusselt number are presented in the form of graphs and tables. The velocity gradient at the boundary is highest for pseudoplastic fluids followed by Newtonian and then dilatant fluids. Increasing the viscosity of the nanofluid and the volume of nanoparticles reduces the rate of heat transfer and enhances the thickness of the momentum boundary layer. The increase in strength of the applied transverse magnetic field and suction velocity increases fluid motion and decreases the temperature distribution within the boundary layer. Increase in the slip velocity enhances the rate of heat transfer whereas thermal slip reduces the rate of heat transfer.

  19. Numerical investigation of magnetohydrodynamic slip flow of power-law nanofluid with temperature dependent viscosity and thermal conductivity over a permeable surface

    Science.gov (United States)

    Hussain, Sajid; Aziz, Asim; Khalique, Chaudhry Masood; Aziz, Taha

    2017-12-01

    In this paper, a numerical investigation is carried out to study the effect of temperature dependent viscosity and thermal conductivity on heat transfer and slip flow of electrically conducting non-Newtonian nanofluids. The power-law model is considered for water based nanofluids and a magnetic field is applied in the transverse direction to the flow. The governing partial differential equations(PDEs) along with the slip boundary conditions are transformed into ordinary differential equations(ODEs) using a similarity technique. The resulting ODEs are numerically solved by using fourth order Runge-Kutta and shooting methods. Numerical computations for the velocity and temperature profiles, the skin friction coefficient and the Nusselt number are presented in the form of graphs and tables. The velocity gradient at the boundary is highest for pseudoplastic fluids followed by Newtonian and then dilatant fluids. Increasing the viscosity of the nanofluid and the volume of nanoparticles reduces the rate of heat transfer and enhances the thickness of the momentum boundary layer. The increase in strength of the applied transverse magnetic field and suction velocity increases fluid motion and decreases the temperature distribution within the boundary layer. Increase in the slip velocity enhances the rate of heat transfer whereas thermal slip reduces the rate of heat transfer.

  20. Analysis and modification of defective surface aggregates on PCDTBT:PCBM solar cell blends using combined Kelvin probe, conductive and bimodal atomic force microscopy

    Directory of Open Access Journals (Sweden)

    Hanaul Noh

    2017-03-01

    Full Text Available Organic photovoltaic systems comprising donor polymers and acceptor fullerene derivatives are attractive for inexpensive energy harvesting. Extensive research on polymer solar cells has provided insight into the factors governing device-level efficiency and stability. However, the detailed investigation of nanoscale structures is still challenging. Here we demonstrate the analysis and modification of unidentified surface aggregates. The aggregates are characterized electrically by Kelvin probe force microscopy and conductive atomic force microscopy (C-AFM, whereby the correlation between local electrical potential and current confirms a defective charge transport. Bimodal AFM modification confirms that the aggregates exist on top of the solar cell structure, and is used to remove them and to reveal the underlying active layer. The systematic analysis of the surface aggregates suggests that the structure consists of PCBM molecules.

  1. The challenges and opportunities of conducting a clinical trial in a low resource setting: The case of the Cameroon mobile phone SMS (CAMPS trial, an investigator initiated trial

    Directory of Open Access Journals (Sweden)

    Ongolo-Zogo Pierre

    2011-06-01

    Full Text Available Abstract Conducting clinical trials in developing countries often presents significant ethical, organisational, cultural and infrastructural challenges to researchers, pharmaceutical companies, sponsors and regulatory bodies. Globally, these regions are under-represented in research, yet this population stands to gain more from research in these settings as the burdens on health are greater than those in developed resourceful countries. However, developing countries also offer an attractive setting for clinical trials because they often have larger treatment naive populations with higher incidence rates of disease and more advanced stages. These factors can present a reduction in costs and time required to recruit patients. So, balance needs to be found where research can be encouraged and supported in order to bring maximum public health benefits to these communities. The difficulties with such trials arise from problems with obtaining valid informed consent, ethical compensation mechanisms for extremely poor populations, poor health infrastructure and considerable socio-economic and cultural divides. Ethical concerns with trials in developing countries have received attention, even though many other non-ethical issues may arise. Local investigator initiated trials also face a variety of difficulties that have not been adequately reported in literature. This paper uses the example of the Cameroon Mobile Phone SMS trial to describe in detail, the specific difficulties encountered in an investigator-initiated trial in a developing country. It highlights administrative, ethical, financial and staff related issues, proposes solutions and gives a list of additional documentation to ease the organisational process.

  2. Interaction of lipidated GBV-C/HGV NS3 (513-522) and (505-514) peptides with phospholipids monolayer. An AFM study.

    Science.gov (United States)

    Weroński, Konrad J; Diez-Pérez, Ismael; Busquets, M Antonia; López-Iglesias, Carmen; Girona, Victoria; Prat, Josefina

    2010-01-01

    Lipidation of a short hydrophilic peptide has the aim to make the molecule amphiphilic, which improves its insertion into lipid monolayer and at the same time, the tendency to self-assembly. These both properties of two positively charged, hepatitis G (GBV-C/HGV) related lipidated peptides--palmitic acid derivatives of the fragments: 505-514 and the 513-522 of the NS3 protein (respectively Palmitoyl-SAELSMQRRG and Palmitoyl-RGRTGRGRSG) were studied. First, using transmission electron microscope (TEM) and atomic force microscope (AFM) the tendency to self-assembly in water solution was examined. Both techniques confirmed the formation of fibrous aggregates of Palmitoyl-SAELSMQRRG in water solution. At the same conditions, any fibrous aggregates of Palmitoyl-RGRTGRGRSG were detected neither by TEM nor by AFM. Insertion of the lipidated peptides into phospholipids monolayer formed by zwitterionic 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC) or negatively charged 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1-glycerol)] (DPPG) was investigated. Monolayers prepared by Langmuir-Blodgett method were visualized by AFM. The presence of lipidated peptides in phospholipid monolayers produced changes in the monolayers and different morphologies of the monolayers were obtained for each of the lipidated peptides.

  3. Comparative study of nanoscale surface structures of calcite microcrystals using FE-SEM, AFM, and TEM.

    Science.gov (United States)

    Chien, Yung-Ching; Mucci, Alfonso; Paquette, Jeanne; Sears, S Kelly; Vali, Hojatollah

    2006-08-01

    The bulk morphology and surface features that developed upon precipitation on micrometer-size calcite powders and millimeter-size cleavage fragments were imaged by three different microscopic techniques: field-emission scanning electron microscopy (FE-SEM), transmission electron microscopy (TEM) of Pt-C replicas, and atomic force microscopy (AFM). Each technique can resolve some nanoscale surface features, but they offer different ranges of magnification and dimensional resolutions. Because sample preparation and imaging is not constrained by crystal orientation, FE-SEM and TEM of Pt-C replicas are best suited to image the overall morphology of microcrystals. However, owing to the decoration effect of Pt-C on the crystal faces, TEM of Pt-C replicas is superior at resolving nanoscale surface structures, including the development of new faces and the different microtopography among nonequivalent faces in microcrystals, which cannot be revealed by FE-SEM. In conjunction with SEM, Pt-C replica provides the evidence that crystals grow in diverse and face-specific modes. The TEM imaging of Pt-C replicas has nanoscale resolution comparable to AFM. AFM yielded quantitative information (e.g., crystallographic orientation and height of steps) of microtopographic features. In contrast to Pt-C replicas and SEM providing three-dimensional images of the crystals, AFM can only image one individual cleavage or flat surface at a time.

  4. Nano-Workbench : A Combined Hollow AFM Cantilever and Robotic Manipulator

    NARCIS (Netherlands)

    Pérez Garza, H.; Ghatkesar, M.K.; Basak, S.; Löthman, P.; Staufer, U.

    2015-01-01

    To manipulate liquid matter at the nanometer scale, we have developed a robotic assembly equipped with a hollow atomic force microscope (AFM) cantilever that can handle femtolitre volumes of liquid. The assembly consists of four independent robots, each sugar cube sized with four degrees of freedom.

  5. Fracture Mechanics Testing of Titanium 6AL-4V in AF-M315E

    Science.gov (United States)

    Sampson, J. W.; Martinez, J.; McLean, C.

    2016-01-01

    The Green Propellant Infusion Mission (GPIM) will demonstrate the performance of AF-M315E monopropellant on orbit. Flight certification requires a safe-life analysis of the titanium alloy fuel tank to ensure inherent processing flaws will not cause failure during the design life of the tank. Material property inputs for this analysis require testing to determine the stress intensity factor for environment-assisted cracking (KEAC) of Ti 6Al-4V in combination with the AF-M315E monopropellant. Testing of single-edge notched, or SE(B), specimens representing the bulk tank membrane and weld material were performed in accordance with ASTM E1681. Specimens with fatigue pre-cracks were loaded into test fixtures so that the crack tips were exposed to AF-M315E at 50 C for a duration of 1,000 hours. Specimens that did not fail during exposure were opened to inspect the crack surfaces for evidence of crack growth. The threshold stress intensity value, KEAC, is the highest applied stress intensity that produced neither a failure of the specimen during the exposure nor showed evidence of crack growth. The threshold stress intensity factor for environment-assisted cracking of the Ti 6Al-4V forged tank material was found to be at least 22 ksivin and at least 31 ksivin for the weld material when exposed to AF-M315E monopropellant.

  6. Surface Mapping with an AFM-CMM Integrated System and Stitching Software

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo; Marinello, Francesco; Bariani, Paolo

    2004-01-01

    In the context of micro-technology, dimensions in the order of hundreds of micrometers are often to be measured, while the detection of the finest details and the analysis of nano-roughness call for the use of highly resolving sensors. AFM probes, owing to the sharpness of their tip combined with...

  7. Dynamics of a Disturbed Sessile Drop Measured by Atomic Force Microscopy (AFM)

    NARCIS (Netherlands)

    McGuiggan, Patricia M.; Grave, Daniel A.; Wallace, Jay S.; Cheng, Shengfeng; Prosperetti, Andrea; Robbins, Mark O.

    2011-01-01

    A new method for studying the dynamics of a sessile drop by atomic force microscopy (AFM) is demonstrated. A hydrophobic microsphere (radius, r 20–30 μm) is brought into contact with a small sessile water drop resting on a polytetrafluoroethylene (PTFE) surface. When the microsphere touches the

  8. Accurate Calibration and Uncertainty Estimation of the Normal Spring Constant of Various AFM Cantilevers

    Directory of Open Access Journals (Sweden)

    Yunpeng Song

    2015-03-01

    Full Text Available Measurement of force on a micro- or nano-Newton scale is important when exploring the mechanical properties of materials in the biophysics and nanomechanical fields. The atomic force microscope (AFM is widely used in microforce measurement. The cantilever probe works as an AFM force sensor, and the spring constant of the cantilever is of great significance to the accuracy of the measurement results. This paper presents a normal spring constant calibration method with the combined use of an electromagnetic balance and a homemade AFM head. When the cantilever presses the balance, its deflection is detected through an optical lever integrated in the AFM head. Meanwhile, the corresponding bending force is recorded by the balance. Then the spring constant can be simply calculated using Hooke’s law. During the calibration, a feedback loop is applied to control the deflection of the cantilever. Errors that may affect the stability of the cantilever could be compensated rapidly. Five types of commercial cantilevers with different shapes, stiffness, and operating modes were chosen to evaluate the performance of our system. Based on the uncertainty analysis, the expanded relative standard uncertainties of the normal spring constant of most measured cantilevers are believed to be better than 2%.

  9. Combined AFM and confocal fluorescence microscope for applications in bio-nanotechnology

    NARCIS (Netherlands)

    Kassies, R.; van der Werf, Kees; Lenferink, Aufrid T.M.; Hunter, C.N.; Olsen, J.D.; Subramaniam, Vinod; Otto, Cornelis

    2005-01-01

    We present a custom-designed atomic force fluorescence microscope (AFFM), which can perform simultaneous optical and topographic measurements with single molecule sensitivity throughout the whole visible to near-infrared spectral region. Integration of atomic force microscopy (AFM) and confocal

  10. [AFM-based technologies as the way towards the reverse Avogadro number].

    Science.gov (United States)

    Pleshakova, T O; Shumov, I D; Ivanov, Yu D; Malsagova, K A; Kaysheva, A L; Archakov, A I

    2015-01-01

    Achievement of the concentration detection limit for proteins at the level of the reverse Avogadro number determines the modern development of proteomics. In this review, the possibility of approximating the reverse Avogadro number by using nanotechnological methods (AFM-based fishing with mechanical and electrical stimulation, nanowire detectors, and other methods) are discussed. The ability of AFM to detect, count, visualize and characterize physico-chemical properties of proteins at concentrations up to 10(-17)-10(-18) M is demonstrated. The combination of AFM-fishing with mass-spectrometry allows the identification of proteins not only in pure solutions, but also in multi-component biological fluids (serum). The possibilities to improve the biospecific fishing efficiency by use of SOMAmers in both AFM and nanowire systems are discussed. The paper also provides criteria for evaluation of the sensitivity of fishing-based detection systems. The fishing efficiency depending on the detection system parameters is estimated. The practical implementation of protein fishing depending on the ratio of the sample solution volume and the surface of the detection system is discussed. The advantages and disadvantages of today's promising nanotechnological protein detection methods implemented on the basis of these schemes.

  11. AFM observation of single, functioning ionotropic glutamate receptors reconstituted in lipid bilayers.

    Science.gov (United States)

    Kasai, Nahoko; Ramanujan, Chandra S; Fujimoto, Ichiro; Shimada, Akiyoshi; Ryan, John F; Torimitsu, Keiichi

    2010-07-01

    Ionotropic glutamate receptors (iGluRs) are responsible for extracellular signaling in the central nervous system. However, the relationship between the overall structure of the protein and its function has yet to be resolved. Atomic force microscopy (AFM) is an important technique that allows nano-scale imaging in liquid. In the present work we have succeeded in imaging by AFM of the external features of the most common iGluR, AMPA-R (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid receptor), in a physiological environment. Homomeric GluR3 receptors were over-expressed in insect cells, purified and reconstituted into lipid membranes. AFM images were obtained in a buffer from membranes immobilized on a mica substrate. Using Au nanoparticle-conjugated antibodies, we show that proteins reconstitute predominantly with the N-terminal domain uppermost on the membrane. A tetrameric receptor structure is clearly observed, but it displays considerable heterogeneity, and the dimensions differ considerably from cryo-electron microscopy measurements. Our results indicate that the extracellular domains of AMPA-R are highly flexible in a physiological environment. AFM allows us to observe the protein surface structure, suggesting the possibility of visualizing real time conformational changes of a functioning protein. This knowledge may be useful for neuroscience as well as in pharmaceutical applications. Copyright 2010 Elsevier B.V. All rights reserved.

  12. Thin block copolymer films : film formation and corrugation under the AFM tip

    NARCIS (Netherlands)

    Maas, J.H.; Cohen Stuart, M.A.; Fleer, G.J.

    2000-01-01

    The tip of an atomic force microscope was used to induce nanoscale ordering in thin films of polystyrene-poly(4-vinyl pyridine) block copolymers under low force. The AFM tip produces rims on a mesoscopic scale oriented perpendicularly to the scanning direction. A wide range of molecular weights of

  13. Observation of Shapiro-steps in AFM-plought micron-size YBCO planar construction

    CSIR Research Space (South Africa)

    Elkaseh, AAO

    2009-01-01

    Full Text Available Using an Atomic Force Microscope (AFM), micron size planar constriction type junctions was successfully ploughed on YBa2Cu3O7-x thin films. The 100 nanometer (nm) thin films are deposited on MgO substrates by an Inverted Cylindrical Magnetron (ICM...

  14. First-principles AFM image simulation with frozen density embedding theory

    Science.gov (United States)

    Sakai, Yuki; Lee, Alex J.; Chelikowsky, James R.

    We present efficient first-principles method of non-contact atomic force microscopy (nc-AFM). Ordinary nc-AFM simulations based on density functional theory (DFT) require exhaustive computational cost because it involves thousands of total energy calculations. Regarding the sample as a fixed external potential can reduce the computational cost, and we adopt frozen density embedding theory (FDET) for this purpose. Simulated nc-AFM images with FDET using a carbon monoxide tip well reproduces the full DFT images of benzene, pentacene, and graphene, although optimized tip-sample distances and interaction energies in FDET are underestimated and overestimated, respectively. The FDET-based simulation method is promising for AFM image simulation of surfaces and two-dimensional materials. This work was supported by U.S. DOE under Grant No. DE-FG02-06ER46286 and Award No. DE-SC0008877, and by Welch Foundation under Grant F-1837. Computational resources are provided by NERSC and TACC.

  15. Coating of AFM probes with aquatic humic and non-humic NOM to study their adhesion properties.

    Science.gov (United States)

    Aubry, Cyril; Gutierrez, Leonardo; Croue, Jean Philippe

    2013-06-01

    Atomic force microscopy (AFM) was used to study interaction forces between four Natural Organic Matter (NOM) samples of different physicochemical characteristics and origins and mica surface at a wide range of ionic strength. All NOM samples were strongly adsorbed on positively charged iron oxide-coated silica colloidal probe. Cross-sectioning by focused ion beam milling technique and elemental mapping by energy-filtered transmission electron microscopy indicated coating completeness of the NOM-coated colloidal probes. AFM-generated force-distance curves were analyzed to elucidate the nature and mechanisms of these interacting forces. Electrostatics and steric interactions were important contributors to repulsive forces during approach, although the latter became more influential with increasing ionic strength. Retracting force profiles showed a NOM adhesion behavior on mica consistent with its physicochemical characteristics. Humic-like substances, referred as the least hydrophilic NOM fraction, i.e., so called hydrophobic NOM, poorly adsorbed on hydrophilic mica due to their high content of ionized carboxyl groups and aromatic/hydrophobic character. However, adhesion force increased with increasing ionic strength, suggesting double layer compression. Conversely, polysaccharide-like substances showed high adhesion to mica. Hydrogen-bonding between hydroxyl groups on polysaccharide-like substances and highly electronegative elements on mica was suggested as the main adsorption mechanism, where the adhesion force decreased with increasing ionic strength. Results from this investigation indicated that all NOM samples retained their characteristics after the coating procedure. The experimental approach followed in this study can potentially be extended to investigate interactions between NOM and clean or fouled membranes as a function of NOM physicochemical characteristics and solution chemistry. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. Coating of AFM probes with aquatic humic and non-humic NOM to study their adhesion properties

    KAUST Repository

    Aubry, Cyril

    2013-06-01

    Atomic force microscopy (AFM) was used to study interaction forces between four Natural Organic Matter (NOM) samples of different physicochemical characteristics and origins and mica surface at a wide range of ionic strength. All NOM samples were strongly adsorbed on positively charged iron oxide-coated silica colloidal probe. Cross-sectioning by focused ion beam milling technique and elemental mapping by energy-filtered transmission electron microscopy indicated coating completeness of the NOM-coated colloidal probes. AFM-generated force-distance curves were analyzed to elucidate the nature and mechanisms of these interacting forces. Electrostatics and steric interactions were important contributors to repulsive forces during approach, although the latter became more influential with increasing ionic strength. Retracting force profiles showed a NOM adhesion behavior on mica consistent with its physicochemical characteristics. Humic-like substances, referred as the least hydrophilic NOM fraction, i.e., so called hydrophobic NOM, poorly adsorbed on hydrophilic mica due to their high content of ionized carboxyl groups and aromatic/hydrophobic character. However, adhesion force increased with increasing ionic strength, suggesting double layer compression. Conversely, polysaccharide-like substances showed high adhesion to mica. Hydrogen-bonding between hydroxyl groups on polysaccharide-like substances and highly electronegative elements on mica was suggested as the main adsorption mechanism, where the adhesion force decreased with increasing ionic strength. Results from this investigation indicated that all NOM samples retained their characteristics after the coating procedure. The experimental approach followed in this study can potentially be extended to investigate interactions between NOM and clean or fouled membranes as a function of NOM physicochemical characteristics and solution chemistry. © 2013 Elsevier Ltd.

  17. Rotaxane functionalized acid-terminated self-assembled siloxane monolayers on non-conducting surfaces - XPS, AFM and TRF

    NARCIS (Netherlands)

    Lubomska, Monika; Karban, Oksana; Pugžlys, Audrius; Kay, Euan R.; Wong, Jenny K.Y.; Leigh, David A.; Rudolf, Petra; Marciniak, M

    2006-01-01

    Mechanically interlocked molecules such as rotaxanes are fascinating for their potential in molecular-scale devices. Rotaxane, stimuli-responsive "molecular shuttles" are molecules where a macrocyclic `bead' is locked onto a linear "thread" by bulky "stoppers". Large amplitude motion of the

  18. Systematic UHV-AFM experiments on Na nano-particles and nano-structures in NaCl

    NARCIS (Netherlands)

    Sugonyako, A.V.; Turkin, A.A.; Gaynutdinov, R.; Vainshtein, D.I.; Hartog, H.W. den; Bukharaev, A.A.

    2005-01-01

    Results of systematic AFM (atomic force microscopy) experiments on heavily and moderatly irradiated NaCl samples are presented. The sodium nanoparticles and structures of nanoparticles are poduced in sodium chloride during irradiation. The AFM images of the nanoparticles have been obtained in ultra

  19. EUV blank defect and particle inspection with high throughput immersion AFM with 1nm 3D resolution

    NARCIS (Netherlands)

    Es, M.H. van; Sadeghian Marnani, H.

    2016-01-01

    Inspection of EUV mask substrates and blanks is demanding. We envision this is a good target application for massively parallel Atomic Force Microscopy (AFM). We envision to do a full surface characterization of EUV masks with AFM enabling 1nm true 3D resolution over the entire surface. The limiting

  20. The electrically detected magnetic resonance microscope: combining conductive atomic force microscopy with electrically detected magnetic resonance.

    Science.gov (United States)

    Klein, Konrad; Hauer, Benedikt; Stoib, Benedikt; Trautwein, Markus; Matich, Sonja; Huebl, Hans; Astakhov, Oleksandr; Finger, Friedhelm; Bittl, Robert; Stutzmann, Martin; Brandt, Martin S

    2013-10-01

    We present the design and implementation of a scanning probe microscope, which combines electrically detected magnetic resonance (EDMR) and (photo-)conductive atomic force microscopy ((p)cAFM). The integration of a 3-loop 2-gap X-band microwave resonator into an AFM allows the use of conductive AFM tips as a movable contact for EDMR experiments. The optical readout of the AFM cantilever is based on an infrared laser to avoid disturbances of current measurements by absorption of straylight of the detection laser. Using amorphous silicon thin film samples with varying defect densities, the capability to detect a spatial EDMR contrast is demonstrated. Resonant current changes as low as 20 fA can be detected, allowing the method to realize a spin sensitivity of 8×10(6)spins/√Hz at room temperature.

  1. Investigation of Ag-TiO2 Interfacial Reaction of Highly Stable Ag Nanowire Transparent Conductive Film with Conformal TiO2 Coating by Atomic Layer Deposition.

    Science.gov (United States)

    Yeh, Ming-Hua; Chen, Po-Hsun; Yang, Yi-Ching; Chen, Guan-Hong; Chen, Hsueh-Shih

    2017-03-29

    The atomic layer deposition (ALD) technique is applied to coat Ag nanowires (NWs) with a highly uniform and conformal TiO2 layer to improve the stability and sustainability of Ag NW transparent conductive films (TCFs) at high temperatures. The TiO2 layer can be directly deposited on Ag NWs with a surface polyvinylpyrrolidone (PVP) coat that acts a bed for TiO2 seeding in the ALD process. The ALD TiO2 layer significantly enhances the thermal stability at least 100 fold when aged between 200-400 °C and also provides an extra function of violet-blue light filtration for Ag NW TCFs. Investigation into the interaction between TiO2 and Ag reveals that the conformal TiO2 shell could effectively prevent Ag from 1D-to-3D ripening. However, Ag could penetrate the conformal TiO2 shell and form nanocrystals on the TiO2 shell surface when it is aged at 400 °C. According to experimental data and thermodynamic evaluation, the Ag penetration leads to an interlayer composed of mixed Ag-Ag2O-amorphous carbon phases and TiO2-x at the Ag-TiO2 interface, which is thought to be caused by extremely high vapor pressure of Ag at the Ag-TiO2 interface at a higher temperature (e.g., 400 °C).

  2. Investigation of trap states in high Al content AlGaN/GaN high electron mobility transistors by frequency dependent capacitance and conductance analysis

    Directory of Open Access Journals (Sweden)

    Jie-Jie Zhu

    2014-03-01

    Full Text Available Trap states in Al0.55Ga0.45N/GaN Schottky-gate high-electron-mobility transistors (S-HEMTs and Al2O3/Al0.55Ga0.45N/GaN metal-oxide-semiconductor HEMTs (MOS-HEMTs were investigated with conductance method in this paper. Surface states with time constant of (0.09–0.12 μs were found in S-HEMTs, and electron tunneling rather than emission was deemed to be the dominant de-trapping mechanism due to the high electric field in high Al content barrier. The density of surface states evaluated in S-HEMTs was (1.02–4.67×1013 eV−1·cm−2. Al2O3 gate insulator slightly reduced the surface states, but introduced low density of new traps with time constant of (0.65–1.29 μs into MOS-HEMTs.

