Leach testing of SYNROC and glass samples at 85 and 200/degree/C
International Nuclear Information System (INIS)
Oversby, V.M.; Ringwood, A.E.
1981-01-01
Leach tests were conducted on 0.5 g disc samples of SYNROC and two glass types using distilled water at 85 and 200/degree/C. No leaching was detected for SYNROC at either temperature. Thus, the upper limit on leach rate for SYNROC is <0.005 g/m/sup 2/d. Waste glass PNL 76-68 had leach rates of 1.4 g/m/sup 2/ d at 85/degree/C and 8.9 g/m/sup 2/ d at 200/degree/C, while 73-1 glass frit had a leach rate of 41 g/m/sup 2/ d at 200/degree/C. The leach tests were repeated in the presence of rock powders. Again, no leaching was measurable for SYNROC. PNL 76-68 glass had leach rates between 4 and 23 g/m/sup 2/ d at 200/degree/C and 73-1 frit leached at rates between 29 and 176 g/m/sup 2/ d at 200/degree/C. Tests were also conducted on crushed glass samples (PNL 76-68, 100-200 /mu/m size fraction). Bulk leach rates were calculated based on measurement of Ca, Cs, and U in the leach solutions. The results of the leach tests show that SYNROC is several orders of magnitude more resistant to leaching than glass
Mixed mobile ion effect on a.c. conductivity of boroarsenate glasses
Indian Academy of Sciences (India)
In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...
Immobilization of krypton-85 in zeolite 5A and porous glass
International Nuclear Information System (INIS)
Christensen, A.B.; DelDebbio, J.A.; Knecht, D.A.; Tanner, J.E.; Cossel, S.C.
1981-12-01
This report demonstrates the technical and economic feasibility for immobilizing krypton-85 by high pressure/high temperature encapsulation in zeolite 5A or thirsty Vyco porous glass. Data are presented to show how process conditions affect the encapsulation and how to compact the zeolite beads with glass frit or other additives to form a fused mass with low dispersibility potential. Krypton specific loadings of 30 and 50 m 3 STP gas per m 3 solid are readily achieved at 100 MPa in porous glass at 900 0 C and zeolite 5A at 700 0 C. Krypton is encapsulated by a sintering process where the porous glass and zeolite 5A voids are sealed. With zeolite 5A, the initial water concentration has a catalytic effect on the sintering, resulting in a transition from crystalline zeolite 5A to an amorphous aluminosilicate. Krypton leakage experiments are used to predict leakage rates from glass or zeolite of less than 0.03% and 0.3% for 10-y storage at 300 and 400 0 C, respectively. Heating the loaded zeolite at 600 to 700 0 C for 4 h removes 0.1% of the total krypton which is loosely held and reduces the subsequent leakage rates at 300 to 400 0 C. Zeolite 5A is chosen as the preferred material to immobilize krypton-85. A preconceptual design and cost estimate is given for a facility to encapsulate 110% of the krypton production of a 2000 metric ton of heavy metal per year reprocessing plant, or 230 m 3 of gas containing 19 MCi of krypton-85. A hot isostatic press (HIP) with an isolated work zone of 8 or 16 L capacity is required to operate for 600 or 300 cycles per year, respectively. Existing HIP technology uses work zones from 1 to 3500 L capacity at similar production rates. A preliminary safety evaluation shows that an incredible worst case accident could be contained and the maximum off-site dose would be well below accident protective action guidance levels
Improved ionic conductivity of lithium-zinc-tellurite glass-ceramic electrolytes
Widanarto, W.; Ramdhan, A. M.; Ghoshal, S. K.; Effendi, M.; Cahyanto, W. T.; Warsito
An enhancement in the secondary battery safety demands the optimum synthesis of glass-ceramics electrolytes with modified ionic conductivity. To achieve improved ionic conductivity and safer operation of the battery, we synthesized Li2O included zinc-tellurite glass-ceramics based electrolytes of chemical composition (85-x)TeO2·xLi2O·15ZnO, where x = 0, 5, 10, 15 mol%. Samples were prepared using the melt quenching method at 800 °C followed by thermal annealing at 320 °C for 3 h and characterized. The effects of varying temperature, alternating current (AC) frequency and Li2O concentration on the structure and ionic conductivity of such glass-ceramics were determined. The SEM images of the annealed glass-ceramic electrolytes displayed rough surface with a uniform distribution of nucleated crystal flakes with sizes less than 1 μm. X-ray diffraction analysis confirmed the well crystalline nature of achieved electrolytes. Incorporation of Li2O in the electrolytes was found to generate some new crystalline phases including hexagonal Li6(TeO6), monoclinic Zn2Te3O8 and monoclinic Li2Te2O5. The estimated crystallite size of the electrolyte was ranged from ≈40 to 80 nm. AC impedance measurement revealed that the variation in the temperatures, Li2O contents, and high AC frequencies have a significant influence on the ionic conductivity of the electrolytes. Furthermore, electrolyte doped with 15 mol% of Li2O exhibited the optimum performance with an ionic conductivity ≈2.4 × 10-7 S cm-1 at the frequency of 54 Hz and in the temperature range of 323-473 K. This enhancement in the conductivity was attributed to the sizable alteration in the ions vibration and ruptures of covalent bonds in the electrolytes network structures.
Improved ionic conductivity of lithium-zinc-tellurite glass-ceramic electrolytes
Directory of Open Access Journals (Sweden)
W. Widanarto
Full Text Available An enhancement in the secondary battery safety demands the optimum synthesis of glass-ceramics electrolytes with modified ionic conductivity. To achieve improved ionic conductivity and safer operation of the battery, we synthesized Li2O included zinc-tellurite glass-ceramics based electrolytes of chemical composition (85-xTeO2·xLi2O·15ZnO, where x = 0, 5, 10, 15 mol%. Samples were prepared using the melt quenching method at 800 °C followed by thermal annealing at 320 °C for 3 h and characterized. The effects of varying temperature, alternating current (AC frequency and Li2O concentration on the structure and ionic conductivity of such glass-ceramics were determined. The SEM images of the annealed glass-ceramic electrolytes displayed rough surface with a uniform distribution of nucleated crystal flakes with sizes less than 1 μm. X-ray diffraction analysis confirmed the well crystalline nature of achieved electrolytes. Incorporation of Li2O in the electrolytes was found to generate some new crystalline phases including hexagonal Li6(TeO6, monoclinic Zn2Te3O8 and monoclinic Li2Te2O5. The estimated crystallite size of the electrolyte was ranged from ≈40 to 80 nm. AC impedance measurement revealed that the variation in the temperatures, Li2O contents, and high AC frequencies have a significant influence on the ionic conductivity of the electrolytes. Furthermore, electrolyte doped with 15 mol% of Li2O exhibited the optimum performance with an ionic conductivity ≈2.4 × 10−7 S cm−1 at the frequency of 54 Hz and in the temperature range of 323–473 K. This enhancement in the conductivity was attributed to the sizable alteration in the ions vibration and ruptures of covalent bonds in the electrolytes network structures. Keywords: Zinc-tellurite, Glass-ceramics, X-ray diffraction, Ionic conductivity, Lithium oxide
Electrical conductivity and viscosity of borosilicate glasses and melts
DEFF Research Database (Denmark)
Ehrt, Doris; Keding, Ralf
2009-01-01
, 0 to 62·5 mol% B2O3, and 25 to 85 mol% SiO2. The glass samples were characterised by different methods. Refractive indices, density and thermal expansion were measured. Phase separation effects were investigated by electron microscopy. The electrical conductivity of glasses and melts were determined......Simple sodium borosilicate and silicate glasses were melted on a very large scale (35 l Pt crucible) to prepare model glasses of optical quality in order to investigate various properties depending on their structure. The composition of the glass samples varied in a wide range: 3 to 33·3 mol% Na2O...... by impedance measurements in a wide temperature range (250 to 1450°C). The activation energies were calculated by Arrhenius plots in various temperature regions: below the glass transition temperature, Tg, above the melting point, Tl, and between Tg and Tl. Viscosity measurements were carried out...
thermal, electrical and structural characterization of fast ion conducting glasses (Ag Br)x(AgPO)1-x
International Nuclear Information System (INIS)
Kartini, E.; Yufus, S.; Priyanto, T; Indayaningsih, N; Collins, M F
2001-01-01
Fast ion conducting glasses are of considerable technological interest because of their possible application in batteries, sensors, and displays. One of the main scientific challenges is to explain how the disordered structure of the glass is related to the high ionic conductivity that can be achieved at ambient temperature. Fast ion conducting glasses (AgBr) x (AgPO3) 1- x with x=0.0; 0.2; 0.3; 0.4; 0.5; 0.7; and 0.85 were prepared by rapid quenching. The studies of structure, thermal property and electrical conductivity have been made. The X-ray diffraction patterns of this system show that the sample are glasses for x 0.5. The neutron diffraction data shows that all AgBr doped glasses exhibit a strong and relatively sharp diffraction peak at anomalously low momentum transfer value, Q∼ 0.7 Α - 1. The low Q-peak is not observed in AgPO 3 glass, and in the X-ray data. The results of electrical conductivity show that the conduction is essentially ionic and due to silver ions alone. The logarithm of the ionic conductivity increases with increasing AgBr mole fraction, and reaches maximum for x = 0.5. The thermal property results measured by differential scanning calorimetric show that the temperatures of the glass transition, the crystallization and the melt reach minimum for the glass with composition x 0.5. We conclude that there appears to be a relation between higher conductivity at ambient temperature, and the low Q-peak. Based on this investigation a better fast ion conducting glass proposed is (AgBr) 0 .5(AgPO 3 ) 0 .5 with the conductivity of 8 x 10 - 5 S/cm
Characterization and Conduction Mechanism of Highly Conductive Vanadate Glass
Directory of Open Access Journals (Sweden)
Tetsuaki Nishida
2015-12-01
Full Text Available This paper reviews recent studies of highly conductive barium iron vanadate glass with a composition of 20 BaO ∙ 10 Fe2O3 ∙ 70 V2O5 (in mol %. Isothermal annealing of the vanadate glass for several ten minutes at a given temperature, higher than glass transition temperature or crystallization temperature, caused an increase in σ. Substitution of CuI (3d10, ZnII (3d10 and CuII (3d9 for FeIII (3d5 was investigated to elucidate the effect of electron configuration on the conductivity (σ. A marked decrease in the activation energy of conduction (Ea was also observed after the annealing. Values of Ea were correlated to the energy gap between the donor level and the conduction band (CB in the n-type semiconductor model. Isothermal annealing of ZnII-substituted vanadate glass (20 BaO ∙ 5 ZnO ∙ 5 Fe2O3 ∙ 70 V2O5 at 450 °C for 30 min showed an increase in σ from 2.5 × 10–6 to 2.1 × 10–1 S cm–1, which was one order of magnitude larger than that of non-substituted vanadate glass (3.4 × 10–2 S cm–1. Under the same annealing condition, σ’s of 2.0 × 10–1 and 3.2 × 10–1 S cm–1 were observed for 20 BaO ∙ 5 Cu2O ∙ 5 Fe2O3 ∙ 70 V2O5 and 20 BaO ∙ 5 CuO ∙ 5 Fe2O3 ∙ 70 V2O5 glasses, respectively. These results demonstrate an increase in the carrier (electron density in the CB, primarily composed of anti-bonding 4s-orbitals.
Radiation damages on superionic conducting glasses
International Nuclear Information System (INIS)
Awano, T.; Handa, K.; Matsuyama, T.
2000-01-01
We measured ESR spectra of color centers on AgI-AgPO 3 , AgI-Ag 2 O-B 2 O 3 , AgI-Ag 2 MoO 4 , AgI-Ag 2 WO 4 , (CH 3 ) 4 NI-(C 2 H 5 ) 4 NI-AgI (TMAI-TEAI-AgI) and its derivatives of superionic conducting glasses. In organic-inorganic mixed glasses, organic ion radicals were observed. They were not affected by ionic conductivity. On the contrary, Ag 2+ , Ag 0 and aggregated Ag 0 were observed in inorganic glasses. These color centers in inorganic glasses were affected by ionic conductivity. (author)
Tm3+/Yb3+ co-doped tellurite glass with silver nanoparticles for 1.85 μm band laser material
Huang, Bo; Zhou, Yaxun; Cheng, Pan; Zhou, Zizhong; Li, Jun; Jin, Wei
2016-10-01
Tm3+/Yb3+ co-doped tellurite glasses with different silver nanoparticles (Ag NPs) concentrations were prepared using the conventional melt-quenching technique and characterized by the UV/Vis/NIR absorption spectra, 1.85 μm band fluorescence emission spectra, transmission electron microscopy (TEM) images, differential scanning calorimeter (DSC) curves and X-ray diffraction (XRD) patterns to investigate the effects of Ag NPs on the 1.85 μm band spectroscopic properties of Tm3+ ions, thermal stability and structural nature of glass hosts. Under the excitation of 980 nm laser diode (LD), the 1.85 μm band fluorescence emission of Tm3+ ions enhances significantly in the presence of Ag NPs with average diameter of ∼8 nm and local surface Plasmon resonance (LSPR) band of ∼590 nm, which is mainly attributed to the increased local electric field induced by Ag NPs at the proximity of doped rare-earth ions on the basis of energy transfer from Yb3+ to Tm3+ ions. An improvement by about 110% of fluorescence intensity is observed in the Tm3+/Yb3+ co-doped tellurite glass containing 0.5 mol% amount of AgNO3 while the prepared glass samples possess good thermal stability and amorphous structural nature. Meanwhile, the Judd-Ofelt intensity parameters Ωt (t = 2,4,6), spontaneous radiative transition probabilities, fluorescence branching ratios and radiative lifetimes of relevant excited levels of Tm3+ ions were determined based on the Judd-Ofelt theory to reveal the enhanced effects of Ag NPs on the 1.85 μm band spectroscopic properties, and the energy transfer micro-parameters and phonon contribution ratios were calculated based on the non-resonant energy transfer theory to elucidate the energy transfer mechanism between Yb3+ and Tm3+ ions. The present results indicate that the prepared Tm3+/Yb3+ co-doped tellurite glass with an appropriate amount of Ag NPs is a promising lasing media applied for 1.85 μm band solid-state lasers and amplifiers.
Thermal studies of Se85-xTe15Inx (x = 3,6,9,12) glasses
International Nuclear Information System (INIS)
Sushama, D.; George, Achamma; Asokan, S.
2011-01-01
Bulk glasses of compositions Se 85-x Te 15 In x (x = 3,6,9,12) are prepared by melt quenching technique and Differential scanning calorimetry (DSC) is employed to study the thermal stability, crystallization mechanism as well as specific heat of these glasses. It is found that the addition of indium increases the glass transition temperature. From the heating rate dependence of the glass transition temperature the activation energy of glass transition is determined using Kissinger's equation for non-isothermal crystallization of materials. An attempt has been made to explain the variation in the value of T c , T p and ΔC p for the composition Se 73 Te 15 In 12 using rigidity percolation threshold (RPT). From the values of (T c -T g ) the stable glass system is determined.
Thermal conductivity of glass copper-composite
International Nuclear Information System (INIS)
Kinoshita, Makoto; Terai, Ryohei; Haidai, Haruki
1980-01-01
Glass-metal composites are to be one of the answers for promoting thermal conduction in the glassy solids containing high-level radioactive wastes. In order to investigate the effect of metal addition on thermal conductivity of glasses, glass-copper composites were selected, and the conductivities of the composites were measured and discussed in regards to copper content and microstructure. Fully densified composites were successfully prepared by pressure sintering of the powder mixtures of glass and copper at temperatures above the yield points of the constituent glasses if the copper content was not so much. The conductivity was measured by means of a comparative method, in which the thermal gradient of the specimen was compared with that of quartz glass as standard under thermally steady state. Measurements were carried out at around 50 0 C. The thermal conductivity increased with increasing content of copper depending on the kind of copper powder used. The conductivities of the composites of the same copper content differed considerably each another. Fine copper powder was effective on increasing conductivity, and the conductivity became about threefold of that of glass by mixing the fine copper powder about 10 vol%. For the composites containing the fine copper powder less than 5 vol%, the conductivity obeyed so-called logarithmic rule, one of the mixture rules of conductivity, whereas for composites containing more than 5 vol%, the conductivity remarkably increased apart from the rule. This fact suggests that copper becomes continuous in the composite when the copper content increased beyond 5 vol%. For the composites containing coarse copper powder, the conductivity was increased not significantly, and obeyed an equation derived from the model in which conductive material dispersed in less conductive one. (author)
Determination of ionic conductivity in the Bi-Si-O and Pb-Si-O glasses
Directory of Open Access Journals (Sweden)
Karczewski J.
2018-03-01
Full Text Available Impedance spectroscopy measurements in various gas atmospheres were carried out in order to explain the doubts about the type of carriers and the mechanism of electrical conductivity in Bi-Si-O and Pb-Si-O glasses. In bismuth silicate glass, a typical ionic conductivity with oxygen ions as charge carriers was observed. The level of electrical conductivity of the glass at 400 °C was 5 × 10-8 S·cm-1, with the activation energy of 1.3 eV and was independent of measuring atmosphere. In the case of lead silicate glasses, the conductivity changed with measuring atmosphere. Two types of charge carriers: oxygen ions and proton ions were postulated. Proton conductivity measured in wet argon at temperature 400 °C was estimated at the level of 4 × 10-8 S·cm-1 while the oxygen ions conductivity in such conditions was 78 × 10-8 S·cm-1. We suggest that both types of charge carriers are transported along the same conduction paths using oxygen defects in the glass structure.
Thermal conductivities of some lead and bismuth glasses
Velden, P.F. van
1965-01-01
Thermal conductivities have been measured, mainly at 40°C, of glasses within the systems PbO-Bi2O3-SiO2, PbO-Bi2O3-Al2O3-SiO2, and BaO- (Bi2O3 or PbO) -SiO2. Aiming at lowest thermal conductivity, preference was given to glasses of low silica and low alumina contents. Glass formation persists at
Susman, S.; Volin, K.J.
Described is an ionically conducting glass for use as a solid electrolyte in a power or secondary cell containing an alkali metal-containing anode and a cathode separated by an alkali metal ion conducting glass having an ionic transference number of unity and the general formula: A/sub 1 + x/D/sub 2-x/3/Si/sub x/P/sub 3 - x/O/sub 12 - 2x/3/, wherein A is a network modifier for the glass and is an alkali metal of the anode, D is an intermediate for the glass and is selected from the class consisting of Zr, Ti, Ge, Al, Sb, Be, and Zn and X is in the range of from 2.25 to 3.0. Of the alkali metals, Na and Li are preferred and of the intermediate, Zr, Ti and Ge are preferred.
Viswanath, Pamarti; Prashanth, Sadhu Sai Pavan; Molli, Muralikrishna; Wicram, Jaschin Prem; Sai Muthukumar, V.
2018-04-01
Glass ceramics are excellent replacement for single crystalline materials which are expensive and difficult to fabricate. In this context, we have attempted to fabricate glass nanocomposites comprising of Lithium Borate glass matrix embedded with lead free ferroelectric Ba0.85Ca0.15Zr0.1Ti0.9O3 (BCZT). Both of these functional materials are known to exhibit excellent ferroelectric behavior and are currently explored for various device applications. We have prepared these novel glass nanocomposite using melt-quenching techniquein various chemical composition involving different molar ratio. x(Ba0.85Ca0.15Zr0.1Ti0.9O3)-(1-x)(Li2O.2B2O3) where (x=0.1,0.2,0.3,0.4). The as-quenched samples exhibited amorphous nature as revealed by X-ray Diffraction studies. With the increase in BCZT content we have observed significant alteration in optical bandgap and Urbach energy. The tailoring of optical properties by tuning the structure was probed by Raman vibrational spectroscopy which confirmed the dominant role played by BCZT as a network modifier in these borate glasses. Concomitantly, these glass nanocomposites were found to be excellent UV absorbers.
Thermal Conductivity of Foam Glass
DEFF Research Database (Denmark)
Petersen, Rasmus Rosenlund; König, Jakob; Yue, Yuanzheng
Due to the increased focus on energy savings and waste recycling foam glass materials have gained increased attention. The production process of foam glass is a potential low-cost recycle option for challenging waste, e.g. CRT glass and industrial waste (fly ash and slags). Foam glass is used...... as thermal insulating material in building and chemical industry. The large volume of gas (porosity 90 – 95%) is the main reason of the low thermal conductivity of the foam glass. If gases with lower thermal conductivity compared to air are entrapped in the glass melt, the derived foam glass will contain...... only closed pores and its overall thermal conductivity will be much lower than that of the foam glass with open pores. In this work we have prepared foam glass using different types of recycled glasses and different kinds of foaming agents. This enabled the formation of foam glasses having gas cells...
International Nuclear Information System (INIS)
Wenlong Yao
2006-01-01
This thesis consists of six sections. The first section gives the basic research background on the ionic conduction mechanism in glass, polarization in the glass, and the method of determining the mobile carrier density in glass. The proposed work is also included in this section. The second section is a paper that characterizes the structure of MI + M 2 S + (0.1 Ga 2 S 3 + 0.9 GeS 2 ) (M = Li, Na, K and Cs) glasses using Raman and IR spectroscopy. Since the ionic radius plays an important role in determining the ionic conductivity in glasses, the glass forming range for the addition of different alkalis into the basic glass forming system 0.1 Ga 2 S 3 + 0.9 GeS 2 was studied. The study found that the change of the alkali radius for the same nominal composition causes significant structure change to the glasses. The third section is a paper that investigates the ionic conductivity of MI + M 2 S + (0.1Ga 2 S 3 + 0.9 GeS 2 ) (M = Li, Na, K and Cs) glasses system. Corresponding to the compositional changes in these fast ionic conducting glasses, the ionic conductivity shows changes due to the induced structural changes. The ionic radius effect on the ionic conductivity in these glasses was investigated. The fourth section is a paper that examines the mobile carrier density based upon the measurements of space charge polarization. For the first time, the charge carrier number density in fast ionic conducting chalcogenide glasses was determined. The experimental impedance data were fitted using equivalent circuits and the obtained parameters were used to determine the mobile carrier density. The influence of mobile carrier density and mobility on the ionic conductivity was separated. The fifth section is a paper that studies the structures of low-alkali-content Na 2 S + B 2 S 3 (x (le) 0.2) glasses by neutron and synchrotron x-ray diffraction. Similar results were obtained both in neutron and synchrotron x-ray diffraction experiments. The results provide direct
Isotope effect in glass-transition temperature and ionic conductivity of lithium-borate glasses
International Nuclear Information System (INIS)
Nagasaki, Takanori; Morishima, Ryuta; Matsui, Tsuneo
2002-01-01
The glass-transition temperature and the electrical conductivity of lithium borate (0.33Li 2 O-0.67B 2 O 3 ) glasses with various isotopic compositions were determined by differential thermal analysis and by impedance spectroscopy, respectively. The obtained glass-transition temperature as well as the vibrational frequency of B-O network structure was independent of lithium isotopic composition. This result indicates that lithium ions, which exist as network modifier, only weakly interact with B-O network structure. In addition, the glass-transition temperature increased with 10 B content although the reason has not been understood. The electrical conductivity, on the other hand, increased with 6 Li content. The ratio of the conductivity of 6 Li glass to that of 7 Li glass was found to be 2, being larger than the value (7/6) 1/2 calculated with the simple classical diffusion theory. This strong mass dependence could be explained by the dynamic structure model, which assumes local structural relaxation even far below the glass-transition temperature. Besides, the conductivity appeared to increase with the glass-transition temperature. Possible correlations between the glass-transition temperature and the electrical conductivity were discussed. (author)
Effective thermal conductivity of glass-fiber board and blanket standard reference materials
International Nuclear Information System (INIS)
Smith, D.R.; Hust, J.G.
1983-01-01
This chapter reports on measurements of effective thermal conductivity performed on a series of specimens of glass-fiber board and glass-fiber blanket. Explains that measurements of thermal conductivity were conducted as a function of temperature from 85 to 360 K, of temperature difference with T=10 to 100 K, of bulk density from 11 to 148 kg/m 3 and for nitrogen, argon, and helium inter-fiber fill gases at pressures from atmospheric to high vacuum. Analyzes and compares results with values from the published literature and National Bureau of Standards (NBS) certification data for similar material. Gives polynomial expressions for the functional relation between conductivity, temperature, and density for board and for blanket
Color centers of a borosilicate glass induced by 10 MeV proton, 1.85 MeV electron and 60Co-γ ray
Du, Jishi; Wu, Jiehua; Zhao, Lili; Song, Lixin
2013-05-01
Optical absorption spectra, electron paramagnetic resonance (EPR) spectra, Raman spectra of a borosilicate glass after irradiation by 10 MeV proton, 1.85 MeV electron and 60Co-γ ray were studied. The process of irradiation inducing color centers in the glass was discussed. The band gap of the glass before and after 60Co-γ ray irradiation was studied using Mott and Davis's theory, and it was found that calculated change of the band gap introduced a paradox, because Mott and Davis's theory on the band gap cannot be adopted in the study on the irradiated glass.
Energy Technology Data Exchange (ETDEWEB)
Yao, Wenlong [Iowa State Univ., Ames, IA (United States)
2006-01-01
This thesis consists of six sections. The first section gives the basic research background on the ionic conduction mechanism in glass, polarization in the glass, and the method of determining the mobile carrier density in glass. The proposed work is also included in this section. The second section is a paper that characterizes the structure of MI + M2S + (0.1 Ga2S3 + 0.9 GeS2) (M = Li, Na, K and Cs) glasses using Raman and IR spectroscopy. Since the ionic radius plays an important role in determining the ionic conductivity in glasses, the glass forming range for the addition of different alkalis into the basic glass forming system 0.1 Ga2S3 + 0.9 GeS2 was studied. The study found that the change of the alkali radius for the same nominal composition causes significant structure change to the glasses. The third section is a paper that investigates the ionic conductivity of MI + M2S + (0.1Ga2S3 + 0.9 GeS2) (M = Li, Na, K and Cs) glasses system. Corresponding to the compositional changes in these fast ionic conducting glasses, the ionic conductivity shows changes due to the induced structural changes. The ionic radius effect on the ionic conductivity in these glasses was investigated. The fourth section is a paper that examines the mobile carrier density based upon the measurements of space charge polarization. For the first time, the charge carrier number density in fast ionic conducting chalcogenide glasses was determined. The experimental impedance data were fitted using equivalent circuits and the obtained parameters were used to determine the mobile carrier density. The influence of mobile carrier density and mobility on the ionic conductivity was separated. The fifth section is a paper that studies the structures of low-alkali-content Na2S + B2S3 (x ≤ 0.2) glasses by neutron and synchrotron x-ray diffraction
Electronic conductivity studies on oxyhalide glasses containing TMO
Energy Technology Data Exchange (ETDEWEB)
Vijayatha, D. [R& D Center, Bharatiar University, Coimbatore, Tamil Nadu (India); Department of Physics, Gurunanak Institute of Technology, Hyderabad -040 (India); Viswanatha, R. [Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore 560012 (India); Sujatha, B. [Department of Electronics and Communcation, MSRIT, Bangalore 560054 (India); Narayana Reddy, C., E-mail: nivetejareddy@gmail.com [Department of Physics, Sree Siddaganga College of Arts, Science and Commerce, Tumkur 572102 (India)
2016-05-06
Microwave-assisted synthesis is cleaner, more economical and much faster than conventional methods. The development of new routes for the synthesis of solid materials is an integral part of material science and technology. The electronic conductivity studies on xPbCl{sub 2} – 60 PbO – (40-x) V{sub 2}O{sub 5} (1 ≥ x ≤ 10) glass system has been carried out over a wide range of composition and temperature (300 K to 423 K). X-ray diffraction study confirms the amorphous nature of the samples. The Scanning electron microscopic studies reveal the formation of cluster like morphology in PbCl{sub 2} containing glasses. The d.c conductivity exhibits Arrhenius behaviour and increases with V{sub 2}O{sub 5} concentration. Analysis of the results is interpreted in view Austin-Mott’s small polaron model of electron transport. Activation energies calculated using regression analysis exhibit composition dependent trend and the variation is explained in view of the structure of lead-vanadate glass.
Martin, Steve W; Bischoff, Christian; Schuller, Katherine
2015-12-24
A negative mixed glass former effect (MGFE) in the Na(+) ion conductivity of glass has been found in 0.5Na2S + 0.5[xGeS2 + (1 - x)PS5/2] glasses where the Na(+) ion conductivity is significantly smaller for all of the ternary glasses than either of the binary end-member glasses. The minimum conductivity of ∼0.4 × 10(-6) (Ω cm)(-1) at 25 °C occurs for the x = 0.7 glass. Prior to this observation, the alkali ion conductivity of sulfide glasses at constant alkali concentration, but variable ratio of one glass former for another (x) ternary mixed glass former (MGF) glasses, has always produced a positive MGFE in the alkali ion conductivity; that is, the ternary glasses have always had higher ion conductivities that either of the end-member binary glasses. While the Na(+) ion conductivity exhibits a single global minimum value, the conductivity activation energy exhibits a bimodal double maximum at x ≈ 0.4 and x ≈ 0.7. The modified Christensen-Martin-Anderson-Stuart (CMAS) model of the activation energies reveals the origin of the negative MGFE to be due to an increase in the dielectric stiffness (a decrease in relative dielectric permittivity) of these glasses. When coupled with an increase in the average Na(+) ion jump distance and a slight increase in the mechanical stiffness of the glass, this causes the activation energy to go through maximum values and thereby produce the negative MGFE. The double maximum in the conductivity activation energy is coincident with double maximums in CMAS calculated strain, ΔES, and Coulombic, ΔEC, activation energies. In these ternary glasses, the increase in the dielectric stiffness of the glass arises from a negative deviation of the limiting high frequency dielectric permittivity as compared to the binary end-member glasses. While the CMAS calculated total activation energies ΔEact = ΔES + ΔEC are found to reproduce the overall shape of the composition dependence of the measured ΔEact values, they are consistently
Electronic Conductivity of Vanadium-Tellurite Glass-Ceramics
DEFF Research Database (Denmark)
Kjeldsen, Jonas; Yue, Yuanzheng; Bragatto, Caio B.
2013-01-01
In this paper, we investigate the electronic conductivity of 2TeO2-V2O5 glass-ceramics with crystallinity ranging from 0 to 100 wt.%, i.e., from entirely amorphous to completely crystalline. The glass is prepared by the melt quenching technique, and the crystal is prepared by subsequent heat...... spectroscopy. We find similar activation energies for both glass and crystal, implying that they have similar conduction mechanisms, i.e., thermally activated hopping. The electronic conductivity of 2TeO2-V2O5 glass is about one order of magnitude higher than that of the corresponding crystal......, and a percolation phenomenon occurs at a glass fraction of 61 wt.%, increasing from a lower conductivity in the crystal to a higher conductivity in the glass. We explain the behavior of electronic conduction in the 2TeO2-V2O5 glass-ceramics by considering constriction effects between particles as well...
Low expansion and high gain Nd laser glasses
International Nuclear Information System (INIS)
Izumitani, Tetsuro; Peng, B.
1995-01-01
Due to the relationship between Judd-Ofelt intensity parameter and covalency, new laser glasses have been developed which have low expansion coefficients (85--91 x 10 -7 /cm C, 0--70 C) and high emission cross sections. They have good chemical properties, high Young's modulus and high thermal conductivities. These glasses are suitable for the National Ignition Facility
Color centers of a borosilicate glass induced by 10 MeV proton, 1.85 MeV electron and 60Co-γ ray
International Nuclear Information System (INIS)
Du, Jishi; Wu, Jiehua; Zhao, Lili; Song, Lixin
2013-01-01
Optical absorption spectra, electron paramagnetic resonance (EPR) spectra, Raman spectra of a borosilicate glass after irradiation by 10 MeV proton, 1.85 MeV electron and 60 Co-γ ray were studied. The process of irradiation inducing color centers in the glass was discussed. The band gap of the glass before and after 60 Co-γ ray irradiation was studied using Mott and Davis's theory, and it was found that calculated change of the band gap introduced a paradox, because Mott and Davis's theory on the band gap cannot be adopted in the study on the irradiated glass. - Highlights: ► All the three types of irradiation induce the same types of color centers. ► Calculated change of the band gap introduced a paradox. ► Mott and Davis's theory on band gap cannot be adopted in the irradiated glass
Energy Technology Data Exchange (ETDEWEB)
El-Desoky, M.M., E-mail: mmdesoky@gmail.com [Department of Physics, Faculty of Education, Suez Canal University, Al-Arish 45511, North Sinaa (Egypt); Ibrahim, F.A. [Department of Physics, Faculty of Education, Suez Canal University, Al-Arish 45511, North Sinaa (Egypt); Mostafa, A.G.; Hassaan, M.Y. [Department of Physics, Faculty of Science, Al-Azhar University, Nasr City 11884, Cairo (Egypt)
2010-09-15
Selected glasses of Fe{sub 2}O{sub 3}-PbO{sub 2}-Bi{sub 2}O{sub 3} system have been transformed into nanomaterials by annealing at temperature close to crystallization temperature (T{sub c}) for 1 h. The effects of the annealing of the present samples on its structural and electrical properties were studied by Moessbauer spectroscopy, transmission electron micrograph (TEM), differential scanning calorimeter (DSC) and dc conductivity ({sigma}). Moessbauer spectroscopy was used in order to determine the states of iron and its hyperfine structure. The effect of nanocrystalization on the Moessbauer hyperfine parameters did not exhibit significant modifications in present glasses. However, in case of glass ceramic nanocrystals show a distinct decrease in the quadrupole splitting ({Delta}) is observed, reflecting an evident decrease in the distortion of structural units like FeO{sub 4} units. In general, the Moessbauer parameters of the nano-crystalline phase exhibit tendency to increase with PbO{sub 2} content. TEM of as-quenched glasses confirm the homogeneous and essentially featureless morphology. TEM of the corresponding glass ceramic nanocrystals indicates nanocrystals embedded in the glassy matrix with average particle size of about 32 nm. The crystallization temperature (T{sub c}) was observed to decrease with PbO{sub 2} content. The glass ceramic nanocrystals obtained by annealing at T{sub c} exhibit improvement of electrical conductivity up to four orders of magnitude than the starting glasses. This considerable improvement of electrical conductivity after nanocrystallization is attributed to formation of defective, well-conducting phases 'easy conduction paths' along the glass-crystallites interfaces.
Na, Min Young; Park, Sung Hyun; Kim, Kang Cheol; Kim, Won Tae; Kim, Do Hyang
2018-05-01
Both thermoplastic formability and electrical conductivity of Al-Ni-Y metallic glass with 12 different compositions have been investigated in the present study with an aim to apply as a functional material, i.e. as a binder of Ag powders in Ag paste for silicon solar cell. The thermoplastic formability is basically influenced by thermal stability and fragility of supercooled liquid which can be reflected by the temperature range for the supercooled liquid region (ΔT x ) and the difference in specific heat between the frozen glass state and the supercooled liquid state (ΔC p ). The measured ΔT x and ΔC p values show a strong composition dependence. However, the composition showing the highest ΔT x and ΔC p does not correspond to the composition with the highest amount of Ni and Y. It is considered that higher ΔT x and ΔC p may be related to enhancement of icosahedral SRO near T g during cooling. On the other hand, electrical resistivity varies with the change of Al contents as well as with the change of the volume fraction of each phase after crystallization. The composition range with the optimum combination of thermoplastic formability and electrical conductivity in Al-Ni-Y system located inside the composition triangle whose vertices compositions are Al87Ni3Y10, Al85Ni5Y10, and Al86Ni5Y9.
Ionic conductivities of lithium phosphorus oxynitride glasses, polycrystals, and thin films
International Nuclear Information System (INIS)
Wang, B.; Bates, J.B.; Chakoumakos, B.C.; Sales, B.C.; Kwak, B.S.; Zuhr, R.A.; Robertson, J.D.
1994-11-01
Various lithium phosphorus oxynitrides have been prepared in the form of glasses, polycrystals, and thin films. The structures of these compounds were investigated by X-ray and neutron diffraction, X-ray photoelectron spectroscopy (XPS), and high-performance liquid chromatography (HPLC). The ac impedance measurements indicate a significant improvement of ionic conductivity as the result of incorporation of nitrogen into the structure. In the case of polycrystalline Li 2.88 PO 3.73 N 0.14 with the γ-Li 3 PO 4 structure, the conductivity increased by several orders of magnitude on small addition of nitrogen. The highest conductivities in the bulk glasses and thin films were found to be 3.0 x 10 -7 and 8.9 x 10 -7 S·cm -1 at 25 degrees C, respectively
Energy Technology Data Exchange (ETDEWEB)
El-Desoky, M.M., E-mail: mmdesoky@gmail.co [Physics Department, Faculty of Education, Suez Canal University, El-Arish (Egypt); Zayed, H.S.S.; Ibrahim, F.A.; Ragab, H.S. [Physics Department, Faculty of Education, Suez Canal University, El-Arish (Egypt)
2009-11-15
The structural and electrical conductivity (sigma) of annealed SrTiO{sub 3}-PbO{sub 2}-V{sub 2}O{sub 5} glasses were studied. The annealing of initially glass samples leads to formation of nanocrystalline grains embedded in the glassy matrix. XRD patterns of the glass-ceramic samples show that nanocrystals were embedded in the glassy matrix with an average grain size of 32 nm. The glass-ceramic nanocrystals obtained by annealing at temperatures close to the crystallization temperature T{sub c} exhibit enhancement of electrical conductivity up to four orders of magnitude than initially glasses. The enhancement of the electrical conductivity due to annealing was attributed to two interdependent factors: (i) an increase of concentration of V{sup 4+}-V{sup 5+} pairs; and (ii) formation of defective, well-conducting regions along the glass-crystallites interfaces. From the conductivity temperature relation, it was found that small polaron hopping model was applicable at temperature above theta{sub D}/2 (theta{sub D}, the Debye temperature). The electrical conduction at T >theta{sub D}/2 was due to non-adiabatic small polaron hopping (SPH) of electrons between vanadium ions. The parameters obtained from the fits of the experimental data to this model appear reasonable and are consistent with glass composition.
International Nuclear Information System (INIS)
El-Desoky, M.M.; Zayed, H.S.S.; Ibrahim, F.A.; Ragab, H.S.
2009-01-01
The structural and electrical conductivity (σ) of annealed SrTiO 3 -PbO 2 -V 2 O 5 glasses were studied. The annealing of initially glass samples leads to formation of nanocrystalline grains embedded in the glassy matrix. XRD patterns of the glass-ceramic samples show that nanocrystals were embedded in the glassy matrix with an average grain size of 32 nm. The glass-ceramic nanocrystals obtained by annealing at temperatures close to the crystallization temperature T c exhibit enhancement of electrical conductivity up to four orders of magnitude than initially glasses. The enhancement of the electrical conductivity due to annealing was attributed to two interdependent factors: (i) an increase of concentration of V 4+ -V 5+ pairs; and (ii) formation of defective, well-conducting regions along the glass-crystallites interfaces. From the conductivity temperature relation, it was found that small polaron hopping model was applicable at temperature above θ D /2 (θ D , the Debye temperature). The electrical conduction at T >θ D /2 was due to non-adiabatic small polaron hopping (SPH) of electrons between vanadium ions. The parameters obtained from the fits of the experimental data to this model appear reasonable and are consistent with glass composition.
Ionic conductivities of lithium phosphorus oxynitride glasses, polycrystals, and thin films
Energy Technology Data Exchange (ETDEWEB)
Wang, B.; Bates, J.B.; Chakoumakos, B.C.; Sales, B.C.; Kwak, B.S.; Zuhr, R.A. [Oak Ridge National Lab., TN (United States); Robertson, J.D. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Chemistry
1994-11-01
Various lithium phosphorus oxynitrides have been prepared in the form of glasses, polycrystals, and thin films. The structures of these compounds were investigated by X-ray and neutron diffraction, X-ray photoelectron spectroscopy (XPS), and high-performance liquid chromatography (HPLC). The ac impedance measurements indicate a significant improvement of ionic conductivity as the result of incorporation of nitrogen into the structure. In the case of polycrystalline Li{sub 2.88}PO{sub 3.73}N{sub 0.14} with the {gamma}-Li{sub 3}PO{sub 4} structure, the conductivity increased by several orders of magnitude on small addition of nitrogen. The highest conductivities in the bulk glasses and thin films were found to be 3.0 {times} 10{sup -7} and 8.9 {times} 10{sup -7} S{center_dot}cm{sup -1} at 25{degrees}C, respectively.
Densification of MgSiO3 glass with pressure and temperature
DEFF Research Database (Denmark)
Yamada, A; Gaudio, Sarah; Lesher, Charles
2010-01-01
The density and structure of MgSiO3 glass (v-En) recovered from a series of annealing experiments up to 1000°C at 2.0, 5.5 and 8.5 GPa have been investigated using Archimedes' method and Raman spectroscopy, respectively. The densities of recovered glasses are found to be a complex function...... of pressure and temperature. At room temperature, compression up to 8.5 GPa, followed by decompression, yields a glass with a density within 0.6 % of the 1-atm value. Likewise, the 1-atm density is fully recovered in glass heated up to ~500°C at 2.0 GPa at higher pressures. A sharp increase in recovered...... density is observed between 500°C and 800°C at 2.0 GPa, 200°C and 500°C at 5.5 GPa and from room-T and 300°C at 8.5 GPa. At higher annealing temperatures the changes in density are more modest. This break in slope occurs for a glass density of 2.89 g/cm3 at 2.0 GPa and 2.95 g/cm3 at 5.5 and 8.5 GPa. Above...
AC Conductivity and Dielectric Properties of Borotellurite Glass
Taha, T. A.; Azab, A. A.
2016-10-01
Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.
Energy Technology Data Exchange (ETDEWEB)
Hassaan, M.Y., E-mail: myhassaan@yahoo.com [Al-Azhar University, Faculty of Science, Physics Department, 11884 Cairo (Egypt); Ebrahim, F.M.; Mostafa, A.G. [Al-Azhar University, Faculty of Science, Physics Department, 11884 Cairo (Egypt); El-Desoky, M.M., E-mail: mmdesoky@gmail.com [Suez Canal University, Faculty of Science, Physics Department, Suez (Egypt)
2011-09-15
Highlights: {yields} Selected glasses of V{sub 2}O{sub 5}-BaO-5Fe{sub 2}O{sub 3} system have been transformed into nanomaterials by annealing at temperature close to crystallization temperature (T{sub c}) for 1 h. {yields} Glass ceramic nanocrystals are important because of their physical properties which are not obtainable in other classes of materials. {yields} Crystal and grain sizes are the most significant structural parameters in electronic nanocrystalline glassy phases. {yields} These phases have very high electrical conductivity, hence glass-ceramic nanocrystals are expected to be used, for example, as a gas sensor. - Abstract: Six glass samples with a composition of 75V{sub 2}O{sub 5} + 10BaO + 15Fe{sub 2}O{sub 3} mol%, with 0, 10, 15, 20, and 25 wt% of sulfur were prepared by using a quenching method. The samples were measured by XRD, DSC, TEM, Moessbauer spectrometry and D.C. conductivity. The prepared samples were heat treated at temperature close to their crystallization temperatures for 1 h, and then the previous measurements were repeated. The results showed that the treatment process caused the formation of V{sub 2}O{sub 5} and FeVO{sub 4} nanocrystals with size of 17-25 nm dispersed in the glass matrix. The addition of sulfur reduced only the vanadium ions to V{sup 4+}, while it was found that iron ions were Fe{sup 3+} only. D.C. conduction enhanced due to the small polaron or electron hopping from V{sup 4+} to V{sup 5+} ions. The heat treated samples exhibit much higher conductivity and much lower activation energy than the as-prepared glasses. The heat treated samples showed decreased thermal stability with the addition of sulfur. This considerable enhancement of electrical conductivity after nanocrystallization referred to the formation of extensive and dense network of electronic conduction paths which are situated between V{sub 2}O{sub 5} nanocrystals and their surfaces.
Hanaya, Minoru; Nakayama, Michiko; Hatate, Atsuo; Oguni, Masaharu
1995-08-01
Heat capacities and ac conductivities of AgI-based fast ion conducting glasses of AgI-Ag2O-P2O5 and AgI-Ag2O-B2O3 systems with different P-O or B-O network structures but with the same AgI concentration of 1.55×104 mol m-3 were measured in the temperature range 14-400 K and in the temperature and frequency ranges 100-200 K and 10 Hz-1 MHz, respectively. The β-glass transition due to a freezing-in of the rearrangement of Ag+ ions was observed by adiabatic calorimetry for the glasses in the liquid-nitrogen temperature region, and the conductometry was suggested to see the same mode of Ag+-ion motion as the calorimetry. It was found that the development of the network structure of the glass former at constant AgI concentration resulted in the decrease of the β-glass transition temperature and the activation energy for the diffusional motion of Ag+ ions and in the increase of the heat-capacity jump associated with the glass transition. The results support the amorphous AgI aggregate model for the structure of the conductive region in the glasses with relatively high AgI compositions, indicating that Ag+-ion conductivity is mainly dominated by the degree of development of the AgI aggregate region dependent on the glass-former network structure as well as the AgI composition.
Mixed conductivity studies in silver oxide based barium vanado-tellurite glasses
International Nuclear Information System (INIS)
Pant, Meenakshi; Kanchan, D.K.; Sharma, Poonam; Jayswal, Manish S.
2008-01-01
The dc conductivity and frequency dependent ac conductivity of the quaternary glass system x(BaO:1.5 Ag 2 O)-(95 - x)V 2 O 5 -5TeO 2 , are reported in the frequency range 1 Hz to 32 MHz in the temperature range from room temperature to 433 K. The dc conductivity measured in high temperature range increased with transition metal oxide content while the activation range decreased. The conductivity arises mainly from polaron hopping between V 4+ and V 5+ ions. High temperature conductivity data satisfy Mott's small polaron hopping model. It is found that a mechanism of non-adiabatic hopping is the most appropriate conduction model for these glasses. A power law behavior σ(ω) = σ dc + Aω n (with 0 < n < 1) is well exhibited by the ac conductivity data of the glasses. The activation energy calculated from both the relaxation time and dc conductivity is found to be nearly same in both the cases. A scaling of the conductivity spectra with respect to temperature and composition is attempted and it is observed that the relaxation dynamics of charge carriers in the present glasses is independent of temperature and composition
International Nuclear Information System (INIS)
Elalaily, N.A.; Khalil, Magda M.I.; Ahmed, L.S.
2007-01-01
The effect of electric field strength on conduction in soda lime silicate glass doped with blast furnace slag with different concentration was studied and the value of jump distance was calculated. The structure and the mixed anion effect in the conductivity have been examined by measuring the electrical conductivity of glass samples at temperature ranging between 20 and 250 deg. C. The results showed that the electrical conductivity of the examined glasses are divided into three ranges depending on the temperature range. The first is from room temperature to about 49.5 deg. C, the second is at a temperature range of 60.3-104 deg. C where the glass shows a decrease in its conductivity with the increase in temperature. This was followed by another increase in the electrical conductivity with the increase in temperature. The results also showed that the glass becomes more insulating as the slag content increased. The effect of irradiation was also studied by exposing glass samples to two different irradiation doses. It can be noticed that irradiation causes an increase in the electrical conductivity, especially at high temperature. The results were discussed and correlated according to the molecular structure of the prepared glass
Conduction mechanism in bismuth silicate glasses containing titanium
International Nuclear Information System (INIS)
Dult, Meenakshi; Kundu, R.S.; Murugavel, S.; Punia, R.; Kishore, N.
2014-01-01
Bismuth silicate glasses mixed with different concentrations of titanium dioxide having compositions xTiO 2 –(60−x)Bi 2 O 3 –40SiO 2 with x=0, 5, 10, 15 and 20 were prepared by the normal melt quench technique. The frequency dependence of the ac electrical conductivity of different compositions of titanium bismuth silicate glasses has been studied in the frequency range 10 −1 Hz to 10 MHz and in the temperature range 623–703 K. The temperature and frequency dependent conductivity is found to obey Jonscher's universal power law for all the compositions of titanium bismuth silicate glass system. The dc conductivity (σ dc ), so called crossover frequency (ω H ), and frequency exponent (s) have been estimated from the fitting of experimental data of ac conductivity with Jonscher's universal power law. Enthalpy to dissociate the cation from its original site next to a charge compensating center (H f ) and enthalpy of migration (H m ) have also been estimated. The conductivity data have been analyzed in terms of different theoretical models to determine the possible conduction mechanism. Analysis of the conductivity data and the frequency exponent shows that the correlated barrier hopping of electrons between Ti 3+ and Ti 4+ ions in the glasses is the most favorable mechanism for ac conduction. The temperature dependent dc conductivity has been analyzed in the framework of theoretical variable range hopping model (VRH) proposed by Mott which describe the hopping conduction in disordered semiconducting systems. The various polaron hopping parameters have also been deduced. Mott's VRH model is found to be in good agreement with experimental data and the values of inverse localization length of s-like wave function (α) obtained by this model with modifications suggested by Punia et al. are close to the ones reported for a number of oxide glasses
Energy Technology Data Exchange (ETDEWEB)
Midouni, Adnene [Useful Materials Valorization Laboratory, National Centre of Research in Materials Science, Technologic Park of Borj Cedria, B.P. 73, 8027 Soliman (Tunisia); Université de Tunis El Manar, Campus Universitaire Farhat Hached, B.P. No 94- Rommana, 1068 Tunis (Tunisia); Houchati, Mohamed Ikbal, E-mail: ikb_med@yahoo.fr [Useful Materials Valorization Laboratory, National Centre of Research in Materials Science, Technologic Park of Borj Cedria, B.P. 73, 8027 Soliman (Tunisia); Unité de Recherche Catalyse et Matériaux pour l’Environnement et les Procédés URCMEP (UR11ES85), Faculté des Sciences de Gabès/Université de Gabès, Campus Universitaire Cité Erriadh, Gabès 6072 (Tunisia); Othman, Walid Belhaj [Laboratoire de Physico-Chimie des Matériaux Minéraux et leurs Applications, CNRSM, Technopole de Borj Cedria, B.P. 95, Hammam-Lif 2050 (Tunisia); Chniba-Boudjada, Nassira [Laboratoire de Cristallographie, CNRS, 25 Avenue des Martyrs, BP 166, 3804 Grenoble Cedex 9 (France); Ceretti, Monica; Paulus, Werner [Institut de Chimie Moléculaire et des Matériaux – UMR 5253 – ICG C2M: Chimie et Cristallochimie des Matériaux, Université de Montpellier 2, Case courrier 01504 Place Eugène Bataillon, Bat 15, F-34095 Montpellier cedex 5 (France); and others
2016-08-15
The results of the synthesis and characterization of the optimally doped La{sub 1.85}Ca{sub 0.15}(Cu{sub 1−x}Ni{sub x})O{sub 4-δ} solid solution with x = 0, 0.1, 0.2 and 0.3 are reported. The versatility of these La{sub 1.85}Ca{sub 0.15}(Cu{sub 1−x}Ni{sub x})O{sub 4−δ} materials is explained on the basis of structural features and the ability to accommodate oxygen nonstoichiometry. According to powder X-ray and neutron diffraction data, La{sub 1.85}Ca{sub 0.15}(Cu{sub 1−x}Ni{sub x})O{sub 4−δ} adopts the tetragonal structure with oxygen vacancies occurring preferentially at the O{sub ap} sites within the {(La/Ca)O} layers of the perovskite blocks and the oxygen deviation from stoichiometry δ was found to be δ=0.0905(6). The bulk conductivity indicated an Arrhenius-type thermally activated process and oxygen vacancies are the possible ionic charge carriers at T=270 °C. An increase of the conductivity was detected when Ni was introduced. With nickel ratio variation, a strong correlation was observed between the Cu(Ni)-O{sub ap} apical bond length variation and the conductivity variation through controlling the O{sup 2−} ion migration. - Highlights: • We report the synthesis and structure of the La{sub 1.85}Ca{sub 0.15}(Cu{sub 1−x}Ni{sub x})O{sub 4−δ} (0≤x≤0.3; δ=0.0905) compounds. • La{sub 1.85}Ca{sub 0.15}(Cu{sub 1−x}Ni{sub x})O{sub 4−δ} (x=0.0, 0.2, 0.3) doped with Ni{sup 2+} have a higher conductivity than undoped La{sub 1.85}Ca{sub 0.15}CuO{sub 4−δ}. • At T=270 °C, sample x=0.3 has the highest conductivity (0.2915 sm{sup −1}).
The electronic conduction of glass and glass ceramics containing various transition metal oxides
International Nuclear Information System (INIS)
Yoshida, T.; Matsuno, Y.
1980-01-01
Nb 2 O 5 -V 2 O 5 -P 2 O 5 glasses containing only Group Va oxides have been investigated to elucidate their electronic conduction and structure, as compared with other glasses obtained by the addition of various transition metal oxides to vanadium phosphate. The P 2 O 5 introduction for Nb 2 O 5 in this glass with the same amount of V 2 O 5 increased the conductivity about two times. Glass ceramics having high conductivity increased by two orders of magnitude and the activation energy for conduction decreased from about 0.5 to 0.2 eV. The crystals were confirmed to be (V,Nb) 2 O 5 and Nb phosphate, one of which was highly conductive and developed a pillar-like shape with a length of more than 20 μm. (orig.)
Ion conductivities of ZrF4-BaF2-CsF glasses
International Nuclear Information System (INIS)
Kawamoto, Yoji; Nohara, Ichiro
1987-01-01
The glass-forming region in the ZrF 4 -BaF 2 -CsF glass system has been determined and the ac conductivity and the transport number of fluoride ions have been measured. The conductivities of compounds β-Cs 2 ZrF 6 , α-SrZrF 6 , α-BaZrF 6 , β-BaZrF 6 and α-PbZrF 6 have also been measured. These results and a previous study of ZrF 4 -BaF 2 -MF n (M: the groups I-IV metals) glasses revealed the following: (1) the ZrF 4 -BaF 2 -CsF glasses are exclusively fluoride-ion conductors; (2) the ionic conductivities of ZrF 4 -based glasses are predominantly determined by the activation energies for conduction; (3) the activation energy for conduction decreases with an increase in the average polarizability of glass-constituting cations; (4) a decrease in average Zr-F bond length and a lowering of the average F coordination number of Zr are presumed to increase the activation energy for conduction. Principles of developing ZrF 4 -based glasses with higher conductivities have also been proposed. (Auth.)
A nonconjugated radical polymer glass with high electrical conductivity
Joo, Yongho; Agarkar, Varad; Sung, Seung Hyun; Savoie, Brett M.; Boudouris, Bryan W.
2018-03-01
Solid-state conducting polymers usually have highly conjugated macromolecular backbones and require intentional doping in order to achieve high electrical conductivities. Conversely, single-component, charge-neutral macromolecules could be synthetically simpler and have improved processibility and ambient stability. We show that poly(4-glycidyloxy-2,2,6,6-tetramethylpiperidine-1-oxyl), a nonconjugated radical polymer with a subambient glass transition temperature, underwent rapid solid-state charge transfer reactions and had an electrical conductivity of up to 28 siemens per meter over channel lengths up to 0.6 micrometers. The charge transport through the radical polymer film was enabled with thermal annealing at 80°C, which allowed for the formation of a percolating network of open-shell sites in electronic communication with one another. The electrical conductivity was not enhanced by intentional doping, and thin films of this material showed high optical transparency.
High electric field conduction in low-alkali boroaluminosilicate glass
Dash, Priyanka; Yuan, Mengxue; Gao, Jun; Furman, Eugene; Lanagan, Michael T.
2018-02-01
Electrical conduction in silica-based glasses under a low electric field is dominated by high mobility ions such as sodium, and there is a transition from ionic transport to electronic transport as the electric field exceeds 108 V/m at low temperatures. Electrical conduction under a high electric field was investigated in thin low-alkali boroaluminosilicate glass samples, showing nonlinear conduction with the current density scaling approximately with E1/2, where E is the electric field. In addition, thermally stimulated depolarization current (TSDC) characterization was carried out on room-temperature electrically poled glass samples, and an anomalous discharging current flowing in the same direction as the charging current was observed. High electric field conduction and TSDC results led to the conclusion that Poole-Frenkel based electronic transport occurs in the mobile-cation-depleted region adjacent to the anode, and accounts for the observed anomalous current.
Ion-conductivity of thin film Li-Borate glasses
International Nuclear Information System (INIS)
Abouzari, M.R.S.
2007-01-01
In this thesis, the specific conductivity of ion-sputtered lithium borate thin films is studied. To this end, lithium borate glasses of the composition yLi 2 O.(1-y)B 2 O 3 with y=0.15, 0.20, 0.25, and 0.35 were produced as sputter targets. Films with thicknesses between 7 nm and 700 nm are deposited on silicon substrate between two AlLi electrodes. Conductivity spectra have been taken over a frequency range of 5 Hz to 2 MHz. The measurements were performed at different temperatures between 40 C and 350 C depending on the thickness and the composition of the films. The following results are derived by studying the conductivities of the films: i) The specific dc conductivity of layers with thicknesses larger than 150 nm is independent of their thicknesses; we call these layers 'thick films' and consider their conductivity as the 'base conductivity'. ii) The specific dc conductivity of layers with thicknesses smaller than 150 nm, called 'thin films', depends on the layer thickness. A nontrivial enhancement of the specific dc conductivity about three orders of magnitude for y=0.15, 0.2, and 0.25 is observed. iii) The base conductivity depends on y and at 120 C it varies between 4 x 10 -10 Ω -1 cm -1 and 2.5 x 10 -6 Ω -1 cm -1 when y varies between 0.15 and 0.35, whereas the maximum value of the specific dc conductivity of extremely thin films (with a thickness of some nanometre) seems to be independent of y and equals to the specific dc conductivity of layers with y= 0.35. Furthermore, we found in this work a physical interpretation of the so-called 'Constant Phase Element' (CPE) which is widely used in equivalent circuits for ionic conductors. This element describes correctly the depressed impedance semicircles observed in impedance spectroscopy. So far, this effect is sometimes attributed to the surface roughness. We have shown not only the invalidity of this approach, but we have also found that the depression arises from the nature of ionic motions. The model
International Nuclear Information System (INIS)
Jayaseelan, S.; Muralidharan, P.; Venkateswarlu, M.; Satyanarayana, N.
2005-01-01
Silverarsenotellurite (SAT), silverphosphotellurite (SPT) and silvervanadotellurite (SVT) quaternary glass systems were prepared with various formers compositions by a melt quenching method. Glass nature, glass transition temperature (T g ) and structure of the prepared glasses were identified respectively by X-ray diffraction (XRD), differential scanning calorimetric (DSC) and Fourier transform infrared (FT-IR) technique. Electrical conductivity studies were carried out by impedance measurement in the frequency range 40 Hz to 100 KHz at different temperatures for all three sets of AgI-Ag 2 O-[TeO 2 -M 2 O 5 ] (M 2 O 5 = As 2 O 5 , P 2 O 5 , V 2 O 5 ) glasses. The high conducting compositions of SAT, SPT and SVT glass samples were fixed from the results of total conductivity (σ t ). Electronic conductivity (σ e ) studies were made on high conducting composition of each glass system by Wagner's polarization method. Total current (i t ) is due to ion and electron. Electronic current (i e ) due to electron were estimated through mobility studies. Ionic conductivity (σ i ) and ionic current (i i ) were calculated respectively using the conductivity (σ t and σ e ) and current (i t and i e ) results for the SAT, SPT and SVT glasses. Transport numbers due to ion (t i ) and electron (t e ) were calculated using the conductivity and mobility results for each glass system. The high conducting composition of the SAT, SPT and SVT glasses were used as solid electrolytes with silver metal as an anode and iodine:graphite (I:C) as a cathode for the fabrication of solid state batteries (SSBs). All the fabricated batteries were characterized by measuring the open circuit voltage (OCV) and polarization properties and estimated the batteries performances
International Nuclear Information System (INIS)
Dehariya, Harsha; Kumar, R; Polu, A R
2012-01-01
The idea to explore new 'Superionic Electrolytes', 'Fast ionic conductors' is due to their tremendous potential applications in solid state electrochemical devices viz. solid state batteries, fuel cells, sensors, super capacitors. Superionic glasses have attracted great deal of attention due to their several advantageous over their crystalline counterparts such as high ionic conductivity, easy preparation, wide selection of compositions, isotropic properties and high stability etc [4-7]. Large numbers of silver ion based glasses have been reported in the literature for the glassy system of AgI:Ag2O: MxOy (MxOy = B2O3, SiO2, P2O5, GeO2, V2O5, As2O5, CrO3, SeO2, MoO3 and TeO3 etc many of them shows high silver ion conductivity [8]. Ion transport behavior of Silver Boro Tungstate glass system x[0.75AgI:0.25AgCl]: (1-x) [Ag2O(B2O3:WO3)], where 0 ≤ x ≤ 1 in molar wt% prepared by melt quench technique were reported. The new host [0.75AgI:0.25AgCl] was used as a better alternate in place of conventional host salt AgI. Conductivity measurement were carried out on this glass system as a function of frequency from 50 Hz to 5 MHz, over a temperature range of 27 C to 200 C, for different compositions by Impedance spectroscopy. The composition 0.7[0.75AgI:0.25AgCl]: 0.3[Ag2O(B2O3:WO3)] shows the highest conductivity of the order of σrt ∼ 2.76x10-2 S/cm, referred to as the Optimum Conducting Composition (OCC). The enhancement in the conductivity has been obtained by mixed former effect. XRD result shows that the system is completely amorphous. Temperature dependence of conductivity of all compositions were studied and reported. Activation energies (Ea) were also evaluated from the slope of .Log(σ) vs 1000/T, Arrhenius plots.
Dehariya, Harsha; Kumar, R.; Polu, A. R.
2012-05-01
The idea to explore new 'Superionic Electrolytes', "Fast ionic conductors" is due to their tremendous potential applications in solid state electrochemical devices viz. solid state batteries, fuel cells, sensors, super capacitors. Superionic glasses have attracted great deal of attention due to their several advantageous over their crystalline counterparts such as high ionic conductivity, easy preparation, wide selection of compositions, isotropic properties and high stability etc [4-7]. Large numbers of silver ion based glasses have been reported in the literature for the glassy system of AgI:Ag2O: MxOy (MxOy = B2O3, SiO2, P2O5, GeO2, V2O5, As2O5, CrO3, SeO2, MoO3 & TeO3 etc many of them shows high silver ion conductivity [8]. Ion transport behavior of Silver Boro Tungstate glass system x[0.75AgI:0.25AgCl]: (1-x) [Ag2O{B2O3:WO3}], where 0 <= x <= 1 in molar wt% prepared by melt quench technique were reported. The new host [0.75AgI:0.25AgCl] was used as a better alternate in place of conventional host salt AgI. Conductivity measurement were carried out on this glass system as a function of frequency from 50 Hz to 5 MHz, over a temperature range of 27°C to 200°C, for different compositions by Impedance spectroscopy. The composition 0.7[0.75AgI:0.25AgCl]: 0.3[Ag2O{B2O3:WO3}] shows the highest conductivity of the order of σrt ~ 2.76 × 10-2 S/cm, referred to as the Optimum Conducting Composition (OCC). The enhancement in the conductivity has been obtained by mixed former effect. XRD result shows that the system is completely amorphous. Temperature dependence of conductivity of all compositions were studied & reported. Activation energies (Ea) were also evaluated from the slope of .Log(σ) vs 1000/T, Arrhenius plots.
DEFF Research Database (Denmark)
Østergaard, Martin Bonderup; Petersen, Rasmus Rosenlund; König, Jakob
2017-01-01
The understanding of the thermal transport mechanism of foam glass is still lacking. The contribution of solid- and gas conduction to the total thermal conductivity remains to be reported. In many foam glasses, the solid phase consist of a mix of an amorphous and a crystalline part where foaming...... containing glass and crystalline foaming agents and amorphous samples where the foaming agents are completely dissolved in the glass structure, respectively. Results show that the samples prepared by sintering have a higher thermal conductivity than the samples prepared by melt-quenching. The thermal...... conductivities of the sintered and the melt-quenched samples represent an upper and lower limit of the solid phase thermal conductivity of foam glasses prepared with these foaming agents. The content of foaming agents dissolved in the glass structure has a major impact on the solid thermal conductivity of foam...
International Nuclear Information System (INIS)
Bakel, A.J.; Ebert, W.L.; Strachan, D.M.
1996-01-01
The corrosion behavior of a borosilicate glass containing 20 mass 5 Na 2 O was assessed using static dissolution tests. This glass (LD6-5412) is representative of high Na glasses that may be used to stabilize Hanford low-level radioactive waste. The normalized mass loss (NL) decreases as NL(Na) ∼ NL(B) > NL(Si) in 20 and 40 C for tests conducted at glass surface area to leachant volume (S/V) ratio of 10 m -1 , and decreases as NL(Na) > NL(B) ∼ NL(Si) in 90 C tests conducted at 10 m -1 and in all tests conducted at higher S/V. The difference in the corrosion behavior is probably caused by the influence of dissolved glass components in the leachates. The NL(Na) is greater than the NL(B) or NL(Si) in all the tests conducted. Results from long-term tests at 2,000 m -1 show that the preferential release of Na persists for longer than one year at all temperatures and indicate that Na is released from this glass by an ion exchange process
Comparative study of ion conducting pathways in borate glasses
International Nuclear Information System (INIS)
Hall, Andreas; Swenson, Jan; Adams, Stefan
2006-01-01
The conduction pathways in metal-halide doped silver, lithium, and sodium diborate glasses have been examined by bond valence analysis of reverse Monte Carlo (RMC) produced structural models of the glasses. Although all glass compositions have basically the same short-range structure of the boron-oxygen network, it is evident that the intermediate-range structure is strongly dependent on the type of mobile ion. The topography of the pathways and the coordination of the pathway sites differ distinctly between the three glass systems. The mobile silver ions in the AgI-doped glass tend to be mainly iodine-coordinated and travel in homogeneously distributed pathways located in salt-rich channels of the borate network. In the NaCl-doped glass, there is an inhomogeneous spatial distribution of pathways that reflects the inhomogeneous introduction of salt ions into the glass. However, since the salt clusters are not connected, no long-range conduction pathways are formed without including also oxygen-rich regions. The pathways in the LiCl-doped glass are slightly more evenly distributed compared to the NaCl-doped glass (but not as ordered as in the AgI-doped glass), and the regions of mainly oxygen-coordinated pathway sites are of higher importance for the long-range migration. In order to more accurately investigate how these differences in the intermediate-range order of the glasses affect the ionic conductivity, we have compared the realistic structure models to more or less randomized structures. An important conclusion from this comparison is that we find no evidence that a pronounced intermediate-range order in the atomic structure or in the network of conduction pathways, as in the AgI-doped glass, is beneficial for the dc conductivity
Highly Electrically Conducting Glass-Graphene Nanoplatelets Hybrid Coatings.
Garcia, E; Nistal, A; Khalifa, A; Essa, Y; Martín de la Escalera, F; Osendi, M I; Miranzo, P
2015-08-19
Hybrid coatings consisting of a heat resistant Y2O3-Al2O3-SiO2 (YAS) glass containing 2.3 wt % of graphene nanoplatelets (GNPs) were developed by flame spraying homogeneous ceramic powders-GNP granules. Around 40% of the GNPs survived the high spraying temperatures and were distributed along the splat-interfaces, forming a percolated network. These YAS-GNP coatings are potentially interesting in thermal protection systems and electromagnetic interference shields for aerospace applications; therefore silicon carbide (SiC) materials at the forefront of those applications were employed as substrates. Whereas the YAS coatings are nonconductive, the YAS-GNP coatings showed in-plane electrical conductivity (∼10(2) S·m(-1)) for which a low percolation limit (below 3.6 vol %) is inferred. Indentation tests revealed the formation of a highly damaged indentation zone showing multiple shear displacements between adjacent splats probably favored by the graphene sheets location. The indentation radial cracks typically found in brittle glass coatings are not detected in the hybrid coatings that are also more compliant.
Energy Technology Data Exchange (ETDEWEB)
El-Desoky, M.M., E-mail: mmdesoky@gmail.com [Department of Physics, Faculty of Education, Suez Canal University, Al-Arish (Egypt)
2010-02-15
The effects of the annealing of 20BaO-30V{sub 2}O{sub 5}-50Bi{sub 2}O{sub 3} glass on the structural and electrical properties were studied by scanning electron micrographs (SEM), X-ray diffraction (XRD), differential scanning calorimeter (DSC) density (d) and dc conductivity ({sigma}). The XRD and SEM observations have shown that the sample under study undergoes structural changes: from amorphous at the beginning, to partly crystalline after nanocrystallization at crystallization temperature (T{sub c}) for 1 h and to colossal crystallization after the annealing at the same temperature for 24 h. The average size of these grains after nanocrystallization at T{sub c} for 1 h was estimated to be about 25-35 nm. However, the glass heat treated at T{sub c} = 580 deg. C for 24 h the microstructure changes considerably. The nanomaterials obtained by nanocrystallization at T{sub c} for 1 h exhibit giant improvement of electrical conductivity up to four order of magnitude and better thermal stability than the as-received glass. The major role in the conductivity enhancement of this nanomaterial is played by the developed interfacial regions 'conduction tissue' between crystalline and amorphous phases, in which the concentration of V{sup 4+}-V{sup 5+} pairs responsible for electron hopping is higher than inside the glassy matrix. The annealing at T{sub c} for 24 h leads to decrease of the electronic conductivity. This phenomena lead to disappearance of the abovementioned 'conduction tissue' for electrons and substantial reduction of electronic conductivity. The high temperature (above {theta}/2) dependence of conductivity could be qualitatively explained by the small polaron hopping (SPH) model. The physical parameters obtained from the best fits of this model are found reasonable and consistent with the glass compositions.
Ion-conductivity of thin film Li-Borate glasses
Energy Technology Data Exchange (ETDEWEB)
Abouzari, M.R.S.
2007-12-17
In this thesis, the specific conductivity of ion-sputtered lithium borate thin films is studied. To this end, lithium borate glasses of the composition yLi{sub 2}O.(1-y)B{sub 2}O{sub 3} with y=0.15, 0.20, 0.25, and 0.35 were produced as sputter targets. Films with thicknesses between 7 nm and 700 nm are deposited on silicon substrate between two AlLi electrodes. Conductivity spectra have been taken over a frequency range of 5 Hz to 2 MHz. The measurements were performed at different temperatures between 40 C and 350 C depending on the thickness and the composition of the films. The following results are derived by studying the conductivities of the films: i) The specific dc conductivity of layers with thicknesses larger than 150 nm is independent of their thicknesses; we call these layers 'thick films' and consider their conductivity as the 'base conductivity'. ii) The specific dc conductivity of layers with thicknesses smaller than 150 nm, called 'thin films', depends on the layer thickness. A nontrivial enhancement of the specific dc conductivity about three orders of magnitude for y=0.15, 0.2, and 0.25 is observed. iii) The base conductivity depends on y and at 120 C it varies between 4 x 10{sup -10} {omega}{sup -1}cm{sup -1} and 2.5 x 10{sup -6} {omega}{sup -1}cm{sup -1} when y varies between 0.15 and 0.35, whereas the maximum value of the specific dc conductivity of extremely thin films (with a thickness of some nanometre) seems to be independent of y and equals to the specific dc conductivity of layers with y= 0.35. Furthermore, we found in this work a physical interpretation of the so-called 'Constant Phase Element' (CPE) which is widely used in equivalent circuits for ionic conductors. This element describes correctly the depressed impedance semicircles observed in impedance spectroscopy. So far, this effect is sometimes attributed to the surface roughness. We have shown not only the invalidity of this approach, but
Electrical Conductivity, Relaxation and the Glass Transition: A New Look at a Familiar Phenomenon
Angel, Paul W.; Cooper, Alfred R.; DeGuire, Mark R.
1996-01-01
Annealed samples from a single melt of a 10 mol% K2O-90SiO2 glass were reheated to temperatures ranging from 450 to 800 C, held isothermally for 20 min, and then quenched in either air or a silicon oil bath. The complex impedance of both the annealed and quenched samples was measured as a function of temperature from 120 to 250 C using ac impedance spectroscopy from 1 Hz to 1 MHz. The dc conductivity, sigma(sub dc), was measured from the low frequency intercept of depressed semicircle fits to the complex impedance data. When the sigma(sub dc) at 150 C was plotted against soak temperature, the results fell into three separate regions that are explained in terms of the glass structural relaxation time, tau(sub S). This sigma(sub dc) plot provides a new way to look the glass transition range, Delta T(sub r). In addition, sigma(sub dc) was measured for different soak times at 550 C, from which an average relaxation time of 7.3 min was calculated. It was found that the size and position of the Delta T(sub r) is controlled by both the soak time and cooling rate.
International Nuclear Information System (INIS)
Prasad, P.S.S.; Radhakrishna, S.
1988-01-01
The molybdo-tungstate (MoO 3 -WO 3 ) combination of glass formers with silver oxide (Ag 2 O) as glass modifier and silver iodide (AgI) as ionic conductor were prepared to study the transport and dielectric properties of 60% AgI-40% (x Ag 2 O-y(WO 3 -MoO 3 )) for x/y=0.33 to 3.0 and establish the feasibility of using these glasses as electrolytes in the fabrication and characterisation of solid state batteries and potential memory devices. The details of the preparation of glasses and methods of measurement of their capacitance, dielectric loss factor and ac conductivity in the frequency range 100 Hz - 100 kHz from 30-120 C have been reported. The electronic contribution to the total conductivity, the ionic and electronic transport numbers were determined using Wagners dc polarisation technique. The observed high ionic and low electronic conductivities were attributed to the formation of ionic clusters in the glass and the effect of mixing two glass formers. The observed total ionic conductivity and its temperature dependence was explained using Arrhenius relation σ=σ 0 /T exp(-E/RT) and the measured dielectric constant and dielectric loss were explained on the basis of Jonschers theory. The frequency dependence of dielectric constant obeys the theory based on the polarisation of ions. 25 refs.; 8 figs
Diffusion and ionic conduction in oxide glasses
International Nuclear Information System (INIS)
Mehrer, H; Imre, A W; Tanguep-Nijokep, E
2008-01-01
The ion transport properties of soda-lime silicate and alkali borate glasses have been studied with complimentary tracer diffusion and impedance spectroscopy techniques in order to investigate the ion dynamics and mixed-alkali effect (MAE). In soda-lime silicate glasses the tracer diffusivity of 22 Na alkali ions is more than six orders of magnitude faster than the diffusivity of earth alkali 45 Ca ions. This observation is attributed to a stronger binding of bivalent earth alkali ions to the glass network as compared to that of alkali ions. The conductivity of the investigated standard soda-lime silicate glasses is mostly due to the high mobility of sodium ions and a temperature independent Haven ratio of about 0.45 is obtained. For single alkali sodium-borate glasses, the Haven ratio is also temperature independent, however, it is decreases with decreasing temperature for rubidium-borate glass. The MAE was investigated for Na-Rb borate glasses and it was observed that the tracer diffusivities of 22 Na and 86 Rb ions cross, when plotted as function of the relative alkali content. This crossover occurs near the Na/(Na+Rb) ratio of the conductivity minimum due to MAE. The authors suggest that this crossover and the trend of diffusion coefficients is the key to an understanding of the MAE
Structure and DC conductivity of lead sodium ultraphosphate glasses
International Nuclear Information System (INIS)
Abid, M.; Et-tabirou, M.; Taibi, M.
2003-01-01
Glasses of (0.40-x)Na 2 O-xPbO-0.60P 2 O 5 system with (0≤x≤0.40) molar fraction have been prepared with a conventional melting procedure. Their physical, thermal and spectroscopic studies such as density, molar volume, glass transition temperature, ionic conductivity and infrared spectroscopy have been investigated. The density and thermal stability of theses glasses increase with the substitution of PbO for Na 2 O. The ionic conductivity increases substantially with increasing concentration of sodium oxide and diminishes with increasing PbO content. Fourier-transform infrared spectroscopy reveals the formation of P-O-Pb bonds in theses glasses. The formation of P-O-Pb bonds which replace P-O - ...Na + bonds is in accordance with variations of glass transition temperature (T g ), molar volume (V m ) and ionic conductivity (σ). The former bonds are the origin of the partial glass-forming ability of Pb 2+
Structure and Dynamics on Superionic Conducting Phosphate Glasses By Neutron Scattering
International Nuclear Information System (INIS)
Kartini, E.; Kennedy, S.J.; Itoh, K.; Arai, M.; Mezei, F.; Nakamura, M.
2005-01-01
Full text: A series of Neutron Diffraction and Inelastic scattering experiments have been performed on superionic conducting phosphate glasses, MX-MPO 3 (M=Ag; X=I,S) and AgI-Ag 2 S-AgPO 3 . These materials are used for solid state battery, due to high conductivity up to 10 -2 S.cm -1 at ambient temperature. The conductivity of the insulator glass AgPO 3 ∼ 10 -7 S.cm -1 . Interestingly, the structure factor S(Q) exhibits a prepeak at very low Q∼0.7 Aangstroem -1 related to the IRO ∼ 10-12 Aangstroem and the Radial Distribution Function gives an extra peak ∼ 2.8 Aangstroem -1 that corresponds to Ag-I correlation. The dynamic structure factor S(Q,ω), shows a Boson peak at low energy ∼ 2.5 meV that increases with composition and temperature. These behaviors seem to be universal for the AgI doped glasses, but the origin remains not well understood. Increasing mobility of the Ag ions, due to expansion of the phosphate network plays a dominant role on raising the ionic conductivity, prepeak and Boson peak. (authors)
Energy Technology Data Exchange (ETDEWEB)
Pietrzak, T.K.; Wasiucionek, M.; Michalski, P.P.; Kaleta, A.; Garbarczyk, J.E., E-mail: garbar@if.pw.edu.pl
2016-11-15
Glassy analogs of two important cathode materials for Li-ion cells: V{sub 2}O{sub 5} and phosphoolivine LiFePO{sub 4} were heat-treated in order to prepare nanocrystallized materials with high electronic conductivity of up to 7 × 10{sup −2} S cm{sup −1} and ca 7 × 10{sup −3} S cm{sup −1} at 25 °C, respectively. There is a clear correlation between the crystallization phenomena and the increase in the electrical conductivity for both groups of glasses. Electrochemical tests of heat-treated glasses of the V{sub 2}O{sub 5}–P{sub 2}O{sub 5} system, used as cathodes in lithium cells confirm their good gravimetric capacity and reversibility. Heat-treatment of glasses of the Li{sub 2}O–FeO–V{sub 2}O{sub 5}–P{sub 2}O{sub 5} system also leads to a high increase in the conductivity and to formation of nanocrystalline grains in the glassy matrix, evidenced by HR-TEM images. The temperature dependence of the conductivity of these materials follows the Arrhenius formula. The presented results indicate that the overall increase in conductivity in nanocrystallized materials is due to good charge transport properties of their interfacial regions.
Dielectric relaxation of glass particles with conductive nano-coatings
Energy Technology Data Exchange (ETDEWEB)
Hussain, Shahid [Applied Technologies Department, QinetiQ Limited, Cody Technology Park, Farnborough, Hampshire, GU14 0LX (United Kingdom)
2009-03-21
This research focuses on the dielectric properties of particles consisting of glass cores with nanometre conductive coatings. The effects of the core glass particle shape (sphere, flake and fibre) and size are investigated for different coating characteristics over the frequency range 0.5-18 GHz. Experimental results for the coated glass particle combinations show the existence of a dielectric loss peak. This feature is associated with interfacial relaxation between the insulating core glass particle and the nanoscale conductive coating. The relaxation mechanism provides enhanced loss that is not observed in conventional solid metal particle composites. The results are fitted to a model, which shows that the relaxation frequency increases with increasing coating conductivity and thickness, with additional parameters identified for further particle optimizations.
Energy Technology Data Exchange (ETDEWEB)
Hassaan, M. Y., E-mail: myhassaan@yahoo.com [Al-Azhar University, Physics Department, Faculty of Science (Egypt); El-Desoky, M. M. [Suez Canal University, Physics Department, Faculty of Science (Egypt); Masuda, H.; Kubuki, S. [Tokyo Metropolitan University, Department of Chemistry, Graduate School of Science and Engineering (Japan); Nishida, T. [Kinki University, Department of Biological and Environmental Chemistry, Faculty of Humanity-Oriented Science and Engineering (Japan)
2012-03-15
xLi{sub 2}O{center_dot}(20-x)Ag{sub 2}O{center_dot}20Fe{sub 2}O{sub 3}{center_dot}60P{sub 2}O{sub 5} glasses (x = 0, 5, 10, 15 and 20 mol%) and 5Ag{sub 2}O{center_dot}15Li{sub 2}O{center_dot}5V{sub 2}O{sub 5}{center_dot}15Fe{sub 2}O{sub 3}{center_dot}60P{sub 2}O{sub 5} glass were prepared by melt-quenching of the reagent mixture at 1000 Degree-Sign C. Glass transition temperature (T{sub g}) and crystallization temperature (T{sub c}) of these samples were determined by differential thermal analysis (DTA). It proved that T{sub g} increased with Li{sub 2}O content. XRD of as-quenched glasses confirmed their amorphous nature. XRD of samples heat treated for one hour at temperature near their T{sub c}, indicated nanocrystals precipitated in the glassy matrix with an average particle size of 35 nm. Moessbauer results revealed that the relative fraction of Fe{sup 2 + } was decreased with an increasing Li{sub 2}O content. The isomer shift values of Fe{sup 3 + } lie in a range of 0.38-0.45 mm s{sup - 1}, while those for Fe{sup 2 + } were 1.10-1.31 mm s{sup - 1}. Heat-treated sample of 5Ag{sub 2}O{center_dot}15Li{sub 2}O{center_dot}5V{sub 2}O{sub 5}{center_dot}15Fe{sub 2}O{sub 3}{center_dot}60P{sub 2}O{sub 5} glass exhibit an enhancement of the electrical conductivity by three orders of magnitude due to the 3d-electron (polaron) hopping from V{sup 4 + } to V{sup 5 + } in the 'vanadate glass' units.
International Nuclear Information System (INIS)
Rice, Jarrett A.; Pokorny, Richard; Schweiger, Michael J.; Hrma, Pavel R.
2014-01-01
The heat conductivity (λ) and the thermal diffusivity (a) of reacting glass batch, or melter feed, control the heat flux into and within the cold cap, a layer of reacting material floating on the pool of molten glass in an all-electric continuous waste glass melter. After previously estimating λ of melter feed at temperatures up to 680 deg C, we focus in this work on the λ(T) function at T > 680 deg C, at which the feed material becomes foamy. We used a customized experimental setup consisting of a large cylindrical crucible with an assembly of thermocouples, which monitored the evolution of the temperature field while the crucible with feed was heated at a constant rate from room temperature up to 1100°C. Approximating measured temperature profiles by polynomial functions, we used the heat transfer equation to estimate the λ(T) approximation function, which we subsequently optimized using the finite-volume method combined with least-squares analysis. The heat conductivity increased as the temperature increased until the feed began to expand into foam, at which point the conductivity dropped. It began to increase again as the foam turned into a bubble-free glass melt. We discuss the implications of this behavior for the mathematical modeling of the cold cap
Photoreduction of Carbon Dioxide to Methane Over Sb1.5Sn8.5-x Ti x O19.0 with High Conductivity.
Do, Jeong Yeon; Kwak, Byeong Sub; Kang, Misook
2018-09-01
In order to enhance the photoreduction of CO2 to CH4, a new type of photocatalyst, Sb1.5Sn8.5-xTixO19.0, with high conductivity and low bandgap was developed by partially incorporating Ti into the framework of Sb1.5Sn8.5O19.0 (antimony-doped tin oxide, ATO) using a controlled hydrothermal method. XRD and TEM analyses indicated that the Sb1.5Sn8.5-xTixO19.0 particles exhibited a tetragonal crystal structure and were approximately 20 nm in size. Furthermore, the bandgap and conductivity of these materials increased with increasing Ti content. A study of the photoreduction of CO2 with H2O revealed a remarkable increase in the generation of CH4 over the Sb1.5Sn8.5-xTixO19.0 catalysts. In particular, CH4 generation was the highest when Sb1.5Sn8.5Ti1.0O19.0 was used as the photocatalyst, and was three-fold higher than that achieved by using anatase TiO2. Photoluminescence studies showed that the enhanced photocatalytic activity of the Sb1.5Sn8.5-xTixO19.0 materials could be attributed to the interfacial transfer of photogenerated charges, which led to an effective charge separation and inhibition of the recombination of photogenerated electron-hole (e-/h+) pairs.
Andersson, Ove; Johari, G P
2016-02-14
To investigate the effects of local density fluctuations on phonon propagation in a hydrogen bonded structure, we studied the thermal conductivity κ of the crystal, liquid, and glassy states of pure glycerol as a function of the temperature, T, and the pressure, p. We find that the following: (i) κcrystal is 3.6-times the κliquid value at 140 K at 0.1 MPa and 2.2-times at 290 K, and it varies with T according to 138 × T(-0.95); (ii) the ratio κliquid (p)/κliquid (0.1 MPa) is 1.45 GPa(-1) at 280 K, which, unexpectedly, is about the same as κcrystal (p)/κcrystal (0.1 MPa) of 1.42 GPa(-1) at 298 K; (iii) κglass is relatively insensitive to T but sensitive to the applied p (1.38 GPa(-1) at 150 K); (iv) κglass-T plots show an enhanced, pressure-dependent peak-like feature, which is due to the glass to liquid transition on heating; (v) continuous heating cold-crystallizes ultraviscous glycerol under pressure, at a higher T when p is high; and (vi) glycerol formed by cooling at a high p and then measured at a low p has a significantly higher κ than the glass formed by cooling at a low p. On heating at a fixed low p, its κ decreases before its glass-liquid transition range at that p is reached. We attribute this effect to thermally assisted loss of the configurational and vibrational instabilities of a glass formed at high p and recovered at low p, which is different from the usual glass-aging effect. While the heat capacity, entropy, and volume of glycerol crystal are less than those for its glass and liquid, κcrystal of glycerol, like its elastic modulus and refractive index, is higher. We discuss these findings in terms of the role of fluctuations in local density and structure, and the relations between κ and the thermodynamic quantities.
Energy Technology Data Exchange (ETDEWEB)
Song, Jie; Chen, Julia; Klapperich, Catherine M.; Eng, Vincent; Bertozzi, Carolyn R.
2004-07-20
Primary amine-functionalized glass slides obtained through a multi-step plasma treatment were conjugated with anionic amino acids that are frequently found as mineral binding elements in acidic extracellular matrix components of natural bone. The modified glass surfaces were characterized by X-ray photoelectron spectroscopy (XPS) and contact angle measurements. Human osteosarcoma TE85 cells were cultured on these functionalized slides and analyses on both protein and gene expression levels were performed to probe the ''biocompatibility'' of the surface ligands. Cell attachment and proliferation on anionic surfaces were either better than or comparable to those of cells cultured on tissue culture polystyrene (TCPS). The modified glass surfaces promoted the expression of osteocalcin, alkaline phosphatase activity and ECM proteins such as fibronectin and vitronectin under differentiation culture conditions. Transcript analysis using gene chip microarrays confirmed that culturing TE85 cells on anionic surfaces did not activate apoptotic pathways. Collectively, these results suggest that the potential mineral-binding anionic ligands examined here do not exert significant adverse effects on the expression of important osteogenic markers of TE85 cells. This work paves the way for the incorporation of these ligands into 3-dimensional artificial bone-like scaffolds.
Energy Technology Data Exchange (ETDEWEB)
Dahiya, M. S.; Khasa, S., E-mail: skhasa@yahoo.com; Yadav, Arti [Physics Department, Deenbandhu Chhotu Ram University of Science and Technology, Murthal, India-131039 (India); Agarwal, A. [Applied Physics Department, Guru Jambheshwara University of Science and Technology, Hisar, India-125001 (India)
2016-05-23
Lithium bismuth borate glasses containing different amounts of cobalt and iron oxides having chemical composition xFe{sub 2}O{sub 3}•(20-x)CoO•30Li{sub 2}O•10Bi{sub 2}O{sub 3}•40B{sub 2}O{sub 3} (x = 0, 5, 10, 15 and 20 mol% abbreviated as CFLBB1-5 respectively) prepared via melt quench technique have been investigated for their dc electrical conductivity. The amorphous nature of prepared glasses has been confirmed through X-ray diffraction measurements. The dc electrical conductivity has been analyzed by applying Mott’s small polaron hopping model. Activation energies corresponding to lower and higher temperature region have been evaluated. The iron ion concentration (N), mean spacing between iron ions (R) and polaron radius (R{sub p}) has been evaluated using the values of phonon radius (R{sub ph}) and Debye temperature (θ{sub D}). The glass sample without iron (CFLBB1) shows ionic conductivity but the incorporation of iron in the glass matrix results in the appearance of electronic conductivity.
Electrical conductivity studies of Bi2O3–Li2O–ZnO–B2O3 glasses
International Nuclear Information System (INIS)
Bale, Shashidhar; Rahman, Syed
2012-01-01
Highlights: ► Ac conductivity measurements and its analysis has been performed on Bi 2 O 3 –Li 2 O–ZnO–B 2 O 3 glasses in the temperature range 30–300 °C and a frequency range of 100 Hz to 1 MHz. ► The dc conductivity increased and the activation energy decreased with lithium content. ► The frequency dependent conductivity has been analyzed employing conductivity and modulus formalisms. ► The onset of conductivity relaxation shifts towards higher frequencies with temperature. ► The Almond–West conductivity formalism is used to explain the scaling behavior, and the relaxation mechanism is independent of temperature. -- Abstract: Ac conductivity measurements and its analysis has been performed on xBi 2 O 3 –(65−x)Li 2 O–20ZnO–15B 2 O 3 (0 ≤ x ≤ 20) glasses in the temperature range 30–300 °C and a frequency range of 100 Hz to 1 MHz. The dc conductivity increased and the activation energy decreased with lithium content. The frequency dependent conductivity has been analyzed employing conductivity and modulus formalisms. The onset of conductivity relaxation shifts towards higher frequencies with temperature. The Almond–West conductivity formalism is used to explain the scaling behavior, and the relaxation mechanism is independent of temperature.
Effect of mixed transition metal ions on DC conductivity in lithium bismuth borate glasses
Energy Technology Data Exchange (ETDEWEB)
Khasa, S.; Yadav, Arti, E-mail: artidabhur@gmail.com; Dahiya, M. S.; Seema,; Ashima [Physics Department, Deenbandhu Chhotu Ram University of Science & Technology, Murthal-131039 (India); Agarwal, A. [Physics Department, G.J. University of science and technology, Hisar-125001 (India)
2015-06-24
The DC conductivities of glasses having composition x(2NiO·V{sub 2}O{sub 5})·(30-x)Li{sub 2}O·20Bi{sub 2}O{sub 3}·50B{sub 2}O{sub 3} (with x=0, 2, 5, 7 and 10, i.e. NVLBB glasses) and glass samples having composition 7NiO·23 Li{sub 2}O·20Bi{sub 2}O{sub 3}·50B{sub 2}O{sub 3} and 7V{sub 2}O{sub 5}·23Li{sub 2}O·20Bi{sub 2}O{sub 3}·50B{sub 2}O{sub 3} (NLBB and VLBB respectively) are investigated as a function of temperature. Conductivity for glasses containing higher percentage of lithium ions is predominantly ionic and in glasses containing higher percentage of transition metal (TM) ions is predominantly electronic. The observed increase in conductivity with x and peak-like behavior at x=7 in NVLBB glasses due to competitive transport of small polaron contributing to a significant structural change in NVLBB glasses. Variation of molar volume and density was also observed with x. In NVLBB glasses, as x increases density increases except a slight decrease at x=7. Also density increases in NLBB whereas in case of VLBB it decreases in comparison to NVLBB1 glass composition. Mott’s small polaron hopping (SPH) model has been applied to analyze the high temperature conductivity data and activation energy.
International Nuclear Information System (INIS)
Hrma, P.R.; Piepel, G.F.
1994-12-01
A Composition Variation study (CVS) is being performed within the Pacific Northwest Laboratory Vitrification Technology Development (PVTD) project in support of a future high-level nuclear waste vitrification plant at the Hanford site in Washington. From 1989 to 1994, over 120 nonradioactive glasses were melted and properties measured in five statistically-designed experimental phases. Glass composition is represented by the 10 components SiO 2 , B 2 O 3 , Al 2 O 3 , Fe 2 O 3 , ZrO 2 , Na 2 O, Li 2 O, CaO, MgO, and Others (all remaining components). The properties measured include viscosity (η), electrical conductivity (ε), glass transition temperature (T g ), thermal expansion of solid glass (α s ) and molten glass (α m ), crystallinity (quenched and canister centerline cooled glasses), liquidus temperature (T L ), durability based on normalized elemental releases from the Materials Characterization Center-1 28-day dissolution test (MCC-1, r mi ) and the 7-day Product Consistency Test (PCT, r pi ), and solution pHs from MCC-1 and PCT. Amorphous phase separation was also evaluated. Empirical first- and second-order mixture models were fit using the CVS data to relate the various properties to glass composition. Equations for calculating the uncertainty associated with property values predicted by the models were also developed. The models were validated using both internal and external data. Other modeling approaches (e.g., non-bridging oxygen, free energy of hydration, phase-equilibria T L ) were investigated for specific properties. A preliminary Qualified Composition Region was developed to identify glass compositions with high confidence of being processable in a melter and meeting waste form acceptance criteria
Thermal conductivity of a superconducting spin-glass
International Nuclear Information System (INIS)
Crisan, M.
1988-01-01
The temperature dependence of the thermal conductivity for a superconducting spin-glass is calculated, taking a short-range spin-spin interaction in a super-conductor carrying a uniform flow. The presence of the short-range interaction between frozen spins gives rise to a strong depression in the thermal conductivity
Conductivity studies on microwave synthesized glasses
Indian Academy of Sciences (India)
It has been found that conductivity in these glasses changes from the predominantly 'ionic' to predominantly 'electronic' depending upon the chemical composition. ... Indian Institute of Science, Bangalore 560012, India; Department of Physics, Sree Siddaganga College of Arts, Science and Commerce, Tumkur University, ...
Raman scattering and modulated-DSC experiments on Potassium Germanate glasses*
Wang, N.; Novita, D.; Boolchand, P.
2006-03-01
We have synthesized titled glasses in the 0 modulated-DSC (MDSC) experiments. Raman lineshapes observed in the present work are quite similar to those reported by Henderson and Wang ^1. Preliminary MDSC experiments reveal glass transition temperatures, Tg(x), starting from a value of 570 C at x = 0, to decrease to 508 C near x = 0.06, and to increase thereafter almost linearly to 552 C as x increases to 0.15. On the other hand, the non-reversing enthalpy associated with Tg provides evidence of a global minimum in the 0.08 0.10 as Floppy, while those in the reversibility window as representing the Intermediate Phase^2. The space filling nature of the Intermediate Phase is, independently, corroborated by trends in molar volumes which show a broad global minimum in the 9-11% range. Identification of the three elastic phases provides a physical basis to understand the origin of the Germanate anomaly, and the electrical conductivity threshold when glasses become mechanically floppy. *Supported by NSF grant DMR 04-56472. ^1 G.S.Henderson and H.M.Wang, Eur. J. Mineral. 14, 733 (2002). ^2 P.Boolchand, G.Lucovsky, J.C. Phillips and M.F.Thorpe, Phil. Mag 85,3823 (2005).
Rinke de Wit, T. F.; Bekelie, S.; Osland, A.; Wieles, B.; Janson, A. A.; Thole, J. E.
1993-01-01
The genes for two novel members (designated 85A and 85C) of the Mycobacterium leprae antigen 85 complex family of proteins and the gene for the closely related M. leprae MPT51 protein were isolated. The complete DNA sequence of the M. leprae 85C gene and partial sequences of the 85A and MPT51 genes
International Nuclear Information System (INIS)
Gin, S.; Godon, N.; Mestre, J.P.; Vernaz, E.Y.; Beaufort, D.
1994-01-01
The dissolution kinetics of the French open-quotes R7T7close quotes nonradioactive LWR reference glass in solutions containing dissolved humic acids were investigated at 9O degrees C during static tests with imposed or free pH. Experiments conducted in highly dilute media, with a glass-surface-area-to-solution-volume (SA/V) ratio of 5 m -1 , showed that the glass dissolution surface reaction is catalyzed by humic acids. With higher degrees of reaction progress (SA/V = 100 m -1 and free pH) the humic acids impose pH modifications on the system compared with inorganic media; moreover, they directly or indirectly enhance the dissolution of certain alkali metals and transition elements, forming aqueous complexes with the latter. During experiments with an imposed pH of 8.5 (SA/V = 1300 and 5300 m -1 ), the humic acids appear to cause increased silica solubility that cannot be accounted for by the formation of silica complexes. A residual corrosion rate in the humic acid media exceeding the rate measured in inorganic media suggests that, in addition to silica, one or more element complexes formed by humic acids may be a kinetically limiting factor. This hypothesis must be confirmed, however, as the quantity of humic acids per unit glass surface area was too small in this experiment to allow unambiguous characterization of the phenomenon
International Nuclear Information System (INIS)
Wicks, G.G.; Stone, J.A.; Chandler, G.T.; Williams, S.
1986-08-01
Long-term leaching data were obtained on SRP 131/TDS waste glass using MCC-1 or slightly modified MCC-1 standard leaching tests. Experiments were conducted out to four years at 40 0 C and 3-1/2 years at 90 0 C. These experiments have produced the longest standardized leaching data currently available in the waste management community. Long-term leaching data provide important input to modeling of waste glass behavior and ultimate prediction of waste glass performance. In this study, the leaching behavior of SRP waste glass was found to be excellent; leachates based on a variety of elements were not only very low, but also improved with increasing time. In addition to these data, results are also reported from another independent Savannah River study. Leaching behavior at 40 0 C and 90 0 C was assessed not only for a similar SRP 131 waste glass composition, but also for extreme waste glass compositions involving high-iron and high-aluminum waste. In addition, these experiments were performed using not only a standard deionized water leachant, but also simplified brine and silicate groundwater simulations. These two large data bases will be summarized and correlated along with some of the more interesting results recently reported in another study, a two-year leaching program performed on a similar SRP waste glass composition at Battelle Pacific Northwest Laboratories
Fabrication and characterization of MCC approved testing material - ATM-1 glass
International Nuclear Information System (INIS)
Wald, J.W.