  3. Scanning Ion Conductance Microscopy of Live Keratinocytes

    Science.gov (United States)

    Hegde, V.; Mason, A.; Saliev, T.; Smith, F. J. D.; McLean, W. H. I.; Campbell, P. A.

    2012-07-01

    Scanning ion conductance microscopy (SICM) is perhaps the least well known technique from the scanning probe microscopy (SPM) family of instruments. As with its more familiar counterpart, atomic force microscopy (AFM), the technique provides high-resolution topographic imaging, with the caveat that target structures must be immersed in a conducting solution so that a controllable ion current may be utilised as the basis for feedback. In operation, this non-contact characteristic of SICM makes it ideal for the study of delicate structures, such as live cells. Moreover, the intrinsic architecture of the instrument, incorporating as it does, a scanned micropipette, lends itself to combination approaches with complementary techniques such as patch-clamp electrophysiology: SICM therefore boasts the capability for both structural and functional imaging. For the present observations, an ICnano S system (Ionscope Ltd., Melbourn, UK) operating in 'hopping mode' was used, with the objective of assessing the instrument's utility for imaging live keratinocytes under physiological buffers. In scans employing cultured HaCaT cells (spontaneously immortalised, human keratinocytes), we compared the qualitative differences of live cells imaged with SICM and AFM, and also with their respective counterparts after chemical fixation in 4% paraformaldehyde. Characteristic surface microvilli were particularly prominent in live cell imaging by SICM. Moreover, time lapse SICM imaging on live cells revealed that changes in the pattern of microvilli could be tracked over time. By comparison, AFM imaging on live cells, even at very low contact forces (monitoring the most delicate living structures with attendant high spatial resolutions.

  4. Force modulation for improved conductive-mode atomic force microscopy

    NARCIS (Netherlands)

    Koelmans, W.W.; Sebastian, Abu; Despont, Michel; Pozidis, Haris

    We present an improved conductive-mode atomic force microscopy (C-AFM) method by modulating the applied loading force on the tip. Unreliable electrical contact and tip wear are the primary challenges for electrical characterization at the nanometer scale. The experiments show that force modulation

  5. Abiotic reversible self-assembly of fulvic and humic acid aggregates in low electrolytic conductivity solutions by dynamic light scattering and zeta potential investigation.

    Science.gov (United States)

    Esfahani, Milad Rabbani; Stretz, Holly A; Wells, Martha J M

    2015-12-15

    The aggregation of humic substances and their interaction with filtration media (membranes, soils) has implications for our understanding of membrane fouling during water treatment, the facilitated transport of contaminants, and the transport of organic matter through the microbial loop. To investigate the aggregation of fulvic and humic acids in low electrolytic conductivity solutions, laboratory studies of simulated environmental water samples as well as actual environmental water samples were examined. Intensity-, volume-, and number-based particle size distributions (PSDs) were obtained by dynamic light scattering. Aggregates were categorized into three ranges, i.e., 10-100 nm, 100-1000 nm, and >1 μm. Individual biomacromolecules and the aggregates between 10 nm and 1 μm were presumed to be precursors for the formation of a large 5-μm-sized-particle. The self-assembly of the large-in-volume, few-in-number, 5-μm-sized particle was observed in real-time and occurred in unfiltered samples and in samples filtered (0.45 μm) at a nominal size one order of magnitude smaller. The supramicrometer-sized particle formed, dissipated, and spontaneously re-formed over turbulent/quiescent cycles in the presence of sodium azide indicating reversible abiotic self-assembly. Zeta potential analyses demonstrated that colloidal stability increased as concentration increased. DLS studies of the environmental water samples were comparable to those of the simulated laboratory samples. The operational range of the instrumentation used in these experiments was 0.6 nm-6 μm; therefore, aggregates larger than 6 μm may exist in these solutions. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Investigations on neurotoxicity of chemical substances at the workplace. VII. Longitudinal study with determination of nerve conduction velocities in persons occupationally exposed to styrene

    Energy Technology Data Exchange (ETDEWEB)

    Triebig, G.; Schaller, K.H.; Valentin, H.

    1985-01-01

    The aim of this longitudinal study was to investigate whether long-term exposure to styrene is associated with functional disorders of the peripheral nervous system. Eleven workers (age: 24 to 54 years) of a polyester resin boat industry were studied neurophysiologically and biochemically in 1980 and 1983. The duration of styrene-exposure varied from 3 to 7 years, with a median of 4 years. The control group was comprised of 11 non-styrene-exposed workers of similar age. Air Monitoring with passive samplers was performed on different days for each person. The mean styrene concentrations were 114, 97 and 92 ppm respectively and therefore in the magnitude of the current MAK-value of 100 ppm in the Federal Republic of Germany (FRG). For Biological Monitoring styrene in blood (S-B) and mandelic acid (MA) as well as phenylglyoxylic-acid (PGA) in urine were determined in post-shift samples. The median values for MA at four different sampling times were 816, 1660, 1101 and 1224 mg/g creatinine and for PGA 200, 273, 342 and 336 mg/g creatinine respectively. These levels were below the current Biologischer Arbeitsstoff Toleranzwert (BAT-Wert) for MA (2000 mg/l) and MA + PGA (2500 mg/l). The S-B concentrations ranged from 0.05 mg/l to 3.26 mg/l, with mean values of 0.92 and 0.70 mg/l. The nerve conduction velocities (NCV) of motor and sensory nerve fibers (N. ulnaris and/or N. medianus) showed no significant differences between styrene-exposed workers and age-matched control persons. There were no hints of dose-effect-relationships by correlation analyses. Furthermore the follow-up determination revealed no significant changes regarding NCV.

  7. Surface features on Sahara soil dust particles made visible by atomic force microscope (AFM phase images

    Directory of Open Access Journals (Sweden)

    M. O. Andreae

    2008-10-01

    Full Text Available We show that atomic force microscopy (AFM phase images can reveal surface features of soil dust particles, which are not evident using other microscopic methods. The non-contact AFM method is able to resolve topographical structures in the nanometer range as well as to uncover repulsive atomic forces and attractive van der Waals' forces, and thus gives insight to surface properties. Though the method does not allow quantitative assignment in terms of chemical compound description, it clearly shows deposits of distinguishable material on the surface. We apply this technique to dust aerosol particles from the Sahara collected over the Atlantic Ocean and describe micro-features on the surfaces of such particles.

  8. AFM assessment of the surface nano/microstructure on chemically damaged historical and model glasses

    Energy Technology Data Exchange (ETDEWEB)

    Carmona, Noemi [Centro Nacional de Investigaciones Metalurgicas, CSIC, Avda. Gregorio del Amo, 8, 28040 Madrid (Spain); Kowal, Andrzej [Institute of Catalysis and Surface Chemistry, PAN, ul. Niezapominajek 8, 30239 Cracow (Poland); Rincon, Jesus-Maria [Instituto Eduardo Torroja de Ciencias de la Construccion, CSIC, C. Serrano Galvache s/n, 28033 Madrid (Spain); Villegas, Maria-Angeles, E-mail: mariangeles.villegas@cchs.csic.es [Centro Nacional de Investigaciones Metalurgicas, CSIC, Avda. Gregorio del Amo, 8, 28040 Madrid (Spain); Instituto de Historia, Centro de Ciencias Humanas y Sociales, CSIC, C. Albasanz, 26-28, 28037 Madrid (Spain)

    2010-01-15

    Surface chemical damage on selected historical glasses from 13th to 19th centuries was evaluated by means of atomic force microscopy (AFM). Nano- and microstructure, roughness and topography of ancient glass samples have been compared with those of model glasses prepared by conventional melting at the laboratory with similar compositions to those most frequently found in historical glass pieces. The results obtained allow discussing the chemical degradation mechanisms in terms of the acid and/or basic chemical attack carried out by the combination of gaseous pollutants and environmental humidity. Even though deep corrosion features escape to the observation order of magnitude of the AF microscope used, the AFM technique proves to be quite useful for the study and evaluation of the most common surface pathologies of historical glasses with different compositions once submitted to natural weathering.

  9. Liquid solution delivery through the pulled nanopipette combined with QTF-AFM system

    Science.gov (United States)

    An, Sangmin; Stambaugh, Corey; Kim, Gunn; Lee, Manhee; Kim, Yonghee; Lee, Kunyoung; Jhe, Wonho

    2012-02-01

    Nanopipette is a versatile fluidic tool for biochemical analysis, controlled liquid delivery in bio-nanotechnology. However, most of the researches have been performed in solution based system, thus it is challenge to study nanofluidic properties of the liquid solution delivery through the nanopipette in ambient conditions. In this work, we demonstrated the liquid ejection, dispersion, and subsequent deposition of the nanoparticles via a 30 nm aperture pipette based on the quartz tuning fork -- atomic force microscope (QTF-AFM) combined nanopipette system.

  10. High-Speed AFM Images of Thermal Motion Provide Stiffness Map of Interfacial Membrane Protein Moieties

    OpenAIRE

    Preiner, Johannes; Horner, Andreas; Karner, Andreas; Ollinger, Nicole; Siligan, Christine; Pohl, Peter; Hinterdorfer, Peter

    2014-01-01

    The flexibilities of extracellular loops determine ligand binding and activation of membrane receptors. Arising from fluctuations in inter- and intraproteinaceous interactions, flexibility manifests in thermal motion. Here we demonstrate that quantitative flexibility values can be extracted from directly imaging the thermal motion of membrane protein moieties using high-speed atomic force microscopy (HS-AFM). Stiffness maps of the main periplasmic loops of single reconstituted water channels ...

  11. Accurate, explicit formulae for higher harmonic force spectroscopy by frequency modulation-AFM

    OpenAIRE

    Kfir Kuchuk; Uri Sivan

    2015-01-01

    Summary The nonlinear interaction between an AFM tip and a sample gives rise to oscillations of the cantilever at integral multiples (harmonics) of the fundamental resonance frequency. The higher order harmonics have long been recognized to hold invaluable information on short range interactions but their utilization has thus far been relatively limited due to theoretical and experimental complexities. In particular, existing approximations of the interaction force in terms of higher harmonic...

  12. Fabrication of tuning-fork based AFM and STM tungsten probe

    KAUST Repository

    Al-Falih, Hisham

    2011-12-01

    We compare the sharpness of tungsten probe tips produced by the single-step and two-step dynamic electrochemical etching processes. A small radius of curvature (RoC) of 25 nm or less was routinely obtained when the two-step electrochemical etching (TEE) process was adopted, while the smallest achievable RoC was ∼10 nm, rendering it suitable for atomic force microscopy (AFM) or scanning tunneling microscopy (STM) applications. © 2011 IEEE.

  13. Tumor suppressor protein SMAR1 modulates the roughness of cell surface: combined AFM and SEM study

    Directory of Open Access Journals (Sweden)

    Mamgain Hitesh

    2009-10-01

    Full Text Available Abstract Background Imaging tools such as scanning electron microscope (SEM and atomic force microscope (AFM can be used to produce high-resolution topographic images of biomedical specimens and hence are well suited for imaging alterations in cell morphology. We have studied the correlation of SMAR1 expression with cell surface smoothness in cell lines as well as in different grades of human breast cancer and mouse tumor sections. Methods We validated knockdown and overexpression of SMAR1 using RT-PCR as well as Western blotting in human embryonic kidney (HEK 293, human breast cancer (MCF-7 and mouse melanoma (B16F1 cell lines. The samples were then processed for cell surface roughness studies using atomic force microscopy (AFM and scanning electron microscopy (SEM. The same samples were used for microarray analysis as well. Tumors sections from control and SMAR1 treated mice as well as tissues sections from different grades of human breast cancer on poly L-lysine coated slides were used for AFM and SEM studies. Results Tumor sections from mice injected with melanoma cells showed pronounced surface roughness. In contrast, tumor sections obtained from nude mice that were first injected with melanoma cells followed by repeated injections of SMAR1-P44 peptide, exhibited relatively smoother surface profile. Interestingly, human breast cancer tissue sections that showed reduced SMAR1 expression exhibited increased surface roughness compared to the adjacent normal breast tissue. Our AFM data establishes that treatment of cells with SMAR1-P44 results into increase in cytoskeletal volume that is supported by comparative gene expression data showing an increase in the expression of specific cytoskeletal proteins compared to the control cells. Altogether, these findings indicate that tumor suppressor function of SMAR1 might be exhibited through smoothening of cell surface by regulating expression of cell surface proteins. Conclusion Tumor suppressor

  14. Comparative studies of thin film growth on aluminium by AFM, TEM and GDOES characterization

    Energy Technology Data Exchange (ETDEWEB)

    Qi, Jiantao, E-mail: alexanderinmanchester@gmail.com; Thompson, George E.

    2016-07-30

    Highlights: • Coating initiation was evidenced after conversion treatment for only 30 s and the uniform cross section revealed a chemical deposition process of electrolyte anions on aluminium. • A proceeding process of aluminium dissolution during conversion treatment was found for the first time, indicating non-inhibitive kinetics of anodic reactions. • Coating growth on aluminium was determined by the availability of electrolyte anions and the prolonged conversion treatment crated a significant concentration gradient to limit growth. • Coating shrinkage either in the microscope or after post-coating treatment in the air was clarified, especially for the coating after prolonged conversion treatments. - Abstract: In this present study, comparative studies of trivalent chromium conversion coating formation, associated with aluminium dissolution process, have been investigated using atomic force microscopy (AFM), transmission electron microscopy (TEM) and glow-discharge optical emission spectroscopy (GDOES). High-resolution electron micrographs revealed the evident and uniform coating initiation on the whole surface after conversion treatment for only 30 s, although a network of metal ridges was created by HF etching pre-treatment. In terms of conversion treatment process on electropolished aluminium, constant kinetics of coating growth, ∼0.30 ± 0.2 nm/s, were found after the prolonged conversion treatment for 600 s. The availability of electrolyte anions for coating deposition determined the growth process. Simultaneously, a proceeding process of aluminium dissolution during conversion treatment, of ∼0.11 ± 0.02 nm/s, was found for the first time, indicating constant kinetics of anodic reactions. The distinct process of aluminium consumption was assigned with loss of corrosion protection of the deposited coating material as evidenced in the electrochemical impedance spectroscopy. Based on the present data, a new mechanism of coating growth on aluminium

  15. Fracture Growth Testing of Titanium 6AL-4V in AF-M315E

    Science.gov (United States)

    Sampson, Jeffrey W.; Martinez, Jonathan; McLean, Christopher

    2015-01-01

    The Green Propellant Infusion Mission (GPIM) will demonstrate the performance of AF-M315E monopropellant in orbit. Flight certification requires a safe-life analysis of the titanium alloy fuel tank to ensure inherent flaws will not cause failure during the design life. Material property inputs for this analysis require testing to determine the stress intensity factor for environmentally-assisted cracking (K (sub EAC)) of Ti 6Al-4V in combination with the AF-M315E monopropellant. Testing of single-edge notched specimens SE(B) representing the bulk tank membrane and weld material were performed in accordance with ASTM E1681. Specimens with fatigue pre-cracks were loaded into test fixtures so that the crack tips were exposed to the monopropellant at 50 degrees Centigrade for a duration of 1,000 hours. Specimens that did not fail during exposure were opened to inspect the crack surfaces for evidence of crack growth. The threshold stress intensity value, KEAC, is the highest applied stress intensity that produced neither a failure of the specimen during the exposure nor showed evidence of crack growth. The threshold stress intensity factor of the Ti 6Al-4V forged tank material when exposed to AF-M315E monopropellant was found to be at least 22.0 kilopounds per square inch. The stress intensity factor of the weld material was at least 31.3 kilopounds per square inch.

  16. Combined AFM and confocal fluorescence microscope for applications in bio-nanotechnology.

    Science.gov (United States)

    Kassies, R; van der Werf, K O; Lenferink, A; Hunter, C N; Olsen, J D; Subramaniam, V; Otto, C

    2005-01-01

    We present a custom-designed atomic force fluorescence microscope (AFFM), which can perform simultaneous optical and topographic measurements with single molecule sensitivity throughout the whole visible to near-infrared spectral region. Integration of atomic force microscopy (AFM) and confocal fluorescence microscopy combines the high-resolution topographical imaging of AFM with the reliable (bio)-chemical identification capability of optical methods. The AFFM is equipped with a spectrograph enabling combined topographic and fluorescence spectral imaging, which significantly enhances discrimination of spectroscopically distinct objects. The modular design allows easy switching between different modes of operation such as tip-scanning, sample-scanning or mechanical manipulation, all of which are combined with synchronous optical detection. We demonstrate that coupling the AFM with the fluorescence microscope does not compromise its ability to image with a high spatial resolution. Examples of several modes of operation of the AFFM are shown using two-dimensional crystals and membranes containing light-harvesting complexes from the photosynthetic bacterium Rhodobacter sphaeroides.

  17. A Novel Dog-Bone Oscillating AFM Probe with Thermal Actuation and Piezoresistive Detection

    Directory of Open Access Journals (Sweden)

    Zhuang Xiong

    2014-10-01

    Full Text Available In order to effectively increase the resonance frequency and the quality factor of atomic force microscope (AFM probes, a novel oscillating probe based on a dog-bone shaped MEMS resonator was conceived, designed, fabricated and evaluated. The novel probe with 400 μm in length, 100 μm in width and 5 μm in thickness was enabled to feature MHz resonance frequencies with integrated thermal actuation and piezoresistive detection. Standard silicon micromachining was employed. Both electrical and optical measurements were carried out in air. The resonance frequency and the quality factor of the novel probe were measured to be 5.4 MHz and 4000 respectively, which are much higher than those (about several hundreds of kHz of commonly used cantilever probes. The probe was mounted onto a commercial AFM set-up through a dedicated probe-holder and circuit board. Topographic images of patterned resist samples were obtained. It is expected that the resonance frequency and the measurement bandwidth of such probes will be further increased by a proper downscaling, thus leading to a significant increase in the scanning speed capability of AFM instruments.

  18. A Novel Dog-Bone Oscillating AFM Probe with Thermal Actuation and Piezoresistive Detection †

    Science.gov (United States)

    Xiong, Zhuang; Mairiaux, Estelle; Walter, Benjamin; Faucher, Marc; Buchaillot, Lionel; Legrand, Bernard

    2014-01-01

    In order to effectively increase the resonance frequency and the quality factor of atomic force microscope (AFM) probes, a novel oscillating probe based on a dog-bone shaped MEMS resonator was conceived, designed, fabricated and evaluated. The novel probe with 400 μm in length, 100 μm in width and 5 μm in thickness was enabled to feature MHz resonance frequencies with integrated thermal actuation and piezoresistive detection. Standard silicon micromachining was employed. Both electrical and optical measurements were carried out in air. The resonance frequency and the quality factor of the novel probe were measured to be 5.4 MHz and 4000 respectively, which are much higher than those (about several hundreds of kHz) of commonly used cantilever probes. The probe was mounted onto a commercial AFM set-up through a dedicated probe-holder and circuit board. Topographic images of patterned resist samples were obtained. It is expected that the resonance frequency and the measurement bandwidth of such probes will be further increased by a proper downscaling, thus leading to a significant increase in the scanning speed capability of AFM instruments. PMID:25365463

  19. AFM and pulsed laser ablation methods for Cultural Heritage: application to archeometric analysis of stone artifacts

    Science.gov (United States)

    Barberio, M.; Veltri, S.; Stranges, F.; Bonanno, A.; Xu, F.; Antici, P.

    2015-09-01

    In this paper, we introduce the use of the atomic force microscope (AFM) and of the pulsed laser ablation as methods for morphological diagnostic with nanoscale precision of archeological artifacts and corrosive patina removal from stone artifacts. We test our methodology on stone artifacts extracted from the Church of Sotterra (located in Calabria, South Italy). The AFM microscopy was compared with different petrographic, chemical, optical and morphological analysis methods for identifying the textural characteristics, evaluating the state of preservation and formulating some hypotheses about the provenance and composition of the impurity patina located on the artifact surfaces. We demonstrate that with the nanometric precision obtained with AFM microscopy, it is possible to distinguish the different states of preservation, much better than using conventional petrographic methods. The surface's roughness is evaluated from very small artifact's fragments, reducing the coring at micrometric scale with a minimal damage to the artworks. After the diagnosis, we performed restoration tests using the pulsed laser ablation (PLA) method and compared it with the more common micro-sandblasting under dry conditions. We find that the PLA is highly effective for the removal of the surficial patina, with a control of a few hundreds of nanometers in the cleaning of surface, without introducing chemical or morphological damages to the artifacts. Moreover, PLA can be easily implemented in underwater conditions; this has the great advantage that stone and pottery artifacts for marine archeological sites do not need to be removed from the site.

  20. Accurate, explicit formulae for higher harmonic force spectroscopy by frequency modulation-AFM

    Directory of Open Access Journals (Sweden)

    Kfir Kuchuk

    2015-01-01

    Full Text Available The nonlinear interaction between an AFM tip and a sample gives rise to oscillations of the cantilever at integral multiples (harmonics of the fundamental resonance frequency. The higher order harmonics have long been recognized to hold invaluable information on short range interactions but their utilization has thus far been relatively limited due to theoretical and experimental complexities. In particular, existing approximations of the interaction force in terms of higher harmonic amplitudes generally require simultaneous measurements of multiple harmonics to achieve satisfactory accuracy. In the present letter we address the mathematical challenge and derive accurate, explicit formulae for both conservative and dissipative forces in terms of an arbitrary single harmonic. Additionally, we show that in frequency modulation-AFM (FM-AFM each harmonic carries complete information on the force, obviating the need for multi-harmonic analysis. Finally, we show that higher harmonics may indeed be used to reconstruct short range forces more accurately than the fundamental harmonic when the oscillation amplitude is small compared with the interaction range.

  1. Accurate, explicit formulae for higher harmonic force spectroscopy by frequency modulation-AFM.

    Science.gov (United States)

    Kuchuk, Kfir; Sivan, Uri

    2015-01-01

    The nonlinear interaction between an AFM tip and a sample gives rise to oscillations of the cantilever at integral multiples (harmonics) of the fundamental resonance frequency. The higher order harmonics have long been recognized to hold invaluable information on short range interactions but their utilization has thus far been relatively limited due to theoretical and experimental complexities. In particular, existing approximations of the interaction force in terms of higher harmonic amplitudes generally require simultaneous measurements of multiple harmonics to achieve satisfactory accuracy. In the present letter we address the mathematical challenge and derive accurate, explicit formulae for both conservative and dissipative forces in terms of an arbitrary single harmonic. Additionally, we show that in frequency modulation-AFM (FM-AFM) each harmonic carries complete information on the force, obviating the need for multi-harmonic analysis. Finally, we show that higher harmonics may indeed be used to reconstruct short range forces more accurately than the fundamental harmonic when the oscillation amplitude is small compared with the interaction range.

  2. Writing with Fluid: Structuring Hydrogels with Micrometer Precision by AFM in Combination with Nanofluidics.

    Science.gov (United States)

    Helfricht, Nicolas; Mark, Andreas; Behr, Marina; Bernet, Andreas; Schmidt, Hans-Werner; Papastavrou, Georg

    2017-08-01

    Hydrogels have many applications in biomedical surface modification and tissue engineering. However, the structuring of hydrogels after their formation represents still a major challenge, in particular due to their softness. Here, a novel approach is presented that is based on the combination of atomic force microscopy (AFM) and nanofluidics, also referred to as FluidFM technology. Its applicability is demonstrated for supramolecular hydrogel films that are prepared from low-molecular weight hydrogelators, such as derivates of 1,3,5-benzene tricarboxamides (BTAs). BTA films can be dissolved selectively by ejecting alkaline solution through the aperture of a hollow AFM-cantilever connected to a nanofluidic controller. The AFM-based force control is essential in preventing mechanical destruction of the hydrogels. The resulting "chemical writing" process is studied in detail and the influence of various parameters, such as applied pressure and time, is validated. It is demonstrated that the achievable structuring precision is primarily limited by diffusion and the aperture dimensions. Recently, various additive techniques have been presented to pattern hydrogels. The here-presented subtractive approach can not only be applied to structure hydrogels from the large class of reversibly formed gels with superior resolution but would also allow for the selective loading of the hydrogels with active substances or nanoparticles. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Non--Cubic Symmetry of the Electronic Response in AFM Late Transition--Metal Oxides.

    Science.gov (United States)

    Posternak, M.; Baldereschi, A.; Massidda, S.; Resta, R.

    1998-03-01

    The late transition--metal monoxides (MnO, FeO, CoO, NiO) have the rocksalt structure in their paramagnetic phase, while below the Neel temperature a weak structural distortion accompanies an AFM ordering of type II. Therefore, it is generally assumed that most nonmagnetic (i.e. spin--integrated) crystalline properties are essentially cubic: we give here convincing evidence of the contrary. We focus on the half--filled d shell oxide MnO as the most suitable case study, on which we perform accurate ab--initio, all--electron calculations, within different one--particle schemes. In order to study the symmetry lowering due to AFM ordering, we assume an ideal cubic geometry throughout. The calculated TO frequencies and Born effective charge tensor do not have cubic symmetry. The standard LSD severely exaggerates the deviations from cubic symmetry, confirming its unreliability for calculating properties of insulating AFM oxides, while a model self--energy correction scheme(S. Massidda et al.), Phys. Rev. B 55, 13494 (1997). reduces considerably the anisotropy. We also explain the origin and the magnitude of this effect in terms of the mixed charge--transfer/Mott--Hubbard character of MnO.