1985-10-01
The Materials Characterization Center Approved Testing Material ATM-1 is a borosilicate glass that incorporates nonradioactive constituents and uranium to represent high-level waste (HLW) resulting from the reprocessing of commercial nuclear reactor fuel. Its composition is based upon the simulated HLW glass type 76-68 to which depleted uranium has been added as UO 2 . Three separate lots of ATM-1 glass have been fabricated, designated ATM-1a, ATM-1b, and ATM-1c. Limited analyses and microstructural evaluations were conducted on each type. Each lot of ATM-1 glass was produced from a feedstock melted in an air atmosphere at between 1150 to 1200 0 C and cast into stress annealed rectangular bars. Bars of ATM-1a were nominally 1.3 x 1.3 x 7.6 cm (approx.36 g each), bars of ATM-1b were nominally 2 x 2.5 x 17.5 cm (approx.190 g each) and bars of ATM-1c were nominally 1.9 x 1.9 x 15 cm (approx.170 g each). Thirteen bars of ATM-1a, 14 bars of ATM-1b, and 6 bars of ATM-1c were produced. Twelve random samples from each of lots ATM-1a, ATM-1b, and ATM-1c were analyzed. The concentrations (except for U and Cs) were obtained by Inductively-Coupled Argon Plasma Atomic Emission Spectroscopy analysis. Cesium analysis was performed by Atomic Absorption Spectroscopy, while uranium was analyzed by Pulsed Laser Fluorometry. X-ray diffraction analysis of four samples indicated that lot ATM-1a had no detectable crystalline phases (<3 wt %), while ATM-1b and ATM-1c contained approx.3 to 5 wt % iron-chrome spinel crystals. These concentrations of secondary spinel component are not considered uncommon. Scanning electron microscopy examination of fracture surfaces revealed only a random, apparently crystalline, second phase (1-10 μm diam) and a random distribution of small voids or bubbles (approx.1 μm nominal diam)
Conductivity in alkali doped CoO-B2O3 glasses
International Nuclear Information System (INIS)
Nagaraja, N; Sankarappa, T; Santoshkumar; Sadashivaiah, P J; Yenkayya
2009-01-01
Two series of cobalt-borate glasses doped with Li 2 O and K 2 O in single and mixed proportions have been synthesized by melt quenching method and investigated for ac conductivity in the frequency range of 50Hz to 5MHz and temperature range of 310K to 610K. From the measured total conductivity, the pure ac component and its frequency exponent, s were determined. In the single alkali doped glasses, for all the frequencies, the conductivity increased with increase of Li 2 O up to 0.4 mole fractions and decreased for further increase of Li 2 O. The temperature dependence of conductivity has been analyzed using Mott's small polaron hopping model and activation energy for ac conduction has been determined. Based on conductivity and activation behaviors, in single alkali glasses, a change over of conduction mechanism predominantly from ionic to electronic has been predicted. In mixed alkali doped glasses, the conductivity passed through minimum and activation energy passed through maximum for second alkali (K 2 O) content of 0.2 mole fractions. This result revealed the mixed alkali effect to be occurring at 0.2 mole fractions of K 2 O. The frequency exponent, s, was compared with theoretical models such as Quantum Mechanical Tunneling and Correlated Barrier Hopping models and found them to be inadequate to explain the experimental observations. Time-temperature superposition principle has been verified in both the sets of glasses.
Zhang, Ji; Sun, Wei; Zhao, Jiangtao; Sun, Lei; Li, Lei; Yan, Xue-Jun; Wang, Ke; Gu, Zheng-Bin; Luo, Zhen-Lin; Chen, Yanbin; Yuan, Guo-Liang; Lu, Ming-Hui; Zhang, Shan-Tao
2017-08-02
Thin films of 0.85BiFe 1-2x Ti x Mg x O 3 -0.15CaTiO 3 (x = 0.1 and 0.2, abbreviated to C-1 and C-2, respectively) have been fabricated on (001) SrTiO 3 substrate with and without a conductive La 0.7 Sr 0.3 MnO 3 buffer layer. The X-ray θ-2θ and ϕ scans, atomic force microscopy, and cross-sectional transmission electron microscopy confirm the (001) epitaxial nature of the thin films with very high growth quality. Both the C-1 and C-2 thin films show well-shaped magnetization-magnetic field hysteresis at room temperature, with enhanced switchable magnetization values of 145.3 and 42.5 emu/cm 3 , respectively. The polarization-electric loops and piezoresponse force microscopy measurements confirm the room-temperature ferroelectric nature of both films. However, the C-1 films illustrate a relatively weak ferroelectric behavior and the poled states are easy to relax, whereas the C-2 films show a relatively better ferroelectric behavior with stable poled states. More interestingly, the room-temperature thermal conductivity of C-1 and C-2 films are measured to be 1.10 and 0.77 W/(m·K), respectively. These self-consistent multiferroic properties and thermal conductivities are discussed by considering the composition-dependent content and migration of Fe-induced electrons and/or charged point defects. This study not only provides multifunctional materials with excellent room-temperature magnetic, ferroelectric, and thermal conductivity properties but may also stimulate further work to develop BiFeO 3 -based materials with unusual multifunctional properties.
Percolative ionic conduction in the LiAlSiO4 glass-ceramic system
International Nuclear Information System (INIS)
Biefeld, R.M.; Pike, G.E.; Johnson, R.T. Jr.
1977-01-01
The effect f crystallinity on the lithium ion conductivity in LiAlSiO 4 glass and glass-ceramic solid electrolytes has been determined. The ionic conductivity is thermally activated with an activation energy and pre-exponential factor that change in a marked and nonsimple manner as the volume fraction of crystallinity changes. These results are explained by using a continuum percolation model (effective-medium approximation) which assumes that ionic conduction in the glass-ceramic is almost entirely within the glass phase until the crystalline volume fraction rises above approx. 55%. The LiAlSiO 4 system would seem to be nearly ideal for application of percolation theory since the crystalline phase, β eucryptite, has nearly the same composition as the glass phase. Hence, as the crystallite volume fraction increases in the glass ceramic, the residual glass composition and conductivity remain the same. This is the first application of percolation theory to ionic transport in glass-ceramics and excellent agreement is obtained between theory and experiment for the LiAlSiO 4 system
Relaxation behavior of ion conducting glasses
International Nuclear Information System (INIS)
Bunde, A.; Dieterich, W.; Maass, P.; Meyer, M.
1997-01-01
We investigate by Monte Carlo simulations the diffusion of ions in an energetically disordered lattice, where the Coulomb interaction between the mobile ions is explicitly taken into account. We show that the combined effect of Coulomb interaction and disorder can account for the ionic ac-conductivity in glasses and the recently discovered non-Arrhenius behavior of the dc-conductivity in glassy fast ionic conductors. Our results suggest that glassy ionic conductors can be optimized by lowering the strength of the energetic disorder but that the ionic interaction effects set an upper bound for the conductivity at high temperatures. (author)
Energy Technology Data Exchange (ETDEWEB)
Toge, N.; Minami, T. (Univ. of Osaka Prefecture, Osaka (Japan))
1991-12-01
Nonoxide glasses whose main constituent are chalcogen elements like S, Se, or Te etc. show a lot of various properties, for instance, high infrared transmittancy and semi-conductivity which are already well known. Additionally, the optical properties change a lot along with the phase transition's happening between crystal and noncrystal under comparative low temperature. Further, it is also observed that the glasses containing proper cation appear high ion-conductivity. This paper supplies a brief reviews of chalcogenide glasses used as materials for infrared fiber, phase transition optical memory and superionic conductor, wherein the former two have already on the stage of utilization, particularly the realization of a rewritable optical memory is possible by using chalcogenide glasses film, and ion-conductor is in the phase to have shown the possibility of high conductivity while the development thereof is being expected. 22 refs., 8 figs.
Energy Technology Data Exchange (ETDEWEB)
Meyer, Benjamin Michael [Iowa State Univ., Ames, IA (United States)
2003-01-01
As time progresses, the world is using up more of the planet's natural resources. Without technological advances, the day will eventually arrive when these natural resources will no longer be sufficient to supply all of the energy needs. As a result, society is seeing a push for the development of alternative fuel sources such as wind power, solar power, fuel cells, and etc. These pursuits are even occurring in the state of Iowa with increasing social pressure to incorporate larger percentages of ethanol in gasoline. Consumers are increasingly demanding that energy sources be more powerful, more durable, and, ultimately, more cost efficient. Fast Ionic Conducting (FIC) glasses are a material that offers great potential for the development of new batteries and/or fuel cells to help inspire the energy density of battery power supplies. This dissertation probes the mechanisms by which ions conduct in these glasses. A variety of different experimental techniques give a better understanding of the interesting materials science taking place within these systems. This dissertation discusses Nuclear Magnetic Resonance (NMR) techniques performed on FIC glasses over the past few years. These NMR results have been complimented with other measurement techniques, primarily impedance spectroscopy, to develop models that describe the mechanisms by which ionic conduction takes place and the dependence of the ion dynamics on the local structure of the glass. The aim of these measurements was to probe the cause of a non-Arrhenius behavior of the conductivity which has been seen at high temperatures in the silver thio-borosilicate glasses. One aspect that will be addressed is if this behavior is unique to silver containing fast ion conducting glasses. more specifically, this study will determine if a non-Arrhenius correlation time, τ, can be observed in the Nuclear Spin Lattice Relaxation (NSLR) measurements. If so, then can this behavior be modeled with a new single
Electrical conductivity and modulus formulation in zinc modified bismuth boro-tellurite glasses
Dhankhar, Sunil; Kundu, R. S.; Dult, Meenakshi; Murugavel, S.; Punia, R.; Kishore, N.
2016-09-01
The ac conductivity of zinc modified tellurium based quaternary glasses having composition 60 TeO2-10 B2O3-(30 - x) Bi2O3-x ZnO; x = 10, 15, 20, 25 and 30 has been investigated in the frequency range 10-1-105 Hz and in temperature range 483-593 K. Frequency and temperature dependent ac conductivity found to obey Jonscher power law modified by Almond-West. DC conductivity, crossover frequency and frequency exponent have been estimated from the fitting of the experimental data of conductivity with Jonscher power law modified by Almond-West. The ac conductivity and its frequency exponent have been analyzed by various theoretical models. In presently studied glasses ac conduction takes place via tunneling of overlapping large polaron tunneling. Activation energy is found to be increased with increase in zinc content and dc conduction takes place via variable range hopping proposed by Mott with some modification suggested by Punia et al. The value of the stretched exponent ( β) obtained by fitting of M^' ' }} reveals the presence of non-Debye type relaxation. Scaling spectra of ac conductivity and electric modulus collapse into a single master curve for all compositions and temperatures, reveals the presence of composition and temperature independent conduction and relaxation process in these glasses. Activation energy of conduction ( W) and electric modulus ( E R ) are nearly equal, indicating that polaron have to overcome the same energy barrier during conduction as well as relaxation processes.
Kwok, Chau-To; Vogelaar, Ingrid P; van Zelst-Stams, Wendy A; Mensenkamp, Arjen R; Ligtenberg, Marjolijn J; Rapkins, Robert W; Ward, Robyn L; Chun, Nicolette; Ford, James M; Ladabaum, Uri; McKinnon, Wendy C; Greenblatt, Marc S; Hitchins, Megan P
2014-05-01
Germline mutations of the DNA mismatch repair genes MLH1, MSH2, MSH6 or PMS2, and deletions affecting the EPCAM gene adjacent to MSH2, underlie Lynch syndrome by predisposing to early-onset colorectal, endometrial and other cancers. An alternative but rare cause of Lynch syndrome is constitutional epimutation of MLH1, whereby promoter methylation and transcriptional silencing of one allele occurs throughout normal tissues. A dominantly transmitted constitutional MLH1 epimutation has been linked to an MLH1 haplotype bearing two single-nucleotide variants, NM_000249.2: c.-27C>A and c.85G>T, in a Caucasian family with Lynch syndrome from Western Australia. Subsequently, a second seemingly unrelated Caucasian Australian case with the same MLH1 haplotype and concomitant epimutation was reported. We now describe three additional, ostensibly unrelated, cancer-affected families of European heritage with this MLH1 haplotype in association with constitutional epimutation, bringing the number of index cases reported to five. Array-based genotyping in four of these families revealed shared haplotypes between individual families that extended across ≤2.6-≤6.4 megabase regions of chromosome 3p, indicating common ancestry. A minimal ≤2.6 megabase founder haplotype common to all four families was identified, which encompassed MLH1 and additional flanking genes and segregated with the MLH1 epimutation in each family. Our findings indicate that the MLH1 c.-27C>A and c.85G>T variants are borne on a European ancestral haplotype and provide conclusive evidence for its pathogenicity via a mechanism of epigenetic silencing of MLH1 within normal tissues. Additional descendants bearing this founder haplotype may exist who are also at high risk of developing Lynch syndrome-related cancers.
The influence of ZnO incorporation on the aqueous leaching characteristics of a borosilicate glass
Vance, E. R.; Gregg, D. J.; Karatchevtseva, I.; Griffiths, G. J.; Olufson, K.; Rees, Gregory J.; Hanna, John V.
2017-10-01
With increasing ZnO content, short term aqueous durability enhancement of all elements in borosilicate glasses containing 1.0 and 3.85 wt% ZnO was evident in 7-day PCT-B tests. In 14-day MCC-1 type leach tests conducted at 90 °C, surface alteration was very clear in the undoped glass via the formation of strongly altered amorphous material which tended to spall off the surface. No sign of crystallinity was detected by grazing incidence X-ray diffraction or electron microscopy of the surface layers and the surface material was very rich in silica. For the ZnO-bearing glasses, significant growth of particles following PCT leaching for 7 days was observed, due to a build-up of surface ZnO-containing Si-rich material and possible agglomeration. This alteration layer was also observed in MCC-1 type experiments in which cross-section SEM-EDS data were obtained. Raman, infrared and 11B and 29Si MAS NMR spectroscopy showed only slight changes in boron speciation on the addition of up to 9.1 wt% ZnO. Bulk positron annihilation lifetime spectra (PALS) of glasses containing 0-3.85 wt% ZnO could be analysed with three distinct lifetimes and also showed only slight differences. These results indicate that the basic glass structure was essentially not influenced by the ZnO content and that the passivation of the alteration layer is promoted by ZnO content.
Electrical conductivity studies in (Ag3AsS3)x(As2S3)1-x superionic glasses and composites
Studenyak, I. P.; Neimet, Yu. Yu.; Kranjčec, M.; Solomon, A. M.; Orliukas, A. F.; Kežionis, A.; Kazakevičius, E.; Šalkus, T.
2014-01-01
Compositional, frequency, and temperature studies of impedance and electrical conductivity in (Ag3AsS3)x(As2S3)1-x superionic glasses and composites were performed. Frequency range from 10 Hz to 3 × 109 Hz and temperature interval 300-400 K were used for the measurements. Compositional dependences of electrical conductivity and activation energy are analyzed; the most substantial changes are observed with the transition from (Ag3AsS3)0.4(As2S3)0.6 glass to (Ag3AsS3)0.5(As2S3)0.5 composite. With increase of Ag3AsS3 content, the investigated materials are found to have crystalline inclusions and show the two-phase composite nature. Addition of Ag3AsS3 leads to the increase of electrical conductivity whereas the activation energy decreases.
AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses
International Nuclear Information System (INIS)
Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana
2011-01-01
Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.
Flexural creep of coated SiC-fiber-reinforced glass-ceramic composites
International Nuclear Information System (INIS)
Sun, E.Y.
1995-01-01
This study reports the flexural creep behavior of a fiber-reinforced glass-ceramic and associated changes in microstructure. SiC fibers were coated with a dual layer of SiC/BN to provide a weak interface that was stable at high temperatures. Flexural creep, creep-rupture, and creep-strain recovery experiments were conducted on composite material and barium-magnesium aluminosilicate matrix from 1,000 to 1,200 C. Below 1,130 C, creep rates were extremely low (∼10 -9 s -1 ), preventing accurate measurement of the stress dependence. Above 1,130 C, creep rates were in the 10 -8 s -1 range. The creep-rupture strength of the composite at 1,100 C was about 75--80% of the fast fracture strength. Creep-strain recovery experiments showed recovery of up to 90% under prolonged unloading. Experimental creep results from the composite and the matrix were compared, and microstructural observations by TEM were employed to assess the effectiveness of the fiber coatings and to determine the mechanism(s) of creep deformation and damage
Molla, Atiar Rahaman; Basu, Bikramjit
2009-04-01
The design and development of glass ceramic materials provide us the unique opportunity to study the microstructure development with changes in either base glass composition or heat treatment conditions as well as to understand processing-microstructure-property (mechanical/biological) relationship. In the present work, it is demonstrated how various crystal morphology can develop when F(-) content in base glass (K(2)O-B(2)O(3)-Al(2)O(3)-SiO(2)-MgO-F) is varied in the range of 1.08-3.85% and when all are heat treated at varying temperatures of 1000-1120 degrees C. For some selected heat treatment temperature, the heat treatment time is also varied over 4-24 h. It was established that with increase in fluoride content in the glass composition, the crystal volume fraction of the glass-ceramic decreases. Using 1.08% fluoride, more than 80% crystal volume fraction could be achieved in the K(2)O-B(2)O(3)-Al(2)O(3)-SiO(2)-MgO-F system. It was observed that with lower fluoride content glass-ceramic, if heated at 1040 degrees C for 12 h, an oriented microstructure with 'envelop like' crystals can develop. For glass ceramics with higher fluorine content (2.83% or 3.85%), hexagonal-shaped crystals are formed. Importantly, high hardness of around 8 GPa has been measured in glass ceramics with maximum amount of crystals. The three-point flexural strength and elastic modulus of the glass-ceramic (heat treated at 1040 degrees C for 24 h) was 80 MPa and 69 GPa of the sample containing 3.85% fluorine, whereas, similar properties obtained for the sample containing 1.08% F(-) was 94 MPa and 57 GPa, respectively. Further, in vitro dissolution study of the all three glass-ceramic composition in artificial saliva (AS) revealed that leached fluoride ion concentration was 0.44 ppm, when the samples were immersed in AS for 8 weeks. This was much lower than the WHO recommended safety limits of 1.5 ppm. Among all the investigated glass-ceramic samples, the glass ceramic with 3.85% F
Lithium conductivity in glasses of the Li2O-Al2O3-SiO2 system.
Ross, Sebastian; Welsch, Anna-Maria; Behrens, Harald
2015-01-07
To improve the understanding of Li-dynamics in oxide glasses, i.e. the effect of [AlO4](-) tetrahedra and non-bridging oxygens on the potential landscape, electrical conductivity of seven fully polymerized and partly depolymerized lithium aluminosilicate glasses was investigated using impedance spectroscopy (IS). Lithium is the only mobile particle in these materials. Data derived from IS, i.e. activation energies, pre-exponential factors and diffusivities for lithium, are interpreted in light of Raman spectroscopic analyses of local structures in order to identify building units, which are crucial for lithium dynamics and migration. In polymerized glasses (compositional join LiAlSiO4-LiAlSi4O10) the direct current (DC) electrical conductivity continuously increases with increasing lithium content while lithium diffusivity is not affected by the Al/Si ratio in the glasses. Hence, the increase in electrical conductivity can be solely assigned to lithium concentration in the glasses. An excess of Li with respect to Al, i.e. the introduction of non-bridging oxygen into the network, causes a decrease in lithium mobility in the glasses. Activation energies in polymerized glasses (66 to 70 kJ mol(-1)) are significantly lower than those in depolymerized networks (76 to 78 kJ mol(-1)) while pre-exponential factors are nearly constant across all compositions. Comparison of the data with results for lithium silicates from the literature indicates a minimum in lithium diffusivity for glasses containing both aluminium tetrahedra and non-bridging oxygens. The findings allow a prediction of DC conductivity for a large variety of lithium aluminosilicate glass compositions.
Thermal Conductivity of Foam Glasses Prepared using High Pressure Sintering
DEFF Research Database (Denmark)
Østergaard, Martin Bonderup; Petersen, Rasmus Rosenlund; König, Jakob
The increasing focus on better building insulation is important to lower energy consumption. Development of new and improved insulation materials can contribute to solving this problem. Foam glass has a good insulating effect due to its large gas volume (porosity >90 %). It can be produced with o...... the thermal conductivity varies with gas composition. This allows us to determine the contribution of the gas and solid phase to the total thermal conductivity of a foam glass....
Transparent conducting properties of anatase Ti0.94Nb0.06O2 polycrystalline films on glass substrate
International Nuclear Information System (INIS)
Hitosugi, T.; Ueda, A.; Nakao, S.; Yamada, N.; Furubayashi, Y.; Hirose, Y.; Konuma, S.; Shimada, T.; Hasegawa, T.
2008-01-01
We report on transparent conducting properties of anatase Ti 0.94 Nb 0.06 O 2 (TNO) polycrystalline films on glass substrate, and discuss the role of grain crystallinity and grain boundary on resistivity. Thin films of TNO were deposited using pulsed laser deposition at substrate temperature ranging from room temperature to 350 deg. C, with subsequent H 2 -annealing at 500 deg. C. Polycrystalline TNO films showed resistivity of 4.5 x 10 -4 Ω cm and 1.5 x 10 -3 Ω cm for films prepared at substrate temperature of room temperature and 250 deg. C, respectively. X-ray diffraction measurements and transmission electron microscopy reveal that grain crystallinity and grain boundary play key roles in conductive films
Electronic conductivity in glasses of the TeO sub 2 -V sub 2 O sub 5 -MoO sub 3 system
Energy Technology Data Exchange (ETDEWEB)
Lebrun, N.; Levy, M; Souquet, J.L. (URA D1213-E.N.S.E.E.G., Saint Martin d' Heres (France). Laboratoire d' Ionique et d' Electrochimie du Solide)
1990-08-01
Conductivity and redox potential on glasses of the TeO{sub 2}-V{sub 2}O{sub 5}-MoO{sub 3} system have been measured. For temperatures between 20 to 200 pC, the electronic conductivity proceed by an activated mechanism. Variations of the pre-exponential factor interpreted by the small polaron theory indicate that only the vanadium ions are involved in the conduction mechanism. Cyclic voltamperometry measurements performed on TeO{sub 2}V{sub 2}O{sub 4}-MoO{sub 3} glasses as working electrode show that at 1 V difference between the V{sup +V}/V{sup +IV} and Mo{sup +I}/Mo{sup +V} redox potentials exists in the glassy material. This correspondend to an energy gap which may be to large to allow the electron transition from vanadium to molybdenum ions. (author). 13 refs.; 4 figs.; 1 tab.
International Nuclear Information System (INIS)
Ahn, Byung Tae.
1989-01-01
The first part of this work studies lithium-conducting sulfide glasses for battery applications, while the second part studies the thermodynamic properties of a superconducting oxide compound by using an oxide electrolyte. Lithium conducting glasses based on the SiS 2 -Li 2 S system are possible solid electrolytes for high-energy-density lithium batteries. The foremost requirement for solid electrolytes is that they should have high ionic conductivities. Unfortunately, most crystalline lithium conductors have low ionic conductivities at room temperature. However, glass ionic conductors show higher ionic conductivities than do crystalline forms of the same material. In addition to higher ionic conductivities, glasses appear to have several advantages over crystalline materials. These advantages include isotropic conductivity, absence of grain boundary effects, ease of glass forming, and the potential for a wide range of stability to oxidizing and reducing conditions. Using pyrolitic graphite-coated quartz ampoules, new ternary compounds and glasses in the SiS 2 -Li 2 S system were prepared. Several techniques were used to characterize the materials: powder x-ray diffraction, differential thermal analysis, differential scanning calorimetry, and AC impedance spectroscopy. The measured lithium conductivity of the sulfide glasses was one of the highest among the known solid lithium conductors. Measuring the equilibrium open circuit voltages assisted in determining the electrochemical stabilities of the ternary compounds and glasses with respect to pure Li. A solid-state ionic technique called oxygen coulometric titration was used to measure the thermodynamic stability, the oxygen stoichiometry, and the effects of the oxygen stoichiometry, and the effects of the oxygen stoichiometry and the cooling rate on superconductivity of the YBa 2 Cu 3 O 7-x compound were investigated
Characterization of Analytical Reference Glass-1 (ARG-1)
International Nuclear Information System (INIS)
Smith, G.L.
1993-12-01
High-level radioactive waste may be immobilized in borosilicate glass at the West Valley Demonstration Project, West Valley, New York, the Defense Waste Processing Facility (DWPF), Aiken, South Carolina, and the Hanford Waste Vitrification Project (HWVP), Richland, Washington. The vitrified waste form will be stored in stainless steel canisters before its eventual transfer to a geologic repository for long-term disposal. Waste Acceptance Product Specifications (WAPS) (DOE 1993), Section 1.1.2 requires that the waste form producers must report the measured chemical composition of the vitrified waste in their production records before disposal. Chemical analysis of glass waste forms is receiving increased attention due to qualification requirements of vitrified waste forms. The Pacific Northwest Laboratory (PNL) has been supporting the glass producers' analytical laboratories by a continuing program of multilaboratory analytical testing using interlaboratory ''round robin'' methods. At the PNL Materials Characterization Center Analytical Round Robin 4 workshop ''Analysis of Nuclear Waste Glass and Related Materials,'' January 16--17, 1990, Pleasanton, California, the meeting attendees decided that simulated nuclear waste analytical reference glasses were needed for use as analytical standards. Use of common standard analytical reference materials would allow the glass producers' analytical laboratories to calibrate procedures and instrumentation, to control laboratory performance and conduct self-appraisals, and to help qualify their various waste forms
Directory of Open Access Journals (Sweden)
Basareddy Sujatha
2017-01-01
Full Text Available Glasses in the system xV2O5·20Li2O·(80 − x [0.6B2O3:0.4ZnO] (where 10 ≤ x ≤ 50 have been prepared by a simple microwave method. Microwave synthesis of materials offers advantages of efficient transformation of energy throughout the volume in an effectively short time. Conductivity in these glasses was controlled by the concentration of transition metal ion (TMI. The dc conductivity follows Arrhenius law and the activation energies determined by regression analysis varies with the content of V2O5 in a non-linear passion. This non-linearity is due to different conduction mechanisms operating in the investigated glasses. Impedance and electron paramagnetic resonance (EPR spectroscopic studies were performed to elucidate the nature of conduction mechanism. Cole–cole plots of the investigated glasses consist of (i single semicircle with a low frequency spur, (ii two depressed semicircles and (iii single semicircle without spur, which suggests the operation of two conduction mechanisms. EPR spectra reveal the existence of electronic conduction between aliovalent vanadium sites. Further, in highly modified (10V2O5 mol% glasses Li+ ion migration dominates.
Elastic flexibility, fast-ion conduction, boson and floppy modes in AgPO3-AgI glasses
Novita, Deassy I.; Boolchand, P.; Malki, M.; Micoulaut, Matthieu
2009-05-01
Raman scattering, IR reflectance and modulated-DSC measurements are performed on specifically prepared dry (AgI)x(AgPO3)1-x glasses over a wide range of compositions 0%37.8% are elastically flexible. Raman optical elasticity power laws, trends in the nature of the glass transition endotherms, corroborate the three elastic phase assignments. Ionic conductivities reveal a step-like increase when glasses become stress-free at x>xc(1) = 9.5% and a logarithmic increase in conductivity (σ~(x-xc(2))μ) once they become flexible at x>xc(2) = 37.8% with a power law μ = 1.78. The power law is consistent with percolation of 3D filamentary conduction pathways. Traces of water doping lower Tg and narrow the reversibility window, and can also completely collapse it. Ideas on network flexibility promoting ion conduction are in harmony with the unified approach of Ingram et al (2008 J. Phys. Chem. B 112 859), who have emphasized the similarity of process compliance or elasticity relating to ion transport and structural relaxation in decoupled systems. Boson mode frequency and scattering strength display thresholds that coincide with the two elastic phase boundaries. In particular, the scattering strength of the boson mode increases almost linearly with glass composition x, with a slope that tracks the floppy mode fraction as a function of mean coordination number r predicted by mean-field rigidity theory. These data suggest that the excess low frequency vibrations contributing to the boson mode in flexible glasses come largely from floppy modes.
International Nuclear Information System (INIS)
Chatterjee, S.; Banerjee, S.; Mollah, S.; Chaudhuri, B.K.
1996-01-01
Electrical conductivity and thermoelectric power (TEP) of the as-quenched and annealed (at 500 degree C for 10 h and 840 degree C for 24 h) Bi 4-n Pb n Sr 3 Ca 3 Cu 4 O x (x = 0 endash 1.0) glasses have been measured. The dc conductivity data of the as-quenched and the partially annealed (at 500 degree C) glasses can be explained by considering the small-polaron hopping conduction mechanism which is found to change from the nonadiabatic to the adiabatic regime with annealing the glasses at 500 degree C. This change over is due to the presence of microcrystals in the partially annealed glasses as observed from x-ray-diffraction and scanning electron microscopic studies. This adiabatic behavior is also visualized even for some as-quenched glasses having a very small amount of the more conducting microcrystalline phase. All the 840 degree C annealed glasses are superconductors with T c between 110 and 115 K. The Seebeck coefficient (S) of the partially annealed glass system is found to be positive and increases linearly with temperature. The S values of the corresponding glass-ceramic superconductors showing broad peaks around T c . A change over in the values of S from positive (below ∼290 K) to negative (above ∼290 K) indicates the coexistence of both electrons and holes in these superconductors. The TEP data can be fitted with both the two-band model of Forro et al. [Solid State Commun. 73, 501 (1990)] and the Nagaosa-Lee model [Phys. Rev. Lett. 64, 2450 (1990)]. Therefore, the bosonic contribution in the transport properties of these superconductors, as suggested by the Nagaosa-Lee model, is supported. copyright 1996 The American Physical Society
Static structure of superionic conducting glass of Ag-Ge-Se system
Energy Technology Data Exchange (ETDEWEB)
Suenaga, R; Nakashima, S; Tahara, S; Takeda, S [Graduate School of Sciences, Kyushu University, 4-2-1 Ropponmatsu, Fukuoka 810-8560 (Japan); Kawakita, Y [Faculty of Sciences, Kyushu University, 4-2-1 Ropponmatsu, Fukuoka 810-8560 (Japan); Kohara, S [Japan Synchrotron Radiation Research Inst., 1-1-1 Kouto, Sayo-cho, Hyogo 679-5198 (Japan)], E-mail: takeda@rc.kyushu-u.ac.jp
2008-02-15
Superionic conducting glasses are the important materials as solid electrolytes. Amorphous Ag-Ge-Se system is well known to exhibit the superionic conducting behavior where silver ions easily migrate into the mixed structure of Ag{sub 2}Se and Ge-Se chalcogenide glass. It will be good material to study how the superionic conducting region distributes in the glassy network, and whether the conducting paths extends to the entire of the material, or the localized and limited area in an isolated region. In this paper, we will present the results of the static structure of Ag-Ge-Se system by high-energy X-ray diffraction measurements.
Li, Y; Placek, L M; Coughlan, A; Laffir, F R; Pradhan, D; Mellott, N P; Wren, A W
2015-02-01
This study was conducted to determine the influence that network modifiers, sodium (Na+) and strontium (Sr2+), have on the solubility of a SiO2-TiO2-CaO-Na2O/SrO bioactive glass. Glass characterization determined each composition had a similar structure, i.e. bridging to non-bridging oxygen ratio determined by X-ray photoelectron spectroscopy. Magic angle spinning nuclear magnetic resonance (MAS-NMR) confirmed structural similarities as each glass presented spectral shifts between -84 and -85 ppm. Differential thermal analysis and hardness testing revealed higher glass transition temperatures (Tg 591-760 °C) and hardness values (2.4-6.1 GPa) for the Sr2+ containing glasses. Additionally the Sr2+ (~250 mg/L) containing glasses displayed much lower ion release rates than the Na+ (~1,200 mg/L) containing glass analogues. With the reduction in ion release there was an associated reduction in solution pH. Cytotoxicity and cell adhesion studies were conducted using MC3T3 Osteoblasts. Each glass did not significantly reduce cell numbers and osteoblasts were found to adhere to each glass surface.
Energy Technology Data Exchange (ETDEWEB)
Qiu, Honghua; Mori, H; Sakata, H; Hirayama, T [Tokai Univ., Tokyo (Japan). Faculty of Engineering
1995-01-01
In this study, taking into consideration that TeO2 is a component of the glass network and Sb2O3 shows the redox effect in the glasses reducing its possibility of transformation of Sb{sup 3+} to Sb{sup 5+} as well as glass basicity, highly conductive tellurite based glasses have been prepared by the press-quenching method selecting the Fe2O3-Sb2O3-TeO2 system, and the electroconductive mechanism of the glasses has been examined by measuring its D.C. conductivity {sigma}. Part of the obtained information is as follows; the glass formation range of the Fe2O3-Sb2O3-TeO2 system has been 0 {le} Fe2O3 {le} 15mol%, 0 {le} Sb2O3 {le} 18mol% and 78 {le} TeO2 {le} 100mol% and about 15mol% of the additional amount of Fe2O3 has been the limit of glass formation. As the amount of Fe2O3 has increased, C{sub Fe} has also increased and with this, the linear electroconductivity of the glasses has increased from 1.86 {times} 10{sup -7}S{center_dot}cm{sup -1} to 1.62 {times} 10{sup -6}S{center_dot}cm{sup -1} and the glasses have been confirmed as the n-type semiconductor. The factor determining {sigma} of the glasses has been C{sub Fe} which has increased as the amount of Fe2O3 has increased. 34 refs., 8 figs., 2 tabs.
Development of all-solid lithium-ion battery using Li-ion conducting glass-ceramics
Energy Technology Data Exchange (ETDEWEB)
Inda, Yasushi [Research and Development Department, Ohara-inc, 1-15-30 Oyama, Sagamihara, Kanagawa 229-1186 (Japan); Graduate School of Engineering, Iwate University, 4-3-5 Ueda, Morioka, Iwate 020-8551 (Japan); Katoh, Takashi [Research and Development Department, Ohara-inc, 1-15-30 Oyama, Sagamihara, Kanagawa 229-1186 (Japan); Baba, Mamoru [Graduate School of Engineering, Iwate University, 4-3-5 Ueda, Morioka, Iwate 020-8551 (Japan)
2007-12-06
We have developed a high performance lithium-ion conducting glass-ceramics. This glass-ceramics has the crystalline form of Li{sub 1+x+y}Al{sub x}Ti{sub 2-x}Si{sub y}P{sub 3-y}O{sub 12} with a NASICON-type structure, and it exhibits a high lithium-ion conductivity of 10{sup -3} S cm{sup -1} or above at room temperature. Moreover, since this material is stable in the open atmosphere and even to exposure to moist air, it is expected to be applied for various uses. One of applications of this material is as a solid electrolyte for a lithium-ion battery. Batteries were developed by combining a LiCoO{sub 2} positive electrode, a Li{sub 4}Ti{sub 5}O{sub 12} negative electrode, and a composite electrolyte. The battery using the composite electrolyte with a higher conductivity exhibited a good charge-discharge characteristic. (author)
Energy Technology Data Exchange (ETDEWEB)
Hasegawa, Satoshi; Imanishi, Nobuyuki; Zhang, Tao; Xie, Jian; Hirano, Atsushi; Takeda, Yasuo; Yamamoto, Osamu [Department of Chemistry, Faculty of Engineering, Mie University, 1577 Kurimamachiya-cho, Tsu, Mie 514-8507 (Japan)
2009-04-01
The water stability of the fast lithium ion conducting glass-ceramic electrolyte, Li{sub 1+x+y}Al{sub x}Ti{sub 2-x}Si{sub y}P{sub 3-y}O{sub 12} (LATP), has been examined in distilled water, and aqueous solutions of LiNO{sub 3}, LiCl, LiOH, and HCl. This glass-ceramics are stable in aqueous LiNO{sub 3} and aqueous LiCl, and unstable in aqueous 0.1 M HCl and 1 M LiOH. In distilled water, the electrical conductivity slightly increases as a function of immersion time in water. The Li-Al/Li{sub 3-x}PO{sub 4-y}N{sub y}/LATP/aqueous 1 M LiCl/Pt cell, where lithium phosphors oxynitrides Li{sub 3-x}PO{sub 4-y}N{sub y} (LiPON) are used to protect the direct reaction of Li and LATP, shows a stable open circuit voltage (OCV) of 3.64 V at 25 C, and no cell resistance change for 1 week. Lithium phosphors oxynitride is effectively used as a protective layer to suppress the reaction between the LATP and Li metal. The water-stable Li/LiPON/LATP system can be used in Li/air secondary batteries with the air electrode containing water. (author)
Thermal shock behaviour of SiC-fibre-reinforced glasses
International Nuclear Information System (INIS)
Klug, T.; Reichert, J.; Brueckner, R.
1992-01-01
The preparation of two SiC-fibre-reinforced glasses with very different thermal expansion coefficients and glass transition temperatures is described and the influence of long-time temperature and thermal shock behaviour of these composites on the mechanical properties is investigated by means of bending test experiments before and after thermal treatments. It will be shown from experiments and calculations on stresses due to thermal expansion mismatch between fibre and glass matrix that not only best mechanical properties but also best thermal shock behaviour are connected with low tensile intrinsic stresses produced by thermal expansion mismatch during preparation. The thermal shock resistance of the best composite (SiC fibre/DURAN glass) does not show a significant decrease of flexural strength even after 60 shocks from 550 to 25deg C in water, while the bulk glass sample of the same dimension was destroyed by one thermal shock from 350deg C. (orig.) [de
Solid electrolyte batteries and fast ion conducting glasses, factors affecting a proposed merger
Energy Technology Data Exchange (ETDEWEB)
Uhlmann, D R; Tuller, H L; Button, D P; Valez, M [Massachusetts Inst. of Tech., Cambridge (USA). Dept. of Materials Science and Engineering
1983-01-01
The present paper is concerned with advanced battery systems employing glass as a solid electrolyte. After an initial discussion of battery systems employing solid electrolytes, and of the attractive features offered by glass electrolytes, consideration is given to batteries fabricated with such electrolytes and to their performance characteristics. Subsequent discussion is directed to the two principal characteristics of glasses which are critical to their use as solid electrolytes - viz., their electrical conductivity and resistance to corrosive attack. The present state of knowledge in each of these areas is summarized, with particular focus on glasses with exceptionally high ionic conductivities - so-called fast ion conductors or FIC's.
Kumar, E. Ramesh; Nageswar Rao, P.; Appa Rao, B.
2016-09-01
Super ion conducting glasses of composition D%AgI-(100-D)%[MAg2O-F{(F1)B2O3- (F2)TeO2}]; D=10.0 to 60.0 in steps of 10.0 for a fixed values of F1 (0.4), F2 (0.6) which are glass network formers, fixed values of modifier M(0.667), F (0.333) and D is dopant salt which was varied. These glasses were prepared by melt quenching technique. XRD spectra taken for all the samples. Electrical characterization was done in terms of AC and DC conductivities. DC and AC conductivities at room temperature increased from 10-5 to 10-1 scm-1 and DC activation energy (Edc) found to decrease from 0.36 to 0.19eV with increase in D% ratio. Measurements are performed over the frequency range 1 kHz to 3 MHz at different temperatures. From the impedance spectroscopy real and imaginary parts of impedances (Z', Z"), conductivities were calculated and plotted, and equivalent R-C circuit parameters were obtained from Cole-Cole plots. With the increase in D%, AC conductivity is observed to increase whereas the AC activation energy (Eac) is observed to decrease from 0.23 to 0.14 eV. The quantitative analysis of these results indicates that the electrical conductivity of silver borate glasses is enhanced with increase in D% ratio. Based on conductivity values these glasses are ionic conductors, in which conduction is by hopping mechanism. An attempt is made to understand the charge transportation process.
A FeNiMnC alloy with strain glass transition
Directory of Open Access Journals (Sweden)
Hui Ma
2018-02-01
Full Text Available Recent experimental and theoretical investigations suggested that doping sufficient point defects into a normal ferroelastic/martensitic alloy systems could lead to a frozen disordered state of local lattice strains (nanomartensite domains, thereby suppressing the long-range strain-ordering martensitic transition. In this study, we attempt to explore the possibility of developing novel ferrous Elinvar alloys by replacing nickel with carbon and manganese as dopant species. A nominal Fe89Ni5Mn4.6C1.4 alloy was prepared by argon arc melting, and XRD, DSC, DMA and TEM techniques were employed to characterize the strain glass transition signatures, such as invariance in average structure, frequency dispersion in dynamic mechanical properties (storage modulus and internal friction and the formation of nanosized strain domains. It is indicated that doping of Ni, Mn and C suppresses γ→α long-range strain-ordering martensitic transformation in Fe89Ni5Mn4.6C1.4 alloy, generating randomly distributed nanosized domains by strain glass transition. Keywords: Strain glass transition, Elinvar alloys, Point defects, Nanosized domains
A Simple Demonstration of the High-Temperature Electrical Conductivity of Glass
Chiaverina, Chris
2014-01-01
We usually think of glass as a good electrical insulator; this, however, is not always the case. There are several ways to show that glass becomes conducting at high temperatures, but the following approach, devised by Brown University demonstration manager Gerald Zani, may be one of the simplest to perform.
Specific heat characteristics of Ce70Ga8.5Cu18.5Ni3 metallic glass at low temperatures
Liu, Rentao; Zhong, Langxiang; Zhang, Bo
2018-03-01
Specific heat behaviors have been studied in Ce70Ga8.5Cu18.5Ni3 bulk metallic glass (BMG) from 2 K to 50 K. The low-temperature specific heat of the Ce-based metallic glass is a combined action of the Fermi liquids term, Debye oscillator term, and Einstein oscillator term as well as excess term. We also observed an intense boson peak around 15 K and attributed it to a harmonic localized Einstein mode influenced by the dense-packed atomic cluster structure. It is also demonstrated that Ce70Ga8.5Cu18.5Ni3 BMG belongs to the strongly correlated heavy-fermion system with a great electron specific heat coefficient and a high Wilson ratio. It exhibits a typical Fermi-Liquid feature when the temperature is above 10 K, while it exhibits a Non-Fermi-Liquid feature when the temperature is below 3.5 K.
Ion conductivity of nasicon ceramics
International Nuclear Information System (INIS)
Hoj, J.W.; Engell, J.
1989-01-01
The Nasicon ss ,Na 1 + X Zr 2 Si X P 3 - X O 12 o , X , 3, includes some of the best solid state sodium conductors known today. Compositions in the interval 1.6 , X , 2.6 show conductivities comparable to the best β double-prime-alumina ceramics. It is well known that the ion conductivity of β-alumina is strongly dependent on the texture of the ceramic. Here a similar behavior is reported for Nasicon ceramics. Ceramics of the bulk composition Na 2.94 Zr 1.49 Si 2.20 P 0.80 O 10.85 were prepared by a gel method. The final ceramics consist of Nasicon crystals with x = 2.14 and a glass phase. The grain size and texture of the ceramics were controlled by varying the thermal history of the gel based raw materials and the sintering conditions. The room temperature resistivity of the resulting ceramics varies from 3.65*10 3 ohm cm to 1.23*10 3 ohm cm. Using the temperature comparison method and estimates of the area of grain boundaries in the ceramics, the resistivity of the Nasicon phase is estimated to be 225 ohm cm at 25 degrees C. B 2 O 3 - or Al 2 O 3 -doping of the glass bearing Nasicon ceramic lower the room temperature resistivity by a factor 2 to 5. The dopants do not substitute into the Nasicon phase in substantial amounts
International Nuclear Information System (INIS)
Xu Feng; Wang Zhiming; Chen Guang; Jiang Jianzhong; Du Youwei
2008-01-01
After a review of the selection process of (Nd 0.625 Ni 0.375 ) 85 Al 15 as a metallic glass with a relatively high glass-forming ability, we investigate the influences of its phase transitions by duplicating the heating process of the isochronal thermal analysis with low-temperature annealings. The structure, thermal stability and magnetic properties are characterized. And the influences on magnetic properties are particularly discussed with emphasis. Both the annealing processes, to the glass-transition temperature and to the onset temperature of crystallization, bring about a higher coercivity of the sample and a higher freezing temperature of the spin-glass-state. For the sample annealed to the onset temperature of crystallization, the influence is quite obvious and is ascribed to the formation of ferrimagnetic Nd 7 Ni 3 phase, as detected by XRD. For the sample annealed to the glass-transition temperature, the indistinct influence is further identified with the analysis of the frequency dependence of the spin-glass-state, and it is mainly attributed to the change of the short-range order in the amorphous matrix
Energy Technology Data Exchange (ETDEWEB)
Mohaghegh, E., E-mail: elnaz.mohaghegh@gmail.com [Department of Materials Science and Engineering, Sharif University of Technology, Tehran, 11155-9466 (Iran, Islamic Republic of); Nemati, A. [Department of Materials Science and Engineering, Sharif University of Technology, Tehran, 11155-9466 (Iran, Islamic Republic of); Eftekhari Yekta, B. [Ceramic Division, School of Metallurgy and Materials Engineering, Iran University of Science and Technology, Tehran, 16846-13114 (Iran, Islamic Republic of); Banijamali, S. [Ceramic Division, Materials & Energy Research Center, Alborz, 31787-316 (Iran, Islamic Republic of)
2017-04-01
In this study, Li{sub 2}O-TiO{sub 2}-P{sub 2}O{sub 5}-x(Fe{sub 2}O{sub 3}) (x = 0, 2.5, 5 and 7.5 weight part) glass and glass-ceramics were synthesized through conventional melt-quenching method and subsequently heat treatment. Glass samples were studied by UV–visible spectroscopy and crystallized samples were characterized by differential thermal analysis, X-ray diffractometry and field emission scanning electron microscopy. Besides, electrical properties were examined according to the electrochemical impedance spectroscopy techniques. Experimental optical spectra of the Fe{sub 2}O{sub 3}-doped glasses revealed strong UV absorption band in the range of 330–370 nm, which were attributed to the presence of Fe{sup 3+} ions. The major crystalline phase of the fabricated glass-ceramics was LiTi{sub 2}(PO{sub 4}){sub 3}. However, Li{sub 3}PO{sub 4} was also identified as the minor one. Considering the impedance spectroscopy studies, ionic conductivity of Fe{sub 2}O{sub 3} containing glasses was higher than that of the base glass. Additionally, the maximum bulk ionic conductivity of 1.38 × 10{sup −3} S/cm was achieved as well as activation energy as low as 0.26 eV at room temperature for x = 5. - Highlights: • Bulk and total ionic conductivity was extracted by using impedance spectroscopy. • Ionic conductivity of the studied glasses and glass-ceramics increased with increasing Fe{sub 2}O{sub 3} content. • The highest bulk ionic conductivity at room temperature was found to be 1.38 × 10{sup −3} S/cm for GC{sub 5}.
Changes in glass formation and glass forming ability of Nd2Fe14B by the addition of TiC
International Nuclear Information System (INIS)
Branagan, D.J.; Iowa State Univ. of Science and Technology, Ames, IA; McCallum, R.W.; Iowa State Univ. of Science and Technology, Ames, IA
1996-01-01
The glass forming ability (GFA) of a stoichiometric Nd 2 Fe 14 B alloy modified with TiC additions was studied. Structural, magnetic, and thermal measurements of as-quenched melt-spun ribbons indicate increasing enhancement of GFA with increasing amounts of TiC addition. The limit of the glass formation range and the amount of glass formed at a particular cooling rate also increased with TiC addition. Enhanced GFA was concurrent with changes in the intrinsic properties of the glass. The crystallization temperature, as well as the transformation rate of crystallization, was raised by TiC addition. The intrinsic magnetic properties of the glass were changed with reductions in saturation magnetization and Curie temperature T c with increasing amounts of TiC addition. The intrinsic glass changes were related to changes in the local short range order of the glass and are consistent with a reduction in free volume and an increased packing efficiency. These changes in local structure of the glass increase the glass stability, which means that less undercooling is needed to prevent crystallization. Thus, at a particular cooling rate, a higher percentage of glass will be formed and the GFA is increased. (orig.)
D.C. electrical conductivity measurements on ADP single crystals ...
Indian Academy of Sciences (India)
Unknown
Impurity added ADP crystals; density; electrical conductivity measurements. 1. Introduction ... determined by the intrinsic defects caused by thermal fluctuations in the ... beaker (corning glass vessel) and allowed to equilibrate at the desired ...
Direct growth of transparent conducting Nb-doped anatase TiO2 polycrystalline films on glass
International Nuclear Information System (INIS)
Yamada, Naoomi; Kasai, Junpei; Hitosugi, Taro; Hoang, Ngoc Lam Huong; Nakao, Shoichiro; Hirose, Yasushi; Shimada, Toshihiro; Hasegawa, Tetsuya
2009-01-01
This paper proposes a novel sputter-based method for the direct growth of transparent conducting Ti 1-x Nb x O 2 (TNO) polycrystalline films on glass, without the need for any postdeposition treatments, by the use of an initial seed-layer. Anatase TNO epitaxial films grown on LaAlO 3 (100) substrates under a reducing atmosphere exhibited a low resistivity (ρ) of (3-6)x10 -4 Ω cm. On glass, however, highly resistive rutile phase polycrystalline films (ρ∼100 Ω cm) formed preferentially under the same conditions. These results suggest that epitaxial stabilization of the oxygen-deficient anatase phase occurs on lattice-matched substrates. To produce a similar effect on a glass surface, we deposited a seed-layer of anatase TNO with excellent crystallinity under an increased oxygen atmosphere. As a result, anatase phase TNO polycrystalline films could be grown even under heavily reducing atmospheres. An optimized film exhibited ρ=1.1x10 -3 Ω cm and optical absorption lower than 10% in the visible region. This ρ value is more than one order of magnitude lower than values reported for directly deposited TNO polycrystalline films. This indicates that the seed-layer method has considerable potential for producing transparent conducting TNO polycrystalline films on glass.
Structural study and DC conductivity of vanadyl doped zinc lithium borate glasses
Energy Technology Data Exchange (ETDEWEB)
Seema [Physics Department, Deenbandhu Chhotu Ram University of Science & Technology, Murthal-131039 (India); Physics Department, Baba Mast Nath University, Asthal Bohr, Rohtak-124001 (India); Khasa, S., E-mail: skhasa@rediff.com; Dahiya, M. S.; Yadav, Arti [Physics Department, Deenbandhu Chhotu Ram University of Science & Technology, Murthal-131039 (India); Agarwal, A. [Applied Physics Department, Guru Jambheshwar University of Science & Technology, Hisar-125001 (India); Dahiya, S. [Physics Department, Baba Mast Nath University, Asthal Bohr, Rohtak-124001 (India)
2015-06-24
Glasses with composition xZnO⋅(30 − x)⋅Li{sub 2}O⋅70B{sub 2}O{sub 3} containing 2 mol% of V{sub 2}O{sub 5} (x = 0, 2, 5, 7 and 10) were prepared by standard melt-quench technique. The amorphous nature of the glass samples was confirmed by using x-ray diffraction. The structural changes in these glasses have been investigated by employing IR spectroscopy in the mid-IR range. The infrared spectroscopic analysis confirms the presence of both triangular and tetraheldral coordinated boron units and absence of boroxol ring. It also shows that metal-oxide vibrations are present which are due to the bonding of lithium and zinc ions with oxygen. The dc conductivity was measured in the temperature range 353-523 K. The dc conductivity results show that conductivity decreases and activation energy increases when Li{sub 2}O is replaced by ZnO, keeping the concentration of B{sub 2}O{sub 3} constant. Decrease in conductivity and increase in activation energy shows that addition of ZnO to the glass matrix shows a “blocking effect” on the overall mobility of alkali ions, but at higher concentration the hopping effect was also observed.
Conductivity in Ag-As-S(Se,Te) chalcogenide glasses
Czech Academy of Sciences Publication Activity Database
Stehlík, Š.; Kolář, J.; Bartoš, M.; Vlček, Milan; Frumar, M.; Zima, Vítězslav; Wágner, T.
2010-01-01
Roč. 181, 37/38 (2010), s. 1625-1630 ISSN 0167-2738 Institutional research plan: CEZ:AV0Z40500505 Keywords : chalcogenide glasses * ionics conductivity * phase separation Subject RIV: CA - Inorganic Chemistry Impact factor: 2.496, year: 2010
Energy Technology Data Exchange (ETDEWEB)
Hujova, Miroslava [Laboratory of Inorganic Materials, Joint Workplace of the University of Chemistry and Technology Prague and the Institute, Institute of Rock Structure and Mechanics of the ASCR, Prague Czech Republic; Pokorny, Richard [Laboratory of Inorganic Materials, Joint Workplace of the University of Chemistry and Technology Prague and the Institute, Institute of Rock Structure and Mechanics of the ASCR, Prague Czech Republic; Klouzek, Jaroslav [Laboratory of Inorganic Materials, Joint Workplace of the University of Chemistry and Technology Prague and the Institute, Institute of Rock Structure and Mechanics of the ASCR, Prague Czech Republic; Dixon, Derek R. [Radiological Materials & Detection Group, Pacific Northwest National Laboratory, Richland Washington; Cutforth, Derek A. [Radiological Materials & Detection Group, Pacific Northwest National Laboratory, Richland Washington; Lee, Seungmin [Radiological Materials & Detection Group, Pacific Northwest National Laboratory, Richland Washington; McCarthy, Benjamin P. [Radiological Materials & Detection Group, Pacific Northwest National Laboratory, Richland Washington; Schweiger, Michael J. [Radiological Materials & Detection Group, Pacific Northwest National Laboratory, Richland Washington; Kruger, Albert A. [U.S. Department of Energy, Office of River Protection, Richland Washington; Hrma, Pavel [Radiological Materials & Detection Group, Pacific Northwest National Laboratory, Richland Washington
2017-07-10
The heat conductivity of reacting melter feed affects the heat transfer and conversion process in the cold cap (the reacting feed floating on molten glass). To investigate it, we simulated the feed conditions and morphology in the cold-cap by preparing “fast-dried slurry blocks”, formed by rapidly evaporating water from feed slurry poured onto a 200°C surface. A heat conductivity meter was used to measure heat conductivity of samples cut from the fast-dried slurry blocks, samples of a cold cap retrieved from a laboratory-scale melter, and loose dry powder feed samples. Our study indicates that the heat conductivity of the feed in the cold cap is significantly higher than that of loose dry powder feed, resulting from the feed solidification during the water evaporation from the feed slurry. To assess the heat transfer at higher temperatures when feed turns into foam, we developed a theoretical model that predicts the foam heat conductivity based on morphology data from in-situ X-ray computed tomography. The implications for the mathematical modeling of the cold cap are discussed.
Nagel, Alexander; McCarthy, Blythe; Bowe, Stacy
Our knowledge of glass production in ancient Egypt has been well augmented by the publication of recently excavated materials and glass workshops, but also by more recent materials analysis, and experiments of modern glass-makers attempting to reconstruct the production process of thin-walled coreformed glass vessels. From the mounting of a prefabricated core to the final glass product our understanding of this profession has much improved. The small but well preserved glass collection of the Freer Gallery of Art in Washington, D.C. is a valid tool for examining and studying the technology and production of ancient Egyptian core formed glass vessels. Charles Lang Freer (1854-1919) acquired most of the material from Giovanni Dattari in Cairo in 1909. Previously the glass had received only limited discussion, suggesting that most of these vessels were produced in the 18th Dynasty in the 15th and 14th centuries BCE, while others date from the Hellenistic period and later. In an ongoing project we conducted computed radiography in conjunction with qualitative x-ray fluorescence analysis on a selected group of vessels to understand further aspects of the ancient production process. This paper will provide an overview of our recent research and present our data-gathering process and preliminary results. How can the examinations of core formed glass vessels in the Freer Gallery contribute to our understanding of ancient glass production and technology? By focusing on new ways of looking at old assumptions using the Freer Gallery glass collections, we hope to increase understanding of the challenges of the production process of core-vessel technology as represented by these vessels.
Structural simulation and ionic conductivity mechanisms in lithium thio-borate based glasses
International Nuclear Information System (INIS)
Estournes, C.
1992-04-01
We propose in this work a structural study of B 2 S 3 -Li 2 S glass system through the use of neutron scattering, X-ray photo-electron spectroscopy and computerized simulation. We have got information on the order at low and short distance range of these glasses. This information has been correlated to changes in physical features like ionic conductivity, density and temperature of the vitreous transition according to their chemical compositions. The knowledge of the local order in the most modified binary glasses has allowed us to propose a model for ionic conduction similar to the model used for ionic crystals. This model has been validated: it yields an activation energy that agrees well with experimental data
Lattice thermal conductivity of silicate glasses at high pressures
Chang, Y. Y.; Hsieh, W. P.
2016-12-01
Knowledge of the thermodynamic and transport properties of magma holds the key to understanding the thermal evolution and chemical differentiation of Earth. The discovery of the remnant of a deep magma ocean above the core mantle boundary (CMB) from seismic observations suggest that the CMB heat flux would strongly depend on the thermal conductivity, including lattice (klat) and radiative (krad) components, of dense silicate melts and major constituent minerals around the region. Recent measurements on the krad of dense silicate glasses and lower-mantle minerals show that krad of dense silicate glasses could be significantly smaller than krad of the surrounding solid mantle phases, and therefore the dense silicate melts would act as a thermal insulator in deep lower mantle. This conclusion, however, remains uncertain due to the lack of direct measurements on the lattice thermal conductivity of silicate melts under relevant pressure-temperature conditions. Besides the CMB, magmas exist in different circumstances beneath the surface of the Earth. Chemical compositions of silicate melts vary with geological and geodynamic settings of the melts and have strong influences on their thermal properties. In order to have a better view of heat transport within the Earth, it is important to study compositional and pressure dependences of thermal properties of silicate melts. Here we report experimental results on lattice thermal conductivities of silicate glasses with basaltic and rhyolitic compositions up to Earth's lower mantle pressures using time-domain thermoreflectance coupled with diamond-anvil cell techniques. This study not only provides new data for the thermal conductivity of silicate melts in the Earth's deep interior, but is crucial for further understanding of the evolution of Earth's complex internal structure.
Energy Technology Data Exchange (ETDEWEB)
Ahlawat, Navneet [Department of Physics, Chaudhary Devi Lal University, Sirsa 125055, Haryana (India); Ahlawat, Neetu, E-mail: neetugju@yahoo.co.in [Department of Applied Physics, Guru Jambheshwar University of Science and Technology, Hisar 125001, Haryana (India); Aghamkar, Praveen [Department of Physics, Chaudhary Devi Lal University, Sirsa 125055, Haryana (India); Agarwal, Ashish; Sanghi, Sujata; Sindhu, Monica [Department of Applied Physics, Guru Jambheshwar University of Science and Technology, Hisar 125001, Haryana (India)
2013-04-01
Ion conducting glasses having composition 30Li{sub 2}O·(70−x)PbO·xSiO{sub 2} were prepared by the normal melt quench technique. The compositional variations in density, molar volume and glass transition temperature confirm the dual role of PbO acting as a network modifying oxide as well as a network forming oxide. Conduction and relaxation mechanisms in these glasses were studied using impedance spectroscopy in the frequency range from 1 Hz to 7 MHz and in a temperature range below glass transition temperature. The ac and dc conductivities, activation energy of the dc conductivity and relaxation frequency were extracted from the impedance spectra. Similar values of activation energy for dc conduction and for conductivity relaxation time indicate that the ions have to overcome the same energy barrier while conducting and relaxing. The increase in dc conductivity for silica rich compositions is attributed to the presence of mixed former effect in the studied glasses. The study of conductivity spectra reveals a transition from non-random to random hopping motion of lithium ions on successive replacement of PbO by SiO{sub 2} in glass matrix. The conduction and relaxation mechanism in the studied glasses are well explained with the concept of mismatch and relaxation (CMR) model.
Effect of alkali content on AC conductivity of borate glasses containing two transition metals
International Nuclear Information System (INIS)
Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.
2009-01-01
Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.
Experimental alteration of R7T7 glass in salt brines at 90 deg C and 150 deg C
International Nuclear Information System (INIS)
Godon, N.; Vernaz, E.; Gin, S.; Beaufort, D.; Thomassin, J.H.
1991-01-01
Static experiments have been developed to investigate the R7T7 glass corrosion in four natural salt brines (brines 1 and 3: pure halite, brines 2 and 4: high Mg, K fluid inclusions rich halite), at 90 deg C and 150 deg C with 0.7 cm -1 S/V ratio and at 11 different running times. Analysis of brines after alteration (pHmeter and ICP) added to a detailed study of the crystalline phases developed at the interface glass-brine (XRD,SEM and Microprobe), showed that the influence of the compositional difference is more important on the nature of the secondary phases formed than on the corrosion rate of the glass. After 91 days of alteration at 150 deg C stady states to be reached (after 40 days at 90 deg C). A long term experiment (1 year) is necessary to confirm this hypothesis. 7 refs., 7 figs., 2 tabs
Yang, Hong-Wang; Tong, Wei-Ping; Zhao, Xiang; Zuo, Liang; Wang, Jian-Qiang
2008-09-01
Al85 Ni5 Y8 C02 and Al 85 Ni5 Y6 C02 Fe2 metallic glasses are fabricated by melt spinning. A kink or a small exothermic peak is observed for both the samples isothermally annealed at sub-glass transition temperatures. Temperature modulated differential scanning calorimetry (TMDSC) data disapprove amorphous phase separation. The activation energies derived from Kissinger plots of the exothermic process on DSC curve around glass transition temperature are consistent with those of β -relaxation of metallic glasses.
Glass formulation for phase 1 high-level waste vitrification
International Nuclear Information System (INIS)
Vienna, J.D.; Hrma, P.R.
1996-04-01
The purpose of this study is to provide potential glass formulations for prospective Phase 1 High-Level Waste (HLW) vitrification at Hanford. The results reported here will be used to aid in developing a Phase 1 HLW vitrification request for proposal (RFP) and facilitate the evaluation of ensuing proposals. The following factors were considered in the glass formulation effort: impact on total glass volume of requiring the vendor to process each of the tank compositions independently versus as a blend; effects of imposing typical values of B 2 O 3 content and waste loading in HLW borosilicate glasses as restrictions on the vendors (according to WAPS 1995, the typical values are 5--10 wt% B 2 O 3 and 20--40 wt% waste oxide loading); impacts of restricting the processing temperature to 1,150 C on eventual glass volume; and effects of caustic washing on any of the selected tank wastes relative to glass volume
Glass formulation for phase 1 high-level waste vitrification
Energy Technology Data Exchange (ETDEWEB)
Vienna, J.D.; Hrma, P.R.
1996-04-01
The purpose of this study is to provide potential glass formulations for prospective Phase 1 High-Level Waste (HLW) vitrification at Hanford. The results reported here will be used to aid in developing a Phase 1 HLW vitrification request for proposal (RFP) and facilitate the evaluation of ensuing proposals. The following factors were considered in the glass formulation effort: impact on total glass volume of requiring the vendor to process each of the tank compositions independently versus as a blend; effects of imposing typical values of B{sub 2}O{sub 3} content and waste loading in HLW borosilicate glasses as restrictions on the vendors (according to WAPS 1995, the typical values are 5--10 wt% B{sub 2}O{sub 3} and 20--40 wt% waste oxide loading); impacts of restricting the processing temperature to 1,150 C on eventual glass volume; and effects of caustic washing on any of the selected tank wastes relative to glass volume.
Numerical modeling of the conduction and radiation heating in precision glass moulding
DEFF Research Database (Denmark)
Sarhadi, Ali; Hattel, Jesper Henri; Hansen, Hans Nørgaard
2012-01-01
wafer, heating can be performed by either conduction or radiation. The numerical simulation of these two heating mechanisms in the wafer based glass moulding process is the topic of the present paper. First, the transient heating of the glass wafer is simulated by the FEM software ABAQUS. Temperature...
Energy Technology Data Exchange (ETDEWEB)
Hitosugi, T. [Department of Chemistry, University of Tokyo, Tokyo 113-0033 (Japan); Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan)], E-mail: hitosugi@chem.s.u-tokyo.ac.jp; Ueda, A. [Department of Chemistry, University of Tokyo, Tokyo 113-0033 (Japan); Nakao, S.; Yamada, N.; Furubayashi, Y.; Hirose, Y.; Konuma, S. [Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan); Shimada, T.; Hasegawa, T. [Department of Chemistry, University of Tokyo, Tokyo 113-0033 (Japan); Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan)
2008-07-01
We report on transparent conducting properties of anatase Ti{sub 0.94}Nb{sub 0.06}O{sub 2} (TNO) polycrystalline films on glass substrate, and discuss the role of grain crystallinity and grain boundary on resistivity. Thin films of TNO were deposited using pulsed laser deposition at substrate temperature ranging from room temperature to 350 deg. C, with subsequent H{sub 2}-annealing at 500 deg. C. Polycrystalline TNO films showed resistivity of 4.5 x 10{sup -4} {omega} cm and 1.5 x 10{sup -3} {omega} cm for films prepared at substrate temperature of room temperature and 250 deg. C, respectively. X-ray diffraction measurements and transmission electron microscopy reveal that grain crystallinity and grain boundary play key roles in conductive films.
Fragility–structure–conductivity relations in vanadium tellurite glass
DEFF Research Database (Denmark)
Kjeldsen, Jonas; Yue, Yuanzheng; Rodrigues, Ana Candida Martins
the ability to intercalate lithium-ions, it is a candidate as cathode material. Here, we investigate the correlation between liquid fragility, structure and electronic conductivity in a series of vanadium-tellurite glasses with varying vanadium concentration. We measure dynamic and thermodynamic fragility...... the number of bonding and non-bonding oxygen atoms per network former, while we use IS and ESR to determine the electronic conductivity and the valence states of the system. We correlate the changes in local atomic structures as determined by NMR to the observed changes in macroscopic properties. Since...
Conductivity study on GeS2-Ga2S3-AgI-Ag chalcohalide glasses
Czech Academy of Sciences Publication Activity Database
Ren, J.; Yan, Q.; Wágner, T.; Zima, Vítězslav; Frumar, M.; Frumarová, Božena; Chen, G.
2013-01-01
Roč. 114, č. 2 (2013), 023701_1-023701_5 ISSN 0021-8979 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * conductivity Subject RIV: CA - Inorganic Chemistry Impact factor: 2.185, year: 2013
Damage characterization of E-glass and C-glass fibre polymer composites after high velocity impact
Razali, N.; Sultan, M. T. H.; Cardona, F.; Jawaid, M.
2017-12-01
The purpose of this work is to identify impact damage on glass fibre reinforced polymer composite structures after high velocity impact. In this research, Type C-glass (600 g/m2) and Type E-glass (600 g/m2) were used to fabricate Glass Fibre-Reinforced Polymer composites (GFRP) plates. The panels were fabricated using a vacuum bagging and hot bounder method. Single stage gas gun (SSGG) was used to do the testing and data acquisition system was used to collect the damage data. Different types of bullets and different pressure levels were used for the experiment. The obtained results showed that the C-glass type of GFRP experienced more damage in comparison to E-glass type of materials based on the amount of energy absorbed on impact and the size of the damage area. All specimens underwent a partial fibre breakage but the laminates were not fully penetrated by the bullets. This indicated that both types of materials have high impact resistance even though the applied pressures of the gas gun were on the high range. We concluded that within the material specifications of the laminates including the type of glass fibre reinforcement and the thickness of the panels, those composite materials are safe to be applied in structural and body armour applications as an alternative to more expensive materials such as Kevlar and type S-glass fibre based panels.
Electrical conduction mechanism in GeSeSb chalcogenide glasses
Indian Academy of Sciences (India)
by melt quenching has been determined at different temperatures in bulk through the I–V characteristic curves ... DC conductivity; chalcogenide glass; Sb–Se bonding; Poole–Frenkel mechanism .... measurements were taken at room temperature as well as ele- .... age across the sample was continuued, the induced thermal.
International Nuclear Information System (INIS)
Masoud, Emad M.; Khairy, M.; Mousa, M.A.
2013-01-01
Graphical abstract: -- Highlights: •AgI dopant created more opened borate network structure. •Dielectric constant and loss values increased with AgI concentration. •AgI dopant enhanced both ion migration and orientation. •0.6 AgI–0.27 Ag 2 O–0.13 B 2 O 3 showed the highest DC-conductivity at room temperature. •It showed also good life time as a solid electrolyte in solid battery at room temperature. -- Abstract: The electrical properties of the ternary ionic conducting glass system xAgI–(1 – x)[0.67Ag 2 O–0.33B 2 O 3 ], where x = 0.4 , 0.5, 0.6, 0.7 and 0.8, were studied for emphasizing the influence of silver iodide concentration on the transport properties in the based borate glasses. The glasses were prepared by melt quenching technique and characterized using X-ray diffraction (XRD), FT-IR spectra and differential thermal analysis (DTA). XRD confirmed a glassy nature for all investigated compositions. Electrical conductivity (σ), dielectric constant (ε′), dielectric loss (ε ″ ) and impedance spectra (Z′–Z′′) were studied for all samples at a frequency range of 0–10 6 Hz and over a temperature range of 303–413 K. Changes of conductivity and dielectric properties with composition, temperature and frequency were analyzed and discussed. A silver iodine battery using glassy electrolyte sample with the highest ionic conductivity (x = 0.6) was studied
Small angle, quasielastic and inelastic neutron scattering from 0.85AgPO3-0.15PbI2 glass
International Nuclear Information System (INIS)
Malugani, J.P.; Tachez, M.; Mercier, R.
1987-01-01
A small angle neutron scattering (SANS) experiment and a quasielastic neutron scattering (QENS) experiment were performed on the fast ionic conductor 0.85AgPO 3 -0.15PbI 2 , which is a vitreous electrolyte. The SANS data show that the scattering obeys Guinier's law for Q -2 A; dispersed heterogeneities are present in the glass with a mean radius of gyration of 20 A. The QENS spectra show a quasielastic broadening of the elastic peak and a long tail up to 40 meV which is due to an inelastic distribution. The results seem to confirm the hypothesis on the structure of this glass: small 'clusters' of AgI with tetrahedral coordination are dispersed in the AgPO 3 host glass. In order to build these clusters, an exchange between Ag + and Pb 2+ is proposed. 18 refs.; 6 figs.; 2 tabs
21 CFR 7.85 - Conduct of a presentation of views before report of criminal violation.
2010-04-01
... of criminal violation. 7.85 Section 7.85 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ENFORCEMENT POLICY Criminal Violations § 7.85 Conduct of a presentation of views before report of criminal violation. (a) The presentation of views shall be heard by a...
2010-04-01
... employee ethical conduct standards and financial disclosure regulations. 3c.1 Section 3c.1 Conservation of... STANDARDS OF CONDUCT § 3c.1 Cross-reference to employee ethical conduct standards and financial disclosure... branch-wide financial disclosure regulations at 5 CFR part 2634, the Standards of Ethical Conduct for...
Generation of micro-sized conductive lines on glass fibre fabrics by inkjet printing
Balda Irurzun, Unai; Dutschk, Victoria; Calvimontes, Alfredo; Akkerman, Remko
2012-01-01
Micro-sized lines were inkjet printed on glass fibre fabrics using different droplet spacing. A conductive ink containing silver nanoparticles was used in this study. Glass fibre fabrics were differently pre-treated to avoid spontaneous spreading of the ink dispersion. The sample topography was
International Nuclear Information System (INIS)
Tawansi, A.; Basha, A.F.; El-Konsol, S.
1981-07-01
The present investigation deals with a study of the γ-radiation effects on the d.c. electrical resistivity (rho) of SiO 2 -Na 2 O-CaO glasses containing Cu 0 , Cu + , Cu 2+ and mixture of Cu + and Cu 2+ ions over the temperature (T) range from 300 to 630 0 K. The applicability of the polaron hopping conduction mechanism has been established from the reciprocal temperature dependence of 1n rho/T for the samples under investigation. The electrical resistivity is found to decrease by increasing the TM valancy which enhances the hoping process. The post-irradiation effect due to ionizing gamma-radiation is investigated within the frame work of the electron (and hole) trapping theory, and an average value of 0.45 is obtained for the parameter Δ, characterizing traps with an exponentially decreasing numbers below the conduction band. (author)
Effect of heat treatment time on microstructure and electrical conductivity in LATP glass ceramics
Energy Technology Data Exchange (ETDEWEB)
Sonigra, Dhiren, E-mail: somans@iitb.ac.in, E-mail: ajit.kulkarni@iitb.ac.in; Soman, Swati, E-mail: somans@iitb.ac.in, E-mail: ajit.kulkarni@iitb.ac.in; Kulkarni, Ajit R., E-mail: somans@iitb.ac.in, E-mail: ajit.kulkarni@iitb.ac.in [Dept. of Metallurgical Engineering and Materials Science, IIT Bombay, Mumbai-400076 (India)
2014-04-24
Glass-ceramic is prepared by heat treatment of melt quenched 14Li{sub 2}O−9Al{sub 2}O{sub 3}−38TiO{sub 2}−39P{sub 2}O{sub 5} glass in the vicinity of crystallization temperature. Growth of ceramic phase is controlled by tuning heat treatment time at fixed temperature. Ceramic phase was identified to be LiTi{sub 2}(PO{sub 4}){sub 3} from X Ray Diffraction analysis. Microstructural evolution of this phase with hold time was observed under high resolution Scanning Electron Microscope. DC conductivity is observed to increase by 4-5 orders of magnitude in this glass-ceramic compared to parent glass. However, formation of pores and cracks with very large heat treatment time seem to hinder further increase of conductivity.
Dependence of conductivity on thickness within the variable-range hopping regime for Coulomb glasses
Directory of Open Access Journals (Sweden)
M. Caravaca
Full Text Available In this paper, we provide some computational evidence concerning the dependence of conductivity on the system thickness for Coulomb glasses. We also verify the Efros–Shklovskii law and deal with the calculation of its characteristic parameter as a function of the thickness. Our results strengthen the link between theoretical and experimental fields. Keywords: Coulomb glass, Conductivity, Density of states, Efros–Shklovskii law
International Nuclear Information System (INIS)
Delorme, L.
1998-01-01
This work is devoted to the study of the mechanisms which control the volatility of the reference glass used for the confinement of radioactive waste. It was conducted on simplified compositions, in the SiO 2 -B 2 O 3 -Al 2 O 3 -αNa 2 O-(1-alpha)Li 2 O-CaO system.The structural approach carried out by NMR, from room temperature up to 1500 deg.C, shows a strong increase in the mobility of alkalis above Tg. A rapid exchange between B III and B IV sites near 700 deg.C, and the change of coordination number B IV- B III near 1100 deg.C, also seem to take place. The analysis of the vapor phase, carried out by High Temperature Mass Spectrometry coupled to Knudsen cells, reveals the presence between 780 deg.C and 830 deg.C of NaBO 2 (g), LiBO 2 (g) and Na 2 (BO 2 )2(g). The calculation of the partial pressure of each species shows that the total pressure of simplified glasses is dominated by the contribution of sodium. To study the volatility of glasses at higher temperature, equipment using the Transpiration method was used. The analysis of the deposits indicate the presence at 1060 deg.C of the species quoted previously. The vaporization rate and the vapor density were determined for each composition studied in a saturated state. Thus, we show that the volatility of the reference glass can be simulated by that of a simplified glass. For α=1, the kinetic of vaporization between 1060 deg.C and 1200 deg.C reveals an evaporation from the surface associated with a mechanism of diffusion in the molten glass. This is similar to the volatility of the reference glass at 1060 deg.C. To finally explain these mechanisms on a microscopic basis, we develop a model of molecular interactions. Between 780 deg.C and 830 deg.C, these mechanisms are controlled by a strong attraction between Na 2 O and Li 2 O, which maintains the total vapor pressure on a quasi-constant lever up to α=0.27. (author)
Studies of natural and 60Co gamma radio-induced conduction in metaphosphate glasses and silica
International Nuclear Information System (INIS)
Mengual Gil, M.A.
1977-01-01
A study of natural and 60 Co gamma radio-induced conduction in metaphosphate glasses and silica is presented. The experimental study of natural conduction current in metaphosphate glasses in function of temperature enables to observe two different values of the activation energies in the respective temperature ranges T>223K and T [fr
International Nuclear Information System (INIS)
Palin, J.M.; Epstein, S.; Stolper, E.M.
1996-01-01
Oxygen isotope partitioning between gaseous CO 2 and a natural rhyolitic glass and melt (77.7 wt% SiO 2 , 0.16 wt% H 2 O total ) has been measured at 550-950 degrees C and approximately 1 bar. Equilibrium oxygen isotope fractionation factors (α CO2-rhyolite = ( 18 O/ 16 O) rhyolite ) determined in exchange experiments of 100-255 day duration. These values agree well with predictions based on experimentally determined oxygen isotope fractionation factors for CO 2 -silica glass and CO 2 -albitic glass/melt, if the rhyolitic glass is taken to be a simple mixture of normative silica and alkali feldspar components. The results indicate that oxygen isotope partitioning in felsic glasses and melts can be modeled by linear combinations of endmember silicate constituents. Rates of oxygen isotope exchange observed in the partitioning experiments are consistent with control by diffusion of molecular H 2 O dissolved in the glass/melt and are three orders of magnitude faster than predicted for rate control solely by diffusion of dissolved molecular CO 2 under the experimental conditions. Additional experiments using untreated and dehydrated (0.09 wt% H 2 O total ) rhyolitic glass quantatively support these interpretations. We conclude that diffusive oxygen isotope exchange in rhyolitic glass/melt, and probably other polymerized silicate materials, it controlled by the concentrations and diffusivities of dissolved oxygen-bearing volatile species rather than diffusion of network oxygen under all but the most volatile-poor conditions. 25 refs., 6 figs., 1 tab
The effect of replaced recycled glass on thermal conductivity and compression properties of cement
khalil, A. S.; Mahmoud, M. A.; AL-Hathal, A.; Jawad, M. K.; Mozahim, B. M.
2018-05-01
This study deal with recycling of waste colorless glass bottles which are prepared as a powder and use them as an alternative for cement to save the environment from west and reduce some of cement(ceramic) damage and interactions with conserving physical properties of block concrete. Different weight percentage (0%, 2%, 4%, 5%, 6%, 8%, 10%, 15%, 20% and 25%) of recycled glass bottle were use in this research to be replaced by a certain percentages of cement. Thermal conductivity was studied for prepared samples. Results show that the thermal conductivity decrease with the increase of weight percentage of glass powder comparing with the stander sample.
Preparation and investigation of Ge-S-I glasses for infrared fiber optics
Velmuzhov, A. P.; Sukhanov, M. V.; Plekhovich, A. D.; Snopatin, G. E.; Churbanov, M. F.; Iskhakova, L. D.; Ermakov, R. P.; Kotereva, T. V.; Shiryaev, V. S.
2016-02-01
Glass samples of [GeSx]90I10 (x = 1.5, 1.7, 2.0, 2.3, 2.45, 2.6) compositions were prepared, and some their thermal, optical properties as well as tendency to crystallization were investigated. The compositional dependences of glass transition temperature, volume fraction of crystallized phase and activation energy of glass formation (Eg) have nonmonotonic character with a maximum for [GeS2.0]90I10 glass. Glasses of 85.8GeS2-14.2GeI4 and [GeS1.5]90I10 compositions are identified as promising for preparation of optical fiber. For the first time, Ge-S-I glass fibers were produced. Minimum optical losses in 85.8GeS2-14.2GeI4 glass fiber were 2.7 dB/m at a wavelength of 5.1 μm, and that in [GeS1.5]90I10 glass fiber were 14.5 dB/m at 5.5 μm.
National Research Council Canada - National Science Library
Bendler, John
2001-01-01
A model, based on defect diffusion, is developed that describes temperature and pressure dependence of dielectric relaxation, ionic conductivity and viscosity of glass-forming liquids near the glass...
Fujimori, Kiyoshi; Lee, Hans; Phillips, Joseph; Nashed-Samuel, Yasser
The European Pharmacopeia surface test to analyze the hydrolytic resistance is a common industrial method to understand and ensure the quality of produced glass vials. Hydrolytic resistance is evaluated by calculating the alkalinity of water extract from autoclaved vials by titration. As an alternative to this titration technique, a conductivity technique was assessed, which directly measures the ions in the water extract. A conductivity meter with a 12 mm diameter electrode was calibrated with a 100 μS/cm conductivity standard and carryover minimized by rinsing the probe in a water beaker per analysis. The limit of quantification at 1 μS/cm was determined as having a signal-to-noise ratio of 3 compared with the water blank. The conductivity method was selective for glass-composing elements (boron, sodium, aluminum, silicon, potassium, and calcium) within the vial extract. Accuracies of spiked conductivity standard within the range of 1 to 100 μS/cm were ±7% and had linearity with coefficient of determination (R 2 ) of ≥0.9999. Intraday precision had a relative standard deviation (RSD) (n = 5) of ≤6% for spiked conductivity standard within the range of 1 to 100 μS/cm. Interday precision had a RSD (n = 4) of ≤6% for 10 vials from three glass vial lots. Conductivity of water extracts from nine sets of seven lots of glass vials had a precise linear relationship [R 2 = 0.9876, RSD = 1% (n = 9)] with titration volumes of the same lots. Conductivity results in μS/cm could be converted to titration volumes in milliliters by a conversion factor of 0.0275. The simplicity, sample stability, and individual vial analysis of the conductivity technique were more advantageous than the current titration technique. The quality of glass vials used as primary containers in the pharmaceutical industry is of concern due to recent observations of glass flake-like delamination, or lamellae, under specific storage conditions. The current European Pharmacopoeia method to assess
Glass microspheres for medical applications
Conzone, Samuel David
Radioactive dysprosium lithium borate glass microspheres have been developed as biodegradable radiation delivery vehicles for the radiation synovectomy treatment of rheumatoid arthritis. Once injected into a diseased joint, the microspheres deliver a potent dose of radiation to the diseased tissue, while a non-uniform chemical reaction converts the glass into an amorphous, porous, hydrated dysprosium phosphate reaction product. The non-radioactive, lithium-borate component is dissolved from the glass (up to 94% weight loss), while the radioactive 165Dy reacts with phosphate anions in the body fluids, and becomes "chemically" trapped in a solid, dysprosium phosphate reaction product that has the same size as the un-reacted glass microsphere. Ethylene diamine tetraacetate (EDTA) chelation therapy can be used to dissolve the dysprosium phosphate reaction product after the radiation delivery has subsided. The dysprosium phosphate reaction product, which formed in vivo in the joint of a Sprague-Dawley rat, was dissolved by EDTA chelation therapy in 100 Gy) of localized beta radiation to a treatment site within the body, followed by complete biodegradability. The non-uniform reaction process is a desirable characteristic for a biodegradable radiation delivery vehicle, but it is also a novel material synthesis technique that can convert a glass to a highly porous materials with widely varying chemical composition by simple, low-temperature, glass/solution reaction. The reaction product formed by nonuniform reaction occupies the same volume as the un-reacted glass, and after drying for 1 h at 300°C, has a specific surface area of ≈200 m2/g, a pore size of ≈30 nm, and a nominal crushing strength of ≈10 MPa. Finally, rhenium glass microspheres, composed of micron-sized, metallic rhenium particles dispersed within a magnesium alumino borate glass matrix were produced by sintering ReO2 powder and glass frit at 1050°C. A 50 mg injection of radioactive rhenium glass
Goins, Christopher M; Dajnowicz, Steven; Thanna, Sandeep; Sucheck, Steven J; Parks, Jerry M; Ronning, Donald R
2017-05-12
Previous studies identified ebselen as a potent in vitro and in vivo inhibitor of the Mycobacterium tuberculosis (Mtb) antigen 85 (Ag85) complex, comprising three homologous enzymes required for the biosynthesis of the mycobacterial cell wall. In this study, the Mtb Ag85C enzyme was cocrystallized with azido and adamantyl ebselen derivatives, resulting in two crystallographic structures of 2.01 and 1.30 Å resolution, respectively. Both structures displayed the anticipated covalent modification of the solvent accessible, noncatalytic Cys209 residue forming a selenenylsulfide bond. Continuous difference density for both thiol modifiers allowed for the assessment of interactions that influence ebselen binding and inhibitor orientation that were unobserved in previous Ag85C ebselen structures. The k inact /K I values for ebselen, adamantyl ebselen, and azido ebselen support the importance of observed constructive chemical interactions with Arg239 for increased in vitro efficacy toward Ag85C. To better understand the in vitro kinetic properties of these ebselen derivatives, the energetics of specific protein-inhibitor interactions and relative reaction free energies were calculated for ebselen and both derivatives using density functional theory. These studies further support the different in vitro properties of ebselen and two select ebselen derivatives from our previously published ebselen library with respect to kinetics and protein-inhibitor interactions. In both structures, the α9 helix was displaced farther from the enzyme active site than the previous Ag85C ebselen structure, resulting in the restructuring of a connecting loop and imparting a conformational change to residues believed to play a role in substrate binding specific to Ag85C. These notable structural changes directly affect protein stability, reducing the overall melting temperature by up to 14.5 °C, resulting in the unfolding of protein at physiological temperatures. Additionally, this structural
1980-07-31
this glass and that dipole-dipole correlations contribute to the "ferroelectric-like" character of this amorphous system. The TeO2 -W03 glasses can only...shows the dielectric constant and Fig. I(b) glass from pure TeO2 ot pure WO. In addition, glass the tan 8 of the WO glass as a function of temperature... glasses containing WO, in various glass forming nitworks of LifO-B1O0, Na:O-BzO,, and TeO2 were prepared from reagent grade oxides at 800 C - 9SO C in
American Society for Testing and Materials. Philadelphia
2002-01-01
1.1 These product consistency test methods A and B evaluate the chemical durability of homogeneous glasses, phase separated glasses, devitrified glasses, glass ceramics, and/or multiphase glass ceramic waste forms hereafter collectively referred to as “glass waste forms” by measuring the concentrations of the chemical species released to a test solution. 1.1.1 Test Method A is a seven-day chemical durability test performed at 90 ± 2°C in a leachant of ASTM-Type I water. The test method is static and conducted in stainless steel vessels. Test Method A can specifically be used to evaluate whether the chemical durability and elemental release characteristics of nuclear, hazardous, and mixed glass waste forms have been consistently controlled during production. This test method is applicable to radioactive and simulated glass waste forms as defined above. 1.1.2 Test Method B is a durability test that allows testing at various test durations, test temperatures, mesh size, mass of sample, leachant volume, a...
A π0 and eta spectrometer of lead glass and BGO for momenta up to 1 GeV/c
International Nuclear Information System (INIS)
Adiels, L.; Bergstroem, I.; Carius, S.; Kerek, A.; Backenstoss, G.; Findeisen, C.; Pavlopoulos, P.; Repond, J.; Tauscher, L.; Troester, D.; Williams, M.C.S.
1986-01-01
A spectrometer consisting of two sets of bismuth germanium oxide (BGO) crystals and a lead-glass array has been used to measure the π 0 and eta momentum spectra produced from proton-antiproton annihilations at rest. We describe the test of the BGO sets in electron beams of energies from 50 to 450 MeV. We discuss the method of construction and calibration of the lead-glass array, as well as procedures to extract the energy and position resolutions for detected photons. A momentum resolution (sigma) for π 0 's and eta's of 4% and 3%, respectively has been achieved at momenta below 1 GeV/c. (orig.)
DEFF Research Database (Denmark)
Jönsson, P. E.; Felton, S.; Svedlindh, P.
2001-01-01
The effect of applied magnetic fields on the collective nonequilibrium dynamics of a strongly interacting Fe-C nanoparticle system has been investigated. It is experimentally shown that the magnetic aging diminishes to finally disappear for fields of moderate strength. The field needed to remove ...... the observable aging behavior increases with decreasing temperature. The same qualitative behavior is observed in an amorphous metallic spin glass (Fe0.15Ni0.85)(75)P16B6Al3....
International Nuclear Information System (INIS)
Kruger, A.A.
1994-10-01
The tutorial covers the following topics: Definitions and terminology; Introduction to glass structure and properties; The glass transition; Structure/property relationships in oxide glasses; Generalized models for predicting structure/properties; Glass surfaces; Chemical durability; and Mechanical properties
Dun, C.A.J.; Hol, M.K.S.; Mylanus, E.A.M.; Cremers, C.W.R.J.
2011-01-01
OBJECTIVES: We present indications and clinical outcomes of fitting an 8.5-mm abutment for bone conduction devices. METHODS: In 39 cases with a follow-up time of more than 12 months after fitting of an 8.5-mm abutment, the preintervention and postintervention courses were retrospectively evaluated.
C-O volatiles in Apollo 15 and Apollo 17 picritic glasses
Rutherford, Malcolm J.; Fogel, Robert A.
1993-01-01
A15 and A17 primitive picritic glasses have been examined by FTIR for the presence of dissolved C-O species to determine the role of C-O gasses on driving lunar fire-fountains. A15 green and yellow glasses were extensively studied and found to be free of dissolved C species down to FTIR detection limits (10-100 ppm; species and sample specific). Preliminary data on A17 orange glasses are similarly devoid of FTIR detectable C-O species. Re-analyses of the C-O driving mechanism theory for mare volcanism demonstrates the need to determine the fO2 of the lunar interior; the factor that most critically determined the role of C gasses in the fire-fountaining events. Oxygen fugacities equivalent to IW-0.5 and above imply dissolved CO3(=) in the primitive glasses at levels above FTIR detection. The f02's below IW-0.5 imply concentrations of CO3(=) below FTIR detection. Recent data suggesting lunar mantle fO2's of IW-2 or less, strongly mitigate against finding FTIR measurable dissolved CO3(=) consistent with the findings of this study.
Glass formation, properties, and structure of soda-yttria-silicate glasses
Angel, Paul W.; Hann, Raiford E.
1991-01-01
The glass formation region of the soda yttria silicate system was determined. The glasses within this region were measured to have a density of 2.4 to 3.1 g/cu cm, a refractive index of 1.50 to 1.60, a coefficient of thermal expansion of 7 x 10(exp -6)/C, softening temperatures between 500 and 780 C, and Vickers hardness values of 3.7 to 5.8 GPa. Aqueous chemical durability measurements were made on select glass compositions while infrared transmission spectra were used to study the glass structure and its effect on glass properties. A compositional region was identified which exhibited high thermal expansion, high softening temperatures, and good chemical durability.
Glass formation, properties and structure of soda-yttria-silica glasses
Angel, Paul W.; Hann, Raiford E.
1992-01-01
The glass formation region of the soda yttria silicate system was determined. The glasses within this region were measured to have a density of 2.4 to 3.1 g/cu cm, a refractive index of 1.50 to 1.60, a coefficient of thermal expansion of 7 x 10(exp -6)/C, softening temperatures between 500 and 780 C, and Vickers hardness values of 3.7 to 5.8 GPa. Aqueous chemical durability measurements were made on select glass compositions while infrared transmission spectra were used to study the glass structure and its effect on glass properties. A compositional region was identified which exhibited high thermal expansion, high softening temperatures, and good chemical durability.
Czech Academy of Sciences Publication Activity Database
Hujová, Miroslava; Pokorný, R.; Kloužek, Jaroslav; Dixon, D.R.; Cutforth, D.A.; Lee, S.; McCarthy, B.P.; Schweiger, M. J.; Kruger, A.A.; Hrma, P.
2017-01-01
Roč. 100, č. 11 (2017), s. 5096-5106 ISSN 0002-7820 Institutional support: RVO:67985891 Keywords : foams * glassmelting * modelling/model * thermal conductivity Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 2.841, year: 2016
Lu, Xingwen; Ning, Xun-An; Chen, Da; Chuang, Kui-Hao; Shih, Kaimin; Wang, Fei
2018-06-01
This study quantitatively determined the extraction of lead from CRT funnel glass and examined the mechanisms of thermally reducing lead in the products of sintering Pb-glass with carbon in the pre-heated furnace. The experimentally derived results indicate that a 90.3 wt% lead extraction efficiency can be achieved with 20 wt% of C addition at 950 °C for 3 min under air. The formation of viscous semi-liquid glass blocked the oxygen supply between the interaction of C and Pb-glass, and was highly effective for the extraction of metallic Pb. A maximum of 87.3% lead recover was obtained with a C to Na 2 CO 3 ratio of 1/3 at 1200 °C. The decrease of C/Na 2 CO 3 ratio enhanced the metallic lead recovery by increasing the glass viscosity for effective sedimentation of metallic lead in the bottom. However, with the further increase of temperature and treatment time, re-vitrification of lead back to silicate-glass matrix was detected in both Pb-glass/C and Pb-glass/C/Na 2 CO 3 systems. The findings indicated that with proper controls, using C as an inexpensive reagent can effectively reduce treatment time and energy, which is crucial to a waste-to-resource technology for economically recovering lead from the waste CRT glass. Copyright © 2018 Elsevier Ltd. All rights reserved.
Ionic conductivity of ZrF4-BaF2-MFsub(n) fluoride glasses (M : The group I--V metal elements)
International Nuclear Information System (INIS)
Kawamoto, Yoji; Nohara, Ichiro
1985-01-01
To glass transition temperature in argon atmosphere using the complex capacitance and complex impedance methods. The ionic conductivity of glasses, represented by log σ = log σ 0 - ΔE/2.303 kT, was nearly dependent only upon the activation energy. The polarizability of cation was found to be a dominant factor which governs activation energy. Thus, glasses with high meanpolarizability of glass-constituting cations exhibited high ionic conductivity, and the ZrF 4 -BaF 2 -CsF system was suggested to be a promising system that may provide a glass with higher fluoride-ion conduction. (author)
Conductive stability of graphene on PET and glass substrates under blue light irradiation
Cao, Xueying; Liu, Xianming; Li, Xiangdi; Lei, Xiaohua; Chen, Weimin
2018-01-01
Electrical properties of graphene transparent conductive film under visible light irradiation are investigated. The CVD-grown graphene on Polyethylene Terephthalate (PET) and glass substrates for flexible and rigid touch screen display application are chosen for research. The resistances of graphene with and without gold trichloride (AuCl3) doping are measured in vacuum and atmosphere environment under blue light irradiation. Results show that the conductivities of all samples change slowly under light irradiation. The change rate and degree are related to the substrate material, doping, environment and lighting power. Graphene on flexible PET substrate is more stable than that on rigid glass substrate. Doping can improve the electrical conductivity but induce instability under light irradiation. Finally, the main reason resulting in the graphene resistance slowly increasing under blue light irradiation is analyzed.
Transport properties of microwave sintered pure and glass added MgCuZn ferrites
Energy Technology Data Exchange (ETDEWEB)
Madhuri, W., E-mail: madhuriw12@gmail.com [School of Advanced Sciences, VIT University, Vellore 632 014 (India); Penchal Reddy, M.; Kim, Il Gon [Department of Physics, Changwon National University, Changwon 641 773 (Korea, Republic of); Rama Manohar Reddy, N. [Department of Materials Science and Nanotechnology, Yogi Vemana University, Kadapa 516 227 (India); Siva Kumar, K.V. [Ceramic Composites Materials Laboratory, Sri Krishnadevaraya University, Anantapur 515 055 (India); Murthy, V.R.K. [Microwave Laboratory, IIT Madras, Chennai 600 036 (India)
2013-07-01
Highlights: • MgCuZn ferrite was successfully prepared by novel microwave sintering (MS) method. • The sintering temperature was notably reduced from 1150 °C to 950 °C for MS. • Temperature dependence of DC conductivity and AC conductivity are studied. • 1 wt% PBS glass added MS MgCuZn ferrite samples are suitable for core materials in multilayer chip inductors (MLCI). -- Abstract: A series of pure stoichiometric and 1 wt% lead borosilicate (PBS) glass added MgCuZn ferrite with the general formula Mg{sub 0.5}Cu{sub x}Zn{sub 0.5−x}Fe{sub 2}O{sub 4} with x = 0.05, 0.1, 0.15, 0.2, 0.25 and 0.3 were synthesized by microwave sintering technique. Single phase spinel structure is exhibited by the XRD patterns of these ferrites. DC and AC conductivity were investigated as a function of composition, temperature and frequency. DC conductivities were also estimated using the impedance spectroscopy analysis of Cole–Cole plots. The DC conductivities thus obtained are in good agreement with the experimental results. All the investigated samples exhibited two regions of conductivity one in the low temperature and the second in the high temperature region. It is observed that PBS glass added samples have lower conductivities than pure samples. Due to their lower conductivities and sintering temperatures the 1 wt% PBS glass added samples are suitable for multilayer chip inductor (MLCI) and high definition TV deflection yoke material application.
Laser ablation of silicate glasses doped with transuranic actinides
International Nuclear Information System (INIS)
Gibson, J.K.; Haire, R.G.
1998-01-01
Direct sampling laser ablation plasma mass spectrometry (DS-LAMS) was applied to silica glasses doped with 237 Np, 242 Pu or 241 Am using a unique instrument recently installed into a transuranic glovebox. The primary goal was to assess the utility of mass spectrometry of directly ablated ions for facile evaluation of actinide (An) constituents of silicate glass immobilization matrices used for encapsulation of radionuclides. The instrument and general procedures have been described elsewhere. Three high-purity silicate glasses prepared by a sol-gel process (SG) and one conventional high-temperature (HT; melting point ∼ 1,450 C) borosilicate glass were studied. These glasses comprised the following constituents, with compositions expressed in mass percentages: Np-HT ∼ 30% SiO 2 + 6% B 2 O 3 + 3% BaO + 13% Al 2 O 3 + 10% PbO + 30% La 2 O 3 + 8% 237 NpO 2 ; Np-SG ∼ 70% SiO 2 + 30% 237 NpO 2 ; Pu-SG ∼ 70% SiO 2 + 30% 242 PuO 2 ; Am-SG ∼ 85% SiO 2 + 15% 241 AmO 2
Structural and volume changes and their correlation in electron irradiated alkali silicate glasses
International Nuclear Information System (INIS)
Gavenda, Tadeáš; Gedeon, Ondrej; Jurek, Karel
2017-01-01
Highlights: • Volume changes were correlated with both incubation dose and Raman spectra. • Irradiation decreases Si-O-Si angle and increases the amount of three-membered rings. • Levelling of the pits depends on the dose below and above incubation dose. • Restoration of the original structure was limited to low-frequency region. - Abstract: Two binary alkali silicate glasses (15K 2 O·85SiO 2 – denoted as K15 and 15Li 2 O·85SiO 2 – denoted as Li15) were irradiated by 50 keV electron beams with doses within the range of 2.1–15.9 kC/m 2 . Volume changes induced by electron irradiation were monitored by means of Atomic Force Microscopy (AFM). Raman spectra were taken from the irradiated spots to observe structural changes. Volume compaction observed at lower doses was correlated with the increase of the D2 peak. Volume expansion at higher doses was related to migration of alkali ions. Irradiated glasses were annealed at 400 °C and 500 °C for 60 min. After annealing irradiated spots were again examined by AFM and Raman spectroscopy in order to determine volume and structural relaxation of radiation induced changes. Annealing at higher temperatures resulted in the levelling of the pits created by irradiation, but only for doses below incubation dose. The pits created by doses above incubation dose were not levelled. Annealing caused decrease of D2 peak and shift of the Si-O-Si vibrations band in direction to original structure. Low-frequency region of annealed Li15 glass was undistinguishable from that of pristine glass, while annealing of K15 glass did not result in the full reversion to the original shape. The differences between glasses were attributed to higher T g of K15 glass. Q-motives bands of both glasses were not completely restored after annealing due to the absence of alkali ions.