  4. Brain tumor classification using AFM in combination with data mining techniques.

    Science.gov (United States)

    Huml, Marlene; Silye, René; Zauner, Gerald; Hutterer, Stephan; Schilcher, Kurt

    2013-01-01

    Although classification of astrocytic tumors is standardized by the WHO grading system, which is mainly based on microscopy-derived, histomorphological features, there is great interobserver variability. The main causes are thought to be the complexity of morphological details varying from tumor to tumor and from patient to patient, variations in the technical histopathological procedures like staining protocols, and finally the individual experience of the diagnosing pathologist. Thus, to raise astrocytoma grading to a more objective standard, this paper proposes a methodology based on atomic force microscopy (AFM) derived images made from histopathological samples in combination with data mining techniques. By comparing AFM images with corresponding light microscopy images of the same area, the progressive formation of cavities due to cell necrosis was identified as a typical morphological marker for a computer-assisted analysis. Using genetic programming as a tool for feature analysis, a best model was created that achieved 94.74% classification accuracy in distinguishing grade II tumors from grade IV ones. While utilizing modern image analysis techniques, AFM may become an important tool in astrocytic tumor diagnosis. By this way patients suffering from grade II tumors are identified unambiguously, having a less risk for malignant transformation. They would benefit from early adjuvant therapies.

  5. Simulation of CNT-AFM tip based on finite element analysis for targeted probe of the biological cell

    Energy Technology Data Exchange (ETDEWEB)

    Yousefi, Amin Termeh, E-mail: at.tyousefi@gmail.com; Miyake, Mikio, E-mail: miyakejaist@gmail.com; Ikeda, Shoichiro, E-mail: sho16.ikeda@gmail.com [ChECA IKohza, Dept. Environmental & Green Technology (EGT), Malaysia, Japan International Institute of Technology (MJIIT), University Technology Malaysia - UTM, Kualalumpur (Malaysia); Mahmood, Mohamad Rusop, E-mail: nano@uitm.gmail.com [NANO-SciTech Centre, Institute of Science, Universiti Teknologi MARA (UiTM), Shah Alam, Selangor (Malaysia)

    2016-07-06

    Carbon nanotubes (CNTs) are potentially ideal tips for atomic force microscopy (AFM) due to the robust mechanical properties, nano scale diameter and also their ability to be functionalized by chemical and biological components at the tip ends. This contribution develops the idea of using CNTs as an AFM tip in computational analysis of the biological cell’s. Finite element analysis employed for each section and displacement of the nodes located in the contact area was monitored by using an output database (ODB). This reliable integration of CNT-AFM tip process provides a new class of high performance nanoprobes for single biological cell analysis.

  6. Simultaneous Scanning Ion Conductance Microscopy and Atomic Force Microscopy with Microchanneled Cantilevers.

    Science.gov (United States)

    Ossola, Dario; Dorwling-Carter, Livie; Dermutz, Harald; Behr, Pascal; Vörös, János; Zambelli, Tomaso

    2015-12-04

    We combined scanning ion conductance microscopy (SICM) and atomic force microscopy (AFM) into a single tool using AFM cantilevers with an embedded microchannel flowing into the nanosized aperture at the apex of the hollow pyramid. An electrode was positioned in the AFM fluidic circuit connected to a second electrode in the bath. We could thus simultaneously measure the ionic current and the cantilever bending (in optical beam deflection mode). First, we quantitatively compared the SICM and AFM contact points on the approach curves. Second, we estimated where the probe in SICM mode touches the sample during scanning on a calibration grid and applied the finding to image a network of neurites on a Petri dish. Finally, we assessed the feasibility of a double controller using both the ionic current and the deflection as input signals of the piezofeedback. The experimental data were rationalized in the framework of finite elements simulations.

  7. 3D-AFM enhancement for CD metrology dedicated to lithography sub-28-nm node requirements

    Science.gov (United States)

    Foucher, J.; Rana, N.; Dezauzier, C.

    2010-03-01

    With the continuous shrinkage of feature dimensions on IC in the semiconductor industry, the measurement uncertainty is becoming one of the major components that have to be controlled in order to guarantee sufficient production yield. Already at the R&D level, we have to cope up with the accurate measurements of sub-40nm dense trenches and contact holes coming from 193 immersion lithography or E-Beam lithography. By using top-down CD-SEM it is currently impossible to extract profile information. Moreover, electron proximity effect leads to non-negligible CD bias in the final measurements. To enable measurement of challenging dimensions with better measurement and reduced measurement uncertainty we have explored and fine tuned an alternative 3D-AFM mode (so-called DT mode) for CD measurements purpose. Theoretically, this mode is supposed to be dedicated only for height measurement but for certain applications it could be extended to reach the nanometer scale accuracy of CD-measurements employing certain optimized scan parameters. In this paper, we will present and discuss results obtained related to the use of this particular mode for CD measurement purpose versus conventional 3D-AFM CD Mode that shows important limitations for aggressive trenches dimensions measurements. We will also present some results related to the use of advanced 3D-AFM tips (typically of 28nm diameter) that have been used with the enhanced DT mode parameters. Example of applications will be shown with typical sub-45nm trenches measurements dedicated to advanced lithography process development that will demonstrate that we have succeed to push ahead the limit of the 3D-AFM technology in measuring the tight dimensions that would allow to continue its use for current and upcoming technology nodes. Finally, we introduce the concept of hybrid metrology in order to smartly use the benefit of reference metrology (i.e 3D-AFM) through the optimization of CD-SEM algorithm that could be used for example

  8. Phenotypic Heterogeneity in Attachment of Marine Bacteria toward Antifouling Copolymers Unraveled by AFM

    Science.gov (United States)

    El-Kirat-Chatel, Sofiane; Puymege, Aurore; Duong, The H.; Van Overtvelt, Perrine; Bressy, Christine; Belec, Lénaïk; Dufrêne, Yves F.; Molmeret, Maëlle

    2017-01-01

    Up to recent years, bacterial adhesion has mostly been evaluated at the population level. Single cell level has improved in the past few years allowing a better comprehension of the implication of individual behaviors as compared to the one of a whole community. A new approach using atomic force microscopy (AFM) to measure adhesion forces between a live bacterium attached via a silica microbead to the AFM tipless cantilever and the surface has been recently developed. The objectives of this study is to examine the bacterial adhesion to a surface dedicated to ship hulls at the population and the cellular level to understand to what extent these two levels could be correlated. Adhesion of marine bacteria on inert surfaces are poorly studied in particular when substrata are dedicated to ship hulls. Studying these interactions in this context are worthwhile as they may involve different adhesion behaviors, taking place in salty conditions, using different surfaces than the ones usually utilized in the literacy. FRC (fouling release coatings)–SPC (self-polishing coatings) hybrids antifouling coatings have been used as substrata and are of particular interest for designing environmentally friendly surfaces, combining progressive surface erosion and low adhesion properties. In this study, a hybrid coating has been synthetized and used to study the adhesion of three marine bacteria, displaying different surface characteristics, using microplate assays associated with confocal scanning laser microscopy (CSLM) and AFM. This study shows that the bacterial strain that appeared to have the weakest adhesion and biofilm formation abilities when evaluated at the population level using microplates assays and CSLM, displayed stronger adhesion forces on the same surfaces at the single cell level using AFM. In addition, one of the strains tested which presented a strong ability to adhere and to form biofilm at the population level, displayed a heterogeneous phenotypic behavior at

  9. Analyzing the vibrational response of an AFM cantilever in liquid with the consideration of tip mass by comparing the hydrodynamic and contact repulsive force models in higher modes

    Science.gov (United States)

    Korayem, Moharam Habibnejad; Nahavandi, Amir

    2017-04-01

    This paper investigates the vibration of a tapping-mode Atomic Force Microscope (AFM) cantilever covered with two whole piezoelectric layers in a liquid medium. The authors of this article have already modeled the vibration of a cantilever immersed in liquid over rough surfaces. Five new ideas have been considered for improving the results of the previous work. Mass and damping of a cantilever probe tip have been considered. Since the probe tip of an AFM cantilever has a mass, which can itself affect the natural frequency of vibration, the significance of this mass has been explored. Also, two hydrodynamic force models for analyzing the mass and damping added to a cantilever in liquid medium have been evaluated. In modeling the vibration of a cantilever in liquid, simplifications are made to the theoretical equations used in the modeling, which may make the obtained results different from those in the real case. So, two hydrodynamic force models are introduced and compared with each other. In addition to the already introduced DMT model, the JKR model has been proposed. The forces acting on a probe tip have attractive and repulsive effects. The attractive Van der Waals force can vary depending on the surface smoothness or roughness, and the repulsive contact force, which is independent of the type of surface roughness and usually varies with the hardness or softness of a surface. When the first mode is used in the vibration of an AFM cantilever, the changes of the existing physical parameters in the simulation do not usually produce a significant difference in the response. Thus, three cantilever vibration modes have been investigated. Finally, an analytical approach for obtaining the response of equations is presented which solves the resulting motion equation by the Laplace method and, thus, a time function is obtained for cantilever deflection is determined. Also, using the COMSOL software to model a cantilever in a liquid medium, the computed natural

  10. Noise and Electrical Oscillations Generation during the Investigation of the Resistive Switching in the Yttria Stabilized Zirconia Films by Conductive Atomic Force Microscopy

    Directory of Open Access Journals (Sweden)

    Oleg Gorshkov

    2015-01-01

    Full Text Available The effect of resistive switching in the yttria stabilized zirconia (YSZ thin films on Si substrates has been studied by Conductive Atomic Force Microscopy (CAFM. The resistive switching of the YSZ films from the low conductive state to the highly conductive one has been found to be associated with the increasing of the noise with broad frequency spectrum related to the redistribution of the oxygen vacancies in YSZ. The electrical oscillations in oscillation loop connected in series to the CAFM probe, the sample, and the bias source related to the excitation of the oscillation loop by the noise in the probe-to-sample contact film have been observed. The effect discovered is promising for application in the memristor devices of new generation.

  11. Conductivity and spectroscopic investigation of bis(trifluoromethanesulfonyl)imide solution in ionic liquid 1-butyl-3-methylimidazolium bis(trifluoromethanesulfonyl)imide.

    Science.gov (United States)

    Yu, Lei; Pizio, Benjamin S; Vaden, Timothy D

    2012-06-07

    Protic ionic liquids (PILs) are promising alternatives to water for swelling Nafion as a fuel cell proton exchange membrane (PEM). PILs can significantly improve the high-temperature performance of a PEM. The proton dissociation and solvation mechanisms in a PIL, which are keys to understanding the proton transportation and conductivity, have not been fully explored. In this paper, we used FTIR, Raman, and electronic spectroscopy with computational simulation techniques to explore the spectroscopic properties of bis(trifluoromethanesulfonyl)imide (HTFSI) solutions in 1-butyl-3-methylimidazolium bis(trifluoromethanesulfonyl)imide (BMITFSI) ionic liquid at concentrations from ∼0.1 to as high as ∼1.0 M. Solution conductivities were measured at room temperature and elevated temperatures up to ∼65 °C. The solution structure and properties depend on the concentration of HTFSI. At lower concentration, around 0.1 M, the HTFSI solution has higher conductivity than pure BMITFSI. However, the conductivity decreases when the concentration increases from 0.1 to 1.0 M. Temperature-dependent conductivities followed the Vogel-Fulcher-Tamman equation at all concentrations. Conductivity and spectroscopy results elucidate the complicated ionization and solvation mechanism of HTFSI in BMITFSI solutions. Raman spectroscopy and density functional theory (DFT) calculations are consistent with the complete ionization of HTFSI to generate solvated H(+) at low concentrations. FTIR, Raman, and electronic spectroscopic results as well as DFT computational simulation indicated that when the concentration is as high as 1.0 M, a significant amount of TFSI(-) is protonated, most likely at the imide nitrogen.

  12. A fully-automated neural network analysis of AFM force-distance curves for cancer tissue diagnosis

    Science.gov (United States)

    Minelli, Eleonora; Ciasca, Gabriele; Sassun, Tanya Enny; Antonelli, Manila; Palmieri, Valentina; Papi, Massimiliano; Maulucci, Giuseppe; Santoro, Antonio; Giangaspero, Felice; Delfini, Roberto; Campi, Gaetano; De Spirito, Marco

    2017-10-01

    Atomic Force Microscopy (AFM) has the unique capability of probing the nanoscale mechanical properties of biological systems that affect and are affected by the occurrence of many pathologies, including cancer. This capability has triggered growing interest in the translational process of AFM from physics laboratories to clinical practice. A factor still hindering the current use of AFM in diagnostics is related to the complexity of AFM data analysis, which is time-consuming and needs highly specialized personnel with a strong physical and mathematical background. In this work, we demonstrate an operator-independent neural-network approach for the analysis of surgically removed brain cancer tissues. This approach allowed us to distinguish—in a fully automated fashion—cancer from healthy tissues with high accuracy, also highlighting the presence and the location of infiltrating tumor cells.

  13. Investigating the Feasibility of Conducting Human Tracking and Following in an Indoor Environment Using a Microsoft Kinect and the Robot Operating System

    Science.gov (United States)

    2017-06-01

    technology , conventional visual processing methods used two- dimensional images, such as a camera image, to analyze a three-dimensional environment ...This did not provide enough information about the environment ; however, with increasing availability of new technology , objects and humans can be...FEASIBILITY OF CONDUCTING HUMAN TRACKING AND FOLLOWING IN AN INDOOR ENVIRONMENT USING A MICROSOFT KINECT AND THE ROBOT OPERATING SYSTEM by

  14. Investigating the effectiveness of using agricultural wastes from empty fruit bunch (EFB), coconut fibre (CF) and sugarcane baggasse (SB) to produce low thermal conductivity clay bricks

    Science.gov (United States)

    Hamzah, Mohamad Hazmi; Deraman, Rafikullah; Saman, Nor Sarwani Mat

    2017-12-01

    In Malaysia, 45% of the average household electricity was consumed by air conditioners to create an acceptable indoor environment. This high energy consumption was mostly related to poor thermal performance of the building envelope. Therefore, selecting a low thermal conductivity of brick wall was of considerable importance in creating energy efficient buildings. Previously, numerous researchers reported the potential used of agricultural waste as an additive in building materials to enhance their thermal properties. The aim of this study is to examine how agricultural wastes from empty fruit bunch (EFB), coconut fibre (CF) and sugarcane bagasse (SB) can act as additive agents in a fired clay brick manufacturing process to produce a low thermal conductivity clay brick. In this study, these agricultural wastes were individually mixed with clay soil in different proportions ranging from 0%, 2.5%, 5%, 7.5% and 10% by weight. Physical and mechanical properties including soil physical properties, as well as thermal conductivity were performed in accordance with BS 1377: Part 2: 1990, BS 3921: 1985 and ASTM C518. The results reveal that incorporating 5% of EFB as an additive component into the brick making process significantly enhances the production of a low thermal conductivity clay brick as compared to other waste alternatives tested. This finding suggests that EFB waste was a potential additive material to be used for the thermal property enhancement of the building envelope.

  15. Crystalline structure and squeeze-out dissipation of liquid solvation layers observed by small-amplitude dynamic AFM

    Science.gov (United States)

    Hofbauer, W.; Ho, R. J.; Hairulnizam, R.; Gosvami, N. N.; O'Shea, S. J.

    2009-10-01

    Using frequency-modulation atomic force microscopy (FM-AFM) at sub-nanometer vibration amplitudes, we find in the system n -dodecanol/graphite that solvation layers may extend for several nanometers into the bulk liquid. These layers maintain crystalline order which can be imaged using FM-AFM. The energy dissipation of the vibrating tip can peak sharply upon penetration of molecular layers. The tip shape appears critical for this effect.

  16. Conducting polymer materials

    Directory of Open Access Journals (Sweden)

    Jovanović Slobodan M.

    2003-01-01

    Full Text Available Conducting polymers represent a very interesting group of polymer materials Investigation of the synthesis, structure and properties of these materials has been the subject of considerable research efforts in the last twenty years. A short presentating of newer results obtained by investigating of the synthesis, structure and properties of two basic groups of conducting polymers: a conducting polymers the conductivity of which is the result of their molecular structure, and b conducting polymer composites (EPC, is given in this paper. The applications and future development of this group of polymer materials is also discussed.

  17. Conduct disorder

    Science.gov (United States)

    ... involve defiant or impulsive behavior, drug use, or criminal activity. Causes Conduct disorder has been linked to: ... 2nd ed. Philadelphia, PA: Elsevier; 2016:chap 23. Review Date 2/21/2017 Updated by: Timothy Rogge, ...

  18. Local Structural Investigations, Defect Formation, and Ionic Conductivity of the Lithium Ionic Conductor Li 4 P 2 S 6

    Energy Technology Data Exchange (ETDEWEB)

    Dietrich, Christian; Sadowski, Marcel; Sicolo, Sabrina; Weber, Dominik A.; Sedlmaier, Stefan J.; Weldert, Kai S.; Indris, Sylvio; Albe, Karsten; Janek, Jurgen; Zeier, Wolfgang G. (JLU); (TU Darmstadt); (Karlsruher)

    2016-12-13

    Glassy, glass–ceramic, and crystalline lithium thiophosphates have attracted interest in their use as solid electrolytes in all-solid-state batteries. Despite similar structural motifs, including PS43–, P2S64–, and P2S74– polyhedra, these materials exhibit a wide range of possible compositions, crystal structures, and ionic conductivities. Here, we present a combined approach of Bragg diffraction, pair distribution function analysis, Raman spectroscopy, and 31P magic angle spinning nuclear magnetic resonance spectroscopy to study the underlying crystal structure of Li4P2S6. In this work, we show that the material crystallizes in a planar structural arrangement as a glass ceramic composite, explaining the observed relatively low ionic conductivity, depending on the fraction of glass content. Calculations based on density functional theory provide an understanding of occurring diffusion pathways and ionic conductivity of this Li+ ionic conductor.

  19. A vibration investigation of a flat surface contact to skull bone for direct bone conduction transmission in sheep skulls in vivo.

    Science.gov (United States)

    Taghavi, Hamidreza; Håkansson, Bo; Eeg-Olofsson, Måns; Johansson, Carina B; Tjellström, Anders; Reinfeldt, Sabine; Bergqvist, Tomas; Olsson, Joakim

    2013-06-01

    Bone conduction implant (BCI) attached with a flat surface contact will offer efficient and linear vibration transmission over time. Despite that percutaneous bone conduction devices (PBCD) are successful in treating patients with conductive hearing loss, there are some drawbacks related to the need of a permanent skin penetration. The BCI system is designed as an alternative to the PBCD because it leaves the skin intact. BCI dummy implants were installed in 3 sheep skulls in vivo to study the vibration transmission characteristics over time. Mechanical point impedances and vibration transfer response functions of the BCI implants were measured at the time of surgery and after a healing period of 8 months. In 1 sheep both implants healed without complications. In the other 2 sheep, the implants were either partially loose or lost to follow up. In the sheep with stable implants, it was found by the resonance frequency shift of the mechanical point impedance that a firmer integration between the implant and bone tissue as seen in osseointegrated surfaces developed over time. It was also shown that the transcranial vibration transmission remains stable and linear. Providing bone chips in the contact between the implant and the bone did not enhance vibration transmission. The surgical procedure for installing the BCI dummy implants was uneventful. The mechanical point impedances and vibration transfer response functions indicate that the BCI implants integrate and that transmission conditions remain stable over time.

  20. Quantitative study of the elastic modulus of loosely attached cells in AFM indentation experiments.

    Science.gov (United States)

    Dokukin, Maxim E; Guz, Nataliia V; Sokolov, Igor

    2013-05-21

    When measuring the elastic (Young's) modulus of cells using AFM, good attachment of cells to a substrate is paramount. However, many cells cannot be firmly attached to many substrates. A loosely attached cell is more compliant under indenting. It may result in artificially low elastic modulus when analyzed with the elasticity models assuming firm attachment. Here we suggest an AFM-based method/model that can be applied to extract the correct Young's modulus of cells loosely attached to a substrate. The method is verified by using primary breast epithelial cancer cells (MCF-7) at passage 4. At this passage, approximately one-half of cells develop enough adhesion with the substrate to be firmly attached to the substrate. These cells look well spread. The other one-half of cells do not develop sufficient adhesion, and are loosely attached to the substrate. These cells look spherical. When processing the AFM indentation data, a straightforward use of the Hertz model results in a substantial difference of the Young's modulus between these two types of cells. If we use the model presented here, we see no statistical difference between the values of the Young's modulus of both poorly attached (round) and firmly attached (close to flat) cells. In addition, the presented model allows obtaining parameters of the brush surrounding the cells. The cellular brush observed is also statistically identical for both types of cells. The method described here can be applied to study mechanics of many other types of cells loosely attached to substrates, e.g., blood cells, some stem cells, cancerous cells, etc. Copyright © 2013 Biophysical Society. Published by Elsevier Inc. All rights reserved.

  1. CVD-grown graphene on LaAlO3/SrTiO3: transferring, patterning and c-AFM lithography

    Science.gov (United States)

    Huang, Mengchen; Jnawali, Giriraj; Hsu, Jen-Feng; Lee, Hyungwoo; Ryu, Sangwoo; Bi, Feng; Chen, Lu; Ghahari, Fereshte; Ravichandran, Jayakanth; Kim, Philip; Eom, Chang-Beom; D'Urso, Brian; Irvin, Patrick; Levy, Jeremy

    2015-03-01

    Interesting properties are anticipated when graphene is integrated with complex-oxide heterostructures. To create these structures, single-layer graphene is grown by chemical vapor deposition and transferred onto LaAlO3/SrTiO3. following a deep UV exposure method, the size and position of the graphene can be patterned to be compatible with the c-AFM lithography technique applied on LaAlO3/SrTiO3. Local control of metal-insulator transition at LaAlO3/SrTiO3 interface is reversibly achieved using the c-AFM lithography technique without observable graphene degradation. The graphene layer can also serve as a top gate to modulate the LaAlO3/SrTiO3 interface conductance. We gratefully acknowledge support for this work from NSF (DMR-1124131 and DMR-1234096), ONR (N00014-13-1-0806) and AFOSR (FA9550-10-1-0524 and FA9550-12-1-0342)

  2. Molecular dynamics simulations of GaAs-crystal surface modifications during nanoindentation with AFM tip.

    Science.gov (United States)

    Prasolov, N. D.; Brunkov, P. N.; Gutkin, A. A.

    2017-11-01

    The nanoindentation model of atomically flat surface of GaAs with the AFM tip was developed on the base of Molecular Dynamics. It was found that as a temperature rises above 100 K the nanoindention results in increase of number of atoms with higher number of neighbours, i.e. point defect appears in the topmost atomic layers of GaAs. The observed results can be explained with the kinetic concept of the mechanism of fracture of solid state where the generation of native point defects caused by the fluctuation of thermal energy and the external stress results in enhancement of the defect generation rate.

  3. Crystal structures of Boro-AFm and sBoro-AFt phases

    Energy Technology Data Exchange (ETDEWEB)

    Champenois, Jean-Baptiste [Commissariat a l' Energie Atomique et aux Energies Alternatives, CEA DEN/DTCD/SPDE, F-30207 Bagnols sur Ceze (France); Mesbah, Adel [Commissariat a l' Energie Atomique et aux Energies Alternatives, CEA DEN/DTCD/SPDE, F-30207 Bagnols sur Ceze (France); Clermont Universite, ENSCCF, Institut de Chimie de Clermont-Ferrand, BP 10448, F-63000 Clermont-Ferrand (France); Cau Dit Coumes, Celine, E-mail: celine.cau-dit-coumes@cea.fr [Commissariat a l' Energie Atomique et aux Energies Alternatives, CEA DEN/DTCD/SPDE, F-30207 Bagnols sur Ceze (France); Renaudin, Guillaume [Clermont Universite, ENSCCF, Institut de Chimie de Clermont-Ferrand, BP 10448, F-63000 Clermont-Ferrand (France); CNRS, UMR 6296, ICCF, F-63171 Aubiere (France); Leroux, Fabrice [Clermont Universite, Universite Blaise Pascal, Institut de Chimie de Clermont-Ferrand, BP 10448, F-63000 Clermont-Ferrand (France); CNRS, UMR 6296, ICCF, F-63171 Aubiere (France); Mercier, Cyrille [LMCPA, Universite de Valenciennes et du Hainaut Cambresis, 59600 Maubeuge (France); Revel, Bertrand [Centre Commun de Mesure RMN, Universite Lille1 Sciences et Technologies, Cite Scientifique 59655 Villeneuve d' Ascq Cedex (France); Damidot, Denis [EM Douai, MPE-GCE, 59508 Douai (France)

    2012-10-15

    Crystal structures of boron-containing AFm (B-AFm) and AFt (B-AFt) phases have been solved ab-initio and refined from X-ray powder diffraction. {sup 11}B NMR and Raman spectroscopies confirm the boron local environment in both compounds: three-fold coordinated in B-AFm corresponding to HBO{sub 3}{sup 2-} species, and four-fold coordinated in B-AFt corresponding to B (OH){sub 4}{sup -} species. B-AFm crystallizes in the rhombohedral R3{sup Macron }c space group and has the 3CaO{center_dot}Al{sub 2}O{sub 3}{center_dot}CaHBO{sub 3}{center_dot}12H{sub 2}O (4CaO{center_dot}Al{sub 2}O{sub 3}{center_dot}1/2B{sub 2}O{sub 3}{center_dot}12.5H{sub 2}O, C{sub 4}AB{sub 1/2}H{sub 12.5}) general formulae with planar trigonal HBO{sub 3}{sup 2-} anions weakly bonded at the centre of the interlayer region. One HBO{sub 3}{sup 2-} anion is statistically distributed with two weakly bonded water molecules on the same crystallographic site. B-AFt crystallizes in the trigonal P3cl space group and has the 3CaO{center_dot}Al{sub 2}O{sub 3}{center_dot}Ca(OH){sub 2}{center_dot}2Ca(B (OH){sub 4}){sub 2}{center_dot}24H{sub 2}O (6CaO{center_dot}Al{sub 2}O{sub 3}{center_dot}2B{sub 2}O{sub 3}{center_dot}33H{sub 2}O, C{sub 6}AB{sub 2}H{sub 33}) general formulae with tetrahedral B (OH){sub 4}{sup -} anions located in the channel region of the structure. All tetrahedral anions are oriented in a unique direction, leading to a hexagonal c lattice parameter about half that of ettringite.