Structural and volume changes and their correlation in electron irradiated alkali silicate glasses
Energy Technology Data Exchange (ETDEWEB)
Gavenda, Tadeáš, E-mail: gavendat@vscht.cz [Department of Glass and Ceramics, University of Chemical Technology, Technicka 5, CZ-166 28 Prague (Czech Republic); Gedeon, Ondrej [Department of Glass and Ceramics, University of Chemical Technology, Technicka 5, CZ-166 28 Prague (Czech Republic); Jurek, Karel [Institute of Physics, Academy of the Czech Republic, Na Slovance 2, CZ-182 21 Prague (Czech Republic)
2017-04-15
Highlights: • Volume changes were correlated with both incubation dose and Raman spectra. • Irradiation decreases Si-O-Si angle and increases the amount of three-membered rings. • Levelling of the pits depends on the dose below and above incubation dose. • Restoration of the original structure was limited to low-frequency region. - Abstract: Two binary alkali silicate glasses (15K{sub 2}O·85SiO{sub 2} – denoted as K15 and 15Li{sub 2}O·85SiO{sub 2} – denoted as Li15) were irradiated by 50 keV electron beams with doses within the range of 2.1–15.9 kC/m{sup 2}. Volume changes induced by electron irradiation were monitored by means of Atomic Force Microscopy (AFM). Raman spectra were taken from the irradiated spots to observe structural changes. Volume compaction observed at lower doses was correlated with the increase of the D2 peak. Volume expansion at higher doses was related to migration of alkali ions. Irradiated glasses were annealed at 400 °C and 500 °C for 60 min. After annealing irradiated spots were again examined by AFM and Raman spectroscopy in order to determine volume and structural relaxation of radiation induced changes. Annealing at higher temperatures resulted in the levelling of the pits created by irradiation, but only for doses below incubation dose. The pits created by doses above incubation dose were not levelled. Annealing caused decrease of D2 peak and shift of the Si-O-Si vibrations band in direction to original structure. Low-frequency region of annealed Li15 glass was undistinguishable from that of pristine glass, while annealing of K15 glass did not result in the full reversion to the original shape. The differences between glasses were attributed to higher T{sub g} of K15 glass. Q-motives bands of both glasses were not completely restored after annealing due to the absence of alkali ions.
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
Miyoshi, K.; Buckley, D. H.
1982-01-01
X-ray photoelectron spectroscopy analysis, transmission electron microscopy, diffraction studies, and sliding friction experiments were conducted with ferrous-base metallic glasses in sliding contact with aluminum oxide at temperatures from room to 750 C in a vacuum of 30 nPa. The results indicate that there is a significant temperature influence on the friction properties, surface chemistry, and microstructure of metallic glasses. The relative concentrations of the various constituents at the surface of the sputtered specimens were very different from the normal bulk compositions. Contaminants can come from the bulk of the material to the surface upon heating and impart boric oxide and silicon oxide at 350 C and boron nitride above 500 C. The coefficient of friction increased with increasing temperature to 350 C. Above 500 C the coefficient of friction decreased rapidly. The segregation of contaminants may be responsible for the friction behavior.
Synthesis of 1-13C-1-indanone and 2-13C-1,2,3,4-tetrahydroquinoline
International Nuclear Information System (INIS)
Pickering, R.E.; Wysocki, M.A.; Eisenbraun, E.J.
1985-01-01
The synthesis of 2- 13 C-1,2,3,4-tetrahydroquinoline (5) via 1- 13 C-3-phenylpropanoic acid (1), 1- 13 C-1-indanone (2), 1- 13 C-1-indanone hydrazone (3) and 2- 13 C-3,4-dihydro-2(1H)-quinolinone (4) proceeded in 78, 96, 95, 79, and 85% individual yields respectively for 1, 2, 3, 4, 5 and 61% overall yield of the latter from 1. (author)
International Nuclear Information System (INIS)
Momoshima, Noriyuki; Inoue, Fumio; Sugihara, Shinji; Shimada, Jun; Taniguchi, Makoto
2010-01-01
Atmospheric 85 Kr concentration at Fukuoka, Japan was determined by an improved 85 Kr analytical method using liquid scintillation counting (LSC). An average value of 1.54 ± 0.05 Bq m -3 was observed in 2008, which is about two times that measured in 1981 at Fukuoka, indicating a 29 mBq y -1 rate of increase as an average for these 27 years. The analytical method developed involves collecting Kr from air using activated charcoal at liquid N 2 temperature and purifying it using He at dry ice temperature, followed by Kr separation by gas chromatography. An overall Kr recovery of 76.4 ± 8.1% was achieved when Kr was analyzed in 500-1000 l of air. The Kr isolated by gas chromatography was collected on silica gel in a quartz glass vial cooled to liquid N 2 temperature and the activity of 85 Kr was measured with a low-background LS counter. The detection limit of 85 Kr activity by the present analytical method is 0.0015 Bq at a 95% confidence level, including all propagation errors, which is equivalent with 85 Kr in 1.3 l of the present air under the analytical conditions of 72.1% counting efficiency, 0.1597 cps background count rate, and 76.4% Kr recovery.
Characterisation of the glass transition of an amorphous drug using modulated DSC.
Royall, P G; Craig, D Q; Doherty, C
1998-07-01
The use of modulated differential scanning calorimetry (MDSC) as a novel means of characterising the glass transition of amorphous drugs has been investigated, using the protease inhibitor saquinavir as a model compound. In particular, the effects of measuring variables (temperature cycling, scanning period, heating mode) have been examined. Saquinavir samples of known moisture content were examined using a TA Instruments 2920 MDSC at a heating rate of 2 degrees C/min and an amplitude of +/-0.159 degrees C with a period of 30 seconds. These conditions were used to examine the effects of cycling between - 50 degrees C and 150 degrees C. A range of periods between 20 and 50 seconds were then studied. Isothermal measurements were carried out between 85 degrees C and 120 degrees C using an amplitude of +/-0.159 degrees C with a period of 30 seconds. MDSC showed the glass transition of saquinavir (0.98 +/- 0.05%w/w moisture content) in isolation from the relaxation endotherm to give an apparent glass transition temperature of 107.0 degrees C +/- 0.4 degrees C. Subsequent temperature cycling gave reproducible glass transition temperatures of approximately 105 degrees C for both cooling and heating cycles. The enthalpic relaxation peak observed in the initial heating cycle had an additional contribution from a Tg "shift" effect brought about by the difference in response to the glass transition of the total and reversing heat flow signals. Isothermal studies yield a glass transition at 105.9 degrees C +/- 0.1 degrees C. MDSC has been shown to be capable of separating the glass transition of saquinavir from the relaxation endotherm, thereby facilitating measurement of this parameter without the need for temperature cycling. However, the Tg "shift" effect and the number of modulations through the transition should be taken into account to avoid drawing erroneous conclusions from the experimental data. MDSC has been shown to be an effective method of characterising the glass
Thomas Illing; Heinrich Gotzig; Marcus Schoßig; Christian Bierögel; Wolfgang Grellmann
2016-01-01
The hygrothermal aging of short glass fiber-reinforced polyamide 6 materials (PA6 GF) represents a major problem, especially in thin-walled components, such as in the automotive sector. In this study, therefore, the thickness and the glass fiber content of PA6 GF materials were varied and the materials were exposed to hygrothermal aging. The temperature and relative humidity were selected in the range from −40 °C up to 85 °C, and from 10% up to 85% relative humidity (RH). In the dry-as-molded...
Evaluation of Foaming Behavior of Glass Melts by High-Temperature Microscopy
DEFF Research Database (Denmark)
Petersen, Rasmus Rosenlund; König, Jakob; Yue, Yuanzheng
2016-01-01
Optical monitoring techniques can record in situ the size of glass samples during a dynamic heating process. This allowed us to study sintering and expansion rate of panel glass from cathode ray tube using MnO2 as foaming agent. We show the maximum expansion rate of glass melt foaming (in situ va...... such as type and concentration of foaming agent, glass composition and particle size to obtain foam glass with high porosity and closed pores. Using this approach we show that the foaming of bottle glass is preferentially conducted at a SiC concentration of 1‒4 wt%....
Influence of foaming agents on both the structure and the thermal conductivity of silicate glasses
DEFF Research Database (Denmark)
Østergaard, Martin Bonderup; Petersen, Rasmus Rosenlund; König, Jakob
Foam glass is one of the most promising insulation materials for constructions since it has low thermal conductivity, high compressive strength, non-water permeability, and high fire resistance. They can be produced using cullet sources, e.g., cathode ray tubes (CRT) panel glass, and foaming agents...... such as metal carbonates, or oxidizing transition metal oxides combined with carbonaceous sources. In this work, we mix CRT panel glass powder with different foaming agents: CaCO3 (0-4 wt%), Fe2O3 (0-6 wt%), and MnxOy (0-10 wt%). The powder mixtures are sintered in the range between the glass transition...
Enhancing the Electronic Conductivity of Vanadium-tellurite Glasses by Tuning the Redox State
DEFF Research Database (Denmark)
Kjeldsen, Jonas; Yue, Yuanzheng
Transition metal oxides are used in a variety of electronic purposes, e.g., vanadium tellurite as cathode material in high-power demanding batteries. By tuning the redox state of vanadium, it is possible to achieve a lower internal resistance within the entire battery unit, thus a higher capacity....... In this work we vary the redox state of a given vanadium tellurite system by performing post heat-treatment in controlled atmosphere. This process is in theory not limited only to varying electronic conductivity, but also varying the glass structure, and hence, changing properties of the glasses, e.g, thermal...... and mechanical properties. Finally we give insight into the relation between the redox state and electronic conductivity....
Thermal properties and crystallization of lithium–mica glass and glass-ceramics
International Nuclear Information System (INIS)
Nia, A. Faeghi
2013-01-01
Highlights: • Two groups of Li–mica glass-ceramics, have been compared. • By controlling the glass composition, crystalline lepidolite was obtained. • The T p of Li–mica was through the previous virgilite and eucryptite phase. - Abstract: The purpose of this study was the synthesis of two groups of Li–mica glass-ceramics denoted by lepidolite (Al 2.5 F 2 KLi 1.5 O 10 Si 3 ) and Li-phlogopite (LiMg 3 AlSi 3 O 10 F 2 ). The studied system was SiO 2 –Al 2 O 3 –MgO–K 2 O–Li 2 O. A total of 3 compositions were prepared. Bulk casted glasses and sintered glass-ceramics of Li-phlogopite and lepidolite systems, were prepared. Eucryptite and virgilite were two prior phases of lepidolite and Li-phlogopite crystallization. It was shown that the obtained glass-ceramics have lower TEC than corresponding glasses. Sinterability of lepidolite glass-ceramic was shown that improved by increasing the Al 2 O 3 content in glass composition. TEC and microhardness values were α = 6.08 × 10 −6 /°C, 755 ± 11.1, α = 7.86 × 10 −6 /°C, 739 ± 7.4 and α = 5.05 × 10 −6 /°C, 658 ± 6.2 HV for Li-lep, Klep1 and Klep2 glasses, respectively
International Nuclear Information System (INIS)
Katoh, Yutai; Kotani, M.; Kohyama, A.; Montorsi, M.; Salvo, M.; Ferraris, M.
2000-01-01
Calcia-alumina (CA) glass-ceramic was studied as a candidate low-activation joining and sealing material for SiC/SiC components for fusion blanket and diverter structures, in terms of microstructural stability and mechanical properties. The CA glass-ceramic joining and seal coating were applied to the Hi-Nicalon TM SiC fiber-reinforced SiC matrix composites in which the matrix had been formed through chemical vapor infiltration and polymer impregnation and pyrolysis methods. Microstructural characterization was carried out for the joined and coated materials by optical and scanning electron microscopy (SEM). The mechanical property of the joint was evaluated through a shear test on sandwich joints. The average shear strength of the joined structures was 28 MPa at room temperature. Fractography revealed that the fracture occurred in the glass phase and the shear strength may be improved by reduction of the glass fraction
Energy Technology Data Exchange (ETDEWEB)
Clark, E; Marie Kane, M
2008-12-12
Four formulations of EPDM (ethylene-propylene diene monomer) elastomer were exposed to tritium gas initially at one atmosphere and ambient temperature for between three and four months in closed containers. Material properties that were characterized include density, volume, mass, appearance, flexibility, and dynamic mechanical properties. The glass transition temperature was determined by analysis of the dynamic mechanical property data per ASTM standards. EPDM samples released significant amounts of gas when exposed to tritium, and the glass transition temperature increased by about 3 C. during the exposure. Effects of ultraviolet and gamma irradiation on the surface electrical conductivity of two types of polyaniline films are also documented as complementary results to planned tritium exposures. Future work will determine the effects of tritium gas exposure on the electrical conductivity of polyaniline films, to demonstrate whether such films can be used as a sensor to detect tritium. Surface conductivity was significantly reduced by irradiation with both gamma rays and ultraviolet light. The results of the gamma and UV experiments will be correlated with the tritium exposure results.
Energy Technology Data Exchange (ETDEWEB)
KRUGER AA; MATLACK KS; PEGG IL
2011-12-29
Eight tests using different HLW feeds were conducted on the DM100-BL to determine the effect of variations in glass properties and feed composition on processing rates and melter conditions (off-gas characteristics, glass processing, foaming, cold cap, etc.) at constant bubbling rate. In over seven hundred hours of testing, the property extremes of glass viscosity, electrical conductivity, and T{sub 1%}, as well as minimum and maximum concentrations of several major and minor glass components were evaluated using glass compositions that have been tested previously at the crucible scale. Other parameters evaluated with respect to glass processing properties were +/-15% batching errors in the addition of glass forming chemicals (GFCs) to the feed, and variation in the sources of boron and sodium used in the GFCs. Tests evaluating batching errors and GFC source employed variations on the HLW98-86 formulation (a glass composition formulated for HLW C-106/AY-102 waste and processed in several previous melter tests) in order to best isolate the effect of each test variable. These tests are outlined in a Test Plan that was prepared in response to the Test Specification for this work. The present report provides summary level data for all of the tests in the first test matrix (Matrix 1) in the Test Plan. Summary results from the remaining tests, investigating minimum and maximum concentrations of major and minor glass components employing variations on the HLW98-86 formulation and glasses generated by the HLW glass formulation algorithm, will be reported separately after those tests are completed. The test data summarized herein include glass production rates, the type and amount of feed used, a variety of measured melter parameters including temperatures and electrode power, feed sample analysis, measured glass properties, and gaseous emissions rates. More detailed information and analysis from the melter tests with complete emission chemistry, glass durability, and
Effect of CeO2 addition on electrical and optical properties of lithium borate glasses
International Nuclear Information System (INIS)
Gedam, R.S.; Ramteke, D.D.
2011-01-01
Rare earth (RE) ions play an important role in modern technology as an active ion in many optical materials. RE-doped glasses were used in many optical devices because of abundant number of the absorption and emission bands arising from the transitions between the RE elements energy levels. Among all rare earth, glasses containing CeO 2 are extensively studied for scintillating applications. Radiation length of CeO 2 containing lithium silicate glasses decreases and absorption edge in transmittance shift towards longer wavelength. In the present study an attempt has been made to verify similar results in borate containing glasses. Therefore glass series 15Li 2 O-xCeO 2 -(85''x)B 2 O 3 where x= 0.25, 0.5, 0.75, 1 mol% was prepared by conventional melt quench technique. Their electrical and optical properties have been investigated. It is observed that the conductivity of these glasses decreases while density, glass transition temperature and refractive index increases with the addition of CeO 2 . The conductivity of the glasses is mostly controlled by the activation energy. Since the lithium fraction in the present series is kept constant, the decrease in conductivity for glasses may be attributed to the reduction in the number of available vacant sites for the mobile lithium ions when boron is substituted with CeO 2 . The radiation length was determined using density values and it was found to decrease with the addition of CeO 2 . The absorption coefficient a were determined near the absorption edge of different photon energy for all glass samples and plot of (αhν) 1/2 Vs. hν (Tauc's plot) is shown. It is observed that the optical band gap energy (E g Opt ) decreases with the addition of CeO 2
Investigation of electrical and optical properties of Ge-Ga-As-S glasses doped with rare-earth ions
Czech Academy of Sciences Publication Activity Database
Zavadil, Jiří; Kubliha, M.; Kostka, Petr; Iovu, M.; Labaš, V.; Ivanova, Z.G.
-, č. 377 (2013), s. 85-89 ISSN 0022-3093 R&D Projects: GA ČR GAP106/12/2384; GA MŠk 7AMB12SK147 Institutional support: RVO:67985882 ; RVO:67985891 Keywords : Chalcogenide glass * Direct electrical conductivity * Photoluminescence Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering; DB - Geology ; Mineralogy (USMH-B) Impact factor: 1.716, year: 2013
Bischoff, Christian; Schuller, Katherine; Martin, Steve W
2014-04-03
The 0.5Na2S + 0.5[xGeS2 + (1 - x)PS5/2] mixed glass former (MGF) glass system exhibits a nonlinear and nonadditive negative change in the Na(+) ion conductivity as one glass former, PS5/2, is exchanged for the other, GeS2. This behavior, known as the mixed glass former effect (MGFE), is also manifest in a negative deviation from the linear interpolation of the glass transition temperatures (T(g)) of the binary end-member glasses, x = 0 and x = 1. Interestingly, the composition dependence of the densities of these ternary MGF glasses reveals a slightly positive MGFE deviation from a linear interpolation of the densities of the binary end-member glasses, x = 0 and x = 1. From our previous studies of the structures of these glasses using IR, Raman, and NMR spectroscopies, we find that a disproportionation reaction occurs between PS7/2(4-) and GeS3(2-) units into PS4(3-) and GeS5/2(1-) units. This disproportionation combined with the formation of Ge4S10(4-) anions from GeS5/2(1-) groups leads to the negative MGFE in T(g). A best-fit model of the T(g)s of these glasses was developed to quantify the amount of GeS5/2(1-) units that form Ge4S10(4-) molecular anions in the ternary glasses (∼ 5-10%). This refined structural model was used to develop a short-range structural model of the molar volumes, which shows that the slight densification of the ternary glasses is due to the improved packing efficiency of the germanium sulfide species.
Novajra, G; Boetti, N G; Lousteau, J; Fiorilli, S; Milanese, D; Vitale-Brovarone, C
2016-10-01
Novel bone glass fibre scaffolds were developed by thermally bonding phosphate glass fibres belonging to the P2O5-CaO-Na2O-SiO2-MgO-K2O-TiO2 system (TiPS2.5 glass). Scaffolds with fibres of 85 or 110μm diameter were fabricated, showing compressive strength in the range of 2-3.5MPa, comparable to that of the trabecular bone. The effect of different thermal treatments and fibre diameters and length on the final scaffold structure was investigated by means of micro-CT analysis. The change of the sintering time from 30 to 60min led to a decrease in the scaffold overall porosity from 58 to 21vol.% for the 85μm fibre scaffold and from 50 to 40vol.% when increasing the sintering temperature from 490 to 500°C for the 110μm fibre scaffold. The 85μm fibres resulted in an increase of the scaffold overall porosity, increased pore size and lower trabecular thickness; the use of different fibre diameters allowed the fabrication of a scaffold showing a porosity gradient. In order to impart bioactive properties to the scaffold, for the first time in the literature the introduction in these fibre scaffolds of a bioactive phase, a melt-derived bioactive glass (CEL2) powder or spray-dried mesoporous bioactive glass particles (SD-MBG) was investigated. The scaffold bioactivity was assessed through soaking in simulated body fluid. CEL2/glass fibre scaffold did not show promising results due to particle detachment from the fibres during soaking in simulated body fluid. Instead the use of mesoporous bioactive powders showed to be an effective way to impart bioactivity to the scaffold and could be further exploited in the future through the ability of mesoporous particles to act as systems for the controlled release of drugs. Copyright © 2016 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Yu, Jiajie [Chemicobiology and Functional Materials Institute, Nanjing University of Science and Technology, Nanjing 210094 (China); Shen, Muzhong [School of Engineering, AnHui Agricultural University, Hefei 230036 (China); Liu, Siyu; Li, Feng [Chemicobiology and Functional Materials Institute, Nanjing University of Science and Technology, Nanjing 210094 (China); Sun, Dongping, E-mail: sundpe301@163.com [School of Engineering, AnHui Agricultural University, Hefei 230036 (China); Wang, Tianhe, E-mail: thwang56@126.com [Chemicobiology and Functional Materials Institute, Nanjing University of Science and Technology, Nanjing 210094 (China)
2017-06-01
Graphical abstract: A simple technique for direct growth of gold nanoparticles (GNPs) into a nanostructured porous alumina layer on conductive glass slide (PAOCG). Gold was uniformly distributed in porous alumina layer. Au/PAOCG can serve as a portable, durable and reusable SERS substrate. - Highlights: • A simple method of producing nanoporous alumina layer on conductive glasses. • A facile technique for direct growth of gold nanoparticles (GNPs) into PAOCG. • It presents a general protocol for preparation of (MNPs) on conductive glasses. • Au/PAOCG exhibits high SERS sensitivity and excellent reusability. - Abstract: In this paper, we describe a simple technique for direct growth of gold nanoparticles (GNPs) into a nanostructured porous alumina layer on conductive glass slide (PAOCG). PAOCG was attached firmly with a small piece of steel and was then immersed in a HAuCl{sub 4} solution. Electro-induced electrons from steel were employed to reduce AuCl{sub 4}{sup −} on PAOCG. The galvanic replacement reaction (GRR) was adopted as the fundamental mechanism for reducing metal precursors. This mechanism was further studied by open circuit potential-time (OCP-t) experiment and the result demonstrated that steel induced the continuous proceeding of this reaction. This strategy presents a simple and general protocol for preparation of metal nanoparticles (MNPs) on conductive glass substrates. The SERS properties of Au/PAOCG were investigated using aqueous crystal violet (CV) and 4-mercaptopyridine (4-Mpy) as probe molecules. Au/PAOCG allowed as low as 10{sup −9} M CV and 10{sup −8} M 4-Mpy to be detected. The reusability of this substrate was achieved by measuring the SERS spectrum of the probe molecules followed with a 400 °C heat treatment for 10 min to remove the residuals. This substrate could be reused for at least ten cycles without any significantly reduced SERS performance. Therefore, this surface can serve as a portable, durable and reusable SERS
46 CFR 221.85 - Hearing procedures.
2010-10-01
... § 221.85 Hearing procedures. (a) The Hearing Officer shall conduct a fair and impartial proceeding in... the authentication of any written exhibit or statement. (c) At the close of the Party's presentation...
Enhanced LAW Glass Correlation - Phase 1
Energy Technology Data Exchange (ETDEWEB)
Muller, Isabelle S. [The Catholic Univ. of America, Washington, DC (United States). Vitreous State Lab.; Matlack, Keith S. [The Catholic Univ. of America, Washington, DC (United States). Vitreous State Lab.; Pegg, Ian L. [The Catholic Univ. of America, Washington, DC (United States). Vitreous State Lab.; Joseph, Innocent [Atkins Energy Federal EPC, Inc., Columbia, MD (United States)
2016-12-01
About 50 million gallons of high-level mixed waste is currently stored in underground tanks at the United States Department of Energy’s (DOE’s) Hanford site in the State of Washington. The Hanford Tank Waste Treatment and Immobilization Plant (WTP) will provide DOE’s Office of River Protection (ORP) with a means of treating this waste by vitrification for subsequent disposal. The tank waste will be separated into low- and high-activity waste fractions, which will then be vitrified respectively into Immobilized Low Activity Waste (ILAW) and Immobilized High Level Waste (IHLW) products. The ILAW product will be disposed in an engineered facility on the Hanford site while the IHLW product is designed for acceptance into a national deep geological disposal facility for high-level nuclear waste. The ILAW and IHLW products must meet a variety of requirements with respect to protection of the environment before they can be accepted for disposal. Acceptable glass formulations for vitrification of Hanford low activity waste (LAW) must meet a variety of product quality, processability, and waste loading requirements. To this end, The Vitreous State Laboratory (VSL) at The Catholic University of America (CUA) developed and tested a number of glass formulations during Part A, Part B1 and Part B2 of the WTP development program. The testing resulted in the selection of target glass compositions for the processing of eight of the Phase I LAW tanks. The selected glass compositions were tested at the crucible scale to confirm their compliance with ILAW performance requirements. Duramelter 100 (DM100) and LAW Pilot Melter tests were then conducted to demonstrate the viability of these glass compositions for LAW vitrification at high processing rates.
a.c. conductance study of polycrystal C{sub 60}
Energy Technology Data Exchange (ETDEWEB)
Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure
1995-06-05
The a.c. (1
Role of P{sub 2}O{sub 5} on protonic conduction in sol-gel-derived binary phosphosilicate glasses
Energy Technology Data Exchange (ETDEWEB)
Wang, C.; Abe, Y.; Kasuga, T.; Nogami, M. [Nagoya Institute of Technology, Aichi (Japan). Dept. of Materials Sceince and Engineering
1999-11-01
Sol-gel derived P{sub 2}O{sub 5}-SiO{sub 2} glasses were studied and a remarkable improvement in protonic conduction was observed by increasing the P{sub 2}O{sub 5} content. This was attributed to (1) the variation in glass structure including the reduction of the degree of cross-linking skeleton and the increase of specific surface area of glass due to the non-bridging oxygen (P=O) in P-O tetrahedron, (2) the formation of stronger hydrogen bond between hydroxyl group and P=O group as well as hydroxyl group and, (3) the p-{pi} resonance effect in O{sub (3-t)}PO(OH){sub t} unit. (author)
Fabrication of highly insulating foam glass made from CRT panel glass
DEFF Research Database (Denmark)
König, Jakob; Petersen, Rasmus Rosenlund; Yue, Yuanzheng
2015-01-01
We prepared low-density foam glasses from cathode-ray-tube panel glass using carbon and MnO2 as the foaming agents. We investigated the influence of the carbon and MnO2 concentrations, the glass-powder preparation and the foaming conditions on the density and homogeneity of the pore structure...... and the dependence of the thermal conductivity on the foam density. The results show that the moderate foaming effect of the carbon is greatly improved by the addition of MnO2. A density as low as 131 kg m-3 can be achieved with fine glass powder. The foam density has a slight dependence on the carbon and MnO2...... concentrations, but it is mainly affected by the foaming temperature and the time. The thermal conductivity of the foam-glass samples is lower than that of commercial foam glasses with the same density. The lowest value was determined to be 42 mW m-1 K-1 for a foam glass with a density of 131 kg m-3. A further...
37 CFR 1.85 - Corrections to drawings.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Corrections to drawings. 1.85... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions The Drawings § 1.85 Corrections to drawings. (a) A utility or plant application will not be placed on the files for examination...
New insight into atmospheric alteration of alkali-lime silicate glasses
International Nuclear Information System (INIS)
Alloteau, Fanny; Lehuédé, Patrice; Majérus, Odile; Biron, Isabelle; Dervanian, Anaïs; Charpentier, Thibault; Caurant, Daniel
2017-01-01
Highlights: •Glass silicate network hydrolysis is by far the predominant reaction at 80 °C. •Atmospheric conditions yield different altered layer structure than in immersion. •The altered layer bears about 10 wt% of water mainly as H-bonded SiOH groups. •Alkali ions stay embedded into the altered layer closed to SiOH and H 2 O species. -- Abstract: A mixed alkali lime silicate glass altered in atmospheric conditions (80 °C/85%RH, Relative Humidity) for various lengths of time was characterized at all scales. The altered glass forms a hydrated solid phase bearing about 10 wt% of H 2 O in the form of Si-OH groups and molecular water. No alkali depletion was observed after ageing tests. Structural results from 1 H, 23 Na and 29 Si MAS NMR point out the close proximity of Si-OH, H 2 O and Na + species. This study gives new insight into the mechanisms of the atmospheric alteration, essential to conservation strategies in industry and cultural heritage.
Viljoen, Albertus; Richard, Matthias; Nguyen, Phuong Chi; Fourquet, Patrick; Camoin, Luc; Paudal, Rishi R; Gnawali, Giri R; Spilling, Christopher D; Cavalier, Jean-François; Canaan, Stéphane; Blaise, Mickael; Kremer, Laurent
2018-02-23
An increasing prevalence of cases of drug-resistant tuberculosis requires the development of more efficacious chemotherapies. We previously reported the discovery of a new class of cyclipostins and cyclophostin (CyC) analogs exhibiting potent activity against Mycobacterium tuberculosis both in vitro and in infected macrophages. Competitive labeling/enrichment assays combined with MS have identified several serine or cysteine enzymes in lipid and cell wall metabolism as putative targets of these CyC compounds. These targets included members of the antigen 85 (Ag85) complex ( i.e. Ag85A, Ag85B, and Ag85C), responsible for biosynthesis of trehalose dimycolate and mycolylation of arabinogalactan. Herein, we used biochemical and structural approaches to validate the Ag85 complex as a pharmacological target of the CyC analogs. We found that CyC 7β , CyC 8β , and CyC 17 bind covalently to the catalytic Ser 124 residue in Ag85C; inhibit mycolyltransferase activity ( i.e. the transfer of a fatty acid molecule onto trehalose); and reduce triacylglycerol synthase activity, a property previously attributed to Ag85A. Supporting these results, an X-ray structure of Ag85C in complex with CyC 8β disclosed that this inhibitor occupies Ag85C's substrate-binding pocket. Importantly, metabolic labeling of M. tuberculosis cultures revealed that the CyC compounds impair both trehalose dimycolate synthesis and mycolylation of arabinogalactan. Overall, our study provides compelling evidence that CyC analogs can inhibit the activity of the Ag85 complex in vitro and in mycobacteria, opening the door to a new strategy for inhibiting Ag85. The high-resolution crystal structure obtained will further guide the rational optimization of new CyC scaffolds with greater specificity and potency against M. tuberculosis . © 2018 by The American Society for Biochemistry and Molecular Biology, Inc.
Mögelin, H.; Yao, G.; Zhong, H.; dos Santos, A. R.; Barascu, A.; Meyer, R.; Krenkel, S.; Wassersleben, S.; Hickmann, T.; Enke, D.; Turek, T.; Kunz, U.
2018-02-01
The improvement of redox-flow batteries requires the development of chemically stable and highly conductive separators. Porous glass membranes can be an attractive alternative to the nowadays most common polymeric membranes. Flat porous glass membranes with a pore size in the range from 2 to 50 nm and a thickness of 300 and 500 μm have been used for that purpose. Maximum values for voltage efficiency of 85.1%, coulombic efficiency of 97.9% and energy efficiency of 76.3% at current densities in the range from 20 to 60 mA cm-2 have been achieved. Furthermore, a maximum power density of 95.2 mW cm-2 at a current density of 140 mA cm-2 was gained. These results can be related to small vanadium crossover, high conductivity and chemical stability, confirming the great potential of porous glass membranes for vanadium redox-flow applications.
El-Bashir, S. M.; Alwadai, N. M.; AlZayed, N.
2018-02-01
Polymer nanocomposite films were prepared by doping fullerene C60 in polymer blend composed of polymethacrylate/polyvinyl acetate blends (PMMA/PVAc) using solution cast technique. The films were characterized by differential scanning calorimeter (DSC), Transmission electron microscope (TEM), DC/AC electrical conductivity and dielectric measurements in the frequency range (100 Hz- 1 MHz). The glass transition temperature, Tg, was increased by increasing the concentration of fullerene C60; this property reflects the increase of thermal stability by increasing the nanofiller content. The DC and AC electrical conductivities were enhanced by increasing C60 concentration due to the electron hopping or tunneling between filled and empty localized states above Tg. The relaxation time was determined from the αβ -relaxations and found to be attenuated by increasing the temperature as a typical behavior of amorphous polymers. The calculated values of thermodynamic parameters revealed the increase of molecular stability by increasing the doping concentration; this feature supports the application of PMMA/PVAc/C60 nanocomposite films in a wide scale of solar energy conversion applications such as luminescent down-shifting (LDS) coatings for photovoltaic cells.
International Nuclear Information System (INIS)
Hrma, P.; Piepel, G.F.; Smith, D.E.; Redgate, P.E.; Schweiger, M.J.
1993-04-01
Viscosity and electrical conductivity of 79 simulated borosilicate glasses in the expected range of compositions to be produced in the Hanford Waste Vitrification Plant were measured within the temperature span from 950 to 1250 degree C. The nine major oxide components were SiO 2 , B 2 O 3 , Li 2 O, Na 2 O, CaO, MgO, Fe 2 O 3 , Al 2 O 3 , and ZrO 2 . The test compositions were generated statistically. The data were fitted by Fulcher and Arrhenius equations with temperature coefficients being multilinear functions of the mass fractions of the oxide components. Mixture models were also developed for the natural logarithm of viscosity and that of electrical conductivity at 1150 degree C. Least squares regression was used to obtain component coefficients for all the models
Studies on Bi-Sr-Ca-Cu-O glasses and superconducting glass ceramics
International Nuclear Information System (INIS)
Singh, R.; Zacharias, E.
1991-01-01
Bi-Sr-Ca-Cu-O glasses and glass ceramics of various compositions were synthesised. The glass transition temperature varies from 396 to 422degC depending on the glass composition. The bulk glass ceramics of 4334, 4336, 2223 and 4246 compositions show superconductivity when the corresponding glass samples were heat-treated in air at 820degC for 3, 9, 12 and 24 h respectively. X-ray diffraction studies show that the superconducting phase present in all these compositions is Bi 2 Sr 2 Ca 1 Cu 2 O x . The 4334 glass ceramic is almost a single-phase material with a preferred orientation such that the c axis is normal to the sample surface. The 2223 glass ceramic has a higher T c (onset) than the other three compositions indicating the presence of high T c phase (110 K) also. ESR studies on the glass samples indicate the existence of Cu 2+ . The effect of heat treatment on ESR shows that the intensity of resonance decreases with increase in heat-treatment duration. This effect is more pronounced for the 4334 and 2223 compositions. The advantages of synthesizing superconducting materials by glass route are discussed in view of practical applications. (author). 9 refs., 6 figs
Relative leach behavior of waste glasses and naturally occurring glasses
International Nuclear Information System (INIS)
Adams, P.B.
1979-01-01
Simulated nuclear waste glasses of the sodium-borosilicate type with a low waste loading and of the zinc-borosilicate type with a high waste loading have been compared with obsidians. The resuls indicate that the waste glasses would corrode in normal natural environments at a rate of about 0.1 μm per year at 30 0 C and about 5 μm per year at 90 0 C, compared with obsidians which seem to corrode at, or less than, about 0.01 μm per year at 30 0 C and less than 1 μm per year at 90 0 C. Activation energies for reactions of the two waste glasses with pure water are about 20 kcal/g-mol. 3 figures, 7 tables
Characterization of Fe -doped silver phosphate glasses
Indian Academy of Sciences (India)
... to their several spe- cial properties such as large thermal expansion coefficients, ... increase the conductivity of these glasses is to increase the modifier or dopant ... phosphate glasses were measured by the a.c. impedance spectroscopic .... and Fe2O3-doped Ag2O–P2O5 glasses were determined from. DSC curves and ...
Glass formation and properties in the gallia-calcia system
Whichard, G.; Day, D. E.
1984-01-01
The critical cooling rate for glass formation was measured for five compositions in the Ga2O3-CaO system and varied from a low of (315 + or - 85) C/s for a eutectic melt containing 37.5 mol pct Ga2O3 to a high of (840 + or - 60) C/s for a melt containing 52 mol pct Ga2O3. The density and refractive index both increased with increasing Ga2O3 content, but the crystallization temperature and microhardness varied only slightly. The IR spectra of these glasses suggest that both GaO4 tetrahedra and GaO6 octahedra are present.
Surface Decontamination Studies of Cs-137 and Sr-85 Using Polymer Gel
International Nuclear Information System (INIS)
Pham, L.; Nguyen, C.; Nguyen, L.
2015-01-01
Strippable polymer coating is one of the methods for effective surface decontamination to remove isotopes on the contaminated surface. This method is applying in nuclear facilities on the World. In this paper, we present the results obtained in our laboratory from product the polymer coating to apply to remove radioisotopes of "1"3"7Cs and "8"5Sr from surface of glass, stainless steel, mild steel, ceramic, PVC plastic. This polymer gel solution consist of water soluble polymer preferably polyvinyl alcohol (PVA), plasticizing agent (glycerine) and chelating agents, (citric acid) which can be sprayed or pasted on to contaminated surface. After some hours, these gel solutions was dried to form a strong thin film and it was easily peeled off from a contaminated surface with the radioactive isotopes and can be disposed off as radioactive solid waste. In this study infrared spectrophotometry technique was used to examine the interaction of the cesium and strontium ions with polyvinyl alcohol (PVA), polymer gel and the results of the study were also presented. The results showed that decontamination efficiency of "1"3"7Cs and "8"5Sr strongly depended on property, porosity and smoothness of the contaminated surface and obtained from 95-99% on glass and stainless steel, ceramic and PVC plastic surfaces. The decontamination efficiency also depended on activity and coating thickness. Optimization of film thickness is around 0.2 mm. Decontamination efficiency of Polymer gel were compared with Decongel 1101 (product from USA) on surfaces. IR spectra studies indicated that Cs and Sr ions interacted with PVA and citric acid in Polymer gel through cacboxyl (C = O) group. Polymer gel could remove of "1"3"7Cs and "8"5Sr better than PVA gel does because of citric acid, which can form chelating complex with Cs and Sr ion. (author)
Cesium Hydroxide Fusion Dissolution of Analytical Reference Glass-1 in Both Powder and Shard Form
International Nuclear Information System (INIS)
Coleman, C.J.; Spencer, W.A.
1998-04-01
CsOH has been shown to be an effective and convenient dissolution reagent for Analytical Reference Glass-1 (ARG-1). This glass standard was prepared from nonradioactive DWPF Start-up Glass. Therefore, its composition is similar to DWPF product glass and many of the glass matrices prepared at SRTC.The principal advantage of the CsOH fusion dissolution is that the reagent does not add the alkali metals Li, Na, and K usually needed by SRS customers. Commercially available CsOH is quite pure so that alkali metals can be measured accurately, often without blank corrections. CsOH fusions provide a single dissolution method for applicable glass to replace multiple dissolution schemes used by most laboratories. For example, SRTC glass samples are most commonly dissolved with a Na 2 O 2 -NaOH fusion (ref.1) and a microwave- assisted acid dissolution with HNO 3 -HF-H 3 BO 3 -HCl (ref.2). Othe laboratories use fusion methods based on KOH, LiBO 2 , and Na 2 CO 3 CsOH fusion approach reduces by half not only the work in the dissolution laboratory, but also in the spectroscopy laboratories that must analyze each solution.Experiments also revealed that glass shards or pellets are rapidly attacked if the flux temperature is raised considerably above the glass softening point. The softening point of ARG-1 glass is near 650 degrees C. Fusions performed at 750 degrees C provided complete dissolutions and accurate elemental analyses of shards. Successful dissolution of glass shards was demonstrated with CsOH, Na 2 O 2 , NaOH, KOH, and RbOH. Ability to dissolve glass shards is of considerable practical importance. Crushing glass to a fine powder is a slow and tedious task, especially for radioactive glasses dissolved in shielded cells. CsOH fusion of glass powder or shards is a convenient, cost-effective dissolution scheme applicable in SRTC, the DWPF, and the commercial glass industry
A radiophotoluminescent glass plate system for medium-sized field dosimetry
International Nuclear Information System (INIS)
Nakagawa, Keiichi; Koyanagi, Hiroki; Shiraki, Takashi; Saegusa, Shigeki; Sasaki, Katsutake; Oritate, Takashi; Mima, Kazuo; Miyazawa, Masanori; Ishidoya, Tatsuyo; Ohtomo, Kuni; Yoda, Kiyoshi
2005-01-01
A two-dimensional radiophotoluminescent system for medium-sized field dosimetry has been developed using a silver-activated phosphate glass plate with a dimension of 120 mmx120 mmx1 mm and a readout unit comprising a UV excitation lamp and a CCD imager. A dose ranging from 0 to 400 cGy, provided by a 6 MV x-ray beam, was delivered to the glass plate oriented perpendicularly to the beam and positioned in a water phantom at a depth of 10 cm, where the center of the glass plate coincided with the linac isocenter. After the dose delivery, the glass plate was placed in the readout system. The CCD output intensity increased linearly with the applied dose. The angular dependence of response on the direction of radiation incidence was measured by rotating the glass plate in the water phantom, indicating that the output remained constant up to 75 deg. from perpendicular incident direction, followed by a steep reduction down to 85% at an angle of 90 deg. A lateral dose distribution resulting from a 60 mmx60 mm irradiation was compared between the glass plate and an x-ray film having had the same exposure, showing that the glass plate and the x-ray film led to identical dose distributions. The dose reproducibility for a glass plate and the sensitivity variation among different glass plates were also evaluated
Corrosion testing of a plutonium-loaded lanthanide borosilicate glass made with Frit B.
Energy Technology Data Exchange (ETDEWEB)
Ebert, W. L.; Chemical Engineering
2006-09-30
Laboratory tests were conducted with a lanthanide borosilicate (LaBS) glass made with Frit B and added PuO2 (the glass is referred to herein as Pu LaBS-B glass) to measure the dependence of the glass dissolution rate on pH and temperature. These results are compared with the dependencies used in the Defense HLW Glass Degradation Model that was developed to account for HLW glasses in total system performance assessment (TSPA) calculations for the Yucca Mountain repository to determine if that model can also be used to represent the release of radionuclides from disposed Pu LaBS glass by using either the same parameter values that are used for HLW glasses or parameter values specific for Pu LaBS glass. Tests were conducted by immersing monolithic specimens of Pu LaBS-B glass in six solutions that imposed pH values between about pH 3.5 and pH 11, and then measuring the amounts of glass components released into solution. Tests were conducted at 40, 70, and 90 C for 1, 2, 3, 4, and 5 days at low glass-surface-area-to-solution volume ratios. As intended, these test conditions maintained sufficiently dilute solutions that the impacts of solution feedback effects on the dissolution rates were negligible in most tests. The glass dissolution rates were determined from the concentrations of Si and B measured in the test solutions. The dissolution rates determined from the releases of Si and B were consistent with the 'V' shaped pH dependence that is commonly seen for borosilicate glasses and is included in the Defense HLW Glass Degradation Model. The rate equation in that model (using the coefficients determined for HLW glasses) provides values that are higher than the Pu LaBS-B glass dissolution rates that were measured over the range of pH and temperature values that were studied (i.e., an upper bound). Separate coefficients for the rate expression in acidic and alkaline solutions were also determined from the test results to model Pu LaBS-B glass dissolution
Patil, Vaishali; Patil, Arun; Yoon, Seok-Jin; Choi, Ji-Won
2013-05-01
During last two decades, lithium-based glasses have been studied extensively as electrolytes for solid-state secondary batteries. For practical use, solid electrolyte must have high ionic conductivity as well as chemical, thermal and electrochemical stability. Recent progresses have focused on glass electrolytes due to advantages over crystalline solid. Glass electrolytes are generally classified into two types oxide glass and sulfide glass. Oxide glasses do not react with electrode materials and this chemical inertness is advantageous for cycle performances of battery. In this study, major effort has been focused on the improvement of the ion conductivity of nanosized LiAlTi(PO4)3 oxide electrolyte prepared by mechanical milling (MM) method. After heating at 1000 degrees C the material shows good crystallinity and ionic conductivity with low electronic conductivity. In LiTi2(PO4)3, Ti4+ ions are partially substituted by Al3+ ions by heat-treatment of Li20-Al2O3-TiO2-P2O5 glasses at 1000 degrees C for 10 h. The conductivity of this material is 1.09 x 10(-3) S/cm at room temp. The glass-ceramics show fast ion conduction and low E(a) value. It is suggested that high conductivity, easy fabrication and low cost make this glass-ceramics promising to be used as inorganic solid electrolyte for all-solid-state Li rechargeable batteries.
Glass-ceramic hermetic seals to high thermal expansion metals
Kramer, D.P.; Massey, R.T.
1987-04-28
A process for forming glass-ceramic materials from an alkaline silica-lithia glass composition comprising 60-72 mole-% SiO/sub 2/, 18-27 mole-% Li/sub 2/O, 0-5 mole-% Al/sub 2/O/sub 3/, 0-6 mole-% K/sub 2/O, 0-3 mole-% B/sub 2/O/sub 3/, and 0.5-2.5 mole-% P/sub 2/O/sub 5/, which comprises heating said glass composition at a first temperature within the 950-1050/degree/C range for 5-60 minutes, and then at a devitrification temperature within the 700-900/degree/C range for about 5-300 minutes to obtain a glass-ceramic having a thermal expansion coefficient of up to 210 x 10/sup /minus/7///degree/C. These ceramics form strong, hermetic seals with high expansion metals such as stainless steel alloys. An intermediate nucleation heating step conducted at a temperature within the range of 675-750/degree/C for 10-120 minutes may be employed between the first stage and the devitrification stage. 1 fig., 2 tabs.
Mudzakir, A.; Widhiyanti, T.; Hernani, Arifin, M.; Lestari, A. N.; Jauhariansyah, S.
2017-08-01
The study was conducted to address the problems related to low Indonesian students' scientific literacy as revealed in the PISA (Program for International Student Assessment) since 2000-2015. Science teachers (e.g. chemistry teacher) must recognize the nature of science (NOS) to assist their students in preparing an explanation of a phenomenon scientifically correctly. Teachers also need to understand critically about nature of technology (NOT) and it relationship with science as well as society. To integrate those two kinds of knowledge (NOS and NOT), we can conduct a techno-science activity, which integrate the technology to science course in pre-service teacher education program, so that they can improve their knowledge about nature of science and technology (NOST) and pedagogical content knowledge related to NOST. The purpose of this study was to construct an inquiry based laboratory activity worksheet for making conductive glass so that the pre-service teacher could explain how the structure of the semiconductor Fluor doped Tin Oxide (SnO2.F) affect their performance. This study we conducted, described how to design a pre-service chemistry teacher education course that can improve recognizing view of NOST by using a framework called model of educational reconstruction (MER). The scientific activities in the course were guided inquiry based techno-chemistry experiments involving "From Stannum Metallicum to Conductive Glass". Conductive glasses are interesting subject research for several reason. The application of this technology could be found on solar cell, OLED, and display panel. The doped Tin dioxide has been deposited on glass substrate using the spray pyrolysis technique at 400-550°C substrate temperature, 4-5 times, 20 cm gap between glass and sprayer and 450 angle to form a thin film which will act as electrical contact. The resistivity is about 0.5 - 15Ω. The product resulted on this study was rated by several expert to find if the worksheet could
Energy Technology Data Exchange (ETDEWEB)
Cesano, Federico, E-mail: federico.cesano@unito.it; Agostini, Giovanni, E-mail: giovanni.agostini@esrf.fr; Scarano, Domenica
2015-09-01
Vertically oriented TiO{sub 2} micropillar arrays were obtained on Fluorine-doped Tin Oxide (FTO) conductive glasses by adopting a facile and cost-effective method. The process consists in the spray-coating with a polymer film containing an organo-metallic precursor (Ti isopropoxyde), followed by scratching the film surface by means of a sandpaper and an oxidative treatment. The role played by the scratching step in the formation of vertically oriented TiO{sub 2} micropillars, as well as the nanostructured scaffold nature consequent upon the oxidation, will be highlighted. The morphology, structure and optical properties of samples, were investigated by combining electron and atomic force microscopies with X-ray diffraction and UV–vis spectroscopy. Due to the robust texture of highly crystalline and cemented anatase and rutile nanoparticles and to the porous nature of TiO{sub 2} pillars covering FTO glasses, this system may find application in energy, photochemistry and photodegradation fields. - Highlights: • TiO{sub 2}-based polymer films are deposited on a conductive glass by spray coating. • The polymer film is scratched by a sandpaper. • Quasi-regular arrays of TiO{sub 2} micropillars are obtained via thermal oxidation. • Nanostructured TiO{sub 2} pillars are robust, porous and well adhering to the conductive glass.
International Nuclear Information System (INIS)
Hirata, K.; Abe, Y.