  4. Conducting Polymers

    Indian Academy of Sciences (India)

    polymer backbone), exhibit semiconducting behavior. The discovery of dopingl led to a further dramatic increase in the conductivity of such conjugated polymers to values as ..... CERF's Comments on Modem Science. • If it's incomprehensible, it's mathematics. • If it doesn't make sense, it's either economics or psychology.

  5. Conducting Polymers

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. Conducting Polymers - From a Laboratory Curiosity to the Market Place. S Ramakrishnan. Volume 16 Issue 12 December 2011 pp 1254-1265. Fulltext. Click here to view fulltext PDF. Permanent link:

  6. Block copolymer investigations

    Science.gov (United States)

    Yufa, Nataliya A.

    The research presented in this thesis deals with various aspects of block copolymers on the nanoscale: their behavior at a range of temperatures, their use as scaffolds, or for creation of chemically striped surfaces, as well as the behavior of metals on block copolymers under the influence of UV light, and the healing behavior of copolymers. Invented around the time of World War II, copolymers have been used for decades due to their macroscopic properties, such as their ability to be molded without vulcanization, and the fact that, unlike rubber, they can be recycled. In recent years, block copolymers (BCPs) have been used for lithography, as scaffolds for nano-objects, to create a magnetic hard drive, as well as in photonic and other applications. In this work we used primarily atomic force microscopy (AFM) and transmission electron microscopy (TEM), described in Chapter II, to conduct our studies. In Chapter III we demonstrate a new and general method for positioning nanoparticles within nanoscale grooves. This technique is suitable for nanodots, nanocrystals, as well as DNA. We use AFM and TEM to demonstrate selective decoration. In Chapters IV and V we use AFM and TEM to study the structure of polymer surfaces coated with metals and self-assembled monolayers. We describe how the surfaces were created, exhibit their structure on the nanoscale, and prove that their macroscopic wetting properties have been altered compared to the original polymer structures. Finally, Chapters VI and VII report out in-situ AFM studies of BCP at high temperatures, made possible only recently with the invention of air-tight high-temperature AFM imaging cells. We locate the transition between disordered films and cylinders during initial ordering. Fluctuations of existing domains leading to domain coarsening are also described, and are shown to be consistent with reptation and curvature minimization. Chapter VII deals with the healing of PS-b-PMMA following AFM-tip lithography or

  7. AFM and FTIR characterization of microcrystalline Si obtained from isothermal annealing of Al/a-Si:H

    Energy Technology Data Exchange (ETDEWEB)

    Rojas-Lopez, M.; Orduna-Diaz, A.; Delgado-Macuil, R. [Centro de Investigacion en Biotecnologia Aplicada (CIBA), IPN, Tlaxcala, Tlax. 72197 (Mexico); Olvera-Hernandez, J. [Centro de Investigacion en Dispositivos Semiconductores (CIDS), BUAP, Puebla, Pue. 72570 (Mexico); Navarro-Contreras, H.; Vidal, M.A.; Saucedo, N.; Mendez-Garcia, V.H. [Instituto de Investigacion en Comunicacion Optica (IICO), UASLP, San Luis Potosi, S.L.P. 78100 (Mexico)

    2007-04-15

    Atomic force microscopy and Fourier transform infrared spectroscopy were used to investigate the morphology of the microcrystalline surface, and also the amorphous-crystalline structural transformation of a-Si:H films, isothermally annealed during several hours. Crystallization process was strongly influenced by the deposition of an Al layer on the surface of a-Si:H samples. Representative AFM images show the presence of grains, which increase in diameter with the annealing time. Relative crystallized fraction as a function of the annealing time can be described adequately by using the Avrami equation. The kinetic of this crystallization process suggest a two-dimensional growth of the Si nuclei. Fourier transform infrared measurements show the presence of an intense band near 512 cm{sup -1} associated to Si-Si bonding. We observed the relative diminishing of the intensity of the Si-H wagging mode at 694 cm{sup -1} with annealing time, suggesting effusion of hydrogen to the surface of microcrystalline films. (copyright 2007 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  8. A direct investigation of photocharge transfer across monomolecular layer between C60 and CdS quantum dots by photoassisted conductive atomic force microscopy

    Directory of Open Access Journals (Sweden)

    Xiaohong Jiang

    2016-04-01

    Full Text Available The composite assembly of C60 and CdS Quantum Dots (QDs on ITO substrate was prepared by Langmuir-Blodgett (LB technique using arachic acid (AA, stearic acid (SA and octadecanyl amine (OA as additives. Photoassisted conductive atomic force microscopy was used to make point contact current-voltage (I-V measurements on both the CdS QDs and the composite assembly of C60/CdS. The result make it clear that the CdS, C60/CdS assemblies deposited on ITO substrate showed linear characteristics and the current increased largely under illumination comparing with that in the dark. The coherent, nonresonant tunneling mechanism was used to explain the current occurrence. It is considered that the photoinduced carriers CdS QDs tunneled through alkyl chains increased the current rapidly.

  9. A direct investigation of photocharge transfer across monomolecular layer between C{sub 60} and CdS quantum dots by photoassisted conductive atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Xiaohong; Liu, He; Zhang, Xingtang; Cheng, Gang; Wang, Shujie; Du, Zuliang, E-mail: zld@henu.edu.cn [Key Laboratory for Special Functional Materials, Collaborative Innovation Center of Nano Functional Materials and Applications, Henan University, Kaifeng, 475004, PR. China (China)

    2016-04-15

    The composite assembly of C{sub 60} and CdS Quantum Dots (QDs) on ITO substrate was prepared by Langmuir-Blodgett (LB) technique using arachic acid (AA), stearic acid (SA) and octadecanyl amine (OA) as additives. Photoassisted conductive atomic force microscopy was used to make point contact current-voltage (I-V) measurements on both the CdS QDs and the composite assembly of C{sub 60}/CdS. The result make it clear that the CdS, C{sub 60}/CdS assemblies deposited on ITO substrate showed linear characteristics and the current increased largely under illumination comparing with that in the dark. The coherent, nonresonant tunneling mechanism was used to explain the current occurrence. It is considered that the photoinduced carriers CdS QDs tunneled through alkyl chains increased the current rapidly.

  10. An Investigation of Ion-Pairing of Alkali Metal Halides in Aqueous Solutions Using the Electrical Conductivity and the Monte Carlo Computer Simulation Methods.

    Science.gov (United States)

    Gujt, Jure; Bešter-Rogač, Marija; Hribar-Lee, Barbara

    2014-02-01

    The ion pairing is, in very dilute aqueous solutions, of rather small importance for solutions' properties, which renders its precise quantification quite a laborious task. Here we studied the ion pairing of alkali halides in water by using the precise electric conductivity measurements in dilute solutions, and in a wide temperature range. The low-concentration chemical model was used to analyze the results, and to estimate the association constant of different alkali halide salts. It has been shown that the association constant is related to the solubility of salts in water and produces a 'volcano relationship', when plotted against the difference between the free energy of hydration of the corresponding individual ions. The computer simulation, using the simple MB+dipole water model, were used to interprete the results, to find a microscopic basis for Collins' law of matching water affinities.

  11. Synthesis and Characterization of TiO2-CNTs Nanocomposite and Investigation of Viscosity and Thermal Conductivity of a New Nanofluid

    Directory of Open Access Journals (Sweden)

    E. Khosravifard

    2012-06-01

    Full Text Available Nanofluids are kinds of fluids engineered by dispersing nanoparticles in base fluids, a new challenge for thermal sciences provided by nanotechnology. Due to their excellent characteristics, nanofluids find wide applications in enhancing heat transfer. This paper presents synthesis and characterization of TiO2-CNTs nanocomposites by sonochemical method and investigation of some properties of TiO2-CNTs nanocomposite suspended in 50:50 (by weight propylene glycol and water mixture as a new nanofluid.

  12. Surface study of irradiated sapphires from Phrae Province, Thailand using AFM

    Science.gov (United States)

    Monarumit, N.; Jivanantaka, P.; Mogmued, J.; Lhuaamporn, T.; Satitkune, S.

    2017-09-01

    The irradiation is one of the gemstone enhancements for improving the gem quality. Typically, there are many varieties of irradiated gemstones in the gem market such as diamond, topaz, and sapphire. However, it is hard to identify the gemstones before and after irradiation. The aim of this study is to analyze the surface morphology for classifying the pristine and irradiated sapphires using atomic force microscope (AFM). In this study, the sapphire samples were collected from Phrae Province, Thailand. The samples were irradiated by high energy electron beam for a dose of ionizing radiation at 40,000 kGy. As the results, the surface morphology of pristine sapphires shows regular atomic arrangement, whereas, the surface morphology of irradiated sapphires shows the nano-channel observed by the 2D and 3D AFM images. The atomic step height and root mean square roughness have changed after irradiation due to the micro-structural defect on the sapphire surface. Therefore, this study is a frontier application for sapphire identification before and after irradiation.

  13. The use of functionalized AFM tips as molecular sensors in the detection of pesticides

    Energy Technology Data Exchange (ETDEWEB)

    Deda, Daiana K.; Pereira, Barbara B.S.; Bueno, Carolina C.; Silva, Aline N. da; Ribeiro, Gabrielle A.; Amarante, Adriano M.; Leite, Fabio L., E-mail: fabioleite@ufscar.br [Universidade Federal de Sao Carlos (LNN/UFSCar), Sorocaba, SP (Brazil). Dept. de Fisica, Quimica e Matematica. Lab. de Nanoneurobiofisica; Franca, Eduardo F. [Universidade Federal de Uberlandia (UFU), MG (Brazil). Inst. de Quimica

    2013-11-01

    Atomic force spectroscopy, a technique derived from Atomic Force Microscopy (AFM), allowed to distinguish nonspecific and specific interactions between the acetolactate synthase enzyme (ALS) and anti-atrazine antibody biomolecules and the herbicides imazaquin, metsulfuron-methyl and atrazine. The presence of specific interactions increased the adhesion force (F{sub adh}) between the AFM tip and the herbicides, which made the modified tip a powerful biosensor. Increases of approximately 132% and 145% in the F{sub adh} values were observed when a tip functionalized with ALS was used to detect imazaquin and metsulfuron-methyl, respectively. The presence of specific interactions between the atrazine and the anti-atrazine antibody also caused an increase in the F{sub adh} values (approximately 175%) compared to those observed when using an unfunctionalized tip. The molecular modeling results obtained with the ALS enzyme suggest that the orientation of the biomolecule on the tip surface could be suitable for allowing interaction with the herbicides imazaquin and metsulfuron-methyl. (author)

  14. Characterization of opto-electrical enhancement of tandem photoelectrochemical cells by using photoconductive-AFM

    Science.gov (United States)

    Park, Sun-Young; Elbersen, Rick; Huskens, Jurriaan; Gardeniers, Han; Lee, Joo-Yul; Mul, Guido; Heo, Jinhee

    2017-07-01

    Solar-to-hydrogen conversion by water splitting in photoelectrochemical cells (PECs) is a promising approach to alleviate problems associated with intermittency in solar energy supply and demand. Several interfacial resistances in photoelectrodes limit the performance of such cells, while the properties of interfaces are not easy to analyze in situ. We applied photoconductive-AFM to analyze the performance of WO3/p+n Si photoanodes, containing an ultra-thin metal interface of either Au or Pt. The Au interface consisted of Au nanoparticles with well-ordered interspacing, while Pt was present in the form of a continuous film. Photoconductive-AFM data show that upon illumination significantly larger currents are measured for the WO3/p+n Si anode equipped with the Au interface, as compared to the WO3/p+n Si anode with the Pt interface, in agreement with the better performance of the former electrode in a photoelectrochemical cell. The remarkable performance of the Au-containing electrode is proposed to be the result of favorable electron-hole recombination rates induced by the Au nanoparticles in a plasmon resonance excited state.

  15. Direct visualization of glutamate transporter elevator mechanism by high-speed AFM.

    Science.gov (United States)

    Ruan, Yi; Miyagi, Atsushi; Wang, Xiaoyu; Chami, Mohamed; Boudker, Olga; Scheuring, Simon

    2017-02-14

    Glutamate transporters are essential for recovery of the neurotransmitter glutamate from the synaptic cleft. Crystal structures in the outward- and inward-facing conformations of a glutamate transporter homolog from archaebacterium Pyrococcus horikoshii, sodium/aspartate symporter GltPh, suggested the molecular basis of the transporter cycle. However, dynamic studies of the transport mechanism have been sparse and indirect. Here we present high-speed atomic force microscopy (HS-AFM) observations of membrane-reconstituted GltPh at work. HS-AFM movies provide unprecedented real-space and real-time visualization of the transport dynamics. Our results show transport mediated by large amplitude 1.85-nm "elevator" movements of the transport domains consistent with previous crystallographic and spectroscopic studies. Elevator dynamics occur in the absence and presence of sodium ions and aspartate, but stall in sodium alone, providing a direct visualization of the ion and substrate symport mechanism. We show unambiguously that individual protomers within the trimeric transporter function fully independently.

  16. Characterization of Bitumen Micro-Mechanical Behaviors Using AFM, Phase Dynamics Theory and MD Simulation

    Directory of Open Access Journals (Sweden)

    Yue Hou

    2017-02-01

    Full Text Available Fundamental understanding of micro-mechanical behaviors in bitumen, including phase separation, micro-friction, micro-abrasion, etc., can help the pavement engineers better understand the bitumen mechanical performances at macroscale. Recent researches show that the microstructure evolution in bitumen will directly affect its surface structure and micro-mechanical performance. In this study, the bitumen microstructure and micro-mechanical behaviors are studied using Atomic Force Microscopy (AFM experiments, Phase Dynamics Theory and Molecular Dynamics (MD Simulation. The AFM experiment results show that different phase-structure will occur at the surface of the bitumen samples under certain thermodynamic conditions at microscale. The phenomenon can be explained using the phase dynamics theory, where the effects of stability parameter and temperature on bitumen microstructure and micro-mechanical behavior are studied combined with MD Simulation. Simulation results show that the saturates phase, in contrast to the naphthene aromatics phase, plays a major role in bitumen micro-mechanical behavior. A high stress zone occurs at the interface between the saturates phase and the naphthene aromatics phase, which may form discontinuities that further affect the bitumen frictional performance.

  17. Magnetoelectric versus thermal actuation characteristics of shear force AFM probes with piezoresistive detection

    Science.gov (United States)

    Sierakowski, Andrzej; Kopiec, Daniel; Majstrzyk, Wojciech; Kunicki, Piotr; Janus, Paweł; Dobrowolski, Rafał; Grabiec, Piotr; Rangelow, Ivo W.; Gotszalk, Teodor

    2017-03-01

    In this paper the authors compare methods used for piezoresistive microcantilevers actuation for the atomic force microscopy (AFM) imaging in the dynamic shear force mode. The piezoresistive detection is an attractive technique comparing the optical beam detection of deflection. The principal advantage is that no external alignment of optical source and detector are needed. When the microcantilever is deflected, the stress is transferred into a change of resistivity of piezoresistors. The integration of piezoresistive read-out provides a promising solution in realizing a compact non-contact AFM. Resolution of piezoresistive read-out is limited by three main noise sources: Johnson, 1/f and thermomechanical noise. In the dynamic shear force mode measurement the method used for cantilever actuation will also affect the recorded noise in the piezoresistive detection circuit. This is the result of a crosstalk between an aluminium path (current loop used for actuation) and piezoresistors located near the base of the beam. In this paper authors described an elaborated in ITE (Institute of Electron Technology) technology of fabrication cantilevers with piezoresistive detection of deflection and compared efficiency of two methods used for cantilever actuation.

  18. Self-assembled polyelectrolyte nanorings observed by liquid-cell AFM

    Energy Technology Data Exchange (ETDEWEB)

    Menchaca, J-Luis [Instituto de Fisica, Universidad Autonoma de San Luis Potosi, Alvaro Obregon 64, San Luis Potosi (Mexico); Flores, Hector [Facultad de Estomatologia, Universidad Autonoma de San Luis Potosi, Alvaro Obregon 64, San Luis Potosi (Mexico); Cuisinier, Frederic [INSERM U 595, Federation de Recherche Odontologiques, Universite Louis Pasteur, 11 rue Humann, 67085 Strasbourg Cedex (France); Perez, ElIas [Instituto de Fisica, Universidad Autonoma de San Luis Potosi, Alvaro Obregon 64, San Luis Potosi (Mexico)

    2004-06-09

    Self-assembled polyelectrolyte nanorings formed by polyelectrolytes are presented for the first time in this work. They are formed by poly(ethylenimine) (PEI) and poly(sodium 4-styrenesulfanate) (PSS) during the two first steps of the formation of the self-assembled polyelectrolyte films (SAPFs). These are formed on a negatively charged glass surface and observed by an in situ liquid-cell AFM technique, which has recently been introduced as an alternative technique to follow polyelectrolyte multilayer formation without drying effects (Menchaca et al 2003 Colloids Surf. A 222 185). Nanoring formation strongly depends on the preparation method and parameters such as polyelectrolyte filtration, air and CO{sub 2} presence during SAPFs formation and buffer solution. A necessary condition to obtain nanorings is that polyelectrolyte solutions have to be filtered prior to injection into the liquid-cell AFM. The outer diameter of nanorings can be varied from hundreds of nanometres to microns by changing these parameters. Nanorings are stable in the liquid cell for hours but they disappear on contact with air. Additionally, carbonate ions seem to be mainly responsible for the formation of this novel structure.

  19. AFM Observation of Single Membrane Proteins and its Application to Nano Biodevices

    Science.gov (United States)

    Kasai, Nahoko; Ramanujan, Chandra S.; Sumitomo, Koji; Shinozaki, Youichi; Shimada, Akiyoshi; Ryan, John F.; Torimitsu, Keiichi

    Recent progress on nanotechnology including nanostructure fabrication and nanometer-scale measurement techniques, and work on biomolecules whose size is equivalent to that covered by nanotechnology, are expected to result in the creation of a new research field called nano-bio science. This article introduces our recent work on the observation of single biomolecule; reconstituted a receptor protein into an artificial lipid membrane using an atomic force microscope (AFM). An AFM is a measurement tool that enables us to observe nanometer-scale objects in a liquid environment. We also examine the orientation of the proteins in proteoliposomes with the dynamic light scattering technique (DLS). Most receptor proteins have orientations in molecules, for example the extracellular and intracellular domains. Determining the protein orientation is essential for nano-biodevice fabrication if we wish to utilize the protein's function. We also introduce our recent attempt to realize a nano-bio device; a very small device obtaining and utilizing biological functions; using our state-of-the-art nanofabrication technique and a technique for handling receptor proteins. Thus, by combining nanotechnology and biotechnology to realize nano-biodevices, we can produce ultra-small biological sensors for implantation. Further improvements are expected.

  20. Structural changes of polysulfone membrane use for hemodialysis in the consecutive regime: nanometric analysis by AFM

    Science.gov (United States)

    Batina, Nikola; Acosta García, Ma. Cristina; Avalos Pérez, Angélica; Alberto Ramírez, Mario; Franco, Martha; Pérez Gravas, Héctor; Cadena Méndez, Miguel

    2013-08-01

    Nowadays, the hemodialytic treatment of patients with either acute or chronic renal failure has been improved by promoting biocompatibility in the use of new materials and improve membrane surface characteristics. Low and high flux polysulfone membranes (PM) used in dialysis and ultra filtration have been studied in order to understand the geometry and surface chemistry of the pores at inner (nanometric) and outer (micrometric) membrane parts. The surface changes of polysulfone cartridge membrane (PM) during different number of consecutive reuse trials: after 1st, 10th and 23th times of use. The morphology of the hollow fibers surfaces was studied by means of the atomic force microscopy (AFM) imaging and the surface roughness analysis. The roughness of both inner and outer part of PM surface increases with numbers of reuse trails. Thus, small and medium size pores were wiped out when the number of uses changed from zero to 23 on the outer surface. The pore density decreases. The inner part of membrane shows some nanometric size deformation in forms of new openings and raptures. The AFM analysis show differences in the PM morphology at the nanometric level, not previously revealed, which could be important in the evaluation of the PM.

  1. Simultaneous Measurement of Multiple Mechanical Properties of Single Cells Using AFM by Indentation and Vibration.

    Science.gov (United States)

    Zhang, Chuang; Shi, Jialin; Wang, Wenxue; Xi, Ning; Wang, Yuechao; Liu, Lianqing

    2017-12-01

    The mechanical properties of cells, which are the main characteristics determining their physical performance and physiological functions, have been actively studied in the fields of cytobiology and biomedical engineering and for the development of medicines. In this study, an indentation-vibration-based method is proposed to simultaneously measure the mechanical properties of cells in situ, including cellular mass (m), elasticity (k), and viscosity (c). The proposed measurement method is implemented based on the principle of forced vibration stimulated by simple harmonic force using an atomic force microscope (AFM) system integrated with a piezoelectric transducer as the substrate vibrator. The corresponding theoretical model containing the three mechanical properties is derived and used to perform simulations and calculations. Living and fixed human embryonic kidney 293 (HEK 293) cells were subjected to indentation and vibration to measure and compare their mechanical parameters and verify the proposed approach. The results that the fixed sample cells are more viscous and elastic than the living sample cells and the measured mechanical properties of cell are consistent within, but not outside of the central region of the cell, are in accordance with the previous studies. This work provides an approach to simultaneous measurement of the multiple mechanical properties of single cells using an integrated AFM system based on the principle force vibration and thickness-corrected Hertz model. This study should contribute to progress in biomedical engineering, cytobiology, medicine, early diagnosis, specific therapy and cell-powered robots.

  2. AFM Studies of Salt Concentration Effects on the (110) Surface Structure of Tetragonal Lysozyme Crystals

    Science.gov (United States)

    Pusey, Marc Lee; Gorti, Sridhar; Forsythe, Elizabeth; Konnert, John

    2002-01-01

    Previous high resolution AFM studies of the (110) surface of tetragonal chicken egg white lysozyme crystals had shown that only one of two possible molecular surfaces is present, those constituting the completed 43 helices. These suggested that the crystal growth process was by the solution-phase assembly of the growth units, which then attach to the surface. However, the best fit for the imaged surfaces, vs. those predicted based upon the bulk crystallographic coordinates, were obtained when the packing about the 43 helices was "tightened up", while maintaining the underlying crystallographic unit cell spacing. This results in a widening of the gap between adjacent helices, and the top- most layer(s) may no longer be in contact. We postulated that the tightened packing about the helices is a result of the high salt concentrations in the bulk solution, used to crystallize the protein, driving hydrophobic interactions. Once the crystal surface is sufficiently buried by subsequent growth layers the ratio of salt to protein molecules decreases and the helices relax to their bulk crystallographic coordinates. The crystal surface helix structure is thus a reflection of the solution structure, and the tightness of the packing about the 43 helices would be a function of the bulk salt concentration. AFM images of the (110) surface of tetragonal lysozyme crystals grown under low (2%) and high (5%) NaCl concentrations reveal differences in the packing about the 43 helices consistent with the above proposal.

  3. Strategies for the AFM-based manipulation of silver nanowires on a flat surface

    Science.gov (United States)

    Liu, Hong-Zhi; Wu, Sen; Zhang, Jun-Ming; Bai, Hui-Tian; Jin, Fan; Pang, Hai; Hu, Xiao-Dong

    2017-09-01

    Silver nanowires (Ag NWs) are a promising material for building various sensors and devices at the nanoscale. However, the fast and precise placement of individual Ag NWs is still a challenge today. Atomic force microscopy (AFM) has been widely used to manipulate nanoparticles, yet this technology encounters many difficulties when being applied to the movement of Ag NWs as well as other soft one-dimensional (1D) materials, since the samples are easily distorted or even broken due to friction and adhesion on the substrate. In this paper, two novel manipulation strategies based on the parallel pushing method are presented. This method applies a group of short parallel pushing vectors (PPVs) to the Ag NW along its longitudinal direction. Identical and proportional vectors are respectively proposed to translate and rotate the Ag NWs with a straight-line configuration. The rotation strategy is also applied to straighten flexed Ag NWs. The finite element method simulation is introduced to analyse the behaviour of the Ag NWs as well as to optimize the parameter setting of the PPVs. Experiments are carried out to confirm the efficiency of the presented strategies. By comprehensive application of the new strategies, four Ag NWs are continuously assembled in a rectangular pattern. This study improves the controllability of the position and configuration of Ag NWs on a flat substrate. It also indicates the practicability of automatic nanofabrication using common AFMs.