1991-01-01
Superconducting properties are studied for glass-ceramics which were prepared by reheating glass rods and the glass powder compacts in the BiSrCaCu 2 Al 0.5 O x system, respectively. The glass-ceramic rod specimens obtained by reheating rod glass at 800--830 degree C for 50 h have a T c (R=0) of 85 K, while the disk specimens obtained by reheating the powered glass compacts in the same way do not exhibit superconductivity above 77 K. This difference in superconductivity between the specimens is discussed in terms of crystallization process and the amount of oxygen absorption of the specimens during heating
Oxidation behaviour of metallic glass foams
Energy Technology Data Exchange (ETDEWEB)
Barnard, B.R. [Department of Materials Science and Engineering, 434 Dougherty Hall, University of Tennessee, Knoxville, TN 37996-2200 (United States)], E-mail: bbarnard@utk.edu; Liaw, P.K. [Department of Materials Science and Engineering, 434 Dougherty Hall, University of Tennessee, Knoxville, TN 37996-2200 (United States); Demetriou, M.D.; Johnson, W.L. [Department of Materials Science, Keck Laboratory, California Institute of Technology, Pasadena, CA 91125 (United States)
2008-08-15
In this study, the effects of porosity on the oxidation behaviour of bulk-metallic glasses were investigated. Porous Pd- and Fe-based bulk-metallic glass (BMG) foams and Metglas ribbons were studied. Oxidizing experiments were conducted at 70 deg. C, and around 80 deg. C below glass-transition temperatures, (T{sub g}s). Scanning-electron microscopy/energy-dispersive spectroscopy (SEM/EDS) studies revealed little evidence of oxidation at 70 deg. C. Specimens exhibited greater oxidation at T{sub g} - 80 deg. C. Oxides were copper-based for Pd-based foams, Fe-, Cr-, and Mo-based for Fe-based foams, and Co-based with borosilicates likely for the Metglas. Pd-based foams demonstrated the best oxidation resistance, followed by Metglas ribbons, followed by Fe-based foams.
American Society for Testing and Materials. Philadelphia
2011-01-01
1.1 These practices cover procedures for determining the liquidus temperature (TL) of nuclear waste, mixed nuclear waste, simulated nuclear waste, or hazardous waste glass in the temperature range from 600°C to 1600°C. This method differs from Practice C829 in that it employs additional methods to determine TL. TL is useful in waste glass plant operation, glass formulation, and melter design to determine the minimum temperature that must be maintained in a waste glass melt to make sure that crystallization does not occur or is below a particular constraint, for example, 1 volume % crystallinity or T1%. As of now, many institutions studying waste and simulated waste vitrification are not in agreement regarding this constraint (1). 1.2 Three methods are included, differing in (1) the type of equipment available to the analyst (that is, type of furnace and characterization equipment), (2) the quantity of glass available to the analyst, (3) the precision and accuracy desired for the measurement, and (4) candi...
Fabrication of Radiation Shielding Glass
International Nuclear Information System (INIS)
Tavichai, Nattaya; Pormsean, Suriyont; Dararutana, Pisutti; Sirikulrat, Narin
2003-06-01
In this work, lead glass doped with 50%, 55%,60%, 65%, and 70% w/w Pb 3 O 4 . After that, glass mixtures were melt at 1,250οC with 4 hours soaking time. Molten glass was shaped by mould casting technique then annealed at 700οC and cooled down to room temperature. It was found that the glass with 60%w/w Pb 3 O 4 show maximum absorption coefficient of about 0.383 cm -1 with I-131 at energy 364 keV. The observed refractive indices of the samples range between 1.5908 to 1.5922
Low temperature sintering of fluorapatite glass-ceramics
Denry, Isabelle; Holloway, Julie A.
2014-01-01
Fluorapatite glass-ceramics have been shown to be excellent candidates as scaffold materials for bone grafts, however, scaffold production by sintering is hindered by concurrent crystallization of the glass. Our goal was to investigate the effect of Ca/Al ratio on the sintering behavior of Nb-doped fluorapatite-based glasses in the SiO2-Al2O3-P2O5-MgO-Na2O-K2O-CaO-CaF2 system. Glass compositions with Ca/Al ratio of 1 (A), 2 (B), 4 (C) and 19 (D) were prepared by twice melting at 1525°C for 3h. Glasses were either cast as cylindrical ingots or ground into powders. Disc-shaped specimens were prepared by either sectioning from the ingots or powder-compacting in a mold, followed by heat treatment at temperatures ranging between 700 and 1050°C for 1h. The density was measured on both sintered specimens and heat treated discs as controls. The degree of sintering was determined from these measurements. XRD showed that fluorapatite crystallized in all glass-ceramics. A high degree of sintering was achieved at 775°C for glass-ceramic D (98.99±0.04%), and 900°C for glass-ceramic C (91.31±0.10). Glass-ceramics A or B were only partially sintered at 1000°C (63.6±0.8% and 74.1±1.5%, respectively). SEM revealed a unique microstructure of micron-sized spherulitic fluorapatite crystals in glass-ceramics C and D. Increasing the Ca/Al ratio promoted low temperature sintering of fluorapatite glass-ceramics, which are traditionally difficult to sinter. PMID:24252652
Chatterjee, Soumi; Saha, Shyamal Kumar; Chakravorty, Dipankar
2018-04-01
Nanodimensional sodium silicate glasses of composition 30Na2O.70SiO2 has been prepared within the pores of 5.5 nm of mesoporous silica as a template using the surfactant P123. The nanocomposite was characterized by X-ray diffraction, transmission electron microscope, and X-ray photoelectron spectroscopy. Electrical conductivity of the sample was studied by ac impedance spectroscopy. The activation energy for ionic conduction was found to be 0.13 eV with dc conductivity at room temperature of 10-6 S-cm-1. This is attributed to the creation of oxygen ion vacancies at the interface of mesoporous silica and nanoglass arising out of the presence of Si2+ species in the system. These nanocomposites are expected to be useful for applications in sodiumion battery for storage of renewable energy.
International Nuclear Information System (INIS)
Bates, J.K.; Buck, E.C.; Ebert, W.L.; Luo, J.S.; Tam, S.W.
1998-01-01
We have conducted static dissolution tests to study the corrosion behavior of the Environmental Assessment (EA) glass, which is the benchmark glass for high-level waste glasses being produced at US Department of Energy facilities. These tests were conducted to evaluate the behavior of the EA glass under the same long-term and accelerated test conditions that are being used to evaluate the corrosion of waste glasses. Tests were conducted at 90 C in a tuff groundwater solution at glass surface area/solution volume (WV) ratios of about 2000 and 20,000 m -1 . The glass dissolved at three distinct dissolution rates in tests conducted at 2000 m -1 . Based on the release of boron, dissolution within the first seven days occurred at a rate of about 0.65 g/(m 2 · d). The rate between seven and 70 days decreased to 0.009 g/(m 2 · d). An increase in the dissolution rate occurred at longer times after the precipitation of zeolite phases analcime, gmelinite, and an aluminum silicate base. The dissolution rate after phase formation was about 0.18 g/(m 2 · d). The formation of the same zeolite alteration phases occurred after about 20 days in tests at 20,000 m - . The average dissolution rate over the first 20 days was 0.5 g/(m 2 · d) and the rate after phase formation was about 0.20 g/(m 2 · d). An intermediate stage with a lower rate was not observed in tests at 20,000 m -1 . The corrosion behavior of EA glass is similar to that observed for other high-level waste glasses reacted under the same test conditions. The dissolution rate of EA glass is higher than that of other high-level waste glasses both in 7-day tests and after alteration phases form
Reusch, D. B.
2017-12-01
Melting on the surface of the Greenland ice sheet has been changing dramatically as global air temperatures have increased in recent decades, including melt extent often exceeding the 1981-2010 median through much of the melt season and the onset of intermittent melt moving to earlier in the year. To evaluate potential future change, we investigate surface melting characteristics under both "low" (limited to 1.5 °C) and "high" (RCP 8.5) warming scenarios including analysis of differences in scenario outcomes. Climatologies of melt-relevant variables are developed from two publicly available ensembles of CESM1-CAM5-BGC GCM runs: the 30-member Large Ensemble (CESM LE; Kay et al. 2015) for historical calibration and the RCP 8.5 scenario and the 11-member Low Warming ensemble (CESM LW; Sanderson et al. 2017) for the 1.5 °C scenario. For higher spatial resolution (15 km) and improved polar-centric model physics, we also apply the regional forecast model Polar WRF to decadal subsets (1996-2005; 2071-80) using GCM data archived at sub-daily resolution for boundary conditions. Models were skill-tested against ERA-Interim Reanalysis (ERAI) and AWS observations. For example, CESM LE tends to overpredict both maximum (above-freezing) and minimum daily average surface temperatures compared to observations from the GC-Net Swiss Camp AWS. Ensembles of members differing only by initial conditions allow us to also estimate intramodel uncertainty. Historical (1981-2000) CESM LE spatially averaged July temperatures are 2 +/- 0.2 °C cooler than ERAI while local anomalies in individual members reach up to +/- 2 °C. As expected, Greenland does not escape future (2081-2100) warming (and expectations of more widespread surface melting) even in the LW scenario, but positive changes versus ERAI are mostly coastal (2-3 °C) with the interior showing only minor change (+/- 1 °C). In contrast, under RCP 8.5, the entire ice sheet has warmed by 2-6 °C, or a median increase of 5 °C versus
Energy Technology Data Exchange (ETDEWEB)
Momoshima, Noriyuki, E-mail: momoshima.noriyuki.551@m.kyushu-u.ac.j [Radioisotope Center, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Inoue, Fumio [Graduate School of Science, Kyushu University, 6-10-1Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Sugihara, Shinji [Radioisotope Center, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Shimada, Jun [Graduate School of Science and Technology, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Taniguchi, Makoto [Research Institute for Humanity and Nature, 457-4 Motoyama Kamigamo, Kita-ku, Kyoto 603-8047 (Japan)
2010-08-15
Atmospheric {sup 85}Kr concentration at Fukuoka, Japan was determined by an improved {sup 85}Kr analytical method using liquid scintillation counting (LSC). An average value of 1.54 {+-} 0.05 Bq m{sup -3} was observed in 2008, which is about two times that measured in 1981 at Fukuoka, indicating a 29 mBq y{sup -1} rate of increase as an average for these 27 years. The analytical method developed involves collecting Kr from air using activated charcoal at liquid N{sub 2} temperature and purifying it using He at dry ice temperature, followed by Kr separation by gas chromatography. An overall Kr recovery of 76.4 {+-} 8.1% was achieved when Kr was analyzed in 500-1000 l of air. The Kr isolated by gas chromatography was collected on silica gel in a quartz glass vial cooled to liquid N{sub 2} temperature and the activity of {sup 85}Kr was measured with a low-background LS counter. The detection limit of {sup 85}Kr activity by the present analytical method is 0.0015 Bq at a 95% confidence level, including all propagation errors, which is equivalent with {sup 85}Kr in 1.3 l of the present air under the analytical conditions of 72.1% counting efficiency, 0.1597 cps background count rate, and 76.4% Kr recovery.
Characterization of the perovskite La0,9Sr0,1Ga0,2O2,85 prepared by cation complexation
International Nuclear Information System (INIS)
Reis, S.L.; Grosso, R.L.; Muccillo, E.N.S.
2012-01-01
Strontium and magnesium doped lanthanum gallate exhibits perovskite-type structure and high ionic conductivity. Other features of this ceramic material are large electrolytic regime and negligible electronic conductivity. These characteristics are responsible for the potential use of this solid electrolyte in solid oxide fuel cells operating at intermediate temperatures (~∼500-700 deg C). In this work, the composition La 0.9 Sr 0.1 Ga 0.8 Mg 0.2 O 2.85 was prepared by the cation complexation technique aiming to obtain powder and sintered specimens with good chemical and structural homogeneities. X-ray diffraction results evidence that single phase was obtained, within the limitations of the technique, in samples sintered at 1350 deg C/4 h, with relative density above 92%. (author)
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Employment. 85.31 Section 85.31 Public Welfare....31 Employment. No qualified individuals with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...
7 CFR 301.85-2b - Exempted articles. 1
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.85-2b Section 301.85-2b... § 301.85-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines and other provisions of this subpart. (a) The following articles are...
Low temperature sintering of fluorapatite glass-ceramics.
Denry, Isabelle; Holloway, Julie A
2014-02-01
Fluorapatite glass-ceramics have been shown to be excellent candidates as scaffold materials for bone grafts, however, scaffold production by sintering is hindered by concurrent crystallization of the glass. Objective, our goal was to investigate the effect of Ca/Al ratio on the sintering behavior of Nb-doped fluorapatite-based glasses in the SiO2-Al2O3-P2O5-MgO-Na2O-K2O-CaO-CaF2 system. Methods, glass compositions with Ca/Al ratio of 1 (A), 2 (B), 4 (C) and 19 (D) were prepared by twice melting at 1525°C for 3h. Glasses were either cast as cylindrical ingots or ground into powders. Disk-shaped specimens were prepared by either sectioning from the ingots or powder-compacting in a mold, followed by heat treatment at temperatures ranging between 700 and 1050°C for 1h. The density was measured on both sintered specimens and heat treated discs as controls. The degree of sintering was determined from these measurements. Results and Significance XRD showed that fluorapatite crystallized in all glass-ceramics. A high degree of sintering was achieved at 775°C for glass-ceramic D (98.99±0.04%), and 900°C for glass-ceramic C (91.31±0.10). Glass-ceramics A or B were only partially sintered at 1000°C (63.6±0.8% and 74.1±1.5%, respectively). SEM revealed a unique microstructure of micron-sized spherulitic fluorapatite crystals in glass-ceramics C and D. Increasing the Ca/Al ratio promoted low temperature sintering of fluorapatite glass-ceramics, which are traditionally difficult to sinter. Copyright © 2013 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Fees. 9.85 Section 9.85 Energy NUCLEAR REGULATORY COMMISSION PUBLIC RECORDS Privacy Act Regulations Fees § 9.85 Fees. Fees shall not be charged for search or... available for review, although fees may be charged for additional copies. Fees established under 31 U.S.C...
Photoacoustic investigation of glass transition in AsxTe1-x glasses
International Nuclear Information System (INIS)
Madhusoodanan, K.N.; Nandakumar, K.; Philip, J.; Titus, S.S.K.; Asokan, S.; Gopal, E.S.R.
1989-01-01
Photoacoustic (Pa) technique is used to study glass transition and temperature dependence of thermal diffusivity in As x Te 1-x glasses with 0.25 ≤ x ≤ 0.60. PA amplitude goes through a minimum and the phase shows a maximum at glass transition temperature T g . The variation of thermal diffusivity with temperature shows sharp decrease near T g . The variation of thermal diffusivity with composition shows maximum at x = 0.40 for all temperatures T ≤ T g . (author)
Energy Technology Data Exchange (ETDEWEB)
Mondal, Praloy; Das, Debajyoti, E-mail: erdd@iacs.res.in
2017-07-31
Highlights: • ZnO:Ga film with perpetual c-axis orientation at low T{sub S} by RF magnetron sputtering. • High conductivity (200 S cm{sup −1}) and elevated transmission (∼93% at 500 nm) in nano-sheet like structure. • Si solar cell on ZnO:Ga with efficiency comparable to similar cell on U-type SnO{sub 2} coated Asahi glass. • Higher open circuit voltage and better fill factor with ZnO:Ga than SnO{sub 2}. - Abstract: Technologically appropriate device friendly ZnO:Ga films have been prepared at a low growth temperature (100 °C) by changing the RF power (P) applied to the magnetron plasma. Structurally preferred c-axis orientation of the ZnO:Ga network has been attained with I{sub 〈002〉}/I{sub 〈103〉} > 5. The c-axis oriented grains of wurtzite ZnO:Ga grows geometrically and settles in tangentially, providing favorable conduction path for stacked layer devices. Nano-sheet like structures produced at the surface are interconnected and provide conducting path across the surface; however, those accommodate a lot of pores in between that help better light trapping and reduce the reflection loss. The optimized ZnO:Ga thin film prepared at RF power of 200 W has 〈002〉 oriented grains of average size ∼10 nm and exhibits a very high conductivity ∼200 S cm{sup −1} and elevated transmission (∼93% at 500 nm) in the visible range. The optimized ZnO:Ga film has been used as the transparent conducting oxide (TCO) window layer of RF-PECVD grown silicon thin film solar cells in glass/TCO/p-i-n-Si/Al configuration. The characteristics of identically prepared p-i-n-Si solar cells are compared by replacing presently developed ZnO:Ga TCO with the best quality U-type SnO{sub 2} coated Asahi glass substrates. The ZnO:Ga coated glass substrate offers a higher open circuit voltage (V{sub OC}) and the higher fill factor (FF). The ZnO:Ga film being more stable in hydrogen plasma than its SnO{sub 2} counterpart, maintains a high transparency to the solar
International Nuclear Information System (INIS)
Abo Hussein, E.M.K.
2014-01-01
Glasses containing bismuth oxide have attracted considerable attention, although it is non-conventional glass forming oxide, but it has wide applications. In this work, it is aimed to prove that bismuth silicate glass can act as a good shielding material for γ- rays. For this purpose glass containing 20% bismuth oxide and 80% SiO_2 was prepared using melting-annealing technique. Also effects of adding some alkali heavy metal oxides to this glass such as PbO, BaO or SrO were also studied. The formed glasses were also heat treated at 450 degree C for 4 hours to give the corresponding heat treated glasses. Electron Paramagnetic Resonance (EPR) measurements show that the prepared glasses and heat treated glasses have very good stability when exposed to γ- irradiation, which encourage the assumption of using these glasses as gamma ray shielding materials. Many properties have been investigated, such as density to understand the structural properties, also mechanical properties were verified by measuring microhardness, while the chemical resistance was identified by testing their durability in both acidic and basic solutions. The EPR results were supported by measuring electrical conductivity of the glass and heat treated glass samples at different temperatures ranging from 298 to 553 K, which proved that these glasses have very low conductivity even at high temperature. The formed phases of heat treated glass or glass ceramic samples were demonstrated by means of X-ray diffraction (XRD). Also studying the structure of glasses and heat treated glasses before and after irradiation was investigated by the Infrared transmitting spectra. Calculations of optical band gap energies were demonstrated for some selected glasses and heat treated glasses from the data of UV optical absorption spectra to support the probability of using these bismuth silicate glasses for gamma radiation shielding processing.
International Nuclear Information System (INIS)
Lutze, W.
1988-01-01
This chapter is a survey of world-wide research and development efforts in nuclear waste glasses and its production technology. The principal glasses considered are silicate glasses which contain boron, i.e. borosilicate glass. A historical overview of waste form development programs in nine countries is followed by a summary of the design criteria for borosilicate glass compositions glass compositions. In the sections on glass properties the waste form is characterized in terms of potential alterations under the influence of heat, thermal gradients, radiation, aqueous solutions and combinations thereof. The topics are phase transformations, mechanical properties, radiation effects and chemical durability. The results from studies of volcanic glasses, as natural analogues for borosilicate nuclear waste glasses in order to verify predictions obtained from short-term tests in the laboratory, have been compiled in a special section on natural analogues. A special section on advanced vitrification techniques summarizes the various actual and potential processing schemes and describes the facilities. The literature has been considered until 1985. (author). 430 refs.; 68 figs.; 29 tabs
Spectroscopic properties of 1.8 μm emission in Tm3+ doped bismuth silicate glass
International Nuclear Information System (INIS)
Zhao, Guoying; Tian, Ying; Wang, Xin; Fan, Huiyan; Hu, Lili
2013-01-01
The emission properties around 1.8 μm in Tm 3+ doped bismuth silicate glass have been investigated. Based on the obtained Raman spectroscopy and differential scanning calorimetry curves, it is found the introduced Bi 2 O 3 can efficiently reduce the phonon energy of silicate glass to 926 cm −1 . The energy gap between glass transition temperature and onset temperature of crystallization is 169 °C. The OH − content maintains lower in glass by bubbling dry O 2 during the melting process. The cut-off wavelength in mid-infrared range is as long as 5 μm. Bismuth silicate glass has high radiative transition probability of 238.80 s −1 corresponding to the Tm 3+ : 3 F 4 → 3 H 6 transition compared with conventional silicate glasses. The strongest emission at 1.8 μm with a large full width at half-maximum of 238 nm is achieved from this bismuth silicate glass doped with 0.9 mol% Tm 2 O 3 . Its fluorescence lifetime at 1.8 μm is 640 μs. - Highlights: ► The 1.8 μm fluorescence of Tm 3+ -doped bismuth silicate glass is investigated. ► The prepared glass has lower phonon energy than other typical silicate glasses. ► A broadband 1.8 μm emission with the FWHM of 238 nm is observed. ► The fluorescence lifetime of Tm 3+ : 3 F 4 level reaches 640 μs.
Carson, James K.
2018-06-01
Glass spheres are often used as filler materials for composites. Comparatively few articles in the literature have been devoted to the measurement or modelling of thermal properties of composites containing glass spheres, and there does not appear to be any reported data on the measurement of thermal diffusivities over a range of filler volume fractions. In this study, the thermal diffusivities of guar-gel/glass sphere composites were measured using a transient comparative method. The addition of the glass beads to the gel increased the thermal diffusivity of the composite, more than doubling the thermal diffusivity of the composite relative to the diffusivity of the gel at the maximum glass volume fraction of approximately 0.57. Thermal conductivities of the composites were derived from the thermal diffusivity measurements, measured densities and estimated specific heat capacities of the composites. Two approaches to modelling the effective thermal diffusivity were considered.
46 CFR 196.85-1 - Magazine operation and control.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine operation and control. 196.85-1 Section 196.85... OPERATIONS Magazine Control § 196.85-1 Magazine operation and control. (a) Keys to magazine spaces and magazine chests shall be kept in the sole control or custody of the Master or one delegated qualified...
Low thermal expansion glass ceramics
1995-01-01
This book is one of a series reporting on international research and development activities conducted by the Schott group of companies With the series, Schott aims to provide an overview of its activities for scientists, engineers, and managers from all branches of industry worldwide where glasses and glass ceramics are of interest Each volume begins with a chapter providing a general idea of the current problems, results, and trends relating to the subjects treated This volume describes the fundamental principles, the manufacturing process, and applications of low thermal expansion glass ceramics The composition, structure, and stability of polycrystalline materials having a low thermal expansion are described, and it is shown how low thermal expansion glass ceramics can be manufactured from appropriately chosen glass compositions Examples illustrate the formation of this type of glass ceramic by utilizing normal production processes together with controlled crystallization Thus glass ceramics with thermal c...
Directory of Open Access Journals (Sweden)
N Beigmohammadi
2013-09-01
Full Text Available TiO2-SnO2 thin films were coated on glass and Al / glass substrates by electron gun method. In coating process, the vacuum was 1.5×10-5 torr. Then, films were annealed at 450, 500 and 550 ˚ C. The crystallographic structure and film morphology were investigated by means of XRD and SEM. The electrical (I-V and optical properties were studied by the two point props system and UV/Vis/NIR spectrophotometer. The results showed the films under 550 ˚ C were crystalline. The thickness and grain size were 350 and 50 nm respectively. The electrical conductivity in the sample with Al / glass substrate under 550 ˚ C was better than the other samples. When temperature increased, the energy gap decreased from 4.05 to 4.03 eV for direct cases.
Comparison of a model vapor deposited glass films to equilibrium glass films
Flenner, Elijah; Berthier, Ludovic; Charbonneau, Patrick; Zamponi, Francesco
Vapor deposition of particles onto a substrate held at around 85% of the glass transition temperature can create glasses with increased density, enthalpy, kinetic stability, and mechanical stability compared to an ordinary glass created by cooling. It is estimated that an ordinary glass would need to age thousands of years to reach the kinetic stability of a vapor deposited glass, and a natural question is how close to the equilibrium is the vapor deposited glass. To understand the process, algorithms akin to vapor deposition are used to create simulated glasses that have a higher kinetic stability than their annealed counterpart, although these glasses may not be well equilibrated either. Here we use novel models optimized for a swap Monte Carlo algorithm in order to create equilibrium glass films and compare their properties with those of glasses obtained from vapor deposition algorithms. This approach allows us to directly assess the non-equilibrium nature of vapor-deposited ultrastable glasses. Simons Collaboration on Cracking the Glass Problem and NSF Grant No. DMR 1608086.
The Study on the Alteration of Simulated HLLW Glass in Aqueous Media by Inverse Gas Chromatography
International Nuclear Information System (INIS)
Zhang, Zhentao; Gan, Xueying; Yuan, Wenyi; Wang, Lei; Xing, Haiqing; Balard, Henri
2008-01-01
There exist webs of fissures inside the glass block accessible to underground water and theses fissures will influence the alteration of the glass significantly. It is very necessary to study the fissure surface properties of the glass under deep geological conditions. The alteration tests were conducted using the simulated high level radioactive glass powder immersed in Beishan (candidate disposal site) underground water with S/V ratio of 8000 m -1 at 150 deg. C and 90 deg. C for different periods. After immersion, the glass powder was filtered and dried at 120 deg. C for 3 hours. The surface properties of the dried glass powder were evaluated by inverse chromatography. The results showed that the specific surface area of the glass increases abruptly at the beginning of immersion and then increase slowly afterwards. At higher immersion temperature, the secondary phase is condensing crystals; at the lower immersion temperature, the secondary phases were loosely 'islands' with cracks or fissures. (authors)
International Nuclear Information System (INIS)
Kusmartsev, F.V.
1992-10-01
The physical reasons why the orbital glass may exist in granular high-temperature superconductors and the existing experimental data appeared recently are discussed. The orbital glass is characterized by the coexistence of the orbital paramagnetic state with the superconducting state and occurs at small magnetic fields H c0 c1 . The transition in orbital glass arises at the critical field H c0 which is inversely proportional to the surface cross-area S of an average grain. In connection with theoretical predictions the possible experiments are proposed. (author). 10 refs
Impedance spectroscopy studies on lead free (Ba0.85Ca0.15(Ti0.9Zr0.1O3 ceramics
Directory of Open Access Journals (Sweden)
Ahcène Chaouchi
2012-12-01
Full Text Available The AC complex impedance spectroscopy technique has been used to obtain the electrical parameters of polycrystalline sample of (Ba0.85Ca0.15(Ti0.9Zr0.1O3 in a wide frequency range at different temperatures. This sample was prepared by a high temperature solid-state reaction technique and single phase formation was confirmed by X-ray diffraction technique. This study was carried out by the means of simultaneous analysis of impedance, modulus, and electrical conductivity. The Cole-Cole (Nyquist plots suggest that the grains and grain boundaries are responsible in the conduction mechanism of the material at high temperature. The ColeCole (Nyquist plot studies revealed the presence of grain and grain boundary effect at 485 °C. On the other hand, it showed only the presence of grain boundary component of the resistivity at 535 °C. Complex impedance analysis indicated the presence of non-Debye type dielectric relaxation. The bulk resistance of the material decreases with rise in temperature similar to a semiconductor, and the Cole-Cole (Nyquist plot showed the negative temperature coefficient of resistance (NTCR character of (Ba0.85Ca0.15(Ti0.9Zr0.1O3. The value of activation energy is found to be 0.7433 eV, which suggests that the conduction may be the result of defect and charge carriers present in the materials.
Mediating conducting polymer growth within hydrogels by controlling nucleation
Directory of Open Access Journals (Sweden)
A. J. Patton
2015-01-01
Full Text Available This study examines the efficacy of primary and secondary nucleation for electrochemical polymerisation of conductive polymers within poly(vinyl alcohol methacrylate hydrogels. The two methods of nucleation investigated were a primary heterogeneous mechanism via introduction of conductive bulk metallic glass (Mg64Zn30Ca5Na1 particles and a secondary mechanism via introduction of “pre-polymerised” conducting polymer within the hydrogel (PEDOT:PSS. Evidence of nucleation was not seen in the bulk metallic glass loaded gels, however, the PEDOT:PSS loaded gels produced charge storage capacities over 15 mC/cm2 when sufficient polymer was loaded. These studies support the hypothesis that secondary nucleation is an efficient approach to producing stand-alone conducting hydrogels.
1991-10-31
Glasses with high conductivities can also be formed with the Lewis acids GeO 2 (11 ) and no doubt Bi 20 3, TeO2 , etc., but these have been less...P age 3 1. Mechanical Relaxation and Relation to Electrical Relaxation in Fast Ion-Conducting Glasses ...relaxation although considerable information was available for the classical alkali silicate and borate glasses . Our program was to utilize the rheovibron
Development of microstrip gas chambers on substrata with electronic conductivity
International Nuclear Information System (INIS)
Bouclier, R.; Garabatos, C.; Manzin, G.; Sauli, F.; Shekhtman, L.; Temmel, T.; Della Mea, G.; Maggioni, G.; Rigato, V.; Logachenko, I.
1994-01-01
This paper describes several recent developments on Microstrip Gas Chambers (MSGCs). The authors have studied the operating behavior of the detectors in different gas mixtures; maximum stable gains have been achieved in mixtures of argon and dimethyl-ether (DME) in almost equal proportions. Using detectors manufactured on semi-conducting glass substrates, capable of withstanding very high rates (above 10 6 mm -2 s -1 ), they have demonstrated extended lifetime without gain modifications up to a collected charge of 130 mC cm -1 in clean laboratory operating conditions. They have also verified that relaxing the requirements on cleanness conditions, either in the gas mixing system or in the detector construction, may result in fast aging of the devices under irradiation. As an alternative to the semi-conducting glass, they have developed a novel technique to coat regular glass with a thin lead silicate layer having electron conductivity; a new development consisting in coating already manufactured MSGCs with the thin semi-conducting layer is also described. The preliminary results show an excellent rate capability of this kind of devices, intrinsically simpler to manufacture
Directory of Open Access Journals (Sweden)
Fengguo Liu
2018-03-01
Full Text Available Ionic liquids are considered environmentally friendly media for various industrial applications. Basic data on physicochemical properties are significant for a new material, in terms of developing its potential applications. In this work, 1-ethyl-3-methylimidazolium fluoride ([EMIm]F ionic liquid was synthesized via an anion metathesis process. Physical properties including the density, viscosity, electrical conductivity, and thermal stability of the product were measured. The results show that the density of [EMIm]F decreases linearly with temperature increases, while dynamic viscosity decreases rapidly below 320 K and the temperature dependence of electrical conductivity is in accordance with the VFT (Vogel–Fulcher–Tammann equation. The temperature dependence of the density, conductivity, and viscosity of [EMIm]F can be expressed via the following equations: ρ = 1.516 − 1.22 × 10−3 T, σm = 4417.1exp[−953.17/(T − 166.65] and η = 2.07 × 10−7exp(−5.39 × 104/T, respectively. [EMIm]F exhibited no clear melting point. However, its glass transition point and decomposition temperature are −71.3 °C and 135 °C, respectively.
Energy Technology Data Exchange (ETDEWEB)
Salem, Shaaban M., E-mail: shaabansalem@gmail.com [Department of Physics, Faculty of Science, Al Azhar University, Nasr City 11884, Cairo (Egypt); Abdel-Khalek, E.K. [Department of Physics, Faculty of Science, Al Azhar University, Nasr City 11884, Cairo (Egypt); Department of Physics, Faculty of Science, Jazan University (Saudi Arabia); Mohamed, E.A. [Department of Physics, Faculty of Science (Girl' s Branch), Al Azhar University, Nasr City, Cairo (Egypt); Department of Physics, Faculty of Science, Jazan University (Saudi Arabia); Farouk, M. [Department of Physics, Faculty of Science, Al Azhar University, Nasr City 11884, Cairo (Egypt); Department of Physics, Faculty of Science, Jazan University (Saudi Arabia)
2012-02-05
Highlights: Black-Right-Pointing-Pointer I report, for the first time, the effect of WO{sub 3} on Bi{sub 2}O{sub 3}, Li{sub 2}O, GeO{sub 2} and WO{sub 3} glasses through structural, optical, conductivity and dielectric studies. Black-Right-Pointing-Pointer Optical band gap E{sub op} for all types of electronic transitions, Urbach energy (E{sub r}), and refractive index determined. Black-Right-Pointing-Pointer The WO{sub 3} promotes as bitter constituent the reduction of W{sup 6+} to W{sup 5+} giving the bluish color. Black-Right-Pointing-Pointer Infrared spectra reveal characteristic GeO{sub 4}, GeO{sub 6}, Bi{sub 2}O{sub 3}, BiO{sub 6}, WO{sub 4} and WO{sub 6} units. Black-Right-Pointing-Pointer Based on ac and dc conductivity the conductivity increased and activation energies decreased with increase of WO{sub 3} content at all frequencies. - Abstract: Glasses in the system (65 - x)Bi{sub 2}O{sub 3}-15Li{sub 2}O-20GeO{sub 2}-xWO{sub 3} (where x = 2, 5 and 10 mol%) were prepared by normal melt quenching method. The change in density and molar volume in these glasses indicates the effect of WO{sub 3} on the glass structure. Fourier transform infrared (FT-IR) spectra show that these glasses are made up of GeO{sub 4}, GeO{sub 6}, BiO{sub 6}, BiO{sub 3}, WO{sub 4} and WO{sub 6} basic structural units. The structural units of BiO{sub 6}, GeO{sub 6} and WO{sub 6} increase with the increasing of WO{sub 3} content. The optical constants of these glasses are determined over a spectral range, providing the complex dielectric constant to be calculated. Higher values for the refractive index and dispersion are recorded due to the high polarizability of bismuth and tungsten ions. The values of the optical band gap E{sub g} for all types of electronic transitions and refractive index have been determined and discussed. The dc conductivity measured in the temperature range 423-623 K obeys Arrhenius law. The dielectric constant ({epsilon} Prime ), dielectric loss (tan {delta}) and
Gain measurements at 182 /angstrom/ in C VI generated by a Nd/glass laser
International Nuclear Information System (INIS)
Kim, D.; Skinner, C.H.; Umesh, G.; Suckewer, S.
1988-11-01
We present recent gain measurements in C VI at 182 A for a soft x-ray amplifier produced by a line-focused glass laser(1.053 μm) on a solid carbon target. The maximum gain measured was 8 +- 1 cm/sup /minus/1/ in the recombining plasma column with additional radiation cooling by iron impurities. 10 refs., 3 figs
Foaming Glass Using High Pressure Sintering
DEFF Research Database (Denmark)
Østergaard, Martin Bonderup; Petersen, Rasmus Rosenlund; König, Jakob
Foam glass is a high added value product which contributes to waste recycling and energy efficiency through heat insulation. The foaming can be initiated by a chemical or physical process. Chemical foaming with aid of a foaming agent is the dominant industrial process. Physical foaming has two...... to expand. After heat-treatment foam glass can be obtained with porosities of 80–90 %. In this study we conduct physical foaming of cathode ray tube (CRT) panel glass by sintering under high pressure (5-25 MPa) using helium, nitrogen, or argon at 640 °C (~108 Pa s). Reheating a sample in a heating...... variations. One way is by saturation of glass melts with gas. The other involves sintering of powdered glass under a high gas pressure resulting in glass pellets with high pressure bubbles entrapped. Reheating the glass pellets above the glass transition temperature under ambient pressure allows the bubbles...
Tanaka, Natsuki; Izawa, Takeshi; Takenaka, Shigeo; Yamate, Jyoji; Kuwamura, Mitsuru
2015-07-01
Coiled-coil domain containing 85c (Ccdc85c) is a causative gene for spontaneous mutant mouse with non-obstructive hydrocephalus and subcortical heterotopia. Detailed functions of Ccdc85C protein have not been clarified. To reveal roles of Ccdc85C, we examined the distribution and expression pattern of Ccdc85C in the systemic developing organs in rats. Ccdc85C was expressed in various simple epithelia but not stratified epithelia. In the various epithelia, Ccdc85C was localized at cell-cell junctions and its expression was strong at apical junctions. Furthermore, intense expression was seen at developing period and gradually decreased with advancing development. Distribution of Ccdc85C coincides with that of proliferating epithelial cells. These results suggest that Ccdc85C plays an important role in the proliferative property of simple epithelia.
Disposition of actinides released from high-level waste glass
International Nuclear Information System (INIS)
Ebert, W.L.; Bates, J.K.; Buck, E.C.; Gong, M.; Wolf, S.F.
1994-01-01
A series of static leach tests was conducted using glasses developed for vitrifying tank wastes at the Savannah River Site to monitor the disposition of actinide elements upon corrosion of the glasses. In these tests, glasses produced from SRL 131 and SRL 202 frits were corroded at 90 degrees C in a tuff groundwater. Tests were conducted using crushed glass at different glass surface area-to-solution volume (S/V) ratios to assess the effect of the S/V on the solution chemistry, the corrosion of the glass, and the disposition of actinide elements. Observations regarding the effects of the S/V on the solution chemistry and the corrosion of the glass matrix have been reported previously. This paper highlights the solution analyses performed to assess how the S/V used in a static leach test affects the disposition of actinide elements between fractions that are suspended or dissolved in the solution, and retained by the altered glass or other materials
International Nuclear Information System (INIS)
Nguyen, Ba Nghiep; Henager, Charles H.
2013-01-01
SiC/SiC composites used in fusion reactor applications are subjected to high heat fluxes and require knowledge and tailoring of their in-service thermal conductivity. Accurately predicting the thermal conductivity of SiC/SiC composites as a function of temperature will guide the design of these materials for their intended use, which will eventually include the effects of 14-MeV neutron irradiations. This paper applies an Eshelby–Mori–Tanaka approach (EMTA) to compute the thermal conductivity of unirradiated SiC/SiC composites. The homogenization procedure includes three steps. In the first step EMTA computes the homogenized thermal conductivity of the unidirectional (UD) SiC fiber embraced by its coating layer. The second step computes the thermal conductivity of the UD composite formed by the equivalent SiC fibers embedded in a SiC matrix, and finally the thermal conductivity of the as-formed SiC/SiC composite is obtained by averaging the solution for the UD composite over all possible fiber orientations using the second-order fiber orientation tensor. The EMTA predictions for the transverse thermal conductivity of several types of SiC/SiC composites with different fiber types and interfaces are compared to the predicted and experimental results by Youngblood et al. [J. Nucl. Mater. 307–311 (2002) 1120–1125, Fusion Sci. Technol. 45 (2004) 583–591, Compos. Sci. Technol. 62 (2002) 1127–1139.
THERMAL CONDUCTIVITY OF SIC AND C FIBERS
Energy Technology Data Exchange (ETDEWEB)
Youngblood, Gerald E.; Senor, David J.; Kowbel, W.; Webb, J.; Kohyama, Akira
2000-09-01
Several rod-shaped specimens with uniaxially packed fibers (Hi-Nicalon, Hi-Nicalon Type S, Tyranno SA and Amoco K1100 types) and a pre-ceramic polymer matrix have been fabricated. By using appropriate analytic models, the bare fiber thermal conductivity (Kf) and the interface thermal conductance (h) will be determined as a function of temperature up to 1000?C before and after irradiation for samples cut from these rods. Initial results are: (1) for unirradiated Hi-Nicalon SiC fiber, Kf varied from 4.3 up to 5.9 W/mK for the 27-1000?C range, (2) for unirradiated K1100 graphite fiber, Kf varied from 576 down to 242 W/mK for the 27-1000?C range, and (3) h = 43 W/cm2K at 27?C as a typical fiber/matrix interface conductance.
Czech Academy of Sciences Publication Activity Database
Ferraris, M.; Casalegno, V.; Rizzo, S.; Salvo, M.; Van Staveren, T.O.; Matějíček, Jiří
2012-01-01
Roč. 429, 1-3 (2012), s. 166-172 ISSN 0022-3115 R&D Projects: GA MPO 2A-1TP1/101 Institutional research plan: CEZ:AV0Z20430508 Keywords : glass-ceramic * joining * SiC composites * fusion materials Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.211, year: 2012 http://www.sciencedirect.com/science/article/pii/S0022311512002668
Fusibility of medical glass in hospital waste incineration: Effect of glass components
International Nuclear Information System (INIS)
Jiang, X.G.; An, C.G.; Li, C.Y.; Fei, Z.W.; Jin, Y.Q.; Yan, J.H.
2009-01-01
Medical glass, which is the principal incombustible component in hospital wastes, has a bad influence on combustion. In a rotary kiln incinerator, medical glass melts and turns into slag, possibly adhering to the inner wall. Prediction of the melting characteristics of medical glass hence is important for preventing slagging. The effect of various glass components on fusibility has been investigated experimentally; that of Na 2 O is the most marked. The softening temperature and flow temperature decrease 19.8 o C and 34.0 o C, respectively, with a rise of Na 2 O content in the Basic Content (standard composition of medical glass) of 1%. Correlations between fusion temperatures and glass components have been investigated; predictive functions of four characteristic melting temperatures have been obtained by simplifying the multi-variant series and were verified by testing glass samples. Relative errors of fusion temperatures (computed vs. measured) are mostly less than 5%.
Low-temperature deposition of ZnO thin films on PET and glass substrates by DC-sputtering technique
International Nuclear Information System (INIS)
Banerjee, A.N.; Ghosh, C.K.; Chattopadhyay, K.K.; Minoura, Hideki; Sarkar, Ajay K.; Akiba, Atsuya; Kamiya, Atsushi; Endo, Tamio
2006-01-01
The structural, optical and electrical properties of ZnO thin films (260 - 490 nm thick) deposited by direct-current sputtering technique, at a relatively low-substrate temperature (363 K), onto polyethylene terephthalate and glass substrates have been investigated. X-ray diffraction patterns confirm the proper phase formation of the material. Optical transmittance data show high transparency (80% to more than 98%) of the films in the visible portion of solar radiation. Slight variation in the transparency of the films is observed with a variation in the deposition time. Electrical characterizations show the room-temperature conductivity of the films deposited onto polyethylene terephthalate substrates for 4 and 5 h around 0.05 and 0.25 S cm -1 , respectively. On the other hand, for the films deposited on glass substrates, these values are 8.5 and 9.6 S cm -1 for similar variation in the deposition time. Room-temperature conductivity of the ZnO films deposited on glass substrates is at least two orders of magnitude higher than that of ZnO films deposited onto polyethylene terephthalate substrates under identical conditions. Hall-measurements show the maximum carrier concentration of the films on PET and glass substrate around 2.8 x 10 16 and 3.1 x 10 2 cm -3 , respectively. This report will provide newer applications of ZnO thin films in flexible display technology
Energy Technology Data Exchange (ETDEWEB)
Melo, B. M. G.; Graça, M. P. F., E-mail: mpfg@ua.pt; Prezas, P. R.; Valente, M. A. [Physics Department (I3N), Aveiro University, Campus Universitário de Santiago, Aveiro (Portugal); Almeida, A. F.; Freire, F. N. A. [Mechanics Engineering Department, Ceará Federal University, Fortaleza (Brazil); Bih, L. [Equipe Physico-Chimie la Matière Condensée, Faculté des Sciences de Meknès, Meknès (Morocco)
2016-08-07
In this work, phosphate-borate based glasses with molar composition 20.7P{sub 2}O{sub 5}–17.2Nb{sub 2}O{sub 5}–13.8WO{sub 3}–34.5A{sub 2}O–13.8B{sub 2}O{sub 3}, where A = Li, Na, and K, were prepared by the melt quenching technique. The as-prepared glasses were heat-treated in air at 800 °C for 4 h, which led to the formation of glass-ceramics. These high chemical and thermal stability glasses are good candidates for several applications such as fast ionic conductors, semiconductors, photonic materials, electrolytes, hermetic seals, rare-earth ion host solid lasers, and biomedical materials. The present work endorses the analysis of the electrical conductivity of the as-grown samples, and also the electrical, dielectric, and structural changes established by the heat-treatment process. The structure of the samples was analyzed using X-Ray powder Diffraction (XRD), Raman spectroscopy, and density measurements. Both XRD and Raman analysis confirmed crystals formation through the heat-treatment process. The electrical ac and dc conductivities, σ{sub ac} and σ{sub dc}, respectively, and impedance spectroscopy measurements as function of the temperature, varying from 200 to 380 K, were investigated for the as-grown and heat-treated samples. The impedance spectroscopy was measured in the frequency range of 100 Hz–1 MHz.
International Nuclear Information System (INIS)
Terres, H; Lizardi, A; Chávez, S; López, R; Vaca, M
2017-01-01
In this work, an exergy evaluation to determine the energy availability across to glass covers, place where the solar radiation enters toward a solar cooker box-type is done. Considering the heating process of water, the energy not used is quantified by means of exergy. The results allow identifying the glasses in the cover as the zone where the solar cooker could be improved. The conduction heat transfer losses for the glasses is most big than 75%. Because the values for the conduction heat losses are around 90%, which are very important, this allows to identify the cover glass as the area where improvements could be made in this type of solar cookers. (paper)
Electrical properties of phosphate glasses
International Nuclear Information System (INIS)
Mogus-Milankovic, A; Santic, A; Reis, S T; Day, D E
2009-01-01
Investigation of the electrical properties of phosphate glasses where transition metal oxide such as iron oxide is the network former and network modifier is presented. Phosphate glasses containing iron are electronically conducting glasses where the polaronic conduction is due to the electron hopping from low to high iron valence state. The identification of structural defects caused by ion/polaron migration, the analysis of dipolar states and electrical conductivity in iron phosphate glasses containing various alkali and mixed alkali ions was performed on the basis of the impedance spectroscopy (IS). The changes in electrical conductivity from as-quenched phosphate glass to fully crystallized glass (glass-ceramics) by IS are analyzed. A change in the characteristic features of IS follows the changes in glass and crystallized glass network. Using IS, the contribution of glass matrix, crystallized grains and grain boundary to the total electrical conductivity for iron phosphate glasses was analyzed. It was shown that decrease in conductivity is caused by discontinuities in the conduction pathways as a result of the disruption of crystalline network where two or more crystalline phases are formed. Also, phosphate-based glasses offer a unique range of biomaterials, as they form direct chemical bonding with hard/soft tissue. The surface charges of bioactive glasses are recognized to be the most important factors in determining biological responses. The improved bioactivity of the bioactive glasses as a result of the effects of the surface charges generated by electrical polarization is discussed.
International Nuclear Information System (INIS)
Tait, J.C.
1993-05-01
AECL has investigated three waste forms for the immobilization of high-level liquid wastes that would arise if used CANDU fuels were reprocessed at some time in the future to remove fissile materials for the fabrication of new power reactor fuel. These waste forms are borosilicate glasses, aluminosilicate glasses and titanosilicate glass-ceramics. This report discusses the potential effects of alpha, beta and gamma radiation on the releases of radionuclides from these waste forms as a result of aqueous corrosion by groundwaters that would be present in an underground waste disposal vault. The report discusses solid-state damage caused by radiation-induced atomic displacements in the waste forms as well as irradiation of groundwater solutions (radiolysis), and their potential effects on waste-form corrosion and radionuclide release. The current literature on radiation effects on borosilicate glasses and in ceramics is briefly reviewed, as are potential radiation effects on specialized waste forms for the immobilization of 129 I, 85 Kr and 14 C. (author). 104 refs., 9 tabs., 5 figs
Jo, Sinae; Kang, Seunggu
2013-05-01
The effect of TiO2 on the degree of crystallization, thermal properties and microstructure for MgO-Al2O3-SiO2 glass-ceramics system containing 0-13 wt% TiO2 and 0-1.5 wt% B2O3 in which the cordierite is the main phase was studied. Using Kissinger and Augis-Bennett equations, the activation energy, 510 kJ/mol and Avrami constant, 1.8 were calculated showing the surface-oriented crystallization would be preferred. The alpha-cordierite phase was generated in the glass-ceramics of containing TiO2 of 0-5.6 wt%. However, for the glass-ceramics of TiO2 content above 7 wt%, an alpha-cordierite disappeared and micro-cordierite phase was formed. The glass-ceramics of no TiO2 added had spherical crystals of few tens nanometer size spread in the matrix. As TiO2 content increased up to 5.6 wt%, a lump of dendrite was formed. In the glass-ceramics containing TiO2 7-13 wt%, in which the main phase is micro-cordierite, the dendrite crystal disappeared and a few hundred nanometer sized crystal particles hold tightly each other were generated. The thermal conductivity of glass-ceramics of both a-cordierite and micro-cordierite base decreased with TiO2 contend added. The thermal conductivity of glass-ceramics of 1.5 wt% TiO2 added was 3.4 W/mK which is 36% higher than that of glass-ceramics of no TiO2 added. The sintering temperature for 1.5 wt% TiO2 glass-ceramics was 965 degrees C which could be concluded as to apply to LTCC process for LED packaging.
Glass Ceramics Composites Fabricated from Coal Fly Ash and Waste Glass
International Nuclear Information System (INIS)
Angjusheva, B.; Jovanov, V.; Srebrenkoska, V.; Fidancevska, E.