  4. AFM characterization of solid-supported lipid multilayers prepared by spin-coating.

    Science.gov (United States)

    Pompeo, G; Girasole, M; Cricenti, A; Cattaruzza, F; Flamini, A; Prosperi, T; Generosi, J; Castellano, A Congiu

    2005-06-15

    Lipids are the principal components of biologically relevant structures as cellular membranes. They have been the subject of many studies due to their biological relevance and their potential applications. Different techniques, such as Langmuir-Blodgett and vesicle-fusion deposition, are available to deposit ordered lipid films on etched surfaces. Recently, a new technique of lipid film deposition has been proposed in which stacks of a small and well-controlled number of bilayers are prepared on a suitable substrate using a spin-coater. We studied the morphological properties of multi-layers made of cationic and neutral lipids (DOTAP and DOPC) and mixtures of them using dynamic mode atomic force microscopy (AFM). After adapting and optimizing, the spin-coating technique to deposit lipids on a chemically etched Silicon (1,0,0) substrate, a morphological nanometer-scale characterization of the aforementioned samples has been provided. The AFM study showed that an initial layer of ordered vesicles is formed and, afterward, depending on details of the spin-coating preparation protocol and to the dimension of the silicon substrate, vesicle fusion and structural rearrangements of the lipid layers may occur. The present data disclose the possibility to control the lipid's structures by acting on spin-coating parameters with promising perspectives for novel applications of lipid films.

  5. Protective effect on enamel demineralization of a CPP-ACP paste: an AFM in vitro study.

    Science.gov (United States)

    Poggio, Claudio; Lombardini, Marco; Dagna, Alberto; Chiesa, Marco; Bianchi, Stefano

    2009-12-01

    The aim of the present in vitro study was the evaluation of a CPP-ACP paste (Tooth Mousse) on preventing dental erosion produced by a soft drink (Coca Cola), using Atomic Force Microscopy (AFM). Thirty extracted human central incisors free of caries were selected and divided in a treatment and a control half. The treatment halves were divided in three groups-group 1: demineralization with soft drink (4 intervals of 2 min); group 2: demineralization with soft drink (4 intervals of 2 min) plus Tooth Mousse; group 3: intact enamel plus Tooth Mousse. In groups 2 and 3 Tooth Mousse was applied for 3 min at 0, 8, 24 and 36 h. The surface of each specimen was imaged by AFM and R(rms) values were registered. Among treatment specimens of groups 1 and 2, a statistically significant difference (Ppaste had a protective effect on enamel demineralization. In group 3 no statistically significant difference was registered between exposed and not exposed halves of the specimens. The use of a CPP-ACP paste had a protective effect on enamel demineralization in an in vitro model.

  6. Enamel crystals of mice susceptible or resistant to dental fluorosis: an AFM study

    Directory of Open Access Journals (Sweden)

    Marília Afonso Rabelo BUZALAF

    2014-06-01

    Full Text Available Objective: This study aimed to assess the overall apatite crystals profile in the enamel matrix of mice susceptible (A/J strain or resistant (129P3/J strain to dental fluorosis through analyses by atomic force microscopy (AFM. Material and Methods: Samples from the enamel matrix in the early stages of secretion and maturation were obtained from the incisors of mice from both strains. All detectable traces of matrix protein were removed from the samples by a sequential extraction procedure. The purified crystals (n=13 per strain were analyzed qualitatively in the AFM. Surface roughness profile (Ra was measured. Results: The mean (±SD Ra of the crystals of A/J strain (0.58±0.15 nm was lower than the one found for the 129P3/J strain (0.66±0.21 nm but the difference did not reach statistical significance (t=1.187, p=0.247. Crystals of the 129P3/J strain (70.42±6.79 nm were found to be significantly narrower (t=4.013, p=0.0013 than the same parameter measured for the A/J strain (90.42±15.86 nm. Conclusion: enamel crystals of the 129P3/J strain are narrower, which is indicative of slower crystal growth and could interfere in the occurrence of dental fluorosis.

  7. Investigation of ULF magnetic pulsations, air conductivity changes, and infra red signatures associated with the 30 October Alum Rock M5.4 earthquake

    Directory of Open Access Journals (Sweden)

    T. Bleier

    2009-04-01

    Full Text Available Several electromagnetic signal types were observed prior to and immediately after 30 October 2007 (Local Time M5.4 earthquake at Alum Rock, Ca with an epicenter ~15 km NE of San Jose Ca. The area where this event occurred had been monitored since November 2005 by a QuakeFinder magnetometer site, unit 609, 2 km from the epicenter. This instrument is one of 53 stations of the QuakeFinder (QF California Magnetometer Network-CalMagNet. This station included an ultra low frequency (ULF 3-axis induction magnetometer, a simple air conductivity sensor to measure relative airborne ion concentrations, and a geophone to identify the arrival of the P-wave from an earthquake. Similar in frequency content to the increased ULF activity reported two weeks prior to the Loma Prieta M7.0 quake in 1989 (Fraser-Smith, 1990, 1991, the QF station detected activity in the 0.01–12 Hz bands, but it consisted of an increasing number of short duration (1 to 30 s duration pulsations. The pulsations peaked around 13 days prior to the event. The amplitudes of the pulses were strong, (3–20 nT, compared to the average ambient noise at the site, (10–250 pT, which included a component arising from the Bay Area Rapid Transit (BART operations. The QF station also detected different pulse shapes, e.g. negative or positive only polarity, with some pulses including a combination of positive and negative. Typical pulse counts over the previous year ranged from 0–15 per day, while the count rose to 176 (east-west channel on 17 October, 13 days prior to the quake. The air conductivity sensor saturated for over 14 h during the night and morning prior to the quake, which occurred at 20:29 LT. Anomalous IR signatures were also observed in the general area, within 50 km of the epicenter, during the 2 weeks prior to the quake. These three simultaneous EM phenomena were compared with data collected over a 1–2-year period at the site. The data was also compared against accounts of air

  8. Conduction apraxia.

    OpenAIRE

    Ochipa, C; Rothi, L J; Heilman, K M

    1994-01-01

    A left hemisphere damaged patient with ideomotor apraxia is described, whose performance on pantomime to verbal command was superior to pantomime imitation. His reception of these same gestures (gesture naming) was spared. This syndrome has been named conduction apraxia. To account for this selective impaired performance on gesture imitation, a separation of the representations for gesture production and reception is proposed and a non-lexical gesture processing route for gesture imitation is...

  9. The origin of the "snap-in" in the force curve between AFM probe and the water/gas interface of nanobubbles.

    Science.gov (United States)

    Song, Yang; Zhao, Binyu; Zhang, Lijuan; Lü, Junhong; Wang, Shuo; Dong, Yaming; Hu, Jun

    2014-02-24

    The long-range attractive force or "snap-in" is an important phenomenon usually occurring when a solid particle interacts with a water/gas interface. By using PeakForce quantitative nanomechanics the origin of snap-in in the force curve between the atomic force microscopy (AFM) probe and the water/gas interface of nanobubbles has been investigated. The snap-in frequently happened when the probe was preserved for a certain time or after being used for imaging solid surfaces under atmospheric conditions. In contrast, imaging in liquids rarely induced a snap-in. After a series of control experiments, it was found that the snap-in can be attributed to hydrophobic interactions between the water/gas interface and the AFM probe, which was either modified or contaminated with hydrophobic material. The hydrophobic contamination could be efficiently removed by a conventional plasma-cleaning treatment, which prevents the occurring of the snap-in. In addition, the adsorption of sodium dodecyl sulfate onto the nanobubble surface changed the water/gas interface into hydrophilic, which also eliminated the snap-in phenomenon. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. INVESTIGATING THE MANAGEMENT OF CARIOUS PRIMARY TEETH IN GENERAL DENTAL PRACTICE: AN OVERVIEW OF THE DEVELOPMENT AND CONDUCT OF THE FICTION TRIAL.

    Science.gov (United States)

    Stewart, Matthew; Keightley, Alexander; Maguire, Anne; Chadwick, Barbara; Vale, Luke; Homer, Tara; Douglas, Gail; Deery, Chris; Marshman, Zoe; Ryan, Vicky; Innes, Nicola

    2015-11-01

    The management of carious primary teeth is a challenge for patients, parents and clinicians. Most evidence supporting different management strategies originates from a specialist setting and therefore its relevance to the primary care setting is questionable. The UK National Institute for Health Research (NIHR) Health Technology Assessment (HTA) has commissioned the FiCTION (Filling Children's Teeth: Indicated Or Not?) trial; a multi-centre primary dental care randomised controlled trial (RCT) to determine the most clinically and cost- effective approach to managing caries in the primary dentition in the UK. This large trial began in 2012, is due to be completed in late 2017 and involves 72 practices and 1,124 children initially aged three to seven years with dentine caries, following randomisation to one of three caries management strategies. Clinical, radiographic, quality of life, treatment acceptability and health economics data are collected during the three-year follow up period. This article provides an overview of the development and conduct of FiCTION and discusses some approaches adopted to manage challenges and achieve the patient recruitment target.

  11. Photothermal deflection technique investigation of annealing temperature and time effects on optical and thermal conductivity of V/V2O5 alternating layers structure

    Science.gov (United States)

    Khalfaoui, A.; Ilahi, S.; Abdel-Rahman, M.; Zia, M. F.; Alduraibi, M.; Ilahi, B.; Yacoubi, N.

    2017-10-01

    The VxOy material is fabricated by alternating multilayer of V/V2O5. Two sets of VxOy are presented annealed at 300 °C and 400 °C for 20, 30 and 40 min. We have determined optical absorption spectra of the two sets by comparison between experimental and theoretical PDS amplitude signal. In fact, a variation of the bandgap energy from 2.34eV to 2.49 eV has found for both set annealed at 300 °C and 400 °C for various annealing time. The variation of bandgap energy is discussed testifying a structural and compositional change. Moreover, thermal conductivity of the set annealed at 400 °C showed a variation from 1.96 W/m K to 6.2 W/m K noting a decrease up to 2.89 W/m K for that annealed for 30 min.

  12. Tuning the conductivity of vanadium dioxide films by swift heavy ion irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Ehrhardt, Paul; Hofsaess, Hans; Gehrke, Hans-Gregor [II. Physikalisches Institut, Fakultaet fuer Physik, Universitaet Goettingen, Friedrich-Hund-Platz 1, 37077 Goettingen (Germany); Krauser, Johann [Hochschule Harz, University of Applied Sciences, Friedrichstrasse 57-59, 38855 Wernigerode (Germany); Trautmann, Christina [Gesellschaft fuer Schwerionenforschung, Planckstrasse 1, 64291 Darmstadt (Germany); Ramanathan, Shriram [Harvard School of Engineering and Applied Sciences, Harvard University, Cambridge, MA 02138 (United States)

    2012-07-01

    We demonstrate the generation of a persistent conductivity increase in vanadium dioxide thin films by irradiation with swift heavy ions at room temperature. VO{sub 2} undergoes a temperature driven metal-insulator-transition (MIT) at 67 C. After the ion irradiation the conductivity of the films we observe a strong increase in conductivity below the transition temperature proportional to the ion fluence. This change in conductivity is persistent and remains after several cycles of heating. Low temperature measurements down to 15 K show no further MIT below room temperature. Although the conductivity increase after irradiation at such low fluences is due to single ion track effects, atomic force microscopy (AFM) measurements do not show surface hillocks, which are characteristic for ion tracks in other materials. AFM measurements with conducting tip give no evidence for conducting ion tracks but indicate the existence of conducting regions around poorly conducting ion tracks, possible due to stress generation.

  13. Tracer kinetic modeling of [11C]AFM, a new PET imaging agent for the serotonin transporter

    Science.gov (United States)

    Naganawa, Mika; Nabulsi, Nabeel; Planeta, Beata; Gallezot, Jean-Dominique; Lin, Shu-Fei; Najafzadeh, Soheila; Williams, Wendol; Ropchan, Jim; Labaree, David; Neumeister, Alexander; Huang, Yiyun; Carson, Richard E

    2013-01-01

    [11C]AFM, or [11C]2-[2-(dimethylaminomethyl)phenylthio]-5-fluoromethylphenylamine, is a new positron emission tomography (PET) radioligand with high affinity and selectivity for the serotonin transporter (SERT). The purpose of this study was to determine the most appropriate kinetic model to quantify [11C]AFM binding in the healthy human brain. Positron emission tomography data and arterial input functions were acquired from 10 subjects. Compartmental modeling and the multilinear analysis-1(MA1) method were tested using the arterial input functions. The one-tissue model showed a lack of fit in low-binding regions, and the two-tissue model failed to estimate parameters reliably. Regional time–activity curves were well described by MA1. The rank order of [11C]AFM binding potential (BPND) matched well with the known regional SERT densities. For routine use of [11C]AFM, several noninvasive methods for quantification of regional binding were evaluated, including simplified reference tissue models (SRTM and SRTM2), and multilinear reference tissue models (MRTM and MRTM2). The best methods for region of interest (ROI) analysis were MA1, MRTM2, and SRTM2, with fixed population kinetic values ( or b′) for the reference methods. The MA1 and MRTM2 methods were best for parametric imaging. These results showed that [11C]AFM is a suitable PET radioligand to image and quantify SERT in humans. PMID:23921898

  14. Tracer kinetic modeling of [(11)C]AFM, a new PET imaging agent for the serotonin transporter.

    Science.gov (United States)

    Naganawa, Mika; Nabulsi, Nabeel; Planeta, Beata; Gallezot, Jean-Dominique; Lin, Shu-Fei; Najafzadeh, Soheila; Williams, Wendol; Ropchan, Jim; Labaree, David; Neumeister, Alexander; Huang, Yiyun; Carson, Richard E

    2013-12-01

    [(11)C]AFM, or [(11)C]2-[2-(dimethylaminomethyl)phenylthio]-5-fluoromethylphenylamine, is a new positron emission tomography (PET) radioligand with high affinity and selectivity for the serotonin transporter (SERT). The purpose of this study was to determine the most appropriate kinetic model to quantify [(11)C]AFM binding in the healthy human brain. Positron emission tomography data and arterial input functions were acquired from 10 subjects. Compartmental modeling and the multilinear analysis-1(MA1) method were tested using the arterial input functions. The one-tissue model showed a lack of fit in low-binding regions, and the two-tissue model failed to estimate parameters reliably. Regional time-activity curves were well described by MA1. The rank order of [(11)C]AFM binding potential (BPND) matched well with the known regional SERT densities. For routine use of [(11)C]AFM, several noninvasive methods for quantification of regional binding were evaluated, including simplified reference tissue models (SRTM and SRTM2), and multilinear reference tissue models (MRTM and MRTM2). The best methods for region of interest (ROI) analysis were MA1, MRTM2, and SRTM2, with fixed population kinetic values ( or b') for the reference methods. The MA1 and MRTM2 methods were best for parametric imaging. These results showed that [(11)C]AFM is a suitable PET radioligand to image and quantify SERT in humans.

  15. Nanoclay gelation approach toward improved dye-sensitized solar cell efficiencies: an investigation of charge transport and shift in the TiO2 conduction band.

    Science.gov (United States)

    Wang, Xiu; Kulkarni, Sneha A; Ito, Bruno Ieiri; Batabyal, Sudip K; Nonomura, Kazuteru; Wong, Chee Cheong; Grätzel, Michael; Mhaisalkar, Subodh G; Uchida, Satoshi

    2013-01-23

    Nanoclay minerals play a promising role as additives in the liquid electrolyte to form a gel electrolyte for quasi-solid-state dye-sensitized solar cells, because of the high chemical stability, unique swelling capability, ion exchange capacity, and rheological properties of nanoclays. Here, we report the improved performance of a quasi-solid-state gel electrolyte that is made from a liquid electrolyte and synthetic nitrate-hydrotalcite nanoclay. Charge transport mechanisms in the gel electrolyte and nanoclay interactions with TiO(2)/electrolyte interface are discussed in detail. The electrochemical analysis reveals that the charge transport is solely based on physical diffusion at the ratio of [PMII]:[I(2)] = 10:1 (where PMII is 1-propyl-3-methylimidazolium iodide). The calculated physical diffusion coefficient shows that the diffusion of redox ions is not affected much by the viscosity of nanoclay gel. The addition of nitrate-hydrotalcite clay in the electrolyte has the effect of buffering the protonation process at the TiO(2)/electrolyte interface, resulting in an upward shift in the conduction band and a boost in open-circuit voltage (V(OC)). Higher V(OC) values with undiminished photocurrent is achieved with nitrate-hydrotalcite nanoclay gel electrolyte for organic as well as for inorganic dye (D35 and N719) systems. The efficiency for hydrotalcite clay gel electrolyte solar cells is increased by 10%, compared to that of the liquid electrolyte. The power conversion efficiency can reach 10.1% under 0.25 sun and 9.6% under full sun. This study demonstrates that nitrate-hydrotalcite nanoclay in the electrolyte not only solidifies the liquid electrolyte to prevent solvent leakage, but also facilitates the improvement in cell efficiency.

  16. The Cressey hypothesis (1953 and an investigation into the occurrence of corporate fraud: an empirical analysis conducted in Brazilian banking institutions

    Directory of Open Access Journals (Sweden)

    Michele Rílany Rodrigues Machado

    2017-11-01

    Full Text Available ABSTRACT This article fills a technical-scientific gap that currently exists in the Brazilian literature on corporative fraud, by combining the theoretical framework of agency theory, of criminology, and of the economics of crime. In addition, it focuses on a sector that is usually excluded from analyses due to its specific characteristics and shows the application of multinomial logit panel data regression with random effects, which is rarely used in studies in the area of accounting. The aim of this study is to investigate the occurrence of corporative fraud, as well as cases of fraud in Brazilian banking institutions, by using detection variables related to the Cressey fraud triangle. Research into fraud and methods of detecting fraud has grown in management literature, especially after the occurrence of various corporative scandals in the 1990s. Although regulatory agencies have increased their investments in monitoring and control, fraud investigations and convictions are still common in the day-to-day administration of banks, as can be seen in the Brazilian Central Bank and the National Financial System Resource Council’s databases of punitive proceedings. We believe that this article will have a positive impact in the area of accounting sciences, since it involves corporative fraud in a multidisciplinary form and because it provides the incentive to use a quantitative tool that can help increase the development of similar studies in the area. This study tested the theory that the dimensions of the fraud triangle condition the occurrence of corporative fraud in Brazilian banking institutions. Thirty-two representative variables of corporative fraud were identified in the theoretical-empirical review, which were reduced to seven latent variables by the principal component analysis. Finally, the seven factors formed the independent variables in the multinomial logit models used in the hypothesis tests, which presented promising results.

  17. Conductivity Probe

    Science.gov (United States)

    2008-01-01

    The Thermal and Electrical Conductivity Probe (TECP) for NASA's Phoenix Mars Lander took measurements in Martian soil and in the air. The needles on the end of the instrument were inserted into the Martian soil, allowing TECP to measure the propagation of both thermal and electrical energy. TECP also measured the humidity in the surrounding air. The needles on the probe are 15 millimeters (0.6 inch) long. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  18. Combination of AFM with an objective-type total internal reflection fluorescence microscope (TIRFM) for nanomanipulation of single cells.

    Science.gov (United States)

    Nishida, Shuhei; Funabashi, Yutaka; Ikai, Atsushi

    2002-05-01

    A new instrument was constructed by combining an objective-type total internal reflection fluorescence microscope with an atomic force microscope (AFM). Our purpose of constructing such an instrument is to detect and confirm the result of cellular level manipulations made with the AFM part through the detection system of the highly sensitive fluorescence microscope part. In this combination, manipulations are now possible from the nanometer to the micrometer scales and the fluorescence detection system is sensitive enough even for localizing single molecules. In this paper, we applied the system as a precise intracellular injector (nanoplanter). Fluorescent beads were first chemically immobilized onto a ZnO whisker that was glued to an AFM tip and were injected into a living BALB/3T3 cell together with the whisker. It was demonstrated that the system could clearly show the result of injection, that is, the presence of a small number of fluorescent beads in the cell.

  19. BOREAS AFM-6 NOAA/ETL 35 GHz Cloud/Turbulence Radar GIF Images

    Science.gov (United States)

    Martner, Brooks E.; Newcomer, Jeffrey A. (Editor); Hall, Forrest G.; Smith, David E. (Technical Monitor)

    2000-01-01

    The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-6 team from the National Oceanic and Atmospheric Administration/Environment Technology Laboratory (NOAA/ETL) operated a 35-GHz cloud-sensing radar in the Northern Study Area (NSA) near the Old Jack Pine (OJP) tower from 16 Jul 1994 to 08 Aug 1994. This data set contains a time series of GIF images that show the structure of the lower atmosphere. The NOAA/ETL 35-GHz cloud/turbulence radar GIF images are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  20. Nanotribology at single crystal electrodes: Influence of ionic adsorbates on friction forces studied with AFM

    Energy Technology Data Exchange (ETDEWEB)

    Hausen, Florian; Nielinger, Michael; Ernst, Siegfried [Institut fuer Physikalische und Theoretische Chemie, Universitaet Bonn, Roemerstrasse 164, D-53117 Bonn (Germany); Baltruschat, Helmut [Institut fuer Physikalische und Theoretische Chemie, Universitaet Bonn, Roemerstrasse 164, D-53117 Bonn (Germany)], E-mail: baltruschat@uni-bonn.de

    2008-09-01

    We present friction force measurements on Au(1 1 1) single crystal electrode surfaces performed under electrochemical conditions using an atomic force microscope (AFM). At monoatomic steps friction is increased in both scan directions. In 0.05 M sulfuric acid an increase of friction is observed with the increase of adsorbed sulfate. Friction force increases non-linearly with load. Cu UPD also increases friction in presence of sulfate. However, in presence of 4 x 10{sup -4} M chloride friction is much smaller for all deposited Cu coverages - ranging from a submonolayer up to bulk copper compared to the solution without chloride. After dissolution of bulk copper clusters deposited on Au(1 1 1) we observed an area with higher friction forces due to the formation of an alloy between gold and copper.

  1. Nano-Workbench: A Combined Hollow AFM Cantilever and Robotic Manipulator

    Directory of Open Access Journals (Sweden)

    Héctor Hugo Pérez Garza

    2015-05-01

    Full Text Available To manipulate liquid matter at the nanometer scale, we have developed a robotic assembly equipped with a hollow atomic force microscope (AFM cantilever that can handle femtolitre volumes of liquid. The assembly consists of four independent robots, each sugar cube sized with four degrees of freedom. All robots are placed on a single platform around the sample forming a nano-workbench (NWB. Each robot can travel the entire platform and has a minimum position resolution of 5 nm both in-plane and out-of-plane. The cantilever chip was glued to the robotic arm. Dispensing was done by the capillarity between the substrate and the cantilever tip, and was monitored visually through a microscope. To evaluate the performance of the NWB, we have performed three experiments: clamping of graphene with epoxy, mixing of femtolitre volume droplets to synthesize gold nanoparticles and accurately dispense electrolyte liquid for a nanobattery.

  2. Quantitative multichannel NC-AFM data analysis of graphene growth on SiC(0001

    Directory of Open Access Journals (Sweden)

    Christian Held

    2012-02-01

    Full Text Available Noncontact atomic force microscopy provides access to several complementary signals, such as topography, damping, and contact potential. The traditional presentation of such data sets in adjacent figures or in colour-coded pseudo-three-dimensional plots gives only a qualitative impression. We introduce two-dimensional histograms for the representation of multichannel NC-AFM data sets in a quantitative fashion. Presentation and analysis are exemplified for topography and contact-potential data for graphene grown epitaxially on 6H-SiC(0001, as recorded by Kelvin probe force microscopy in ultrahigh vacuum. Sample preparations by thermal decomposition in ultrahigh vacuum and in an argon atmosphere are compared and the respective growth mechanisms discussed.

  3. Charge dependent asphaltene adsorption onto metal substrate : electrochemistry and AFM, STM, SAM, SEM analysis

    Energy Technology Data Exchange (ETDEWEB)

    Batina, N.; Morales-Martinez, J. [Univ. Autonoma Metropolitana-Iztapalapa (Mexico). Lab. de Nanotecnologia e Ingenieria Molecular; Ivar-Andersen, S. [Technical Univ. of Denmark (Denmark). Dept. Hem. Eng; Lira-Galeana, C. [Inst. Mexicano del Petroleo, Lazaro (Mexico). Molecular Simulation Research Program; De la Cruz-Hernandez, W.; Cota-Araiza, L.; Avalos-Borja, M. [Univ. Nacional Autonoma de Mexico (Mexico)

    2008-07-01

    Asphaltenes have been identified as the main component of pipeline molecular deposits that cause plugging of oil wells. In this study, Atomic Force Microscopy (AFM), Scanning Tunneling Microscopy (STM), Scanning Auger Microprobe Spectroscopy (SAM) and Scanning Electron Microscopy (SEM) were used to characterized molecular deposits of Mexican crude oil and asphaltenes formed at a charged metal surface. The qualitative and quantitative characterization involved determining the size and shape of adsorbed molecules and aggregates, and the elemental analysis of all components in molecular films. Samples were prepared by electrolytic deposition under galvanostatic or potentiostatic conditions directly from the crude oil or asphaltene in toluene solutions. The study showed that the formation of asphaltene deposit depends on the metal substrate charge. Asphaltenes as well as crude oil readily adsorbed at the negatively charged metal surface. Two elements were present, notably carbon and sulfur. Their content ratio varied depending on the metal substrate charge.