2014-01-01
Great quantities of coal ash are produced in thermal power plants which present a double problem to the society: economical and environmental. This waste is a result of burning of coal at temperatures between 1100-14500C. Fly ash available as fine powder presents a source of important oxides SiO2, Al2O3, Fe2O3, MgO, Na2O, but also consist of small amount of ecologically hazardous oxides such as Cr2O3, NiO, MnO. The combination of the fly ash with waste glass under controlled sintering procedure gave bulk glass-ceramics composite material. The principle of this procedure is presented as a multi barrier concept. Many researches have been conducted the investigations for utilization of fly ash as starting material for various glass–ceramics production. Using waste glass ecologically hazardous components are fixed at the molecular level in the silicate phase and the fabricated new glass-ceramic composites possess significantly higher mechanical properties. The aim of this investigation was to fabricate dense glass ceramic composites using fly ash and waste glass with the potential for its utilization as building material
TaxHf1−xB2–SiC multiphase oxidation protective coating for SiC-coated carbon/carbon composites
International Nuclear Information System (INIS)
Ren, Xuanru; Li, Hejun; Fu, Qiangang; Li, Kezhi
2014-01-01
Highlights: • Ta x Hf 1−x B 2 –SiC coating was prepared on SiC coated C/C by in-situ reaction method. • TaB 2 and HfB 2 were introduced in the form of solid solution Ta x Hf 1−x B 2 . • The coating could protect C/C for 1480 h with only 0.57% mass loss at 1773 K in air. • Oxidation layer consists of out Ta–Si–O compound layer and inner SiO 2 glass layer. • Ta–Si–O compound silicate layer presents a better stability than SiO 2 glass layer. - Abstract: A Ta x Hf 1−x B 2 –SiC coating was prepared by in-situ reaction method on SiC coated C/C composites. Ta x Hf 1−x B 2 phase is the form of solid solution between TaB 2 and HfB 2 . Isothermal oxidation behavior at 1773 K and ablation behavior of the coated C/C were tested. Ta x Hf 1−x B 2 –SiC/SiC coating could protect the C/C from oxidation at 1773 K for 1480 h and ablation above 2200 K for 40 s. During oxidation, oxides of Ta and Hf atoms exist as “pinning phases” in the compound glass layer consisted of outer Ta–Si–O compound silicate layer and inner SiO 2 glass layer, which was responsible for the excellent oxidation resistance
Preparation and Dynamic Mechanical Properties at Elevated Temperatures of a Tungsten/Glass Composite
Gao, Chong; Wang, Yingchun; Ma, Xueya; Liu, Keyi; Wang, Yubing; Li, Shukui; Cheng, Xingwang
2018-03-01
Experiments were conducted to prepare a borosilicate glass matrix composite containing 50 vol.% tungsten and examine its dynamic compressive behavior at elevated temperatures in the range of 450-775 °C. The results show that the homogenous microstructure of the tungsten/glass composite with relative density of 97% can be obtained by hot-pressing sintering at 800 °C for 1 h under pressure of 30 MPa. Dynamic compressive testing was carried out by a separate Hopkinson pressure bar system with a synchronous device. The results show that the peak stress decreases and the composite transforms from brittle to ductile in nature with testing temperature increasing from 450 to 750 °C. The brittle-ductile transition temperature is about 500 °C. Over 775 °C, the composite loses load-bearing capacity totally because of the excessive softening of the glass phase. In addition, the deformation and failure mechanism were analyzed.
Wu, Peng; Hu, Ming Yu; Chong, Xiao Yu; Feng, Jing
2018-03-01
Using the solid-state reaction method, the (ZrO2)x-(Dy3TaO7)1-x (x = 0, 0.02, 0.04, 0.06, 0.08, and 0.1) ceramics are synthesized in this work. The identification of the crystal structures indicates that the (ZrO2)x-(Dy3TaO7)1-x ceramics belong to the orthorhombic system, and the space group is C2221 in spite of the value of x increasing to 0.1. The thermal conductivities of the (ZrO2)x-(Dy3TaO7)1-x ceramics range from 1.3 W/(m K) to 1.8 W/(m K), and this value is much lower than that of 7-8 YSZ (yttria-stabilized zirconia). Besides, the (ZrO2)x-(Dy3TaO7)1-x ceramics possess the glass-like thermal conductivity caused by intrinsic oxygen vacancies existing in the lattice of Dy3TaO7. Moreover, the results of thermal expansion rates demonstrate that the (ZrO2)x-(Dy3TaO7)1-x ceramics possess excellent high temperature phase stability, and the thermal expansion coefficients [(9.7-11) × 10-6 K-1] are comparable to that of 7-8 YSZ.
The mechanism of foaming and thermal conductivity of glasses foamed with MnO2
DEFF Research Database (Denmark)
Petersen, Rasmus Rosenlund; König, Jakob; Yue, Yuanzheng
2015-01-01
bubbles and subsequent growth. We discuss evolution of pore morphology in terms of pore number density, pore size and closed porosity. The thermal conductivity of the foam glasses is linearly dependent on density. The heat transfer mechanism is revealed by comparing the experimental data with structural...... data and analytical models.We show that the effect of pore size, presence of crystal inclusions and degree of closed porosity do not affect the overall thermal conductivity....
Electrical conduction studies of hot wall deposited CdSe{sub x}Te{sub 1-x} thin films
Energy Technology Data Exchange (ETDEWEB)
Muthukumarasamy, N. [Department of Physics, Coimbatore Institute of Technology, Coimbatore 641014 (India); Balasundaraprabhu, R.; Jayakumar, S.; Kannan, M.D. [Department of Physics, PSG College of Technology, Coimbatore (India)
2008-08-15
CdSe{sub x}Te{sub 1-x} thin films of different compositions have been deposited on cleaned glass substrates using the hot wall deposition technique under conditions very close to thermodynamical equilibrium with minimum loss of material. The electrical conductivity of the deposited films has been studied as a function of temperature. All the films showed a transition from phonon-assisted hopping conduction through the impurity band to grain-boundary-limited conduction in the conduction/valence band at temperature around 325 K. The conductivity has been found to vary with composition; it varied from 0.0027 to 0.0198 {omega}{sup -1} cm{sup -1} when x changed from 0 to 1. The activation energies of the films of different compositions determined at 225 and 400 K have been observed to lie in the range 0.0031-0.0098 and 0.0285-0.0750 eV, respectively. The Hall-effect studies carried out on the deposited films revealed that the nature of conductivity (p or n-type) was dependent on film composition; films with composition x=0 and 0.15 have been found to be p-type and the ones with composition x=0.4, 0.6, 0.7, 0.85 and 1 have been observed to exhibit n-type conductivity. The carrier concentration has been determined and is of the order of 10{sup 17} cm{sup -3}. The majority of carrier mobilities of the films have been observed to vary from 0.032 to 0.183 cm{sup 2} V{sup -1} s{sup -1} depending on film composition. The study of the mobility of the charge carriers with temperature in the range of 300-450 K showed that the mobility increased with 3/2 power of temperature indicating that the type of scattering mechanism in the studied temperature range is the ionized impurity scattering mechanism. (author)
Radiolysis of cesium iodide solutions at 35 and 85 deg C
International Nuclear Information System (INIS)
Lucas, M.
1981-09-01
An aqueous solution of cesium iodide was irradiated by the gamma rays from a cobalt 60 source with a dose rate of 0.4 Mrad/hr. At 35 deg C the iodide I - is oxidized in molecular iodine I 2 but at 85 deg C the iodate IO 3 - is obtained. The aim of this work is the study of aerosols behaviour released in accidental situation of a PWR in presence of steam [fr
Thermal Conductivity of Structural Glass/Fibre Epoxy Composite as a Function of Fibre Orientation
Cugnet, D; Kuijper, A; Parma, Vittorio; Vandoni, Giovanna
2002-01-01
The LHC, the new superconducting particle accelerator presently under construction at CERN, makes use of some 1200 dipole magnets for orbit bending and 500 quadrupole magnets for focusing/defocusing of the circulating high-energy proton beams. Two or three column-type support posts sustain each cryomagnet. The choice of a convenient material for these supports is critical, because of the required high positioning accuracy of the magnets in their cryostats and stringent thermal budget requirements imposed by the LHC cryogenic system. A glass-fibre/epoxy resin composite has been chosen for its good combination of high stiffness and low thermal conductivity over the 2-293 K temperature range. Plies of long glass-fibres are stacked optimally yielding the best mechanical behaviour. However, heat leaks from the supports are influenced by the thermal characteristics of the composite, which in turn depend on the orientation of the fibres. To study the dependence of the thermal conductivity on fibre's orientation, we ...
Directory of Open Access Journals (Sweden)
As'mau Ibrahim Gebi
2016-12-01
Full Text Available In a bid to address environmental challenges associated with the management of waste Coca cola glass bottle, this study set out to develop glass ceramic materials using waste coca cola glass bottles and magnesite from Sakatsimta in Adamawa state. A reagent grade chrome (coloring agent were used to modify the composition of the coca cola glass bottle; X-ray fluorescence(XRF, X-ray diffraction (XRD and Thermo gravimetric analysis (TGA were used to characterize raw materials, four batches GC-1= Coca cola glass frit +1%Cr2O3, GC-2=97% Coca cola glass frit+ 2% magnesite+1%Cr2O3, GC-3=95% Coca cola glass frit+ 4%magnesite+1%Cr2O3, GC-4=93%Coca cola glass frit+ 6%magnesite+ 1%Cr2O3 were formulated and prepared. Thermal Gradient Analysis (TGA results were used as a guide in selection of three temperatures (7000C, 7500C and 8000C used for the study, three particle sizes -106+75, -75+53, -53µm and 2 hr sintering time were also used, the sinter crystallization route of glass ceramic production was adopted. The samples were characterized by X-ray diffraction (XRD and Scanning Electron Microscope (SEM, the density, porosity, hardness and flexural strength of the resulting glass ceramics were also measured. The resulting glass ceramic materials composed mainly of wollastonite, diopside and anorthite phases depending on composition as indicated by XRD and SEM, the density of the samples increased with increasing sintering temperature and decreasing particle size. The porosity is minimal and it decreases with increasing sintering temperature and decreasing particle size. The obtained glass ceramic materials possess appreciable hardness and flexural strength with GC-3 and GC-4 having the best combination of both properties.
Mechanical Properties of Densified Tectosilicate Calcium-Aluminosilicate Glasses
DEFF Research Database (Denmark)
Johnson, Nicole; Lamberson, Lisa; Smedskjær, Morten Mattrup
Aluminosilicate glasses are widely used in applications such as LCD glass, touchscreens for hand held devices and car windows. We have shown that the tectosilicate compositions exhibit an interesting non-monotonic variation in hardness with increasing SiO2 content. From 40% to 85 mol% SiO2......, hardness and indentation modulus both decrease, consistent with the topological constraint theory. Above 85 mol% SiO2 , hardness increases rapidly with increasing SiO2 content while modulus continues to decrease. A switch from shear to densification based on the species present in the glass has been...... proposed to explain this behavior. To reduce densification and study shear deformation independently, a series of calcium aluminosilicate glasses with tectosilicate compositions were densified by isostatic compression in a gas pressure chamber at elevated temperatures. The compressed glasses have increased...
Mondal, Praloy; Das, Debajyoti
2017-07-01
Technologically appropriate device friendly ZnO:Ga films have been prepared at a low growth temperature (100 °C) by changing the RF power (P) applied to the magnetron plasma. Structurally preferred c-axis orientation of the ZnO:Ga network has been attained with I〈002〉/I〈103〉 > 5. The c-axis oriented grains of wurtzite ZnO:Ga grows geometrically and settles in tangentially, providing favorable conduction path for stacked layer devices. Nano-sheet like structures produced at the surface are interconnected and provide conducting path across the surface; however, those accommodate a lot of pores in between that help better light trapping and reduce the reflection loss. The optimized ZnO:Ga thin film prepared at RF power of 200 W has 〈002〉 oriented grains of average size ∼10 nm and exhibits a very high conductivity ∼200 S cm-1 and elevated transmission (∼93% at 500 nm) in the visible range. The optimized ZnO:Ga film has been used as the transparent conducting oxide (TCO) window layer of RF-PECVD grown silicon thin film solar cells in glass/TCO/p-i-n-Si/Al configuration. The characteristics of identically prepared p-i-n-Si solar cells are compared by replacing presently developed ZnO:Ga TCO with the best quality U-type SnO2 coated Asahi glass substrates. The ZnO:Ga coated glass substrate offers a higher open circuit voltage (VOC) and the higher fill factor (FF). The ZnO:Ga film being more stable in hydrogen plasma than its SnO2 counterpart, maintains a high transparency to the solar radiation and improves the VOC, while reduced diffusion of Zn across the p-layer creates less defects at the p-i interface in Si:H cells and thereby, increases the FF. Nearly identical conversion efficiency is preserved for both TCO substrates. Excellent c-axis orientation even at low growth temperature promises improved device performance by extended parametric optimization.
Distinct atomic structures of the Ni-Nb metallic glasses formed by ion beam mixing
International Nuclear Information System (INIS)
Tai, K. P.; Wang, L. T.; Liu, B. X.
2007-01-01
Four Ni-Nb metallic glasses are obtained by ion beam mixing and their compositions are measured to be Ni 77 Nb 23 , Ni 55 Nb 45 , Ni 31 Nb 69 , and Ni 15 Nb 85 , respectively, suggesting that a composition range of 23-85 at. % of Nb is favored for metallic glass formation in the Ni-Nb system. Interestingly, diffraction analyses show that the structure of the Nb-based Ni 31 Nb 69 metallic glass is distinctly different from the structure of the Nb-based Ni 15 Nb 85 metallic glass, as the respective amorphous halos are located at 2θ≅38 and 39 deg. To explore an atomic scale description of the Ni-Nb metallic glasses, an n-body Ni-Nb potential is first constructed with an aid of the ab initio calculations and then applied to perform the molecular dynamics simulation. Simulation results determine not only the intrinsic glass forming range of the Ni-Nb system to be within 20-85 at. % of Nb, but also the exact atomic positions in the Ni-Nb metallic glasses. Through a statistical analysis of the determined atomic positions, a new dominant local packing unit is found in the Ni 15 Nb 85 metallic glass, i.e., an icositetrahedron with a coordination number to be around 14, while in Ni 31 Nb 69 metallic glasses, the dominant local packing unit is an icosahedron with a coordination number to be around 12, which has been reported for the other metallic glasses. In fact, with increasing the irradiation dose, the Ni 31 Nb 69 metallic glasses are formed through an intermediate state of face-centered-cubic-solid solution, whereas the Ni 15 Nb 85 metallic glass is through an intermediate state of body-centered-cubic-solid solution, suggesting that the structures of the constituent metals play an important role in governing the structural characteristics of the resultant metallic glasses
Ac-conductivity and dielectric response of new zinc-phosphate glass/metal composites
Energy Technology Data Exchange (ETDEWEB)
Maaroufi, A., E-mail: maaroufi@fsr.ac.ma [University of Mohammed V, Laboratory of Composite Materials, Polymers and Environment, Department of Chemistry, Faculty of Sciences, P.B. 1014, Rabat-Agdal (Morocco); Oabi, O. [University of Mohammed V, Laboratory of Composite Materials, Polymers and Environment, Department of Chemistry, Faculty of Sciences, P.B. 1014, Rabat-Agdal (Morocco); Lucas, B. [XLIM UMR 7252 – Université de Limoges/CNRS, 123 avenue Albert Thomas, 87060 Limoges Cedex (France)
2016-07-01
The ac-conductivity and dielectric response of new composites based on zinc-phosphate glass with composition 45 mol%ZnO–55 mol%P{sub 2}O{sub 5}, filled with metallic powder of nickel (ZP/Ni) were investigated by impedance spectroscopy in the frequency range from 100 Hz to 1 MHz at room temperature. A high percolating jump of seven times has been observed in the conductivity behavior from low volume fraction of filler to the higher fractions, indicating an insulator – semiconductor phase transition. The measured conductivity at higher filler volume fraction is about 10{sup −1} S/cm and is frequency independent, while, the obtained conductivity for low filler volume fraction is around 10{sup −8} S/cm and is frequency dependent. Moreover, the elaborated composites are characterized by high dielectric constants in the range of 10{sup 5} for conductive composites at low frequencies (100 Hz). In addition, the distribution of the relaxation processes was also evaluated. The Debye, Cole-Cole, Davidson–Cole and Havriliak–Negami models in electric modulus formalism were used to model the observed relaxation phenomena in ZP/Ni composites. The observed relaxation phenomena are fairly simulated by Davidson–Cole model, and an account of the interpretation of results is given. - Highlights: • Composites of ZnO-P{sub 2}O{sub 5}/metal were investigated by impedance spectroscopy. • Original ac-conductivity behavior was discovered in ZnO-P{sub 2}O{sub 5}/metal composites. • High dielectric constant is measured in ZnO-P{sub 2}O{sub 5}/metal composites. • Dielectric constant as filler function is well interpreted with percolation theory. • Observed relaxation processes are well described using electric modulus formalism.
Glass-Coated Beryllium Mirrors for the LHCb RICH1 Detector
Barber, G J; Cameron, W; D'Ambrosio, C; Frei, C; Harnew, N; Head, R; Khimitch, Y P; Khmelnikov, V A; Loveridge, P W; Metlica, F; Obraztsov, V F; Piedigrossi, D; Sizenev, V; Kompozit Joint Stock Company, Moscow, Russia; Szczypka, P M; Ullaland, O; Vygosky, E; Websdale, D M
2007-01-01
The design, manufacture and testing of lightweight glass-coated beryllium spherical converging mirrors for the RICH1 detector of LHCb are described. The mirrors need to be lightweight to minimize the material budget and fluorocarbon-compatible to avoid degradation in the RICH1 C4F10 gas radiator. Results of the optical measurements for the small-sized prototypes and for the first full-sized prototype mirror are reported.
International Nuclear Information System (INIS)
Abdelouas, A.; Crovisier, J.L.; Lutze, W.; Mueller, R.; Bernotat, W.
1994-01-01
The R7T7 and synthetic basaltic glasses were submitted to corrosion in a saline MgCl 2 dominated solution at 190 degrees C. For both glasses, the early alteration product is a hydrotalcite-like compound in which HPO 4 2- , SO 4 2- and Cl - substitutes to CO 3 2- . The measured d 003 spacing is 7.68 angstrom for the hydrotalcite formed from R7T7 glass and 7.62 angstrom for the hydrotalcite formed from basaltic glass which reflect the high aluminium content. Chemical microanalyses show that the hydrotalcite is subsequently covered by a silica-rich gel which evolves into saponite after few months
Kassem, M; Alekseev, I; Bokova, M; Le Coq, D; Bychkov, E
2018-04-12
Conductivity isotherms of (CdTe) x (AgI) 0.5- x/2 (As 2 Te 3 ) 0.5- x/2 glasses (0.0 ≤ x ≤ 0.15) reveal a nonmonotonic behavior with increasing CdTe content reminiscent of mixed cation effect in oxide and chalcogenide glasses. Nevertheless, the apparent similarity appears to be partly incorrect. Using 110m Ag tracer diffusion measurements, we show that semiconducting CdTe additions produce a dual effect: (i) decreasing the Ag + ion transport by a factor of ≈200 with a simultaneous increase of the diffusion activation energy and (ii) increasing the electronic conductivity by 1.5 orders of magnitude. Consequently, the conductivity minimum at x = 0.05 reflects an ionic-to-electronic transport crossover; the silver-ion transport number decreases by 3 orders of magnitude with increasing x.
Low-Temperature Sintering Li3Mg1.8Ca0.2NbO6 Microwave Dielectric Ceramics with LMZBS Glass
Wang, Gang; Zhang, Huaiwu; Liu, Cheng; Su, Hua; Jia, Lijun; Li, Jie; Huang, Xin; Gan, Gongwen
2018-05-01
Li3Mg1.8Ca0.2NbO6 ceramics doped with Li2O-MgO-ZnO-B2O3-SiO2 glass (LMZBS) were prepared via a solid-state route. The LMZBS glass effectively reduced the sintering temperature of Li3Mg1.8Ca0.2NbO6 ceramics to 950°C. The effects of the LMZBS glass on the sintering behavior, microstructures and microwave dielectric properties of Li3Mg1.8Ca0.2NbO6 ceramics are discussed in detail. Among all the LMZBS doped Li3Mg1.8Ca0.2NbO6 ceramics, the sample with 1 wt.% of LMZBS glass sintered at 950°C for 4 h exhibited good dielectric properties: ɛ r = 16.7, Q × f = 31,000 GHz (9.92 GHz), τ f = - 1.3 ppm/°C. The Li3Mg1.8Ca0.2NbO6 ceramics possessed excellent chemical compatibility with Ag electrodes, and could be applied in low temperature co-fired ceramics (LTCC) applications.
Conductivity studies on microwave synthesized glasses
Indian Academy of Sciences (India)
inantly 'ionic' to predominantly 'electronic' depending upon the chemical composition. The dc ... ion concentration but also due to ... and the broadening of the individual lines.19,20 In glasses ... obtained, which was immediately quenched between copper blocks. ..... tres via V4+–O–V5+ super exchange mechanism.
Energy Technology Data Exchange (ETDEWEB)
Tait, J C
1993-05-01
AECL has investigated three waste forms for the immobilization of high-level liquid wastes that would arise if used CANDU fuels were reprocessed at some time in the future to remove fissile materials for the fabrication of new power reactor fuel. These waste forms are borosilicate glasses, aluminosilicate glasses and titanosilicate glass-ceramics. This report discusses the potential effects of alpha, beta and gamma radiation on the releases of radionuclides from these waste forms as a result of aqueous corrosion by groundwaters that would be present in an underground waste disposal vault. The report discusses solid-state damage caused by radiation-induced atomic displacements in the waste forms as well as irradiation of groundwater solutions (radiolysis), and their potential effects on waste-form corrosion and radionuclide release. The current literature on radiation effects on borosilicate glasses and in ceramics is briefly reviewed, as are potential radiation effects on specialized waste forms for the immobilization of {sup 129}I, {sup 85}Kr and {sup 14}C. (author). 104 refs., 9 tabs., 5 figs.
Glass formability of high T(sub c) Bi-Sr-Ca-Cu-O superconductors
Kaukler, William F.
1992-01-01
A number of compositions of ceramic oxide high T(sub c) superconductors were evaluated for their glass formation ability by means of rapid thermal analysis during quenching, optical and electron microscopy of the quenched samples, and with subsequent DSC measurements. Correlations between experimental measurements and the methodical composition changes identified the formulations of superconductors that can easily form glass. The superconducting material was first formed as a glass, then with subsequent devitrification it was formed into bulk crystalline superconductor by a series of processing methods.
International Nuclear Information System (INIS)
Beke, S.; Sugioka, K.; Midorikawa, K.; Koroesi, L.; Dekany, I.
2011-01-01
A new method for embedding transparent and conductive two- and three-dimensional microstructures in glass is presented. We show that the internal surface of hollow structures fabricated by femtosecond-laser direct writing inside the photosensitive glass can be coated by indium tin oxide (Sn-doped In 2 O 3 , ITO) using a sol-gel process. The idea of combining two transparent materials with different electrical properties, i.e., insulating and conductive, is very promising and hence it opens new prospects in manufacturing cutting edge microdevices, such as lab-on-a-chips (LOCs) and microelectromechanical systems (MEMS). (orig.)
International Nuclear Information System (INIS)
Nakao, S; Sonoda, T
2013-01-01
Diamond-like carbon (DLC) films are prepared by a bipolar-type plasma based ion implantation, and the structural differences between DLC films deposited on different electrical conductive substrates, i.e., conductive Si wafers and insulating glass plates are examined by Raman spectroscopy and x-ray photo emission spectroscopy (XPS). In the Raman measurements, graphite (G) and disorder (D) peaks are observed for both samples. However, the additional photo luminescence is overlapped on the spectra in the case of on-glass sample. To elucidate the structural difference, the intensity ratio of D to G peak (I(D)/I(G)), G peak position and full width at half maximum (FWHM) are obtained by curve fitting using Gaussian function and linear baseline. It is found that the I(D)/I(G) is lower, G peak position is higher and FWHM of G peak is narrower for on-glass sample than for on-Si sample. According to Robertson [1], lower I(D)/I(G) seems more sp 3 C-C bonding in amount for on-glass sample. In contrast, higher G peak position and narrower FWHM of G peak suggest less sp 3 C-C bonding in amount for on-glass sample. The results of XPS analysis with C1s spectra reveal that sp 3 ratio, i.e., the intensity ratio of sp 3 /(sp 3 +sp 2 ) is smaller for on-glass sample than for on-Si sample. The inconsistency of the trend between I(D)/I(G) and other parameters (G peak position and FWHM of G peak) might be caused by the overlap of photo luminescence signal on Raman spectrum as to on-glass sample. From these results, it is considered that sp 3 C-C bonding is reduced in amount when using insulating substrate in comparison with conductive substrate.
Preparation and investigation of GaxGe25As15Se60-x (x = 1 ÷ 5) glasses
Shiryaev, V. S.; Karaksina, E. V.; Velmuzhov, A. P.; Sukhanov, M. V.; Kotereva, T. V.; Plekhovich, A. D.; Churbanov, M. F.; Filatov, A. I.
2017-05-01
Chalcogenide glasses of GaxGe25As15Se60-x (x = 0; 1; 2; 3; 4; 5) compositions are prepared; their transmission range, optical band gap energy, thermal properties and stability against crystallization are studied. It is shown that these glasses have a high transparency in the mid-IR region (from 0.8 to 15 μm), a high glass transition temperature (≥320 °C) and a low tendency to crystallize. The optical band gap energy of GaxGe25As15Se60-x (x = 0; 1; 2; 3; 4; 5) glasses decreases from 1.68 to 1.43 eV as the gallium content increases and the selenium decreases. Their glass network, according to IR spectroscopy data, consists of Ge(Se1/2)4 tetrahedrons and AsSe3/2 pyramids. The Ga2Ge25As15Se58 and Ga3Ge25As15Se57 glasses have highest stability against crystallization. The content of hydrogen and oxygen impurities in the purest glass samples, fabricated using a combination of chemical distillation purification method and vapor transport reaction technique, does not exceed 0.06 ppm (wt) and 0.5 ppm (wt), respectively.
Experimental study on critical breaking stress of float glass under elevated temperature
International Nuclear Information System (INIS)
Wang, Yu; Wang, Qingsong; Shao, Guangzheng; Chen, Haodong; Sun, Jinhua; He, Linghui; Liew, K.M.
2014-01-01
Highlights: • Critical breaking stresses of clear, ground and coated glass were measured. • Breaking stress and strain of smooth glass were measured from 25 °C to 400 °C. • At approximately 100 °C, critical stress reached the minimum value. • Surface treatment and ambient temperature have notable effects on glass breaking. - Abstract: Cracking and subsequent fallout of glass may significantly affect fire dynamics in compartments. Moreover, the breaking tensile stress of glass, a crucial parameter for breakage occurrence, is the least well known among mechanical properties. In this work, a series of experiments were conducted, through mechanical tensile tests, to directly measure the breaking stress of float glass using Material Testing System 810 apparatus. Clear, ground and coated glass samples with a thickness of 6 mm were measured under ambient conditions, with a room temperature of 25 °C. The breaking stress of smooth glass samples was also measured at 75 °C, 100 °C, 125 °C, 150 °C, 200 °C, 300 °C and 400 °C, respectively. The results show that surface treatment may decrease the critical tensile stress of glass panes. The average breaking stress also fluctuates considerably, from 26.60 to 35.72 MPa with the temperature variations investigated here. At approximately 100 °C, critical stress reached the minimum value at which glass breakage occurs more easily. In addition, the thermal expansion coefficient was established using a thermal dilatometer, to obtain the maximum temperature difference float glass can withstand. It is intended that these results will provide some practical guidelines for fire safety engineers
Preparation of no-carrier-added [1-11C]ethylene and [1-11C]1,2-dibromoethane as new labelling agents
International Nuclear Information System (INIS)
Shah, F.; Pike, V.W.; Dowsett, K.
1997-01-01
A method is described for the preparation of NCA [1- 11 C] ethylene based on the passage of [1- 11 C]ethanol over heated (550 o C) quartz glass in a stainless steel tube (in preference to dehydration by catalysis on γ-alumina or pyrolysis). The [1- 11 C]ethanol is prepared from cyclotron-produced NCA [ 11 C]carbon dioxide by 11 C-carboxylation of methylmagnesium bromide, freshly prepared in dibutyl ether, and reduction of the adduct with lithium aluminium hydride in diglyme. The use of involatile solvents avoids the formation of carrier ethylene and radioactive and stable diethyl ether by cracking processes over the heated catalyst. The preparation takes 21 min from the end of radionuclide production and has a radiochemical yield of 44%, decay-corrected from [ 11 C]carbon dioxide. NCA [1- 11 C] ethylene is converted quantitatively into [1- 11 C]1,2-dibromoethane when collected in a solution of bromine in carbon tetrachloride. The NCA [1- 11 C]ethylene and [1- 11 C]1,2-dibromoethane may serve as new and useful labelling agents. (Author)
Directory of Open Access Journals (Sweden)
Ruchi Jain
Full Text Available BACKGROUND: The variable efficacy (0-80% of Mycobacterium bovis Bacille Calmette Guréin (BCG vaccine against adult tuberculosis (TB necessitates development of alternative vaccine candidates. Development of recombinant BCG (rBCG over-expressing promising immunodominant antigens of M. tuberculosis represents one of the potential approaches for the development of vaccines against TB. METHODS/PRINCIPAL FINDINGS: A recombinant strain of BCG - rBCG85C, over expressing the antigen 85C, a secretory immuno-dominant protein of M. tuberculosis, was evaluated for its protective efficacy in guinea pigs against M. tuberculosis challenge by aerosol route. Immunization with rBCG85C resulted in a substantial reduction in the lung (1.87 log(10, p<0.01 and spleen (2.36 log(10, p<0.001 bacillary load with a commensurate reduction in pathological damage, when compared to the animals immunized with the parent BCG strain at 10 weeks post-infection. rBCG85C continued to provide superior protection over BCG even when post-challenge period was prolonged to 16 weeks. The cytokine profile of pulmonary granulomas revealed that the superior protection imparted by rBCG85C was associated with the reduced levels of pro-inflammatory cytokines - interleukin (IL-12, interferon (IFN-gamma, tumor necrosis factor (TNF-alpha, moderate levels of anti-inflammatory cytokine - transforming growth factor (TGF-beta along with up-regulation of inducible nitric oxide synthase (iNOS. In addition, the rBCG85C vaccine induced modulation of the cytokine levels was found to be associated with reduced fibrosis and antigen load accompanied by the restoration of normal lung architecture. CONCLUSIONS/SIGNIFICANCE: These results clearly indicate the superiority of rBCG85C over BCG as a promising prophylactic vaccine against TB. The enduring protection observed in this study gives enough reason to postulate that if an open-ended study is carried out with low dose of infection, rBCG85C vaccine in all
Friction behavior of glass and metals in contact with glass in various environments
Buckley, D. H.
1973-01-01
Sliding friction experiments have been conducted for heat-resistant glass and metals in contact with glass. These experiments were conducted in various environments including vacuum, moist air, dry air, octane, and stearic acid in hexadecane. Glass exhibited a higher friction force in moist air than it did in vacuum when in sliding contact with itself. The metals, aluminum, iron, and gold, all exhibited the same friction coefficient when sliding on glass in vacuum as glass sliding on glass. Gold-to-glass contacts were extremely sensitive to the environment despite the relative chemical inertness of gold.
Energy Technology Data Exchange (ETDEWEB)
Hufenbach, J., E-mail: j.k.hufenbach@ifw-dresden.de [IFW Dresden, Institute for Complex Materials, P.O. Box 270116, D-01171 Dresden (Germany); Helth, A. [IFW Dresden, Institute for Complex Materials, P.O. Box 270116, D-01171 Dresden (Germany); Lee, M.-H. [Korea Institute of Industrial Technology, Gaetbeol-ro 156, Yeonsu-gu, Incheon 406-840 (Korea, Republic of); Wendrock, H.; Giebeler, L. [IFW Dresden, Institute for Complex Materials, P.O. Box 270116, D-01171 Dresden (Germany); Choe, C.-Y.; Kim, K.-H. [Korea Institute of Industrial Technology, Gaetbeol-ro 156, Yeonsu-gu, Incheon 406-840 (Korea, Republic of); Kühn, U. [IFW Dresden, Institute for Complex Materials, P.O. Box 270116, D-01171 Dresden (Germany); Kim, T.-S. [Korea Institute of Industrial Technology, Gaetbeol-ro 156, Yeonsu-gu, Incheon 406-840 (Korea, Republic of); Eckert, J. [IFW Dresden, Institute for Complex Materials, P.O. Box 270116, D-01171 Dresden (Germany); TU Dresden, Institute of Materials Science, D-01062 Dresden (Germany)
2016-09-30
This work presents an investigation on the influence of rare earth additions (Ce) on the microstructure and mechanical properties of a cast Fe85Cr4Mo8V2C1 (element contents in wt%) tool steel. The applied relatively high solidification rate during the casting process promotes the formation of non-equilibrium phases such as martensite, retained austenite as well as a fine network-like structure of complex carbides. This combination of phases and their morphology results in excellent mechanical properties already in the as-cast state. Cerium additions induce a change in phase formation and resulting mechanical properties. Besides morphological and quantitative changes of the main constituent phases, novel carbo-oxide and carbide phases are formed. To investigate this microstructural phenomenon, X-ray diffraction (XRD), transmission electron microscopy (TEM) and scanning electron microscopy (SEM) combined with energy dispersive X-ray spectroscopy (EDX) were applied. Altogether, the addition of small amounts of the rare earth element cerium together with a tailored casting process results in enhanced mechanical properties compared to the Fe85Cr4Mo8V2C1 alloy and offers new possibilities to obtain high-strength and simultaneously adequate ductile cast steels for advanced tool design.
Viscosity and electrical conductivity of glass melts as a function of waste composition
International Nuclear Information System (INIS)
Plodinec, M.J.; Wiley, J.R.
1979-01-01
Radioactive waste at the Savannah River Plant contains high concentrations of nonradioactive compounds of iron and aluminum. Simulated waste compositions containing varying ratios of iron to aluminum were added to glass melts to determine the effect on the melt properties. Waste containing high-aluminum increased the melt viscosity, but waste containing high-iron reduced the melt viscosity. Aluminum and iron both reduced the melt conductivity
American Society for Testing and Materials. Philadelphia
2010-01-01
1.1 This practice describes a single-pass flow-through (SPFT) test method that can be used to measure the dissolution rate of a homogeneous silicate glass, including nuclear waste glasses, in various test solutions at temperatures less than 100°C. Tests may be conducted under conditions in which the effects from dissolved species on the dissolution rate are minimized to measure the forward dissolution rate at specific values of temperature and pH, or to measure the dependence of the dissolution rate on the concentrations of various solute species. 1.2 Tests are conducted by pumping solutions in either a continuous or pulsed flow mode through a reaction cell that contains the test specimen. Tests must be conducted at several solution flow rates to evaluate the effect of the flow rate on the glass dissolution rate. 1.3 This practice excludes static test methods in which flow is simulated by manually removing solution from the reaction cell and replacing it with fresh solution. 1.4 Tests may be conducted wit...
International Nuclear Information System (INIS)
Storms, E.K.
1982-12-01
This report uses selected measurements from the literature to construct analytical expressions that describe the electrical and thermal conductivity of pure, high-density UC/sub 1 +- x/, PuC/sub 1-x/, and (U/sub y/Pu/sub 1-y/C/sub 1 +- x/ as a function of x,y, and temperature. The approach shows that many of the differences between the reported measurements can be resolved if the carbon cntent of the single-phase material is taken into account. Analytical expressions are also given that describe the temperature variation of the phase boundaries for these phases. 16 figures
Ion transport studies in lithium phospho-molybdate glasses containing Cl− ion
International Nuclear Information System (INIS)
Gowda, V.C. Veeranna; Chethana, B.K.; Reddy, C. Narayana
2013-01-01
Highlights: • Addition of LiCl creates more conducting channels for Li + ion movement. • The decrease in E dc with increasing LiCl concentration could be due to Li + ions present in the columbic wells surrounded by Cl − ions are expected to be shallow. • Examined the power law fits using both two term and three term equation with fixed and floated parameters. -- Abstract: Ion conducting glasses in xLiCl–20Li 2 O–(80−x) [0.80P 2 O 5 –0.20MoO 3 ] glass system have been prepared over a wide range of composition (X = 5, 10, 15, 20 and 25 mol%). The electrical conductivity and dielectric relaxation of these glasses were analyzed using impedance spectroscopy in the frequency range of 10 Hz–10 MHz and in the temperature range of 313–353 K. D.c. activation energies extracted from Arrhenius plots using regression analysis, decreases with increasing LiCl mol%. A.c. conductivity data has been fitted to both single and double power law equation with both fixed and variable parameters. The increased conductivity in the present glass system has been correlated with the volume increasing effect and the coordination changes that occur due to structural modification resulting in the creation of non-bridging oxygens (NBO's) of the type O-Mo-O − bonds in the glass network. Dielectric relaxation mechanism in these glasses is analyzed using Kohlrausch–Williams–Watts (KWW) stretched exponential function and stretched exponent (β) is found to be insensitive to temperature
International Nuclear Information System (INIS)
Smith, D.K.
1990-01-01
Mineralogical, textural and compositional data accompanying greenschist facies metamorphism (to 300 degrees C) of basalts of the East Rift Zone (ERZ), Kilauea, Hawaii may be evaluated relative to published and experimental results for the surface corrosion of borosilicate glass. The ERZ alteration sequence is dominated by intermittent palagonite, interlayered smectite-chlorite, chlorite, and actinolite-epidote-anhydrite. Alteration is best developed in fractures and vesicles where surface reaction layers root on the glass matrix forming rinds in excess of 100 microns thick. Fractures control fluid circulation and the alteration sequence. Proximal to the glass surface, palagonite, Fe-Ti oxides and clays replace fresh glass as the surface reaction layer migrates inwards; away from the surface, amphibole, anhydrite, quartz and calcite crystallize from hydrothermal fluids in contact with the glass. The texture and composition of basaltic glass surfaces are similar to those of a SRL-165 glass leached statically for sixty days at 150 degrees C. While the ERZ reservoir is a complex open system, conservative comparisons between the alteration of ERZ and synthetic borosilicate glass are warranted. 31 refs., 2 figs
Shaw, Alison M.; Behn, Mark D.; Humphris, Susan E.; Sohn, Robert A.; Gregg, Patricia M.
2010-01-01
We present new analyses of volatile, major, and trace elements for a suite of glasses and melt inclusions from the 85°E segment of the ultra-slow spreading Gakkel Ridge. Samples from this segment include limu o pele and glass shards, proposed to result from CO 2-driven explosive activity. The major element and volatile compositions of the melt inclusions are more variable and consistently more primitive than the glass data. CO 2 contents in the melt inclusions extend to higher values (167-1596 ppm) than in the co-existing glasses (187-227 ppm), indicating that the melt inclusions were trapped at greater depths. These melt inclusions record the highest CO 2 melt concentrations observed for a ridge environment. Based on a vapor saturation model, we estimate that the melt inclusions were trapped between seafloor depths (˜ 4 km) and ˜ 9 km below the seafloor. However, the glasses are all in equilibrium with their eruption depths, which is inconsistent with the rapid magma ascent rates expected for explosive activity. Melting conditions inferred from thermobarometry suggest relatively deep (25-40 km) and cold (1240°-1325 °C) melting conditions, consistent with a thermal structure calculated for the Gakkel Ridge. The water contents and trace element compositions of the melt inclusions and glasses are remarkably homogeneous; this is an unexpected result for ultra-slow spreading ridges, where magma mixing is generally thought to be less efficient based on the assumption that steady-state crustal magma chambers are absent in these environments. All melts can be described by a single liquid line of descent originating from a pooled melt composition that is consistent with the aggregate melt calculated from a geodynamic model for the Gakkel Ridge. These data suggest a model in which deep, low degree melts are efficiently pooled in the upper mantle (9-20 km depth), after which crystallization commences and continues during ascent and eruption. Based on our melting model
Energy Technology Data Exchange (ETDEWEB)
Reis, S.L.; Grosso, R.L.; Muccillo, E.N.S., E-mail: shirley.reis@usp.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2012-07-01
Strontium and magnesium doped lanthanum gallate exhibits perovskite-type structure and high ionic conductivity. Other features of this ceramic material are large electrolytic regime and negligible electronic conductivity. These characteristics are responsible for the potential use of this solid electrolyte in solid oxide fuel cells operating at intermediate temperatures (~∼500-700 deg C). In this work, the composition La{sub 0.9}Sr{sub 0.1}Ga{sub 0.8}Mg{sub 0.2}O{sub 2.85} was prepared by the cation complexation technique aiming to obtain powder and sintered specimens with good chemical and structural homogeneities. X-ray diffraction results evidence that single phase was obtained, within the limitations of the technique, in samples sintered at 1350 deg C/4 h, with relative density above 92%. (author)
Johari, G P; Andersson, Ove
2017-06-21
We report a study of structural relaxation of high-density glasses of di-n-butyl phthalate (DBP) by measuring thermal conductivity, κ, under conditions of pressure and temperature (p,T) designed to modify both the vibrational and configurational states of a glass. Various high-density glassy states of DBP were formed by (i) cooling the liquid under a fixed high p and partially depressurizing the glass, (ii) isothermal annealing of the depressurized glass, and (iii) pressurizing the glass formed by cooling the liquid under low p. At a given low p, κ of the glass formed by cooling under high p is higher than that of the glass formed by cooling under low p, and the difference increases as glass formation p is increased. κ of the glass formed under 1 GPa is ∼20% higher at ambient p than κ of the glass formed at ambient p. On heating at low p, κ decreases until the glass to liquid transition range is reached. This is the opposite of the increase in κ observed when a glass formed under a certain p is heated under the same p. At a given high p, κ of the low-density glass formed by cooling at low p is lower than that of the high-density glass formed by cooling at that high p. On heating at high p, κ increases until the glass to liquid transition range is reached. The effects observed are due to a thermally assisted approach toward equilibrium at p different from the glass formation p. In all cases, the density, enthalpy, and entropy would change until the glasses become metastable liquids at a fixed p, thus qualitatively relating κ to variation in these properties.
Energy Technology Data Exchange (ETDEWEB)
Kruger, Albert A.; Pegg, I. L.; Chaudhuri, M.; Gong, W.; Gan, H.; Matlack, K. S.; Bardakci, T.; Kot, W.
2013-11-13
in melter operating temperature. Glass composition development was based on one of the HLW waste compositions specified by ORP that has a high concentration of aluminum. Small-scale tests were used to provide an initial screening of various glass formulations with respect to melt rates; more definitive screening was provided by the subsequent DM100 tests. Glass properties evaluated included: viscosity, electrical conductivity, crystallinity, gross glass phase separation and the 7- day Product Consistency Test (ASTM-1285). Glass property limits were based upon the reference properties for the WTP HLW melter. However, the WTP crystallinity limit (< 1 vol% at 950oC) was relaxed slightly as a waste loading constraint for the crucible melts.
Crystallisation behavior and electronic conductivity of vanadium tellurite glass-ceramics
DEFF Research Database (Denmark)
Kjeldsen, Jonas; Yue, Yuanzheng; Rodrigues, A.C.M.
2012-01-01
is synthesized via the melt quenching technique, and crystalline 2TeO2-V2O5 is obtained by further heat-treatment of the quenched glass. Both states are confirmed by x-ray diffraction, scanning electron microscopy and differential scanning calorimetry. The redox state of vanadium is controlled via the melting...... and the ability to intercalate lithium-ions, it is a candidate for usage as cathode material. In the present work, we optimize the electronic conductivity of the congruent 2TeO2-V2O5 composition by tuning both the redox state of the vanadium and the overall degree of crystallinity. Amorphous 2TeO2-V2O5...
DWPF GLASS BEADS AND GLASS FRIT TRANSPORT DEMONSTRATION
Energy Technology Data Exchange (ETDEWEB)
Adamson, D; Bradley Pickenheim, B
2008-11-24
DWPF is considering replacing irregularly shaped glass frit with spherical glass beads in the Slurry Mix Evaporator (SME) process to decrease the yield stress of the melter feed (a non-Newtonian Bingham Plastic). Pilot-scale testing was conducted on spherical glass beads and glass frit to determine how well the glass beads would transfer when compared to the glass frit. Process Engineering Development designed and constructed the test apparatus to aid in the understanding and impacts that spherical glass beads may have on the existing DWPF Frit Transfer System. Testing was conducted to determine if the lines would plug with the glass beads and the glass frit slurry and what is required to unplug the lines. The flow loop consisted of vertical and horizontal runs of clear PVC piping, similar in geometry to the existing system. Two different batches of glass slurry were tested: a batch of 50 wt% spherical glass beads and a batch of 50 wt% glass frit in process water. No chemicals such as formic acid was used in slurry, only water and glass formers. The glass beads used for this testing were commercially available borosilicate glass of mesh size -100+200. The glass frit was Frit 418 obtained from DWPF and is nominally -45+200 mesh. The spherical glass beads did not have a negative impact on the frit transfer system. The transferring of the spherical glass beads was much easier than the glass frit. It was difficult to create a plug with glass bead slurry in the pilot transfer system. When a small plug occurred from setting overnight with the spherical glass beads, the plug was easy to displace using only the pump. In the case of creating a man made plug in a vertical line, by filling the line with spherical glass beads and allowing the slurry to settle for days, the plug was easy to remove by using flush water. The glass frit proved to be much more difficult to transfer when compared to the spherical glass beads. The glass frit impacted the transfer system to the point
DWPF GLASS BEADS AND GLASS FRIT TRANSPORT DEMONSTRATION
International Nuclear Information System (INIS)
Adamson, D.; Pickenheim, Bradley
2008-01-01
DWPF is considering replacing irregularly shaped glass frit with spherical glass beads in the Slurry Mix Evaporator (SME) process to decrease the yield stress of the melter feed (a non-Newtonian Bingham Plastic). Pilot-scale testing was conducted on spherical glass beads and glass frit to determine how well the glass beads would transfer when compared to the glass frit. Process Engineering Development designed and constructed the test apparatus to aid in the understanding and impacts that spherical glass beads may have on the existing DWPF Frit Transfer System. Testing was conducted to determine if the lines would plug with the glass beads and the glass frit slurry and what is required to unplug the lines. The flow loop consisted of vertical and horizontal runs of clear PVC piping, similar in geometry to the existing system. Two different batches of glass slurry were tested: a batch of 50 wt% spherical glass beads and a batch of 50 wt% glass frit in process water. No chemicals such as formic acid was used in slurry, only water and glass formers. The glass beads used for this testing were commercially available borosilicate glass of mesh size -100+200. The glass frit was Frit 418 obtained from DWPF and is nominally -45+200 mesh. The spherical glass beads did not have a negative impact on the frit transfer system. The transferring of the spherical glass beads was much easier than the glass frit. It was difficult to create a plug with glass bead slurry in the pilot transfer system. When a small plug occurred from setting overnight with the spherical glass beads, the plug was easy to displace using only the pump. In the case of creating a man made plug in a vertical line, by filling the line with spherical glass beads and allowing the slurry to settle for days, the plug was easy to remove by using flush water. The glass frit proved to be much more difficult to transfer when compared to the spherical glass beads. The glass frit impacted the transfer system to the point
Energy Technology Data Exchange (ETDEWEB)
Delorme, L
1998-04-23
This work is devoted to the study of the mechanisms which control the volatility of the reference glass used for the confinement of radioactive waste. It was conducted on simplified compositions, in the SiO{sub 2}-B{sub 2}O{sub 3}-Al{sub 2}O{sub 3}-{alpha}Na{sub 2}O-(1-alpha)Li{sub 2}O-CaO system.The structural approach carried out by NMR, from room temperature up to 1500 deg.C, shows a strong increase in the mobility of alkalis above Tg. A rapid exchange between B{sup III} and B{sup IV} sites near 700 deg.C, and the change of coordination number B{sup IV-} B{sup III} near 1100 deg.C, also seem to take place. The analysis of the vapor phase, carried out by High Temperature Mass Spectrometry coupled to Knudsen cells, reveals the presence between 780 deg.C and 830 deg.C of NaBO{sub 2}(g), LiBO{sub 2}(g) and Na{sub 2}(BO{sub 2})2(g). The calculation of the partial pressure of each species shows that the total pressure of simplified glasses is dominated by the contribution of sodium. To study the volatility of glasses at higher temperature, equipment using the Transpiration method was used. The analysis of the deposits indicate the presence at 1060 deg.C of the species quoted previously. The vaporization rate and the vapor density were determined for each composition studied in a saturated state. Thus, we show that the volatility of the reference glass can be simulated by that of a simplified glass. For {alpha}=1, the kinetic of vaporization between 1060 deg.C and 1200 deg.C reveals an evaporation from the surface associated with a mechanism of diffusion in the molten glass. This is similar to the volatility of the reference glass at 1060 deg.C. To finally explain these mechanisms on a microscopic basis, we develop a model of molecular interactions. Between 780 deg.C and 830 deg.C, these mechanisms are controlled by a strong attraction between Na{sub 2}O and Li{sub 2}O, which maintains the total vapor pressure on a quasi-constant lever up to {alpha}=0.27. (author)
Ultralow lattice thermal conductivity in monolayer C3N as compared to graphene
Sarath Kumar, S. R.
2017-09-21
Using density functional theory and the Boltzmann transport equation for phonons, we demonstrate that the thermal conductivity is massively reduced in monolayer CN as compared to isostructural graphene. We show that larger phase space for three-phonon scattering processes is available in monolayer CN, which results in much shorter phonon life-times. Although both materials are characterized by sp hybridisation, anharmonicity effects are found to be enhanced for the C-N and C-C bonds in monolayer CN, reflected by a Grüneisen parameter of -8.5 as compared to -2.2 in graphene. The combination of these properties with the fact that monolayer CN is organic, non-toxic, and built of earth abundant elements gives rise to great potential in thermoelectric applications.
Final Report - Enhanced LAW Glass Formulation Testing, VSL-07R1130-1, Rev. 0, dated 10/05/07
Energy Technology Data Exchange (ETDEWEB)
Kruger, Albert A.; Pegg, I. L.; Matlack, K. S.; Joseph, I.; Muller, I. S.; Gong, W.
2013-11-13
The principal objective of this work was to extend the glass formulation methodology developed in the earlier work [2, 5, 6] for Envelope A, B and C waste compositions for development of compliant glass compositions targeting five high sodium-sulfur waste loading regions. This was accomplished through a combination of crucible-scale tests, and tests on the DM10 melter system. The DM10 was used for several previous tests on LAW compositions to determine the maximum feed sulfur concentrations that can be processed without forming secondary sulfate phases on the surface of the melt pool. This melter is the most efficient melter platform for screening glass compositions over a wide range of sulfate concentrations and therefore was selected for the present tests. The tests were conducted to provide information on melter processing characteristics and off-gas data, including sulfur incorporation and partitioning. As described above, the main objective was to identify the limits of waste loading in compliant glass formulations spanning the range of expected Na{sub 2}O and SO{sub 3} concentrations in the LAW glasses.