  4. Adding Interdisciplinary Exploration to Teaching Laboratories using AFM and Biophysical Samples.

    Science.gov (United States)

    Carter, Ashley

    Biophysics and nanotechnology are promising areas for the next generation of physicists to make an impact. To prepare students for these opportunities, we can add interdisciplinary exploration to our teaching laboratories. Here we describe several biophysical experiments that could be done in the undergraduate teaching laboratory using an AFM. In each laboratory, we image a biological sample and quantify a biophysical parameter: 1) imaging cells to determine membrane tension, 2) imaging microtubules to determine their persistence length, 3) imaging the random walk of DNA molecules to determine their contour length, and 4) imaging stretched DNA molecules to measure the tensional force. In addition, each experiment acts as a gateway for further interdisciplinary exploration in the teaching laboratory or beyond. Work was supported by funds from the Research Corporation.

  5. Surface AFM microscopy of unworn and worn samples of silicone hydrogel contact lenses.

    Science.gov (United States)

    González-Méijome, J M; López-Alemany, A; Almeida, J B; Parafita, M A

    2009-01-01

    To evaluate the qualitative and quantitative topographic changes in the surface of worn contact lenses (CLs) of different materials using atomic force microscopy (AFM). The topography of five different CL materials was evaluated with AFM over a surface of 25 microm(2) according to previously published experimental setup. Average roughness (R(a)) and root mean square (Rms) values were obtained for unworn and worn samples. The R(a) value increased for balafilcon A (11.62-13.68 nm for unworn and worn samples, respectively), lotrafilcon A (3.67-15.01 nm for unworn and worn samples, respectively), lotrafilcon B (4.08-8.42 nm for unworn and worn samples, respectively), galyfilcon A (2.81-14.6 nm for unworn and worn samples, respectively), and comfilcon A (2.87-4.63 nm for unworn and worn samples, respectively). Differences were statistically significant for all lenses except Rms and R(a) for comfilcon A, and R(a) parameter for balafilcon A (p > 0.05). The least relative increase was observed for some balafilcon A samples and for some of these samples the roughness decreased after the lenses had been worn. The changes in surface roughness between unworn and worn lenses are different for different silicone-hydrogel materials. Overall all CLs increased the degree of surface roughness after being worn, even for very short periods of time. However, for samples of balafilcon A, roughness increases at a lower extent or even can decrease as compared to unworn samples of the same material due to filling of the macropores. (c) 2008 Wiley Periodicals, Inc.

  6. TEM and AFM studies of aluminium nitride films synthesized by pulsed laser deposition

    Science.gov (United States)

    Fogarassy, Zs.; Petrik, P.; Duta, L.; Mihailescu, I. N.; Anastasescu, M.; Gartner, M.; Antonova, K.; Szekeres, A.

    2017-12-01

    Aluminium nitride (AlN) films were synthesized by pulsed laser ablation of poly-AlN target on Si(100) substrates using a KrF* excimer laser source ( λ = 248 nm, τ FWHM ≤ 25 ns), with incidence laser fluence of 3 J/cm2 and laser pulse repetition frequencies (LPF) of 3, 10 and 40 Hz, respectively. The depositions were performed in nitrogen pressure of 0.1 Pa and at substrate temperatures of 450 and 800 °C. The AlN structures were studied by transmission electron microscopy, atomic force microscopy (AFM), Fourier transform infrared reflectance (FTIR) spectroscopy and spectroscopic ellipsometry (SE) measurements. The results show that at 450 °C and LPF of 3 Hz the AlN film is entirely amorphous, while at LPF of 10 and 40 Hz nanocrystallites with h-AlN phase appear in the grown films. At 800 °C, well-textured h-AlN nanocrystallites with columnar grains are formed. Growth of nanocrystallites in the 450 °C AlN films, similar to films grown at 800 °C, is possible when the films are deposited onto a high-temperature AlN "seed" layer, as they follow the columnar structure but with small-sized crystallites and a weaker texturing. AFM imaging reveals increasing surface roughness with the degree of crystallinity in the synthesized films. The structural changes are well correlated with the variation in the optical parameters registered by FTIR and SE.

  7. Primary Shape and Nanomechanical Properties of Colloids studied by AFM and SEM

    Science.gov (United States)

    Wieczorek, A. K.; Fritzsche, A.; Totsche, K. U.

    2012-04-01

    Colloids are involved in a multitude of biogeochemical and physicochemical processes in natural soil systems. They may act as mobile reactive carriers, resulting in either reduced or enhanced solute mobility [1]. Interactions of colloids with themselves and with the immobile solid phase not only affect the hydraulic properties, but severely change geometric, mechanic and physicochemical properties of interfaces. Particularly important are the mineral-organic mixed colloidal phases. They form from complex natural solutions either by the way of sorption or co-precipitation [2][3]. The presence of organic substances during development of colloid may not only affect mineral formation and growth, but also colloid stability by additional steric stabilization forces [4]. Thus, these nanoparticulate mixed phases may be much more stable and mobile than classical mineral, organic, or biotic colloids. To be able to understand complicated system of natural colloids it is necessary to understand the interactions between single elements of this system. Therefore, in this study artificial colloidal ferrihydrites were obtained through alkalization of Fe(III)-citrate and Fe(III)-nitrate solution and subjected to incremental addition of humic acid as organic substance. Thus created mixed colloidal phases were then thoroughly analyzed using Scanning Electron Microscopy (SEM), Energy-Dispersive X-ray Spectroscopy (EDX) and Atomic Force Microscopy (AFM). Comparison of changes between pure mineral and mineral-organic colloids in chemical composition and geometric features like particle size, shape, surface area and roughness, was possible. Furthermore, changes in nanomechanical properties of sample material including adhesion, elastic modulus, hardness and energy dissipation were observed and analyzed, using new features of our AFM system. [1] Totsche & Kögel-Knabner (2004) Vadose Zone Journal 3(2), 352-367. [2] Eusterhues et al. (2008) Environ. Sci. Technol. 42, 7891-7897. [3

  8. Probing of miniPEGγ-PNA-DNA Hybrid Duplex Stability with AFM Force Spectroscopy.

    Science.gov (United States)

    Dutta, Samrat; Armitage, Bruce A; Lyubchenko, Yuri L

    2016-03-15

    Peptide nucleic acids (PNA) are synthetic polymers, the neutral peptide backbone of which provides elevated stability to PNA-PNA and PNA-DNA hybrid duplexes. It was demonstrated that incorporation of diethylene glycol (miniPEG) at the γ position of the peptide backbone increased the thermal stability of the hybrid duplexes (Sahu, B. et al. J. Org. Chem. 2011, 76, 5614-5627). Here, we applied atomic force microscopy (AFM) based single molecule force spectroscopy and dynamic force spectroscopy (DFS) to test the strength and stability of the hybrid 10 bp duplex. This hybrid duplex consisted of miniPEGγ-PNA and DNA of the same length (γ(MP)PNA-DNA), which we compared to a DNA duplex with a homologous sequence. AFM force spectroscopy data obtained at the same conditions showed that the γ(MP)PNA-DNA hybrid is more stable than the DNA counterpart, 65 ± 15 pN vs 47 ± 15 pN, respectively. The DFS measurements performed in a range of pulling speeds analyzed in the framework of the Bell-Evans approach yielded a dissociation constant, koff ≈ 0.030 ± 0.01 s⁻¹ for γ(MP)PNA-DNA hybrid duplex vs 0.375 ± 0.18 s⁻¹ for the DNA-DNA duplex suggesting that the hybrid duplex is much more stable. Correlating the high affinity of γ(MP)PNA-DNA to slow dissociation kinetics is consistent with prior bulk characterization by surface plasmon resonance. Given the growing interest in γ(MP)PNA as well as other synthetic DNA analogues, the use of single molecule experiments along with computational analysis of force spectroscopy data will provide direct characterization of various modifications as well as higher order structures such as triplexes and quadruplexes.

  9. Comparative Cryo-SEM and AFM studies of hylid and rhacophorid tree frog toe pads.

    Science.gov (United States)

    Barnes, W Jon P; Baum, Martina; Peisker, Henrik; Gorb, Stanislav N

    2013-12-01

    Cryo-scanning electron microscopy (cryo-SEM) and atomic force microscopy (AFM) offer new avenues for the study of the morphology of tree frog adhesive toe pads. Using these techniques, we compare toe pad microstructure in two distantly related species of tree frog, Litoria caerulea, White (Hylidae) and Rhacophorus prominanus, Smith (Rhacophoridae), in which the toe pads are considered to be convergent. AFM demonstrates the extraordinary similarity of both surface microstructures (largely hexagonal epithelial cells surrounded by deep channels) and nanostructures (an array of nanopillars, ca. 350 nm in diameter, all with a small dimple at the apex). The cryo-SEM studies examined the distribution of the fibrillar cytoskeleton within the different layers of the stratified toe pad epithelium, demonstrating that the cytoskeletal elements (keratin tonofilaments) that lie at an angle to the surface are relatively poorly developed in L. caerulea, clearly so in comparison to R. prominanus. Cryo-SEM also enabled the visualization of the fluid layer that is critical to a toe pad's adhesive function. This was achieved by examination of the frozen fluid residues left behind after removal of a toe within the cryo-SEM's experimental chamber. Such 'toeprints' demonstrated the presence of a wedge of fluid surrounding each toe pad, as well as fluid filling the channels that surround each epithelial cell. Cryo-SEM was used to examine epithelial cell shape. In a sample of 582 cells, 59.5% were hexagonal, the remainder being mainly pentagonal (23.1%) or heptagonal (16.1%). The distribution of differently-shaped cells was not random, but was not associated with either pad curvature or the distribution of mucous pores that provide fluid for the frogs' wet adhesion mechanism. Our main finding, the great similarity of toe pad structure in these two species, has important implications for biomimetics, for such convergent evolution suggests a good starting point for attempts to develop

  10. Nanopuller-open data acquisition platform for AFM force spectroscopy experiments

    Energy Technology Data Exchange (ETDEWEB)

    Pawlak, Konrad; Strzelecki, Janusz

    2016-05-15

    Atomic Force Microscope (AFM) is a widely used tool in force spectroscopy studies. Presently, this instrument is accessible from numerous vendors, albeit commercial solutions are expensive and almost always hardware and software closed. Approaches for open setups were published, as with modern low cost and readily available piezoelectric actuators, data acquisition interfaces and optoelectronic components building such force spectroscopy AFM is relatively easy. However, suitable software to control such laboratory made instrument was not released. Developing it in the lab requires significant time and effort. Our Nanopuller software described in this paper is intended to eliminate this obstacle. With only minimum adjustments this program can be used to control and acquire data with any suitable National Instruments universal digital/analog interface and piezoelectric actuator analog controller, giving significant freedom and flexibility in designing force spectroscopy experiment. Since the full code, written in a graphical LabVIEW environment is available, our Nanopuller can be easily customized. In this paper we describe the program and test its performance in controlling different setups. Successful and accurate force curve acquisition for standard samples (single molecules of I27O reference titin polyprotein and DNA as well as red blood cells) is shown. - Highlights: • We created open data acquisition software for performing Atomic Force Microscopy force measurements with custom laboratory made setups. • The software allows large flexibility in atomic force microscope design with minimum adjustment necessary. • The software is written in LabVIEW, allowing easy customization. • We successfully tested the program on two different hardware configurations by stretching single macromolecules and indenting cells.

  11. Raman confocal microscopy and AFM combined studies of cancerous cells treated with Paclitaxel

    Science.gov (United States)

    Derely, L.; Collart Dutilleul, P.-Y.; Michotte de Welle, Sylvain; Szabo, V.; Gergely, C.; Cuisinier, F. J. G.

    2011-03-01

    Paclitaxel interferes with the normal function of microtubule breakdown, induces apoptosis in cancer cells and sequesters free tubulin. As this drug acts also on other cell mechanisms it is important to monitor its accumulation in the cell compartments. The intracellular spreading of the drug was followed using a WITEC 300R confocal Raman microscope equipped with a CCD camera. Hence Atomic force microscopy (an MFP3D- Asylum Research AFM) in imaging and force mode was used to determine the morphological and mechanical modifications induced on living cells. These studies were performed on living epithelial MCF-7 breast cancer cells. Paclitaxel was added to cell culture media for 3, 6 and 9 hours. Among the specific paclitaxel Raman bands we selected the one at 1670 cm-1 because it is not superposed by the spectrum of the cells. Confocal Raman images are formed by monitoring this band, the NH2 and the PO4 band. Paclitaxel slightly accumulates in the nucleus forming patches. The drug is also concentrated in the vicinity of the cell membrane and in an area close to the nucleus where proteins accumulate. Our AFM images reveal that the treated cancerous MCF-7 cells keep the same size as the non treated ones, but their shape becomes more oval. Cell's elasticity is also modified: a difference of 2 kPa in the Young Modulus characterizes the treated MCF-7 mammary cancerous cell. Our observations demonstrate that paclitaxel acts not only on microtubules but accumulates also in other cell compartments (nucleus) where microtubules are absent.

  12. Degeneracy and instability of nanocontacts between conductive tips and hydrogenated nanocrystalline Si surfaces in conductive atomic force microscopy.

    Science.gov (United States)

    Cavalcoli, Daniela; Rossi, Marco; Tomasi, Andrea; Cavallini, Anna

    2009-01-28

    Conductive atomic force microscopy (C-AFM) has been extensively used for making measurements of electrical properties of nanostructures, devices and multiphase materials. Despite its wide use, the mechanical and electrical interactions at the nanoscale between the tip and the sample surface are not yet well understood. These phenomena should be carefully studied and modeled in order to avoid significant measurement artifacts. In the present contribution a study of the interactions occurring between conductive tips and the surface of nanocrystalline silicon thin films that lead to measurement artifacts is presented. A significant deterioration of the tip coating was detected after a few maps, resulting in meaningless maps. The features of the map obtained dramatically depend on the tip coating characteristics and on the load conditions. Moreover, under a constant bias voltage, the electrical current passing through the tip-sample junction degenerates strongly with time. These phenomena were interpreted by considering the effect of strong electric fields present during C-AFM experiments.

  13. AFM picking-up manipulation of the metaphase chromosome fragment by using the tweezers-type probe

    Energy Technology Data Exchange (ETDEWEB)

    Yamanaka, Keiichiro; Saito, Masato [Department of Biological Science and Biotechnology, School of Materials Science, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); Shichiri, Motoharu; Sugiyama, Sigeru [National Food Research Institute, National Agriculture and Food Research Organization, Kannondai 2-1-12, Tsukuba, Ibaraki 305-8642 (Japan); Takamura, Yuzuru [Department of Biological Science and Biotechnology, School of Materials Science, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); Hashiguchi, Gen [Research Institute of Electronics, Shizuoka University, 3-5-1 Jyouhoku, Hamamatsu, Shizuoka 432-8011 (Japan); Tamiya, Eiichi [Department of Biological Science and Biotechnology, School of Materials Science, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); Department of Applied Physics, Faculty of Engineering, Osaka University, Suita, Osaka 565-0871 (Japan)], E-mail: tamiya@ap.eng.osaka-u.ac.jp

    2008-08-15

    We have studied the development of a new procedure based on atomic force microscopy (AFM) for the analysis of metaphase chromosome. The aim of this study was to obtain detailed information about the specific locations of genes on the metaphase chromosome. In this research, we performed the manipulation of the metaphase chromosome by using novel AFM probes to obtain chromosome fragments of a smaller size than the ones obtained using the conventional methods, such as glass microneedles. We could pick up the fragment of the metaphase chromosome dissected by the knife-edged probe by using our tweezers-type probe.

  14. Longitudinal optical and spin Hall conductivities of Rashba conducting strips coupled to ferromagnetic and antiferromagnetic layers

    Science.gov (United States)

    Riera, José A.

    2017-01-01

    A system composed of a conducting planar strip with Rashba spin-orbit coupling (RSOC), magnetically coupled to a layer of localized magnetic moments, at equilibrium, is studied within a microscopic Hamiltonian with numerical techniques at zero temperature in the clean limit. In particular, transport properties for the cases of ferromagnetic (FM) and antiferromagnetic (AFM) coupled layers are computed in linear response on strips of varying width. Some behaviors observed for these properties are consistent with the ones observed for the corresponding Rashba helical currents. The case of uncoupled Rashba strips is also studied for comparison. In the case of Rashba strips coupled to an AFM localized order, results for the longitudinal dc conductivity, for small strip widths, suggest the proximity to a metal-insulator transition. More interesting, in the proximity of this transition, and in general at intermediate values of the RSOC, a large spin Hall conductivity is observed that is two orders of magnitude larger than the one for the FM order for the same values of the RSOC and strip widths. There are clearly two different regimes for small and for large RSOC, which is also present in the behavior of Rashba helical currents. Different contributions to the optical and the spin Hall conductivities, according to a new classification of inter- or intraband origin proposed for planar strips in the clean limit, or coming from the hopping or spin-orbit terms of the Hamiltonian, are examined. Finally, the effects of different orientation of the coupled magnetic moments will be also studied.

  15. Graphene Conductance Uniformity Mapping

    DEFF Research Database (Denmark)

    Buron, Jonas Christian Due; Petersen, Dirch Hjorth; Bøggild, Peter

    2012-01-01

    We demonstrate a combination of micro four-point probe (M4PP) and non-contact terahertz time-domain spectroscopy (THz-TDS) measurements for centimeter scale quantitative mapping of the sheet conductance of large area chemical vapor deposited graphene films. Dual configuration M4PP measurements......, demonstrated on graphene for the first time, provide valuable statistical insight into the influence of microscale defects on the conductance, while THz-TDS has potential as a fast, non-contact metrology method for mapping of the spatially averaged nanoscopic conductance on wafer-scale graphene with scan times......, dominating the microscale conductance of the investigated graphene film....

  16. Conducting Educational Design Research

    Science.gov (United States)

    McKenney, Susan; Reeves, Thomas

    2012-01-01

    Educational design research blends scientific investigation with systematic development and implementation of solutions to educational problems. Empirical investigation is conducted in real learning settings--not laboratories--to craft usable and effective solutions. At the same time, the research is carefully structured to produce theoretical…

  17. Conducting educational design research

    NARCIS (Netherlands)

    McKenney, Susan; Reeves, Thomas C.

    2012-01-01

    Educational design research blends scientific investigation with systematic development and implementation of solutions to educational problems. Empirical investigation is conducted in real learning settings-not laboratories-to craft usable and effective solutions. At the same time, the research is

  18. Using mobile technology to conduct epidemiological investigations

    Directory of Open Access Journals (Sweden)

    Onicio Batista Leal Neto

    2015-02-01

    Full Text Available INTRODUCTION : The aim of this study was to report the experience of an epidemiological field survey for which data were collected and analyzed using tablets. METHODS : The devices used Epi Info 7 (Android version, which has been modeled a database with variables of the traditional form. RESULTS : Twenty-one households were randomly selected in the study area; 75 residents were registered and completed household interviews with socioeconomic and environmental risk variables. CONCLUSIONS : This new technology is a valuable tool for collecting and analyzing data from the field, with advantageous benefits to epidemiological surveys.

  19. An experimental investigation of electrical conductivities in ...

    Indian Academy of Sciences (India)

    Soni P L and Srivastava H C 1992 Structural polysaccharide chemistry (Dehra Dun: A Surya Publication) p. 13. Wagner J B and Wagner C J 1957 Chem. Rev. 26 1597. Yamashita Y and Nicholson P S 1986 Solid State Ionics 20 147. Figure 7. Applied voltage (V) in volts vs electronic current. (I) in mA are measured at room ...

  20. Formation of surface relief grating in polymers with pendant azobenzene chromophores as studied by AFM/UFM.

    Science.gov (United States)

    Kulikovska, Olga; Gharagozloo-Hubmann, Kati; Stumpe, Joachim; Huey, Bryan D; Bliznyuk, Valery N

    2012-12-07

    We studied peculiarities of the structural reconstruction within holographically recorded gratings on the surface of several different amorphous azobenzene-containing polymers. Under illumination with a light interference pattern, two processes take place in this type of polymer. The first process is the light-induced orientation of azobenzene units perpendicular to the polarization plane of the incident light. The second one is a transfer of macromolecules along the grating vector (i.e. perpendicular to the grating lines). These two processes result in the creation of a volume orientation grating (alternating regions of different direction or degree of molecular orientation) and a surface relief grating (SRG)-i.e. modulation of film thickness. One can assume that both orientation of molecules and their movement might change the local mechanical properties of the material. Therefore, formation of the SRG is expected to result also in modulation of the local stiffness of the polymer film. To reveal and investigate these stiffness changes within the grating, spin-coated polymer films were prepared and the gratings were recorded on them in two different ways: with an orthogonal circular or orthogonal linear polarization of two recording light beams. A combination of atomic force microscopy (AFM) and ultrasonic force microscopy (UFM) techniques was applied for SRG development monitoring. We demonstrate that formation of the phase gratings depends on the chemical structure of polymers being used, polymer film thickness, and recording parameters, with the height of grating structures (depth of modulation) increasing with both the exposure time and the film thickness. UFM images suggest that the slopes of the topographic peaks in the phase gratings exhibit an increased stiffness with respect to the grating depressions.

  1. Determination of mechanical properties of spatially heterogeneous breast tissue specimens using contact mode atomic force microscopy (AFM).

    Science.gov (United States)

    Roy, Rajarshi; Desai, Jaydev P

    2014-09-01

    This paper outlines a comprehensive parametric approach for quantifying mechanical properties of spatially heterogeneous thin biological specimens such as human breast tissue using contact-mode Atomic Force Microscopy. Using inverse finite element (FE) analysis of spherical nanoindentation, the force response from hyperelastic material models is compared with the predicted force response from existing analytical contact models, and a sensitivity study is carried out to assess uniqueness of the inverse FE solution. Furthermore, an automation strategy is proposed to analyze AFM force curves with varying levels of material nonlinearity with minimal user intervention. Implementation of our approach on an elastic map acquired from raster AFM indentation of breast tissue specimens indicates that a judicious combination of analytical and numerical techniques allow more accurate interpretation of AFM indentation data compared to relying on purely analytical contact models, while keeping the computational cost associated an inverse FE solution with reasonable limits. The results reported in this study have several implications in performing unsupervised data analysis on AFM indentation measurements on a wide variety of heterogeneous biomaterials.

  2. Structuration et nanorhéologie d'un liquide confiné : étude par AFM ...

    African Journals Online (AJOL)

    Université Bordeaux 1) at the end of a study carried out on octamethylcyclotetrasiloxane (C8H26Si4O3) confined between a plane solid graphite surface and the tip of a commercial Atomic Force Microscope (AFM), used in dynamic mode tapping.

  3. Assembly of live micro-organisms on microstructured PDMS stamps by convective/capillary deposition for AFM bio-experiments

    Energy Technology Data Exchange (ETDEWEB)

    Dague, E; Jauvert, E; Laplatine, L; Thibault, C [CNRS, LAAS, 7 Avenue du Colonel Roche, F-31077 Toulouse Cedex 4 (France); Viallet, B; Ressier, L, E-mail: edague@laas.fr, E-mail: laurence.ressier@insa-toulouse.fr [Universite de Toulouse, LPCNO, INSA-CNRS-UPS, 135 Avenue de Rangueil, F-31077 Toulouse (France)

    2011-09-30

    Immobilization of live micro-organisms on solid substrates is an important prerequisite for atomic force microscopy (AFM) bio-experiments. The method employed must immobilize the cells firmly enough to enable them to withstand the lateral friction forces exerted by the tip during scanning but without denaturing the cell interface. In this work, a generic method for the assembly of living cells on specific areas of substrates is proposed. It consists in assembling the living cells within the patterns of microstructured, functionalized poly-dimethylsiloxane (PDMS) stamps using convective/capillary deposition. This versatile approach is validated by applying it to two systems of foremost importance in biotechnology and medicine: Saccharomyces cerevisiae yeasts and Aspergillus fumigatus fungal spores. We show that this method allows multiplexing AFM nanomechanical measurements by force spectroscopy on S. cerevisiae yeasts and high-resolution AFM imaging of germinated Aspergillus conidia in buffer medium. These two examples clearly demonstrate the immense potential of micro-organism assembly on functionalized, microstructured PDMS stamps by convective/capillary deposition for performing rigorous AFM bio-experiments on living cells.

  4. Assembly of live micro-organisms on microstructured PDMS stamps by convective/capillary deposition for AFM bio-experiments

    Science.gov (United States)

    Dague, E.; Jauvert, E.; Laplatine, L.; Viallet, B.; Thibault, C.; Ressier, L.

    2011-09-01

    Immobilization of live micro-organisms on solid substrates is an important prerequisite for atomic force microscopy (AFM) bio-experiments. The method employed must immobilize the cells firmly enough to enable them to withstand the lateral friction forces exerted by the tip during scanning but without denaturing the cell interface. In this work, a generic method for the assembly of living cells on specific areas of substrates is proposed. It consists in assembling the living cells within the patterns of microstructured, functionalized poly-dimethylsiloxane (PDMS) stamps using convective/capillary deposition. This versatile approach is validated by applying it to two systems of foremost importance in biotechnology and medicine: Saccharomyces cerevisiae yeasts and Aspergillus fumigatus fungal spores. We show that this method allows multiplexing AFM nanomechanical measurements by force spectroscopy on S. cerevisiae yeasts and high-resolution AFM imaging of germinated Aspergillus conidia in buffer medium. These two examples clearly demonstrate the immense potential of micro-organism assembly on functionalized, microstructured PDMS stamps by convective/capillary deposition for performing rigorous AFM bio-experiments on living cells.

  5. Characterization of Intercalating State of YOYO-1 in λDNA Using SNOM/AFM

    Science.gov (United States)

    Muramatsu, H.; Homma, K.; Yamamoto, N.; Wang, Jia; Sakata-Sogawa, K.; Shimamoto, N.

    λDNA Molecules, in which YOYO-1 was intercalated, were imaged and characterized using a scanning near-field optical / atomic-force microscope. In the microscope system, a scanning unit is mounted on an inverse microscope where the bent optical fiber probe is used to operate in the dynamic mode AFM. Solution of λDNA, 5 μM (base concentration) with 5 μM and 500 nM YOYO-1, were prepared and cast on a γ-APTES treated-cover slips. λDNA immobilized on the cover slips aggregated in line. For λDNA with 5 μM YOYO-1, there is variation in the fluorescence intensity of the DNA and ratios of the fluorescence intensity showed almost integers in each region. As the fluorescence intensity correlated with the area of cross section in the DNA topography, it was suggested that YOYO-1 intercalated in the DNA homogeneously. Contrary, the fluorescence intensity of λDNA with 500 nM YOYO-1 was heterogeneous and did not correlate with the area of topographic cross section. This suggested that YOYO-1 was not intercalated to 71 λDNA uniformly in the concentration and intercalated partially and cooperatively.

  6. Characterizing the surface charge of clay minerals with Atomic Force Microscope (AFM

    Directory of Open Access Journals (Sweden)

    Yuan Guo

    2017-05-01

    Full Text Available The engineering properties of clayey soils, including fluid permeability, erosion resistance and cohesive strength, are quite different from those of non-cohesive soils. This is mainly due to their small platy particle shape and the surrounding diffuse double layer structure. By using the Atomic Force Microscopy (AFM, the surface topography and the interaction force between the silicon dioxide tip and the kaolinite/montmorillonite clay minerals have been measured in the 1.0 mM NaCl solution at neutral pH. From this, the surface potential of the clay minerals is determined by mathematical regression analyses using the DLVO model. The length/thickness ratio of kaolinite and montmorillonite particles measured ranges from 8.0 to 15.0. The surface potential and surface charge density vary with particles. The average surface potential of montmorillonite is −62.8 ± 10.6 mV, and the average surface potential of kaolinite is −40.9 ± 15.5 mV. The measured results help to understand the clay sediment interaction, and will be used to develop interparticle force model to simulate sediment transport during erosion process.

  7. Sequence-controlled RNA self-processing: computational design, biochemical analysis, and visualization by AFM

    Science.gov (United States)

    Petkovic, Sonja; Badelt, Stefan; Flamm, Christoph; Delcea, Mihaela

    2015-01-01

    Reversible chemistry allowing for assembly and disassembly of molecular entities is important for biological self-organization. Thus, ribozymes that support both cleavage and formation of phosphodiester bonds may have contributed to the emergence of functional diversity and increasing complexity of regulatory RNAs in early life. We have previously engineered a variant of the hairpin ribozyme that shows how ribozymes may have circularized or extended their own length by forming concatemers. Using the Vienna RNA package, we now optimized this hairpin ribozyme variant and selected four different RNA sequences that were expected to circularize more efficiently or form longer concatemers upon transcription. (Two-dimensional) PAGE analysis confirms that (i) all four selected ribozymes are catalytically active and (ii) high yields of cyclic species are obtained. AFM imaging in combination with RNA structure prediction enabled us to calculate the distributions of monomers and self-concatenated dimers and trimers. Our results show that computationally optimized molecules do form reasonable amounts of trimers, which has not been observed for the original system so far, and we demonstrate that the combination of theoretical prediction, biochemical and physical analysis is a promising approach toward accurate prediction of ribozyme behavior and design of ribozymes with predefined functions. PMID:25999318

  8. New Information on the Hydrophobic Interaction Revealed by Frequency Modulation AFM.

    Science.gov (United States)

    Schlesinger, Itai; Sivan, Uri

    2017-03-14

    Using ultrahigh resolution atomic force microscopy (AFM) operated in frequency modulation mode, we extend existing measurements of the force acting between hydrophobic surfaces immersed in water in three essential ways. (1) The measurement range, which was previously limited to distances longer than 2-3 nm, is extended to cover all distances, down to contact. The measurements disclose that the long-range attraction observed also by conventional techniques, turns at distances shorter than 1-2 nm into pronounced repulsion. (2) Simultaneous measurements of the dissipative component of the tip-surface interaction reveal an anomalously large dissipation commencing abruptly at the point where attraction begins. The dissipation is more than 2 orders of magnitude larger than expected from bulk water viscosity or from similar measurements between hydrophilic surfaces. (3) The short-range repulsion is oscillatory, indicating molecular ordering of the medium as the hydrophobic surfaces approach each other. The oscillation period, ∼0.5 nm, is larger than the ∼0.3 nm period observed with hydrophilic surfaces. Their range, ∼1.5 nm, is longer as well. These observations are consistent with a conspicuous change in the properties of the surrounding medium, taking place simultaneously with the onset of attraction as the two surfaces approach each other.

  9. Spectroellipsometric, AFM and XPS probing of stainless steel surfaces subjected to biological influences

    Energy Technology Data Exchange (ETDEWEB)

    Vinnichenko, M.; Chevolleau, Th.; Pham, M.T.; Poperenko, L.; Maitz, M.F

    2002-11-30

    Surface modification of austenitic stainless steel (SS) 316L after incubation in growing cell cultures and cell-free media as control has been studied. The following treatments were applied: mouse fibrosarcoma cells L929 for 3 and 7 days, polymorphonuclear neutrophils for 3 and 7 days and human osarcoma cells SAOS-2 for 7 and 14 days. Cells were enzymatically removed in all cases. The modified surfaces were probed in comparison with untreated ones by means of spectroscopic ellipsometry (SE), X-ray photoelectron spectroscopy (XPS) and atomic force microscopy (AFM). XPS shows the appearance of the peak of bonded nitrogen at 400.5 eV characteristic for adsorbed proteins on the surface for each type of cells and for the cell-free medium. Migration of Ni in the adsorbed layer is observed in all cases for samples after the cell cultures. The protein layer thickness is ellipsometrically determined to be within 2.5-6.0 nm for all treated samples with parameterization of its optical constants in Cauchy approach. The study showed that for such biological treatments of the SS the protein layer adsorption is the dominating process in the first 2 weeks, which could play a role in the process of corrosion by complex forming properties with metal ions.

  10. Raman, AFM and SNOM high resolution imaging of carotene crystals in a model carrot cell system.

    Science.gov (United States)

    Rygula, Anna; Oleszkiewicz, Tomasz; Grzebelus, Ewa; Pacia, Marta Z; Baranska, Malgorzata; Baranski, Rafal

    2018-02-02

    Three non-destructive and complementary techniques, Raman imaging, Atomic Force Microscopy and Scanning Near-field Optical Microscopy were used simultaneously to show for the first time chemical and structural differences of carotenoid crystals. Spectroscopic and microscopic scanning probe measurements were applied to the released crystals or to crystals accumulated in a unique, carotenoids rich callus tissue growing in vitro that is considered as a new model system for plant carotenoid research. Three distinct morphological crystal types of various carotenoid composition were identified, a needle-like, rhomboidal and helical. Raman imaging using 532 and 488 nm excitation lines provided evidence that the needle-like and rhomboidal crystals had similar carotenoid composition and that they were composed mainly of β-carotene accompanied by α-carotene. However, the presence of α-carotene was not identified in the helical crystals, which had the characteristic spatial structure. AFM measurements of crystals identified by Raman imaging revealed the crystal topography and showed the needle-like and rhomboidal crystals were planar but they differed in all three dimensions. Combining SNOM and Raman imaging enabled indication of carotenoid rich structures and visualised their distribution in the cell. The morphology of identified subcellular structures was characteristic for crystalline, membraneous and tubular chromoplasts that are plant organelles responsible for carotenoid accumulation in cells. Copyright © 2018 Elsevier B.V. All rights reserved.

  11. Photoluminescence and AFM characterisation of photochemically etched highly resistive n-type silicon

    Energy Technology Data Exchange (ETDEWEB)

    Hadjersi, T.; Gabouze, N. [Unite de Developpement de la Technologie du Silicium (UDTS), 2, Bd. Frantz Fanon, B.P. 399 Alger-Gare, Alger (Algeria); Kooij, E.S. [Solid State Physics, MESA+ Research Institute, University of Twente, P.O. Box 217, 7500 AE Eschede (Netherlands); Yamamoto, N. [Communications Research Laboratory, Basic and Advanced Research, Division, 4-2-1, Nukui- kitamachi, Koganei,Tokyo, 184-8795 (Japan); Sakamaki, K.; Takai, H. [Tokyo Denki University, Department of Electrical Engineering, 2-2 Kanda-Nishiki-cyo, Chiyoda-ku, Tokyo, 101-8457 (Japan)

    2005-06-01

    A light-emitting layer has been made on highly resistive n-type silicon (6.4 k and ohm;cm) using photochemical etching in a mixture of HF with H{sub 2}O{sub 2}. The morphology of the porous films grown after exposure to a He-Ne laser (633 nm) at normal incidence was analysed by Atomic Force Microscopy (AFM). The results show that the film obtained are porous and the morphology of the porous layer obtained are shown to be similar to that obtained by the electrochemical method on highly doped silicon. Furthermore, excitation of the porous silicon layer formed on highly resistive silicon samples under He-Cd laser (325 nm) irradiation shows that the PL intensity increases with increasing etching time. The maximum PL spectrum peaked at 636 nm with a FWHM of about 0.3 eV. Finally, the quantum confinement effect has been invoked to explain the bright, visible, room temperature PL of porous silicon (PS). (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  12. Introduction of next-generation 3D AFM for advanced process control

    Science.gov (United States)

    Foucher, J.; Thérèse, R.; Lee, Y.; Park, S.-I.; Cho, S.-J.

    2013-04-01

    To fulfil advanced process control requirements for 1X node production, the semiconductor industry must cope with multiple parallel metrology requirements such as resolution, precision and accuracy enhancement in all directions to answer to new 3D integrated circuit fabrication methods. At the 1D and 2D levels, CDSEM and Scatterometry techniques are the workhorse techniques for production and process control. However, for process control of 3D devices and high resolution patterning such as direct self-assembly lithography, reference metrology is necessary to maintain a global process control uncertainty that is sufficient for production standards. CD-SEM and Scatterometry have intrinsic limitations that limit their utility for these cases, and new characterization methods are needed. Among the industrial reference techniques currently available, TEM and CD-AFM are generally employed to address this issues but both of these techniques have their own limitations for 1X node production. Nevertheless, they are also very useful for engineers to calibrate production CD metrology techniques and for more accurate process window and process development definition at the R&D level. Thus, there is a critical need to develop new technologies that build upon these capabilities while overcoming the limitations.

  13. Nanotribological characterization of molecularly thick lubricant films for applications to MEMS/NEMS by AFM.

    Science.gov (United States)

    Liu, Huiwen; Bhushan, Bharat

    2003-01-01

    Molecularly thick perfluoropolyether (PFPE) films are considered to be good protective films for micro/nanoelectromechanical systems (MEMS/NEMS) to reduce stiction, friction, and improve their durability. Understanding the nanotribological performance and mechanisms of these films are quite important for efficient lubrication for MEMS/NEMS devices. These devices are used in various operating environments and their effect on friction, adhesion and durability needs to be clarified. For this purpose, mobile and chemically bonded PFPE films were deposited by dip coating technique. The friction and adhesion properties of these films were characterized by atomic force microscopy (AFM). The effect of rest time, velocity, relative humidity, and temperature on nanotribological properties of these films was studied. Durability of these films was also measured by repeated cycling tests. The adhesion, friction mechanisms of PFPE at molecular scale, and the mechanisms of the effect of operating environment and durability are subject of this paper. This study found that adsorption of water, formation of meniscus and its change during sliding, viscosity, and surface chemistry properties play a big role on the friction, adhesion, and durability of the lubricant films.

  14. Sequence-controlled RNA self-processing: computational design, biochemical analysis, and visualization by AFM.

    Science.gov (United States)

    Petkovic, Sonja; Badelt, Stefan; Block, Stephan; Flamm, Christoph; Delcea, Mihaela; Hofacker, Ivo; Müller, Sabine

    2015-07-01

    Reversible chemistry allowing for assembly and disassembly of molecular entities is important for biological self-organization. Thus, ribozymes that support both cleavage and formation of phosphodiester bonds may have contributed to the emergence of functional diversity and increasing complexity of regulatory RNAs in early life. We have previously engineered a variant of the hairpin ribozyme that shows how ribozymes may have circularized or extended their own length by forming concatemers. Using the Vienna RNA package, we now optimized this hairpin ribozyme variant and selected four different RNA sequences that were expected to circularize more efficiently or form longer concatemers upon transcription. (Two-dimensional) PAGE analysis confirms that (i) all four selected ribozymes are catalytically active and (ii) high yields of cyclic species are obtained. AFM imaging in combination with RNA structure prediction enabled us to calculate the distributions of monomers and self-concatenated dimers and trimers. Our results show that computationally optimized molecules do form reasonable amounts of trimers, which has not been observed for the original system so far, and we demonstrate that the combination of theoretical prediction, biochemical and physical analysis is a promising approach toward accurate prediction of ribozyme behavior and design of ribozymes with predefined functions. © 2015 Petkovic et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.

  15. AFM/TIRF force clamp measurements of neurosecretory vesicle tethers reveal characteristic unfolding steps.

    Directory of Open Access Journals (Sweden)

    Mark C Harris

    Full Text Available Although several proteins have been implicated in secretory vesicle tethering, the identity and mechanical properties of the components forming the physical vesicle-plasma membrane link remain unknown. Here we present the first experimental measurements of nanomechanical properties of secretory vesicle-plasma membrane tethers using combined AFM force clamp and TIRF microscopy on membrane sheets from PC12 cells expressing the vesicle marker ANF-eGFP. Application of pulling forces generated tether extensions composed of multiple steps with variable length. The frequency of short (<10 nm tether extension events was markedly higher when a fluorescent vesicle was present at the cantilever tip and increased in the presence of GTPγS, indicating that these events reflect specifically the properties of vesicle-plasma membrane tethers. The magnitude of the short tether extension events is consistent with extension lengths expected from progressive unfolding of individual helices of the exocyst complex, supporting its direct role in forming the physical vesicle-plasma membrane link.

  16. AFM/TIRF force clamp measurements of neurosecretory vesicle tethers reveal characteristic unfolding steps.

    Science.gov (United States)

    Harris, Mark C; Cislo, Dillon; Lenz, Joan S; Umbach, Christopher; Lindau, Manfred

    2017-01-01

    Although several proteins have been implicated in secretory vesicle tethering, the identity and mechanical properties of the components forming the physical vesicle-plasma membrane link remain unknown. Here we present the first experimental measurements of nanomechanical properties of secretory vesicle-plasma membrane tethers using combined AFM force clamp and TIRF microscopy on membrane sheets from PC12 cells expressing the vesicle marker ANF-eGFP. Application of pulling forces generated tether extensions composed of multiple steps with variable length. The frequency of short (<10 nm) tether extension events was markedly higher when a fluorescent vesicle was present at the cantilever tip and increased in the presence of GTPγS, indicating that these events reflect specifically the properties of vesicle-plasma membrane tethers. The magnitude of the short tether extension events is consistent with extension lengths expected from progressive unfolding of individual helices of the exocyst complex, supporting its direct role in forming the physical vesicle-plasma membrane link.

  17. FTIR, AFM and PL properties of thin SiO{sub x} films deposited by HFCVD

    Energy Technology Data Exchange (ETDEWEB)

    Luna-Lopez, J.A., E-mail: jalbluna@siu.buap.mx [CIDS-ICUAP, BUAP, Ciudad Universitaria, Ed. 103 D, Col. San Manuel, C.P. 72570, Puebla (Mexico); Garcia-Salgado, G.; Diaz-Becerril, T.; Lopez, J. Carrillo; Vazquez-Valerdi, D.E.; Juarez-Santiesteban, H.; Rosendo-Andres, E.; Coyopol, A. [CIDS-ICUAP, BUAP, Ciudad Universitaria, Ed. 103 D, Col. San Manuel, C.P. 72570, Puebla (Mexico)

    2010-10-25

    In order to have optoelectronic functions integrated in a single chip, it is very important to obtain a silicon compatible material with an optimal photoluminescence response. The non-stoichiometric silicon oxide (SiO{sub x}) has shown photoluminescence response and is also compatible with silicon technology. In this work, the composition and optical properties of the SiO{sub x} films are studied using null ellipsometry, Fourier transformed infrared spectroscopy (FTIR), atomic force microscopy (AFM), and photoluminescence (PL). The SiO{sub x} films were growth to different temperatures. The IR absorption spectrum shows the presence of three typical Si-O-Si vibrations modes in SiO{sub 2}. However, changes in their intensity and position were observed. Also, when growth temperature decreased, the Si-H vibrations modes were observed. These changes are directly related with compositional variation in the SiO{sub x} films due to the growth temperature. A PL spectrum shows a considerable emission in the range 400-850 nm that varies with the growth temperatures.

  18. Surface characterisation of two strains of Staphylococcus epidermidis with different slime-production by AFM

    Science.gov (United States)

    Méndez-Vilas, A.; Gallardo-Moreno, A. M.; González-Martín, M. L.; Calzado-Montero, R.; Nuevo, M. J.; Bruque, J. M.; Pérez-Giraldo, C.

    2004-11-01

    Slime-producer Staphylococcus epidermidis is one opportunistic bacteria directly related to biomaterial infections inside the human body. The characterisation of the bacterial surface is crucial when trying to control its adhesion process and prevent the biofilm formation. This work aims to analyse the microscopic and submicroscopic surface structure of two strains of S. epidermidis with different slime production, as well as mapping the surface interaction forces. Atomic force microscopy (AFM) shows that S. epidermidis ATCC35984 is covered by a granular-like film, highly compacted with the presence of repeated "holes". However, S. epidermidis ATCC35983 only shows a partial coverage by a less compacted granular-like film, mainly located in the inter-cellular zones. Both films are related to the slime of the two strains studied. As regards to the adhesion forces, results show a greater adhesion of the tip to the slime covering S. epidermidis ATCC35984, than that covering the surface of S. epidermidis ATCC35983. In addition, the adhesion to the free-slime zones of the last strain was higher than to the slime-covered parts.

  19. Investigating the microstructural conduction mechanism of (1-x) Na0.5Bi0.5TiO3 - (x) BaFe12O19 [x in wt%= 10, 20, 30 and 40] novel magnetoelectric ceramic composite systems

    Science.gov (United States)

    Pattanayak, Ranjit; Raut, Subhajit; Routray, Krutika L.; Panigrahi, Simanchalo

    2017-09-01

    Polycrystalline (1-x) Na0.5Bi0.5TiO3 (NBT) - (x) BaFe12O19 (BaM) [x in wt%=40, 30, 20 and 10] novel particulate magnetoelectric (ME) composite systems have successfully fabricated by the solid-state reaction method. The Rietveld refinement of X-ray diffraction patterns provided the evidence about the pure phase formation of desired composite systems. Scanning Electron Microscopic (SEM) images provided the information about grain size and connectivity of both the phases in composite systems. The microstructural conduction mechanism of all the composite systems has been systematically investigated with the help of complex impedance spectroscopic technique. From both impedance and modulus spectroscopic study it is observed that different interfaces (BaM-BaM, BaM-NBT and NBT-NBT) are activated at different temperature ranges (in all the systems). It is also observed that, decreasing of BaM wt%, has significant effect on conduction mechanism of different interfaces. When BaM wt% is decreased, it has been perceived that BaM-NBT interfaces conduction gradually dominating over BaM-BaM interfaces conduction at room temperature (RT) as the result of which S1(NBT90) composite system has shown positive temperature coefficient of resistance (PTCR) behavior.

  20. Probing the role of metal cations on the aggregation behavior of amyloid β-peptide at a single molecule level by AFM

    Energy Technology Data Exchange (ETDEWEB)

    Xie, Yang; Wang, Jianhua, E-mail: wjh@cqu.edu.cn; Liu, Chundong [Chongqing University, Key Laboratory of Biorheological Science and Technology, Ministry of Education, College of Bioengineering (China)

    2016-09-15

    With the development of nanotechnology, understanding of intermolecular interactions on a single molecule level by atomic force spectroscopy (AFM) has played an important role in molecular biology and biomedical science. In recent years, some research suggested that the presence of metal cations is an important regulator in the processes of misfolding and aggregation of the amyloid β-protein (Aβ), which may be an important etiological factor of Alzheimer’s disease. However, the knowledge on the principle of interactions between Aβ and metal cations at the single molecule level is still poor understood. In this paper, the amyloid β-protein (Aβ) was fabricated on substrate of mixed thiol-modified gold nanoparticles using self-assembled monolayer method and the adhesion force in the longitudinal direction between metal cations and Aβ42 were investigated by AFM. The role of metal ions on Aβ aggregation is discussed from the perspective of single molecular force. The force results showed that the specific adhesion force F{sub i} and the nonspecific force F{sub 0} between a single Aβ–Aβ pair in control experiment were calculated as 42 ± 3 and 80 pN, respectively. However, F{sub i} between a single Aβ–Aβ pair in the presence of Cu{sup 2+}, Zn{sup 2+}, Ca{sup 2+} and Al{sup 3+} increased dramatically to 84 ± 6, 89 ± 3, 73 ± 5, 95 ± 5 pN successively, which indicated that unbinding between Aβ proteins is accelerated in the presence of metal cations. What is more, the imaging results showed that substoichiometric copper cations accelerate the formation of fibrils within 3 days. The combined atomic force spectroscopy and imaging analysis indicate that metal cations play a role in promoting the aggregating behavior of Aβ42.

  1. Electrical characterization of grain boundaries of CZTS thin films using conductive atomic force microscopy techniques

    Energy Technology Data Exchange (ETDEWEB)

    Muhunthan, N.; Singh, Om Pal [Compound Semiconductor Solar Cell, Physics of Energy Harvesting Division, New Delhi 110012 (India); Toutam, Vijaykumar, E-mail: toutamvk@nplindia.org [Quantum Phenomena and Applications Division, CSIR-National Physical Laboratory, Dr. K.S. Krishnan Marg, New Delhi 110012 (India); Singh, V.N., E-mail: singhvn@nplindia.org [Compound Semiconductor Solar Cell, Physics of Energy Harvesting Division, New Delhi 110012 (India)

    2015-10-15

    Graphical abstract: Experimental setup for conducting AFM (C-AFM). - Highlights: • Cu{sub 2}ZnSnS{sub 4} (CZTS) thin film was grown by reactive co-sputtering. • The electronic properties were probed using conducting atomic force microscope, scanning Kelvin probe microscopy and scanning capacitance microscopy. • C-AFM current flow mainly through grain boundaries rather than grain interiors. • SKPM indicated higher potential along the GBs compared to grain interiors. • The SCM explains that charge separation takes place at the interface of grain and grain boundary. - Abstract: Electrical characterization of grain boundaries (GB) of Cu-deficient CZTS (Copper Zinc Tin Sulfide) thin films was done using atomic force microscopic (AFM) techniques like Conductive atomic force microscopy (CAFM), Kelvin probe force microscopy (KPFM) and scanning capacitance microscopy (SCM). Absorbance spectroscopy was done for optical band gap calculations and Raman, XRD and EDS for structural and compositional characterization. Hall measurements were done for estimation of carrier mobility. CAFM and KPFM measurements showed that the currents flow mainly through grain boundaries (GB) rather than grain interiors. SCM results showed that charge separation mainly occurs at the interface of grain and grain boundaries and not all along the grain boundaries.

  2. Responsible conduct of research

    CERN Document Server

    Shamoo, Adil E

    2015-01-01

    Since the early 2000s, the field of Responsible Conduct of Research has become widely recognized as essential to scientific education, investigation, and training. At present, research institutions with public funding are expected to have some minimal training and education in RCR for their graduate students, fellows and trainees. These institutions also are expected to have a system in place for investigating and reporting misconduct in research or violations of regulations in research with human subjects, or in their applications to federal agencies for funding. Public scrutiny of the conduct of scientific researchers remains high. Media reports of misconduct scandals, biased research, violations of human research ethics rules, and moral controversies in research occur on a weekly basis. Since the 2009 publication of the 2nd edition of Shamoo and Resnik's Responsible Conduct of Research, there has been a vast expansion in the information, knowledge, methods, and diagnosis of problems related to RCR and the ...

  3. Magnetotransport measurements on AFM structured two-dimensional electron gases on cleaved edges of GaAs/AlGaAs; Magnetotransportmessungen an AFM-strukturierten zweidimensionalen Elektronengasen auf GaAs/AlGaAs-Spaltkanten

    Energy Technology Data Exchange (ETDEWEB)

    Reinwald, Elisabeth

    2009-06-25

    In this thesis a two dimensional electron gas (2DEG) on a (110) cleavage plane of a GaAs/AlGaAs(001) heterostructure was produced by means of cleaved edge overgrowth (CEO) and modulated in two dimensions. The 2DEG was modulated in one direction by a superlattice of the subjacent GaAs/AlGaAs(001) heterostructure. A second modulation, perpendicular to the first was realized by local anodic oxidation (LAO) with an atomic force microscope (AFM). For the process of LAO an electric voltage is applied between the tip of the AFM and the surface of the GaAs. The natural water film on the surface acts as electrolyte so that the GaAs surface is locally oxidized underneath the AFM tip. This oxide leads to a band bending so that the 2DEG underneath the oxide is locally depleted. On these systems magnetotransport measurements revealed that it is actually possible to modulate 2DEGs on a sufficient large area by local anodic oxidation. On the cleaved surfaces the influence of the two dimensional modulation on the electron gas has been demonstrated. (orig.)

  4. Complex conductivity of soils

    DEFF Research Database (Denmark)

    Revil, A.; Coperey, A.; Shao, Z.

    2017-01-01

    to 45 kHz. The soil samples are saturated with 6 different NaCl brines with conductivities (0.031, 0.53, 1.15, 5.7, 14.7, and 22 S m-1, NaCl, 25°C) in order to determine their intrinsic formation factor and surface conductivity. This dataset is used to test the predictions of the dynamic Stern......The complex conductivity of soil remains poorly known despite the growing importance of this method in hyrogeophysics. In order to fill this gap of knowledge, we investigate the complex conductivity of 71 soils samples (including 4 peat samples) and one clean sand in the frequency range 0.1 Hertz...

  5. Elastic properties of Nafion, polybenzimidazole and poly [2,5-benzimidazole] membranes determined by AFM tip nano-indentation

    Energy Technology Data Exchange (ETDEWEB)

    Franceschini, Esteban A. [Departamento de Fisica de Materia Condensada, Centro Atomico Constituyentes, Comision Nacional de Energia Atomica (CNEA), 1650 San Martin, Buenos Aires (Argentina); Corti, Horacio R. [Departamento de Fisica de Materia Condensada, Centro Atomico Constituyentes, Comision Nacional de Energia Atomica (CNEA), 1650 San Martin, Buenos Aires (Argentina); Instituto de Quimica Fisica de los Materiales, Medio Ambiente y Energia (INQUIMAE), Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Pabellon II, Ciudad Universitaria, 1428 Buenos Aires (Argentina)

    2009-03-15

    The mechanical properties of polybenzimidazole (PBI) and poly [2,5-benzimidazole] (ABPBI) membranes, possible candidates to replace Nafion as proton exchange membranes in direct methanol fuel cells (DMFC), were studied. It was observed by AFM imaging that the morphology of the ABPBI membranes strongly depends on the casting procedure, performed at high temperature from methanesulphonic acid and at low temperature from formic acid. The elastic moduli of the undoped and phosphoric acid doped membranes were determined using the AFM force spectroscopy technique and the differences observed with doped and undoped PBI and Nafion membranes, were discussed in terms of the electrostatic and swelling forces between polymer chains. The analysis of the force curves indicates differences in the mechanical behavior of doped PBI and ABPBI membranes compared to Nafion, which could have practical consequences on the stability of the membrane electrode assemblies. (author)

  6. A solution for an inverse problem in liquid AFM: calculation of three-dimensional solvation structure on a sample surface

    CERN Document Server

    Amano, Ken-ich

    2013-01-01

    Recent frequency-modulated atomic force microscopy (FM-AFM) can measure three-dimensional force distribution between a probe and a sample surface in liquid. The force distribution is, in the present circumstances, assumed to be solvation structure on the sample surface, because the force distribution and solvation structure have somewhat similar shape. However, the force distribution is exactly not the solvation structure. If we would like to obtain the solvation structure by using the liquid AFM, a method for transforming the force distribution into the solvation structure is necessary. Therefore, in this letter, we present the transforming method in a brief style. We call this method as a solution for an inverse problem, because the solvation structure is obtained at first and the force distribution is obtained next in general calculation processes. The method is formulated (mainly) by statistical mechanics of liquid.

  7. Thermally induced pure and spin polarized currents in a zigzag silicene nanoribbon based FM/normal/AFM junction

    Science.gov (United States)

    Ghanbari, Atousa; Esmaeilzadeh, Mahdi; Pournaghavi, Nezhat

    2018-01-01

    We study thermally induced spin resolved current in a zigzag silicene nanoribbon when the left and right leads are respectively affected by ferromagnetic (FM) and anti-ferromagnetic (AFM) exchange fields (FM/normal/AFM junction). We show that pure spin current is generated due to the leads temperature difference and the junction can work as a spin Seebeck diode. The pure spin current can be easily controlled by a perpendicular electric field and the junction, in this case, can work as a spin current switch. In addition, we study the effect of a single vacancy and show that the vacancy can slightly destroy the pure spin current property which leads to induce a weak spin polarized current. In the presence of both vacancy and electric field, current with high and tunable spin polarization can be achieved.

  8. Dynamic modeling of trolling-mode AFM: Considering effects of cantilever torsion, nanoneedle flexibility and liquid-nanoneedle interactions.

    Science.gov (United States)

    Sajjadi, Mohammadreza; Pishkenari, Hossein Nejat; Vossoughi, Gholamreza

    2017-11-01

    Trolling mode atomic force microscope (TR-Mode AFM) significantly reduces the hydrodynamic drag generated during operation in liquid environments. This is achieved by utilizing a long nanoneedle and keeping the cantilever out of liquid. In this research, a continuous mathematical model is developed to study TR-Mode AFM dynamics near a sample submerged in the liquid. Effects of cantilever torsion, nanoneedle flexibility, and liquid-nanoneedle interactions are considered in the model. In order to derive the equations of motion, Hamilton's principle and assumed mode method are used. System operation in dynamic mode is numerically simulated and the accuracy of the results is verified by comparison with the results of the finite element method. Displacements of different components of the system are also compared with each other and the dominant displacements are determined. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Lipid asymmetry in DLPC/DSPC supported lipid bilayers, a combined AFM and fluorescence microscopy study

    Energy Technology Data Exchange (ETDEWEB)

    Lin, W; Blanchette, C D; Ratto, T V; Longo, M L

    2005-06-20

    A fundamental attribute of cell membranes is transmembrane asymmetry, specifically the formation of ordered phase domains in one leaflet that are compositionally different from the opposing leaflet of the bilayer. Using model membrane systems, many previous studies have demonstrated the formation of ordered phase domains that display complete transmembrane symmetry but there have been few reports on the more biologically relevant asymmetric membrane structures. Here we report on a combined atomic force microscopy (AFM) and fluorescence microscopy study whereby we observe three different states of transmembrane symmetry in phase-separated supported bilayers formed by vesicle fusion. We find that if the leaflets differ in gel-phase area fraction, then the smaller domains in one leaflet are in registry with the larger domains in the other leaflet and the system is dynamic. In a presumed lipid flip-flop process similar to Ostwald Ripening, the smaller domains in one leaflet erode away while the large domains in the other leaflet grow until complete compositional asymmetry is reached and remains stable. We have quantified this evolution and determined that the lipid flip-flop event happens most frequently at the interface between symmetric and asymmetric DSPC domains. If both leaflets have nearly identical area fraction of gel-phase, gel-phase domains are in registry and are static in comparison to the first state. The stability of these three DSPC domain distributions, the degree of registry observed, and the domain immobility have direct biological significance with regards to maintenance of lipid asymmetry in living cell membranes, communication between inner leaflet and outer leaflet, membrane adhesion, and raft mobility.

  10. Biomechanical Properties of Murine Meniscus Surface via AFM-based Nanoindentation

    Science.gov (United States)

    Li, Qing; Doyran, Basak; Gamer, Laura W.; Lu, X. Lucas; Qin, Ling; Ortiz, Christine; Grodzinsky, Alan J.; Rosen, Vicki; Han, Lin

    2015-01-01

    This study aimed to quantify the biomechanical properties of murine meniscus surface. Atomic force microscopy (AFM)-based nanoindentation was performed on the central region, proximal side of menisci from 6- to 24-week old male C57BL/6 mice using microspherical tips (Rtip ≈ 5 μm) in PBS. A unique, linear correlation between indentation depth, D, and response force, F, was found on menisci from all age groups. This non-Hertzian behavior is likely due to the dominance of tensile resistance by the collagen fibril bundles on meniscus surface that are mostly aligned along the circumferential direction observed on 12-week old menisci. The indentation resistance was calculated as both the effective stiffness, Sind = dF/dD, and the effective modulus, Eind, via the isotropic Hertz model. Values of Sind and Eind were found to depend on indentation rate, suggesting the existence of poro-viscoelasticity. These values do not significantly vary with anatomical sites, lateral versus medial compartments, or mouse age. In addition, Eind of meniscus surface (e.g., 6.1 ± 0.8 MPa for 12 weeks of age, mean ± SEM, n = 13) was found to be significantly higher than those of meniscus surfaces in other species, and of murine articular cartilage surface (1.4 ± 0.1 MPa, n = 6). In summary, these results provided the first direct mechanical knowledge of murine knee meniscus tissues. We expect this understanding to serve as a mechanics-based benchmark for further probing the developmental biology and osteoarthritis symptoms of meniscus in various murine models. PMID:25817332

  11. Recombinant albumin adsorption on mica studied by AFM and streaming potential measurements.

    Science.gov (United States)

    Kujda, Marta; Adamczyk, Zbigniew; Morga, Maria; Sofińska, Kamila

    2015-03-01

    Recombinant human serum albumin (rHSA) in monomeric state is widely used in pharmaceutical industry as a drug excipient and for preparing coatings for medical devices. In this work the adsorption process of rHSA on model mica surface at pH 3.5 was studied using the atomic force microscopy (AFM) and in situ streaming potential measurements. The kinetics of albumin adsorption was determined by a direct enumeration of single molecules over various substrate areas. These results were consistent with streaming potential measurements carried out for the parallel-plate channel flow and with theoretical predictions derived from the random sequential adsorption (RSA) model. Desorption kinetics of albumin under flow conditions was also evaluated via the streaming potential measurements. In this way, the amount of irreversibly bound albumin was quantitatively evaluated to be 0.64 and 1.2 mg m(-2) for ionic strength of 0.01 and 0.15 M, respectively. This agrees with previous results obtained for HSA and theoretical calculations derived from the RSA model. Additionally, it was demonstrated that there existed a fraction of reversibly bound albumin that can be fully eluted within a few hours. The binding energy of these fraction of molecules was -18 kT that is consistent with the electrostatic controlled adsorption mechanism of albumin at this pH. It was concluded that the rHSA monolayers of well-defined coverage can find applications for quantitatively analyzing ligand binding and for performing efficient biomaterials and immunological tests. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Mechanism of immonoglobulin G adsorption on mica-AFM and electrokinetic studies.

    Science.gov (United States)

    Dąbkowska, Maria; Adamczyk, Zbigniew

    2014-06-01

    Adsorption of immunoglobulin G (IgG) from aqueous NaCl solutions of the concentration 10(-3)-0.15M on mica was studied. Initially, the kinetics was evaluated at pH 3.5 by direct AFM imaging. A monotonic increase in the maximum coverage of IgG with NaCl concentration was observed. These results were interpreted in terms of the theoretical model postulating an irreversible adsorption of the protein governed by the random sequential adsorption (RSA) model. Additionally, IgG adsorption and desorption was studied under in situ conditions, with streaming potential measurements. These measurements revealed that the maximum coverage of irreversibly adsorbed IgG varies from 0.37mgm(-2) for 10(-3)M, NaCl to 1.2mgm(-2) for 0.15M, NaCl. The significant role of ionic strength was attributed to the lateral electrostatic repulsion among adsorbed IgG molecules, positively charged at this pH value. These experimental results confirmed that monolayers of irreversibly bound IgG can be produced by adjusting ionic strength of the protein solution. In further experiments the stability and acid base properties of such monolayers were studied using the streaming potential method. It revealed that the monolayers were stable against pH cycling for the range from 3.5 to 9.5. The isoelectric point of mica supported IgG monolayers was 5.9, similar to derived from the micro-electrophoretic measurements in the bulk (5.8). Beside significance for basic sciences, the results indicate that thorough characteristics of IgG can be acquired via streaming potential measurements using microgram quantities of the protein. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. Micro- and nano-electrostatic force fields: generation, 3-dimensional measurement using a novel AFM method and applications

    OpenAIRE

    Jenke, Martin

    2008-01-01

    Electro-static or electro-dynamic fields generated by micro- or nano-electrodes are today widely used in many different fields, such as micro- and nanogripping, "lab on a chip", and "lab in a cell", for the purpose of manipulation, separation, or analysis of micron-sized particles, cells, or single molecules. Commonly numerical simulations and Electrostatic Force Microscopy (EFM) methods, based on Atomic Force Microscopy (AFM), are used to study and predict the electrostatic force fields abov...

  14. AFM and XRD characterization of silver nanoparticles films deposited on the surface of DGEBA epoxy resin by ion sputtering

    Directory of Open Access Journals (Sweden)

    José Elisandro de Andrade

    2013-01-01

    Full Text Available In this work, silver atoms were deposited by ion sputtering on the surface of diglycidyl ether of bisphenol A (DGEBA epoxy resin cured at 150 °C for 6 hours in air. The films of DGEBA and its precursors were characterized by Raman spectroscopy to identify the main functional groups and their relationship with the deposited silver atoms. Silver thin films of 5, 10, 15 and 20 nm were deposited on the epoxy resin at room temperature. Both the initial film of DGEBA and the subsequent silver thin film were analyzed by Atomic Force Microscopy (AFM in the non-contact mode. Silver thin films were also analyzed using X-ray diffraction (XRD at room temperature. The AFM results showed the formation of silver crystallites on the surface of DGEBA at very low coverage whereas XRD indicated that most of them had their main axis aligned to the normal of the surface. An increase in the coverage led to an increase in the grain size as indicated by AFM. However, XRD results indicated that the crystallite size remained almost constant while the appearance of peaks corresponding to other crystalline orientations suggests the coalescence of the original crystallites and an increase in size of the more dense planes, namely [111].

  15. AFM and XRD characterization of silver nanoparticles films deposited on the surface of DGEBA epoxy resin by ion sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Jose Elisandro de; Machado, Rogerio; Macedo, Marcelo Andrade; Cunha, Frederico Guilherme Carvalho [Clinica de Medicina Nuclear e Radiologia de Maceio (MedRadiUS), Radiology and Imaging Diagnosis at Universidade Federal de Alagoas (UFAL), Maceio, AL (Brazil)

    2012-07-01

    In this work, silver atoms were deposited by ion sputtering on the surface of diglycidyl ether of bisphenol A (DGEBA) epoxy resin cured at 150 deg C for 6 hours in air. The films of DGEBA and its precursors were characterized by Raman spectroscopy to identify the main functional groups and their relationship with the deposited silver atoms. Silver thin films of 5, 10, 15 and 20 nm were deposited on the epoxy resin at room temperature. Both the initial film of DGEBA and the subsequent silver thin film were analyzed by Atomic Force Microscopy (AFM) in the non-contact mode. Silver thin films were also analyzed using X-ray diffraction (XRD) at room temperature. The AFM results showed the formation of silver crystallites on the surface of DGEBA at very low coverage whereas XRD indicated that most of them had their main axis aligned to the normal of the surface. An increase in the coverage led to an increase in the grain size as indicated by AFM. However, XRD results indicated that the crystallite size remained almost constant while the appearance of peaks corresponding to other crystalline orientations suggests the coalescence of the original crystallites and an increase in size of the more dense planes, namely [111]. (author)

  16. AFM and XRD characterization of silver nanoparticles films deposited on the surface of DGEBA epoxy resin by ion sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Jose Elisandro de; Machado, Rogerio; Macedo, Marcelo Andrade [Universidade Federal de Sergipe (UFSE), Aracaju, SE (Brazil). Programa de Pos-graduacao em Fisica; Cunha, Frederico Guilherme Carvalho [Universidade Federal de Sergipe (UFSE), Aracaju, SE (Brazil). Programa de Pos-graduacao em Ciencia e Engenharia de Materiais

    2012-07-01

    In this work, silver atoms were deposited by ion sputtering on the surface of diglycidyl ether of bisphenol A (DGEBA) epoxy resin cured at 150 Degree-Sign C for 6 hours in air. The films of DGEBA and its precursors were characterized by Raman spectroscopy to identify the main functional groups and their relationship with the deposited silver atoms. Silver thin films of 5, 10, 15 and 20 nm were deposited on the epoxy resin at room temperature. Both the initial film of DGEBA and the subsequent silver thin film were analyzed by Atomic Force Microscopy (AFM) in the non-contact mode. Silver thin films were also analyzed using X-ray diffraction (XRD) at room temperature. The AFM results showed the formation of silver crystallites on the surface of DGEBA at very low coverage whereas XRD indicated that most of them had their main axis aligned to the normal of the surface. An increase in the coverage led to an increase in the grain size as indicated by AFM. However, XRD results indicated that the crystallite size remained almost constant while the appearance of peaks corresponding to other crystalline orientations suggests the coalescence of the original crystallites and an increase in size of the more dense planes, namely [111]. (author)

  17. Establishing a new conductance stopped-flow apparatus to investigate the initial fast step of reaction between 1,1,1-trichloro-3-methyl-3-phospholene and methanol under a dry inert atmosphere.

    Science.gov (United States)

    Habibi Khorassani, Sayyed Mostafa; Ebrahimi, Ali; Maghsoodlou, Malek Taher; Shahraki, Mehdi; Price, Dennis

    2011-04-21

    In the present work, for the first time, investigation of the initial fast step of reaction between 1,1,1-trichloro-3-methyl-3-phospholene (TCMP) and methanol was studied under a dry inert atmosphere by a newly constructed CSF apparatus by means of a further development in the configuration of the previous stopped-flow spectrophotometer (SFS). Hence, it was necessary to make many changes to the stopped-flow apparatus: replacement of the spectrophotometer amplifier with a conductance amplifier and the use of a conductivity cell to replace the optical one. The conductivity cell was made of polyethylene capillary tube (1 mm internal diameter; i.d.) and its inside dimensions were 1 mm i.d. × 3 mm long. Two tube electrodes which are made of stainless steel (0.8 mm i.d. × 14 mm long) were fixed at opposite ends of the observation cell and their outer surfaces were connected to the conductivity bridge amplifier by the two lead wires. The mixer was a 3-way Teflon valve and the distance between the mixer and the end of the observation cell was 30 mm. For each run, at least 24 µL of solution was required for a typical trace with a dead time of about 5 ms. Because of the extreme sensitivity of TCMP to moisture, the stopped-flow (CSF) apparatus was used inside a glove bag under a dry nitrogen atmosphere. Kinetic parameters for pseudo first-order reaction involving k(obs) = 30 s(-1) at 22 °C and activation energy E(a) = 13.55 KJ mol(-1) were successfully calculated for the initial fast step of the reaction between TCMP and methanol at 22 °C.

  18. The development of electrically conductive polycaprolactone fumarate-polypyrrole composite materials for nerve regeneration.

    Science.gov (United States)

    Runge, M Brett; Dadsetan, Mahrokh; Baltrusaitis, Jonas; Knight, Andrew M; Ruesink, Terry; Lazcano, Eric A; Lu, Lichun; Windebank, Anthony J; Yaszemski, Michael J

    2010-08-01

    Electrically conductive polymer composites composed of polycaprolactone fumarate and polypyrrole (PCLF-PPy) have been developed for nerve regeneration applications. Here we report the synthesis and characterization of PCLF-PPy and in vitro studies showing PCLF-PPy materials support both PC12 cell and dorsal root ganglia (DRG) neurite extension. PCLF-PPy composite materials were synthesized by polymerizing pyrrole in preformed PCLF scaffolds (M(n) 7,000 or 18,000 g mol(-1)) resulting in interpenetrating networks of PCLF-PPy. Chemical compositions and thermal properties were characterized by ATR-FTIR, XPS, DSC, and TGA. PCLF-PPy materials were synthesized with five different anions (naphthalene-2-sulfonic acid sodium salt (NSA), dodecylbenzenesulfonic acid sodium salt (DBSA), dioctyl sulfosuccinate sodium salt (DOSS), potassium iodide (I), and lysine) to investigate effects on electrical conductivity and to optimize chemical composition for cellular compatibility. PCLF-PPy materials have variable electrical conductivity up to 6 mS cm(-1) with bulk compositions ranging from 5 to 13.5 percent polypyrrole. AFM and SEM characterization show microstructures with a root mean squared (RMS) roughness of 1195 nm and nanostructures with RMS roughness of 8 nm. In vitro studies using PC12 cells and DRG show PCLF-PPy materials synthesized with NSA or DBSA support cell attachment, proliferation, neurite extension, and are promising materials for future studies involving electrical stimulation. Copyright 2010 Elsevier Ltd. All rights reserved.

  19. Formation of reflective and conductive silver film on ABS surface via covalent grafting and solution spray

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Dexin; Zhang, Yan [School of Mechanical and Automotive Engineering, South China University of Technology, 381 Wushan, Guangzhou 510640 (China); Bessho, Takeshi [Higashifuji Technical Center, Toyota Motor Corporation, 1200 Mishuku, Susono, Shizuoka 410-1193 (Japan); Kudo, Takahiro; Sang, Jing; Hirahara, Hidetoshi; Mori, Kunio [Faculty of Engineering, Iwate University, 4-3-5 Ueda, Morioka 020-8551 (Japan); Kang, Zhixin, E-mail: zxkang@scut.edu.cn [School of Mechanical and Automotive Engineering, South China University of Technology, 381 Wushan, Guangzhou 510640 (China)

    2015-09-15

    Highlights: • A pure and homogenous silver film was deposited by spray-style plating technique. • The mechanism of covalent bonding between coating and substrate was studied. • The silver coating is highly reflective and conductive. • UV light was used to activate the ABS surface with triazine azide derivative. - Abstract: Conductive and reflective silver layers on acrylonitrile butadiene styrene (ABS) plastics have been prepared by photo grafting of triazine azides upon ultraviolet activation, self-assembling of triazine dithiols and silver electroless plating by solution spray based on silver mirror reaction. The as-prepared silver film exhibited excellent adhesion with ABS owing to covalent bonds between coating and substrate, and the detailed bonding mechanism have been investigated by X-ray photoelectron spectroscopy (XPS). X-ray diffraction (XRD) result revealed that silver film on ABS was pure and with a nanocrystalline structure. Atomic force microscope (AFM) analysis demonstrated that massive silver particles with sizes varying from 80 to 120 nm were deposited on ABS and formed a homogenous and smooth coating, resulting in highly reflective surface. Furthermore, silver maintained its unique conductivity even as film on ABS surface in term of four-point probe method.

  20. The Development of Electrically Conductive Polycaprolactone Fumarate-Polypyrrole Composite Materials for Nerve Regeneration

    Science.gov (United States)

    Runge, M. Brett; Dadsetan, Mahrokh; Baltrusaitis, Jonas; Knight, Andrew M.; Ruesink, Terry; Lazcano, Eric; Lu, Lichun; Windebank, Anthony J.; Yaszemski, Michael J.

    2010-01-01

    Electrically conductive polymer composites composed of polycaprolactone fumarate and polypyrrole (PCLF-PPy) have been developed for nerve regeneration applications. Here we report the synthesis and characterization of PCLF-PPy and in vitro studies showing PCLF-PPy materials support both PC12 cell and dorsal root ganglia (DRG) neurite extension. PCLF-PPy composite materials were synthesized by polymerizing pyrrole in pre-formed PCLF scaffolds (Mn 7,000 or 18,000 g mol−1) resulting in interpenetrating networks of PCLF-PPy. Chemical compositions and thermal properties were characterized by ATR-FTIR, XPS, DSC, and TGA. PCLF-PPy materials were synthesized with five different anions (naphthalene-2-sulfonic acid sodium salt (NSA), dodecylbenzenesulfonic acid sodium salt (DBSA), dioctyl sulfosuccinate sodium salt (DOSS), potassium iodide (I), and lysine) to investigate effects on electrical conductivity and to optimize chemical composition for cellular compatibility. PCLF-PPy materials have variable electrical conductivity up to 6 mS cm−1 with bulk compositions ranging from 5 to 13.5 percent polypyrrole. AFM and SEM characterization show microstructures with a root mean squared (RMS) roughness of 1195 nm and nanostructures with RMS roughness of 8 nm. In vitro studies using PC12 cells and DRG show PCLF-PPy materials synthesized with NSA or DBSA support cell attachment, proliferation, neurite extension, and are promising materials for future studies involving electrical stimulation. PMID:20483452