Review of global environmental-transport models for 3H, 14C, 85Kr, and 129I
International Nuclear Information System (INIS)
Kocher, D.C.; Killough, G.G.
1983-01-01
Global environmental transport models for the long-lived and mobile radionuclides 3 H, 14 C, 85 Kr, and 129 I are reviewed from the perspective of their application to collective dose assessments following releases, e.g., from the nuclear fuel cycle. Contributions to the collective dose commitment from first-pass local and regional exposures are compared. Current global models for 14 C and 85 Kr appear to be satisfactory for dose assessment purposes. Global modeling for 3 H is more difficult than for 14 C and 85 Kr, because of the different physico-chemical forms in which atmospheric releases occur. Global models for 129 I models indicate the primary importance of retention in surface soils for collective doses during the first 10 4 years following atmospheric releases and the importance of long-term transport to ocean sediments for reducing the dose commitment
Polyphase ceramic and glass-ceramic forms for immobilizing ICPP high-level nuclear waste
International Nuclear Information System (INIS)
Harker, A.B.; Flintoff, J.F.
1984-01-01
Polyphase ceramic and glass-ceramic forms have been consolidated from simulated Idaho Chemical Processing Plant wastes by hot isostatic pressing calcined waste and chemical additives by 1000 0 C or less. The ceramic forms can contain over 70 wt% waste with densities ranging from 3.5 to 3.85 g/cm 3 , depending upon the formulation. Major phases are CaF 2 , CaZrTi 207 , CaTiO 3 , monoclinic ZrO 2 , and amorphous intergranular material. The relative fraction of the phases is a function of the chemical additives (TiO 2 , CaO, and SiO 2 ) and consolidation temperature. Zirconolite, the major actinide host, makes the ceramic forms extremely leach resistant for the actinide simulant U 238 . The amorphous phase controls the leach performance for Sr and Cs which is improved by the addition of SiO 2 . Glass-ceramic forms were also consolidated by HIP at waste loadings of 30 to 70 wt% with densities of 2.73 to 3.1 g/cm 3 using Exxon 127 borosilicate glass frit. The glass-ceramic forms contain crystalline CaF 2 , Al 203 , and ZrSi 04 (zircon) in a glass matrix. Natural mineral zircon is a stable host for 4+ valent actinides. 17 references, 3 figures, 5 tables
The effects of the glass surface area/solution volume ratio on glass corrosion: A critical review
International Nuclear Information System (INIS)
Ebert, W.L.
1995-03-01
This report reviews and summarizes the present state of knowledge regarding the effects of the glass surface area/solution volume (SA/V) ratio on the corrosion behavior of borosilicate waste glasses. The SA/V ratio affects the rate of glass corrosion through the extent of dilution of corrosion products released from the glass into the leachate solution: glass corrosion products are diluted more in tests conducted at low SA/V ratios than they are in tests conducted at high SA/V ratios. Differences in the solution chemistries generated in tests conducted at different SA/V ratios then affect the observed glass corrosion behavior. Therefore, any testing parameter that affects the solution chemistry will also affect the glass corrosion rate. The results of static leach tests conducted to assess the effects of the SA/V are discussed with regard to the effects of SA/V on the solution chemistry. Test results show several remaining issues with regard to the long-term glass corrosion behavior: can the SA/V ratio be used as an accelerating parameter to characterize the advanced stages of glass corrosion relevant to long disposal times; is the alteration of the glass surface the same in tests conducted at different SA/V, and in tests conducted with monolithic and crushed glass samples; what are the effects of the SA/V and the extent of glass corrosion on the disposition of released radionuclides? These issues will bear on the prediction of the long-term performance of waste glasses during storage. The results of an experimental program conducted at ANL to address these and other remaining issues regarding the effects of SA/V on glass corrosion are described. 288 refs., 59 figs., 16 tabs
The effects of the glass surface area/solution volume ratio on glass corrosion: A critical review
Energy Technology Data Exchange (ETDEWEB)
Ebert, W.L. [Argonne National Lab., IL (United States). Chemical Technology Div.
1995-03-01
This report reviews and summarizes the present state of knowledge regarding the effects of the glass surface area/solution volume (SA/V) ratio on the corrosion behavior of borosilicate waste glasses. The SA/V ratio affects the rate of glass corrosion through the extent of dilution of corrosion products released from the glass into the leachate solution: glass corrosion products are diluted more in tests conducted at low SA/V ratios than they are in tests conducted at high SA/V ratios. Differences in the solution chemistries generated in tests conducted at different SA/V ratios then affect the observed glass corrosion behavior. Therefore, any testing parameter that affects the solution chemistry will also affect the glass corrosion rate. The results of static leach tests conducted to assess the effects of the SA/V are discussed with regard to the effects of SA/V on the solution chemistry. Test results show several remaining issues with regard to the long-term glass corrosion behavior: can the SA/V ratio be used as an accelerating parameter to characterize the advanced stages of glass corrosion relevant to long disposal times; is the alteration of the glass surface the same in tests conducted at different SA/V, and in tests conducted with monolithic and crushed glass samples; what are the effects of the SA/V and the extent of glass corrosion on the disposition of released radionuclides? These issues will bear on the prediction of the long-term performance of waste glasses during storage. The results of an experimental program conducted at ANL to address these and other remaining issues regarding the effects of SA/V on glass corrosion are described. 288 refs., 59 figs., 16 tabs.
Energy Technology Data Exchange (ETDEWEB)
Akazawa, Housei, E-mail: akazawa.housei@lab.ntt.co.jp [NTT Microsystem Integration Laboratories, 3-1 Morinosato Wakamiya, Atsugi, Kanagawa 243-0198 (Japan)
2012-12-15
Highlights: Black-Right-Pointing-Pointer Reactive sputtering of TiO{sub x}N{sub y} films was achieved under metal-mode conditions. Black-Right-Pointing-Pointer Partially substituting O in TiO{sub 2} with N formed anatase rather than rutile. Black-Right-Pointing-Pointer TiO{sub 2-x}N{sub x} on Al{sub 2}O{sub 3}(0 0 0 1) was more transparent and conductive than on glass substrate. Black-Right-Pointing-Pointer Nb{sup 5+} ions could be doped as donors in TiO{sub 2-x}N{sub x} anatase crystals. - Abstract: Adding N{sub 2} gas during reactive sputtering of a Ti target prevented the target surface from being severely poisoned by oxygen atoms and sustained a high deposition rate for titanium oxynitride films under metal-mode-like sputtering conditions. With progress in the degree of oxidization, films deposited onto a glass substrate varied from TiO{sub 1-x}N{sub x} having a face-centered cubic (fcc) structure to TiO{sub 2-x}N{sub x} having an anatase structure. Titanium oxynitride films deposited on an Al{sub 2}O{sub 3}(0 0 0 1) substrate were epitaxial with major orientations toward the (1 1 1) and (2 0 0) directions for fcc-TiO{sub 1-x}N{sub x} and (1 1 2) for anatase-TiO{sub 2-x}N{sub x}. Intermediately oxidized films between TiO{sub 1-x}N{sub x} and TiO{sub 2-x}N{sub x} were amorphous on the glass substrate but crystallized into a Magneli phase, Ti{sub n}O(N){sub 2n-1}, on the Al{sub 2}O{sub 3}(0 0 0 1) substrate. Partially substituting oxygen in TiO{sub 2} with nitrogen as well as continuously irradiating the growing film surface with a Xe plasma stream preferentially formed anatase rather than rutile. However, the occupation of anion sites with enough oxygen rather than nitrogen was the required condition for anatase crystals to form. The transparent conductive properties of epitaxial TiO{sub 2-x}N{sub x} films on Al{sub 2}O{sub 3}(0 0 0 1) were superior to those of microcrystalline films on the glass substrate. Since resistivity and optical transmittance of Ti
Optical and spectroscopic properties of Eu-doped tellurite glasses and glass ceramics
International Nuclear Information System (INIS)
Stambouli, W.; Elhouichet, H.; Gelloz, B.; Férid, M.
2013-01-01
Tellurite glasses doped with trivalent europium were prepared by the conventional melt quenching technique, in the chemical composition of (85−x) TeO 2 +5La 2 O 3 +10TiO 2 +xEu 2 O 3 by varying the concentration of the rare-earth ion in the order 0.5, 1 and 1.5 mol%. Using Judd–Ofelt analysis, we calculated intensity parameters (Ω 2 and Ω 4 ), spontaneous emission probabilities, the radiative lifetime, luminescence branching factors, the quantum yield of luminescence, and the stimulated emission cross-sections for 5 D 0 → 7 F 2 transition. The change in optical properties with the variation of Eu 3+ ion concentration have been discussed and compared with other glasses. The luminescence intensity ratio, quantum efficiency and emission cross-section values support that the TeEu1.5 tellurite glass is a suitable candidate for red laser source applications. Optical properties for Eu 3+ doped tellurite glass, heated for different temperature, were investigated. Crystalline phases for α-TeO 2 , γ-TeO 2 and TiTe 3 O 8 system were determined by the XRD method. The effect of heat treatment on luminescence properties in the tellurite glass was discussed. By using Eu 3+ as a probe, the local structure of rare-earth ion in tellurite glass, vitro-ceramic and ceramic glass has been investigated. The evaluated J–O intensity parameters have been used to calculate different radiative and laser characteristic parameters of the 5 D 0 excited level. The large magnitudes of stimulated emission cross-section (σ e ), branching ratio (β) and Gain bandwidth (σ e ×Δλ eff ) obtained for 5 D 0 → 7 F 2 (613 nm) transition for ceramic glass indicate that the present glass ceramic is promising host material for Eu 3+ doped fiber amplifiers. The measured lifetime of 5 D 0 excited state increases with increase of the heat treatment which further indicate that some Eu 3+ ions were successfully embedded in the crystal phase and prove the low phonon energy environment of Eu 3+ ions
Energy Technology Data Exchange (ETDEWEB)
Delorme, L
1998-04-23
This work is devoted to the study of the mechanisms which control the volatility of the reference glass used for the confinement of radioactive waste. It was conducted on simplified compositions, in the SiO{sub 2}-B{sub 2}O{sub 3}-Al{sub 2}O{sub 3}-{alpha}Na{sub 2}O-(1-alpha)Li{sub 2}O-CaO system.The structural approach carried out by NMR, from room temperature up to 1500 deg.C, shows a strong increase in the mobility of alkalis above Tg. A rapid exchange between B{sup III} and B{sup IV} sites near 700 deg.C, and the change of coordination number B{sup IV-} B{sup III} near 1100 deg.C, also seem to take place. The analysis of the vapor phase, carried out by High Temperature Mass Spectrometry coupled to Knudsen cells, reveals the presence between 780 deg.C and 830 deg.C of NaBO{sub 2}(g), LiBO{sub 2}(g) and Na{sub 2}(BO{sub 2})2(g). The calculation of the partial pressure of each species shows that the total pressure of simplified glasses is dominated by the contribution of sodium. To study the volatility of glasses at higher temperature, equipment using the Transpiration method was used. The analysis of the deposits indicate the presence at 1060 deg.C of the species quoted previously. The vaporization rate and the vapor density were determined for each composition studied in a saturated state. Thus, we show that the volatility of the reference glass can be simulated by that of a simplified glass. For {alpha}=1, the kinetic of vaporization between 1060 deg.C and 1200 deg.C reveals an evaporation from the surface associated with a mechanism of diffusion in the molten glass. This is similar to the volatility of the reference glass at 1060 deg.C. To finally explain these mechanisms on a microscopic basis, we develop a model of molecular interactions. Between 780 deg.C and 830 deg.C, these mechanisms are controlled by a strong attraction between Na{sub 2}O and Li{sub 2}O, which maintains the total vapor pressure on a quasi-constant lever up to {alpha}=0.27. (author)
Identification of glass compositions suitable for disposal of waste reactive metal
International Nuclear Information System (INIS)
Varma, R.; Brown, A.P.; Kumar, R.; San-Pedro, R.; Freeman, C.J.; Helt, J.E.
1988-09-01
This study was conducted in support of a project to convert waste sodium to a form that is amenable to easy disposal in ordinary landfills. This waste sodium will be from reactor and other operations at the US Department of Energy and will contain small amounts of radioactive species that must not be released to the environment in an uncontrolled manner. The sodium will be converted into a glass that will contain and isolate the radionuclides present in it. This study was conducted to define acceptable glass compositions that (1) are resistant to leaching of sodium by groundwater and rainwater, (2) contain a relatively large proportion of sodium so that unreasonably large volumes of the glass for disposal will not be produced, and (3) are conveniently prepared from the waste sodium. For this purpose, glass samples containing varying amounts of the oxides of sodium, calcium, boron, aluminum, and silicon were prepared in the laboratory. The samples were subjected to the accelerated MCC-1 test to determine resistance to leaching by water at 60/degree/C. Soda-silica glasses were observed to dissolve in the water rather quickly. Addition of the other ingredients was found to impart significant leach resistance to the glasses. Among the high-Na 2 O glasses, those containing alumina (3% Al 2 O 3 -10% CaO-30% Na 2 O and 6% Al 2 O 3 -10% B 2 O 3 -30% Na 2 O) were found to be most resistant to leaching. Lowering the Na 2 O content to 20% made these glasses even more leach resistant. 8 refs., 6 figs., 2 tabs
International Nuclear Information System (INIS)
Kruger, A.A.
1994-10-01
This report contains basic information on electric furnaces used for glass melting and on the properties of glass useful for the stabilization of radioactive wastes. Furnace nomenclature, furnace types, typical silicate glass composition and properties, thermal conductivity information, kinetics of the melting process, glass furnace refractory materials composition and thermal conductivity, and equations required for the operation of glass melters are included
International Nuclear Information System (INIS)
Goles, Ronald W.; Buchmiller, William C.; Hymas, Charles R.; MacIsaac, Brett D.
2002-01-01
In order to further the goal of optimizing Hanford?s HLW borosilicate flowsheet, a glass formulation effort was launched to develop an advanced high-capacity waste form exhibiting acceptable leach and crystal formation characteristics. A simulated C-106/AY-102 waste envelop inclusive of LAW pretreatment products was chosen as the subject of these nonradioactive optimization efforts. To evaluate this optimized borosilicate waste formulation under continuous dynamic vitrification conditions, a research-scale Joule-heated ceramic melter was used to demonstrate the advanced waste form?s flowsheet. The main objectives of this melter test was to evaluate (1) the processing characteristics of the newly formulated C-106/AY-102 surrogate melter-feed stream, (2) the effectiveness of sucrose as a glass-oxidation-state modifier, and (3) the impact of this reductant upon processing rates
Glass composition effects on the results of MCC-1, MCC-3 and pulsed-flow leach tests
International Nuclear Information System (INIS)
Barkatt, A.; Adiga, R.; Adel-Hadadi, M.A.; Barkatt, A.; Feng, X.; Sousanpour, W.
1989-01-01
Glass composition effects on the results of MCC-1, MCC-3 and pulsed-flow leach tests are summarized. Major components of the glasses studied are included. The leachant in all cases was de-ionized water and the temperature was 90 degree C. Test duration of the MCC-1 and MCC-3 was 28 days. The total time in the pulsed-flow test was 112 days. In the MCC-1 test, the results indicate that the forward rate characteristic of the kinetics of leaching in unsaturated environments is relatively independent (within a factor of 2) of such variations. The MCC-3 results reflect the extent of glass dissolution under conditions where the extent of interaction is large enough to cause the solution in contact with the glass to approach saturation with respect to silica and other scarcely soluble components. The pulsed-flow results show that at longer periods of time the dependence of leachate composition on glass composition decreases again and that leachate concentrations approach stabilization at levels which are much lower than the MCC-3 limits
Properties of Desert Sand and CMAS Glass
Bansal, Narottam P.; Choi, Sung R.
2014-01-01
As-received desert sand from a Middle East country has been characterized for its phase composition and thermal stability. X-ray diffraction analysis showed the presence of quartz (SiO2), calcite (CaCO3), gypsum (CaSO4.2H2O), and NaAlSi3O8 phases in as-received desert sand and showed weight loss of approx. 35 percent due to decomposition of CaCO3 and CaSO4.2H2O when heated to 1400 C. A batch of as-received desert sand was melted into calcium magnesium aluminosilicate (CMAS) glass at approx. 1500 C. From inductively coupled plasma-atomic emission spectrometry, chemical composition of the CMAS glass was analyzed to be 27.8CaO-4MgO-5Al2O3-61.6SiO2-0.6Fe2O3-1K2O (mole percent). Various physical, thermal and mechanical properties of the glass have been evaluated. Bulk density of CMAS glass was 2.69 g/cc, Young's modulus 92 GPa, Shear modulus 36 GPa, Poisson's ratio 0.28, dilatometric glass transition temperature (T (sub g)) 706 C, softening point (T (sub d)) 764 C, Vickers microhardness 6.3 +/- 0.4 GPa, indentation fracture toughness 0.75 +/- 0.15 MPa.m (sup 1/2), and coefficient of thermal expansion (CTE) 9.8 x 10 (exp -6)/degC in the temperature range 25 to 700 C. Temperature dependence of viscosity has also been estimated from various reference points of the CMAS glass using the Vogel-Fulcher-Tamman (VFT) equation. The glass remained amorphous after heat treating at 850 C for 10 hr but crystallized into CaSiO3 and Ca-Mg-Al silicate phases at 900 C or higher temperatures. Crystallization kinetics of the CMAS glass has also been investigated by differential thermal analysis (DTA). Activation energies for the crystallization of two different phases in the glass were calculated to be 403 and 483 kJ/mol, respectively.
Energy Technology Data Exchange (ETDEWEB)
Tripathy, Satya N., E-mail: satyanarayantripathy@gmail.com; Wojnarowska, Zaneta; Knapik, Justyna; Paluch, Marian [Institute of Physics, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Silesian Center for Education and Interdisciplinary Research, 75 Pulku Piechoty 1A, 41-500 Chorzow (Poland); Shirota, Hideaki [Department of Nanomaterial Science and Department of Chemistry, Chiba University, 1-33 Yayoi, Inage-ku, Chiba 263-8522 (Japan); Biswas, Ranjit [Department of Chemical, Biological and Macromolecular Sciences, S. N. Bose National Centre for Basic Sciences, JD Block, Sector III, Salt Lake, Kolkata 700098 (India)
2015-05-14
A detailed investigation on the molecular dynamics of ionic deep eutectic solvents (acetamide + lithium nitrate/sodium thiocyanate) is reported. The study was carried out employing dielectric relaxation spectroscopy covering seven decades in frequency (10{sup −1}-10{sup 6} Hz) and in a wide temperature range from 373 K down to 173 K, accessing the dynamic observables both in liquid and glassy state. The dielectric response of the ionic system has been presented in the dynamic window of modulus formalism to understand the conductivity relaxation and its possible connection to the origin of localized motion. Two secondary relaxation processes appear below glass transition temperature. Our findings provide suitable interpretation on the nature of secondary Johari-Goldstein process describing the ion translation and orientation of dipoles in a combined approach using Ngai’s coupling model. A nearly constant loss feature is witnessed at shorter times/lower temperatures. We also discuss the ac conductivity scaling behavior using Summerfield approach and random free energy barrier model which establish the time-temperature superposition principle. These experimental observations have fundamental importance on theoretical elucidation of the conductivity relaxation and glass transition phenomena in molten ionic conductors.
Phase Transformations of an Fe-0.85 C-17.9 Mn-7.1 Al Austenitic Steel After Quenching and Annealing
Cheng, Wei-Chun
2014-09-01
Low-density Mn-Al steels could potentially be substitutes for commercial Ni-Cr stainless steels. However, the development of the Mn-Al stainless steels requires knowledge of the phase transformations that occur during the steel making processes. Phase transformations of an Fe-0.85 C-17.9 Mn-7.1 Al (wt.%) austenitic steel, which include spinodal decomposition, precipitation transformations, and cellular transformations, have been studied after quenching and annealing. The results show that spinodal decomposition occurs prior to the precipitation transformation in the steel after quenching and annealing at temperatures below 1023 K and that coherent fine particles of L12-type carbide precipitate homogeneously in the austenite. The cellular transformation occurs during the transformation of high-temperature austenite into lamellae of austenite, ferrite, and kappa carbide at temperatures below 1048 K. During annealing at temperatures below 923 K, the austenite decomposes into lamellar austenite, ferrite, κ-carbide, and M23C6 carbide grains for another cellular transformation. Last, when annealing at temperatures below 873 K, lamellae of ferrite and κ-carbide appear in the austenite.
Ceramic composite resistors of B4C modified by TIO2 and glass phase
International Nuclear Information System (INIS)
Klimiec, E.; Zaraska, W.; Stobiecki, T.
1998-01-01
Technical progress in the manufacturing technology of composite materials resulted in arising of new generation of bulk resistors, resistant to high levels of overloads and high temperature. These resistors can be applied in extremely heavy working conditions, for instance in cooperation with ignition circuits. The resistors investigated in our research were performed on the basis of ceramic composite consisted of semiconductor boron carbide B 4 C as conductive phase, aluminium oxide Al 2 O 3 and non-alkali glass as insulators and titanium dioxide TiO 2 . The technological procedure of the fabrication of resistors and the results of the tests, such as temperature dependence of the electrical resistance exploitation trials, are presented. (author)
International Nuclear Information System (INIS)
Wicks, G.G.; Lodding, A.R.; Macedo, P.B.; Clark, D.E.
1991-01-01
In July of 1986, the first in-situ test involving burial of simulated high-level waste (HLW) forms conducted in the United States was started. This program, called the Materials Interface Interactions Test or MIIT, comprises the largest, most cooperative field-testing venture in the international waste management community. In July of 1991, the experimental portion of the 5-year MIIT study was completed on schedule. During this time interval, many in-situ measurements were performed, thousands of brine analyses conducted, and hundreds of waste glass and package components exhumed and evaluated after 6 mo., 1 yr., 2 yr. and 5 yr. burial periods. Although analyses are still in progress, the performance of SRS waste glass based on all data currently available has been seen to be excellent thus far. Initial analyses and assessment of Savannah River (SR) waste glass after burial in WIPP at 90 degrees C for 5 years are presented in this document
International Nuclear Information System (INIS)
Barton, J.L.; Vacher, R.; Moncouyoux, J.P.; Vernaz, E.
1997-01-01
Most glasses used as materials are oxides glasses that are produced by a quick quench of a liquid. Glasses are characterized by the absence of periodicity in the atomic arrangements, they do not have symmetries and do not present order over a long distance. This series of 4 short articles present: 1) the properties of glass and its industrial story, 2) the glass structure, 3) a forty years long story of glass as dies used to confine wastes and 4) the methodology used to study the behaviour of glass over very long periods of time. This methodology is based on 5 steps: 1) define and specify the material to study (the prediction of long term alteration of a material is nonsense unless you know well its initial properties), 2) identify all the alteration processes that are likely to happen, determine their kinetics and the influence of environmental parameters, 3) develop mathematical models in order to simulate long-term behaviour of glasses, 4) determine the release rates of the radionuclides confined in the glass, and 5) validate data and models, it is not possible to expect a complete validation of a model that will be extrapolated over tens of thousands of years, nevertheless some ways of validation can lead to a satisfactory level of confidence taking into account reasonable uncertainties. (A.C.)
In-plane thermal conductivity measurements of ZnO-, ZnS-, and YSZ thin-films on glass substrates
Energy Technology Data Exchange (ETDEWEB)
Hartung, David; Gather, Florian; Kronenberger, Achim; Kuhl, Florian; Meyer, Bruno K.; Klar, Peter J. [I. Physikalisches Institut, Justus-Liebig-University, Heinrich-Buff-Ring 16, 35392 Giessen (Germany)
2012-07-01
In this work we present in-plane thermal conductivity measurements of ZnO-, ZnS-, and YSZ thin-films. Borosilicate glass with a thickness of 50 microns and low thermal conductivity for improving the signal to noise ratio was used as substrate material. The above different films are deposited by rf-sputtering and have a thickness of about 1 micron. Our approach is a steady-state measurement. A wide metal wire on the film is used as a heater and two parallel lying narrow wires at distances of 100 microns and 200 microns from the heater wire, respectively, serve as the temperature sensors. The wire structure design is transfered on to the thin films by photolithography and metal evaporation. Measurements of the in-plane thermal conductivities of the above mentioned materials are presented and compared with corresponding results in the literature.
International Nuclear Information System (INIS)
Tosi, M.; Duponchel, C.; Meo, T.; Julier, C.
1987-01-01
Overlapping molecular clones encoding the complement subcomponent C1s were isolated from a human liver cDNA library. The nucleotide sequence reconstructed from these clones spans about 85% of the length of the liver C1s messenger RNAs, which occur in three distinct size classes around 3 kilobases in length. Comparisons with the sequence of C1r, the other enzymatic subcomponent of C1, reveal 40% amino acid identity and conservation of all the cysteine residues. Beside the serine protease domain, the following sequence motifs, previously described in C1r, were also found in C1s: (a) two repeats of the type found in the Ba fragment of complement factor B and in several other complement but also noncomplement proteins, (b) a cysteine-rich segment homologous to the repeats of epidermal growth factor precursor, and (c) a duplicated segment found only in C1r and C1s. Differences in each of these structural motifs provide significant clues for the interpretation of the functional divergence of these interacting serine protease zymogens. Hybridizations of C1r and C1s probes to restriction endonuclease fragments of genomic DNA demonstrate close physical linkage of the corresponding genes. The implications of this finding are discussed with respect to the evolution of C1r and C1s after their origin by tandem gene duplication and to the previously observed combined hereditary deficiencies of Clr and Cls
The incorporation of technetium into a representative low-activity waste glass
International Nuclear Information System (INIS)
Ebert, W.L.; Bakel, A.J.; Bowers, D.L.; Buck, E.C.; Emery, J.W.
1997-01-01
A glass that has been tested to understand the corrosion behavior of waste glasses with high soda contents for immobilizing Hanford incidental wastes has been made by melting crushed glass with either TcO 2 or NaTcO 4 at 1,100--1,300 C. Incorporation of technetium in the glass was affected by solubility or kinetic effects. Metallic technetium inclusions formed in all the TcO 2 -doped glasses. Inclusions also formed in glasses with added NaTcO 4 that were melted at 1,100 C, but a glass melted at 1,200 C did not contain detectable inclusions. The presence of Tc-bearing inclusions complicates the interpretation of results from dissolution tests because of the simultaneous release of technetium from more than one phase, the unknown surface areas of each phase, and the possible incorporation of technetium that is released from one phase into another phase. A glass containing about 0.15 mass % Tc dissolved in the glass is being used in dissolution tests to study the release behavior of technetium
Electrical studies on silver based fast ion conducting glassy materials
International Nuclear Information System (INIS)
Rao, B. Appa; Kumar, E. Ramesh; Kumari, K. Rajani; Bhikshamaiah, G.
2014-01-01
Among all the available fast ion conductors, silver based glasses exhibit high conductivity. Further, glasses containing silver iodide enhances fast ion conducting behavior at room temperature. Glasses of various compositions of silver based fast ion conductors in the AgI−Ag 2 O−[(1−x)B 2 O 3 −xTeO 2 ] (x=0 to1 mol% in steps of 0.2) glassy system have been prepared by melt quenching method. The glassy nature of the compounds has been confirmed by X-ray diffraction. The electrical conductivity (AC) measurements have been carried out in the frequency range of 1 KHz–3MHz by Impedance Analyzer in the temperature range 303–423K. The DC conductivity measurements were also carried out in the temperature range 300–523K. From both AC and DC conductivity studies, it is found that the conductivity increases and activation energy decreases with increasing the concentration of TeO 2 as well as with temperature. The conductivity of the present glass system is found to be of the order of 10 −2 S/cm at room temperature. The ionic transport number of these glasses is found to be 0.999 indicating that these glasses can be used as electrolyte in batteries
Ray, Chandra S.; Brow, Richard K.; Kim, Cheol W.; Reis, Signo T.
2004-01-01
The deformation and crystallization of Li(sub 2)O (center dot) 2SiO2 and Li(sub 2)O (center dot) 1.6SiO2 glass fibers subjected to a bending stress were measured as a function of time over the temperature range -50 to -150 C below the glass transition temperature (Tg). The glass fibers can be permanently deformed at temperatures about 100 C below T (sub)g, and they crystallize significantly at temperatures close to, but below T,, about 150 C lower than the onset temperature for crystallization for these glasses in the no-stress condition. The crystallization was found to occur only on the surface of the glass fibers with no detectable difference in the extent of crystallization in tensile and compressive stress regions. The relaxation mechanism for fiber deformation can be best described by a stretched exponential (Kohlrausch-Williams-Watt (KWW) approximation), rather than a single exponential model.The activation energy for stress relaxation, Es, for the glass fibers ranges between 175 and 195 kJ/mol, which is considerably smaller than the activation energy for viscous flow, E, (about 400 kJ/mol) near T, for these glasses at normal, stress-free condition. It is suspected that a viscosity relaxation mechanism could be responsible for permanent deformation and crystallization of the glass fibers below T,
High-Temperature Thermal Diffusivity Measurements of Silicate Glasses
Pertermann, M.; Hofmeister, A. M.; Whittington, A. G.; Spera, F. J.; Zayac, J.
2005-12-01
Transport of heat in geologically relevant materials is of great interest because of its key role in heat transport, magmatism and volcanic activity on Earth. To better understand the thermal properties of magmatic materials at high temperatures, we measured the thermal diffusivity of four synthetic end-member silicate glasses with the following compositions: albite (NaAlSi3O8), orthoclase (KAlSi3O8), anorthite (CaAl2Si2O8), and diopside (CaMgSi2O6). Thermal diffusivity measurements were conducted with the laser-flash technique and data were acquired from room temperature to a maximum temperature near 1100°C, depending on the glass transition temperature. The presence of sub-mm sized bubbles in one of the orthoclase samples had no discernable effect on measured diffusivities. At room temperature, the three feldspar-type glasses have thermal diffusivity (D) values of 0.58-0.61 mm2/s, whereas the diopside glass has 0.52 mm2/s. With increasing temperature, D decreases by 5-10% (relative) for all samples and becomes virtually constant at intermediate temperatures. At higher temperatures, the anorthite and diopside glasses exhibit significant drops in thermal diffusivity over a 50-100°C interval, correlating with previously published heat capacity changes near the glass transition for these compositions. For anorthite, D (in mm2/s) decreases from 0.48 at 750-860°C to 0.36 at 975-1075°C; for diopside, D changes from 0.42 at 630-750°C to 0.30 at 850-910°C, corresponding to relative drops of 24 and 29%, respectively. Albite and orthoclase glasses do not exhibit this change and also lack significant changes in heat capacity near the glass transition. Instead, D is constant at 400-800°C for albite, and for orthoclase values go through a minimum at 500-600°C before increasing slightly towards 1100°C but it never exceeds the room temperature D. Our data on thermal diffusivity correlate closely with other thermophysical properties. Thus, at least in case of simple
Dielectric properties of NaF–B2O3 glasses doped with certain ...
Indian Academy of Sciences (India)
Dielectric constant ε, loss tan δ, a.c. conductivity σ and dielectric breakdown strength of NaF–B2O3 glasses ... Heat flow % ... peratures of these glasses were determined from the diffe- ... measured values of density d and calculated average.
International Nuclear Information System (INIS)
Anderson, L.D.; Dennis, T.; Elliott, M.L.; Hrma, P.
1993-04-01
Three different simulated nuclear waste glass feeds, consisting of dried waste and glass frit, were heat treated for 1 hour in a gradient furnace at temperatures ranging from approximately 600 degrees C--1000 degrees C. Simulated melter feeds from the Hanford Waste Vitrification Plant (HWVP), the Defense Waste Processing Facility (DWPF), and Kernforschungszentrum Karlsruhe (KfK) in Germany were used. The samples were thin-sectioned and examined by optical microscopy to investigate the stages of the conversion from feed to glass. Various phenomena were seen, such as frit softening, bubble formation, foaming, bubble motion and removal, convective mixing, and homogenization. Behavior of different feeds was similar, although the degree of gas generation and melt homogenization varied
International Nuclear Information System (INIS)
Xu, J.; Yang, Y.Z.; Li, W.; Chen, X.C.; Xie, Z.W.
2016-01-01
The dependency of phosphorous content on the glass forming ability, thermal stability and soft magnetic properties of Fe 83.4 Si 2 B 14−x P x Cu 0.5 C 0.1 (x=0,1,2,3,4) alloys was investigated. The experimental results showed that the substitution of B by P increased the glass forming ability in this alloy system. The Fe 83.4 Si 2 B 10 P 4 Cu 0.5 C 0.1 alloy shows a fully amorphous character. Thermal stability of melt-spun ribbons increases and temperature interval between the first and second crystallization peaks enlarges with the increase of P content. And the saturation magnetic flux density (Bs) shows a slight increase with the increase of P content. The Fe 83.4 Si 2 B 11 P 3 Cu 0.5 C 0.1 nanocrystalline alloy exhibits a high Bs about 200.6 emu/g. The Bs of fully amorphous alloy Fe 83.4 Si 2 B 10 P 4 Cu 0.5 C 0.1 drops dramatically to 172.1 emu/g, which is lower than that of other nanocrystallines. Low material cost and excellent soft magnetic properties make the FeSiBPCuC alloys promise soft magnetic materials for industrial applications. - Highlights: • Partial substituting B by P helps to improve the glass forming ability of the alloy. • The addition of P content reduces the thermal stability and improves heat treatment temperature region for these alloys. • The Fe 83.4 Si 2 B 11 P 3 Cu 0.5 C 0.1 nanocrystalline alloy exhibits a high saturation magnetic density of 200.6 emu/g.
International Nuclear Information System (INIS)
Nakao, Shoichiro; Yamada, Naoomi; Hitosugi, Taro; Hirose, Yasushi; Shimada, Toshihiro; Hasegawa, Tetsuya
2010-01-01
We discuss the fabrication of highly conductive Ta-doped SnO 2 (Sn 1-x Ta x O 2 ; TTO) thin films on glass by pulse laser deposition. On the basis of the comparison of X-ray diffraction patterns and resistivity (ρ) values between epitaxial films and polycrystalline films deposited on bare glass, we proposed the use of seed-layers for improving the conductivity of the TTO polycrystalline films. We investigated the use of rutile TiO 2 and NbO 2 as seed-layers; these are isostructural materials of SnO 2, which are expected to promote epitaxial-like growth of the TTO films. The films prepared on the 10-nm-thick seed-layers exhibited preferential growth of the TTO (110) plane. The TTO film with x = 0.05 on rutile TiO 2 exhibited ρ = 3.5 x 10 -4 Ω cm, which is similar to those of the epitaxial films grown on Al 2 O 3 (0001).
Stretched Exponential relaxation in pure Se glass
Dash, S.; Ravindren, S.; Boolchand, P.
A universal feature of glasses is the stretched exponential relaxation, f (t) = exp[ - t / τ ] β . The model of diffusion of excitations to randomly distributed traps in a glass by Phillips1 yields the stretched exponent β = d[d +2] where d, the effective dimensionality. We have measured the enthalpy of relaxation ΔHnr (tw) at Tg of Se glass in modulated DSC experiments as glasses age at 300K and find β = 0.43(2) for tw in the 0
Development of long term storage technique for recovered Kr-85, (1)
International Nuclear Information System (INIS)
Inada, Eiichi; Motoyama, Shigeji; Tsunoda, Naomi; Yamamoto, Keizo; Hirano, Seiji.
1979-01-01
The adsorption storage method of radioactive krypton Kr-85 using a double cylinder packed with activated charcoal is expected to be put into practical use as an intermediate storing method until the immobilization technique for long term storage is established. In this paper, the conceptual design of an intermediate, remote-controlled Kr-85 storage facility is presented. The features of this system are double containment, low pressure storage, and remote control. Kr-85 is at first filled into a double cylinder by the adsorbing effect of activated charcoal at low temperature (-196 deg C) by cooling with liquid nitrogen. Then, the unwelded portion of the outer cylinder containing the inner cylinder is welded and inspected to make double containment. The double cylinders are cooled by ventilation to remove the decay heat of Kr-85, and krypton leakage is always monitored. If any leakage is detected, the double cylinder is transferred to the cutting cell for the re-encapsulation of Kr-85 in a safe double cylinder. All operations are performed by remote control because of a high radiation field. The expected amount and composition of Kr-85 to be recovered from the reprocessing plant are also given as the design conditions. (Wakatsuki, Y.)
Glass Formulation Development for INEEL Sodium-Bearing Waste
International Nuclear Information System (INIS)
Vienna, J.D.; Schweiger, M.J.; Smith, D.E.; Smith, H.D.; Crum, J.V.; Peeler, D.K.; Reamer, I.A.; Musick, C.A.; Tillotson, R.D.
1999-01-01
a standard liquid-fed joule-heated melter. The normalized elemental releases by 7-day PCT are all well below 1 g/m 2 , which is a very conservative set point used in this study. The T L , ignoring sulfate formation, is less than the 1050 C limit. Based on these observations and the reasonable waste loading of 35 mass 0/0, the SBW glass was a prime candidate for further testing. Sulfate salt segregation was observed in all test melts formed from oxidized carbonate precursors. Melts fabricated using SBW simulants suggest that the sulfate-salt segregation seen in oxide and carbonate melts was much less of a problem. The cause for the difference is likely H 2 SO 4 fuming during the boil-down stage of wet-slurry processing. Additionally, some crucible tests with SBW simulant were conducted at higher temperatures (1250 C), which could increase the volatility of sulfate salts. The fate of sulfate during the melting process is still uncertain and should be the topic of future studies. The properties of the simulant glass confirmed those of the oxide and carbonate glass. Corrosion tests on Inconel 690 electrodes and K-3 refractory blocks conducted at INEEL suggest that the glass is not excessively corrosive. Based on the results of this study, the authors recommend that a glass made of 35% SBW simulant (on a mass oxide and halide basis) and 65% of the additive mix (either filled or raw chemical) be used in demonstrating the direct vitrification of INEEL SBW. It is further recommended that a study be conducted to determine the fate of sulfate during glass processing and the tolerance of the chosen melter technology to sulfate salt segregation and corrosivity of the melt
Lee, Sang-Hoon; Kim, Tae-Wan; Suk, Kyung-Lim; Paik, Kyung-Wook
2015-11-01
Nanofiber anisotropic conductive films (ACF) were invented, by adapting nanofiber technology to ACF materials, to overcome the limitations of ultra-fine-pitch interconnection packaging, i.e. shorts and open circuits as a result of the narrow space between bumps and electrodes. For nanofiber ACF, poly(vinylidene fluoride) (PVDF) and poly(butylene succinate) (PBS) polymers were used as nanofiber polymer materials. For PVDF and PBS nanofiber ACF, conductive particles of diameter 3.5 μm were incorporated into nanofibers by electrospinning. In ultra-fine-pitch chip-on-glass assembly, insulation was significantly improved by using nanofiber ACF, because nanofibers inside the ACF suppressed the mobility of conductive particles, preventing them from flowing out during the bonding process. Capture of conductive particles was increased from 31% (conventional ACF) to 65%, and stable electrical properties and reliability were achieved by use of nanofiber ACF.
International Nuclear Information System (INIS)
Shulishova, O.I.; Zyrin, A.V.; Ismalgaliev, R.K.; Izmajlov, Sh.Z.; Kovylyaev, V.V.; Shevchuk, N.V.; Shcherbak, I.A.
1990-01-01
The electron-probe microanalysis permits investigating the interaction on the boundary of current-conducting and glass-binding phases in cermet films without noble metals on the base of ruthenium oxide. The performed studies along with experiments on model microsections subject to annealing in different media have shown the differences in the process of formation of structure and properties of cermet resistive elements as well as a significance of the oxidation process of current-conducting phase in formation of high working characteristics of cermet resistors on the base of hexaborides of the rare-earth elements
Energy Technology Data Exchange (ETDEWEB)
Morea, R. [Laser Processing Group, Instituto de Optica, CSIC, Serrano 121, 28006 Madrid (Spain); Miguel, A. [Departamento de Física Aplicada I, Escuela Superior de Ingeniería, Universidad del País Vasco UPV/EHU, Alda. Urquijo s/n, 48013 Bilbao (Spain); Fernandez, T.T. [Laser Processing Group, Instituto de Optica, CSIC, Serrano 121, 28006 Madrid (Spain); Maté, B. [Instituto de Estructura de la Materia, CSIC, Serrano 121, 28006 Madrid (Spain); Ferrer, F.J. [Centro Nacional de Aceleradores, Univ. Sevilla-CSIC, Av. Thomas A. Edison 7, 41092 Sevilla (Spain); Maffiotte, C. [CIEMAT, Departamento de Tecnología, Av. Complutense 40, 28040 Madrid (Spain); Fernandez, J.; Balda, R. [Departamento de Física Aplicada I, Escuela Superior de Ingeniería, Universidad del País Vasco UPV/EHU, Alda. Urquijo s/n, 48013 Bilbao (Spain); Materials Physics Center CSIC-UPV/EHU and Donostia International Physics Center, 20018 San Sebastian (Spain); Gonzalo, J., E-mail: j.gonzalo@csic.es [Laser Processing Group, Instituto de Optica, CSIC, Serrano 121, 28006 Madrid (Spain)
2016-02-15
Transparent oxyfluoride tellurite thin film glasses have been produced at room temperature by pulsed laser deposition in O{sub 2} atmosphere from an Er-doped TeO{sub 2}–ZnO–ZnF{sub 2} bulk glass. Thin film glasses present high refractive index (n≥1.95) and good transparency (T≥80%) in the visible (λ>400 nm) and near infrared range. However, their photoluminescence (PL) performance at 1.5 μm is poor. Thermal annealing at moderate temperatures (T≤315 °C), well below glass crystallization, increases the PL intensity by more than one order of magnitude as well as the PL lifetime up to τ≈3.3 ms. Film glasses present a larger fraction of TeO{sub 3} trigonal pyramids than the bulk glass and a very large OH{sup −} content. The structure and composition of film glasses do not change upon annealing and thus the activation of the PL response is related to the improvement of the surface morphology and the significant decrease of their OH{sup −} content. - Highlights: • Transparent Er-doped fluorotellurite films are produced by pulsed laser deposition. • Post-deposition thermal treatments are required to activate Er{sup 3+} photoluminescence. • {sup 4}I{sub 13/2}→{sup 4}I{sub 15/2} emission spectrum is similar for bulk and annealed film glasses. • {sup 4}I{sub 13/2} level fluorescence decay is shorter in annealed films than in bulk glasses. • Photoluminescence response relates to hydroxyl groups concentration in film glasses.
Vanishing Hall conductance in the phase-glass Bose metal at zero temperature
May-Mann, Julian; Phillips, Philip W.
2018-01-01
Motivated in part by numerical simulations [H. G. Katzgraber and A. P. Young, Phys. Rev. B 66, 224507 (2002), 10.1103/PhysRevB.66.224507; J. M. Kosterlitz and N. Akino, Phys. Rev. Lett. 81, 4672 (1998), 10.1103/PhysRevLett.81.4672; Phys. Rev. Lett. 81, 4672 (1998), 10.1103/PhysRevLett.81.4672] that reveal that the energy to create a defect in a gauge or phase glass scales as Lθ with θ power law as does the longitudinal conductance. This prediction can be verified experimentally by applying a ground plane to the 2D samples.
International Nuclear Information System (INIS)
Hegab, N.A.; Afifi, M.A.; Atyia, H.E.; Farid, A.S.
2009-01-01
Thin films of the prepared Se 80 Te 20-x Ge x (x = 5, 7 and 10 at.%) were prepared by thermal evaporation technique. X-ray diffraction patterns showed that the films were in amorphous state. The ac conductivity and dielectric properties of the investigated film compositions were studied in the frequency range 0.1-100 kHz and in temperature range (303-373 K). The experimental results indicated that the ac conductivity and the dielectric properties depended on the temperature and frequency. The ac conductivity is found to obey the ω s law, in accordance with the hopping model, s is found to be temperature dependent (s 1 and dielectric loss ε 2 were found to decrease with frequency and increase with temperature. The maximum barrier height W m , calculated from dielectric measurements according to Guintini equation, agrees with that proposed by the theory of hopping over potential barrier as suggested by Elliott in case of chalcogenide glasses. The density of localized states was estimated for the studied film compositions. The variation of the studied properties with Ge content was also investigated.
Dissolution rates of DWPF glasses from long-term PCT
International Nuclear Information System (INIS)
Ebert, W.L.; Tam, S.W.
1996-01-01
We have characterized the corrosion behavior of several Defense Waste Processing Facility (DWPF) reference waste glasses by conducting static dissolution tests with crushed glasses. Glass dissolution rates were calculated from measured B concentrations in tests conducted for up to five years. The dissolution rates of all glasses increased significantly after certain alteration phases precipitated. Calculation of the dissolution rates was complicated by the decrease in the available surface area as the glass dissolves. We took the loss of surface area into account by modeling the particles to be spheres, then extracting from the short-term test results the dissolution rate corresponding to a linear decrease in the radius of spherical particles. The measured extent of dissolution in tests conducted for longer times was less than predicted with this linear dissolution model. This indicates that advanced stages of corrosion are affected by another process besides dissolution, which we believe to be associated with a decrease in the precipitation rate of the alteration phases. These results show that the dissolution rate measured soon after the formation of certain alteration phases provides an upper limit for the long-term dissolution rate, and can be used to determine a bounding value for the source term for radionuclide release from waste glasses. The long-term dissolution rates measured in tests at 20,000 per m at 90 degrees C in tuff groundwater at pH values near 12 for the Environmental Assessment glass and glasses made with SRL 131 and SRL 202 frits, respectively
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Gambling. 27.85 Section 27.85 Wildlife and... WILDLIFE REFUGE SYSTEM PROHIBITED ACTS Disturbing Violations: Personal Conduct § 27.85 Gambling. Gambling in any form, or the operation of gambling devices, for money or otherwise, on any national wildlife...
Energy Technology Data Exchange (ETDEWEB)
Godon, N.; Thomassin, J.H.; Touray, J.C.; Vernaz, E.
1988-01-01
In order to simulate the leaching of nuclear wastes in repositories percolated by solutions of variable salinity, leaching tests of R7T7 glass in solutions with different NaCl contents have been performed at 90/sup 0/C and 1 bar using a static procedure. A comparison of the efficiency of the different leachants indicated that the alteration was maximum in pure water and in 23.7 g (NaCl) kg/sup -1/ solution. In deionized water, uranium- and rare-earth elements simulating the actinides were found quite immobile: they have not been detected in solution but are present in the alteration layer. On the other hand, in the 23.7 g (NaCl) kg/sup -1/ solution, high amounts of uranium, cerium and neodymium have been detected in solution and did not accumulate in the solid phases. In the highest salinity brines, the bulk reactivity of the glass decreased. In all leachants, the alteration layer was structured in two parts: hydrated glass and flakes. The flakes were mainly nickel-and zinc-bearing aluminosilicate phases. When crystallized, the flakes were identified as berthierine.
International Nuclear Information System (INIS)
Zhu Rongbao; Yang Liucheng; Wei Liansheng; Ji Liqiang; Zhang Zengrui
1988-03-01
A new type of on-line monitoring system used to monitor radioactive nuclides with α or soft β radiation in the effluent from a high pressure ion exchange column is described. The beads made of cerium-impregnated lithium silicate glass are used as scientillation material. They are filled into a quartz glass tube to form a flow cell. By reducing the diameter of glass beads to more closly approximate the average range of α or soft β radiation in solution, the absolute counting efficiency for 241 Am, 242 Cm α radiation have reached and 85.8% and 92.8% respectively, for 14 C, 90 Sr- 90 Y β radiation, 62.1% and 88.6% respectively. These values can be comparable to those achieved with on-line liquid scientillation technique. When the total amount of 241 Am added into column is decreased to 7.4 Bq it is still possible to obtain a clear chromatography peak (half peak width = 0.22 mL)
International Nuclear Information System (INIS)
Anderson, L.D.; Dennis, T.; Elliott, M.L.; Hrma, P.
1994-01-01
Three simulated nuclear waste glass feeds, consisting of dried waste and glass frit, were heat treated for 1 hour in a gradient furnace at temperatures ranging from approximately 600 degrees C to 1000 degrees C. Simulated melter feeds from the Hanford Waste Vitrification Plant (HWVP), the Defense Waste Processing Facility (DWPF), and Kernforschungszentru Karlsruhe (KfK) in Germany were used. The samples were thin sectioned and examined by optical microscopy to investigate the stages of the conversion from feed to glass. Various phenomena were seen, such as frit softening, bubble formation, foaming, bubble motion and removal, convective mixing, and homogenization. The behavior of different feeds was similar, although the degree of gas generation and melt homogenization varied. 2 refs., 8 tabs
Uptake and metabolism of 14C-chloropyrifos by marine bivalves
International Nuclear Information System (INIS)
Zhong, C.G.; Chen, S.; Zhao, X.; Shi, J.; Carvalho, F.P.
1999-01-01
The uptake and metabolism of 14 C-chlorpyrifos by two marine bivalves, Paphia undulata and Sinonovacula constricta, were studied in a simulated ecosystem. The experiments were carried out in two 30 L glass tanks containing each 20 L of filtered sea water, contaminated with 14 C-chlorpyrifos 1.85x10 4 Bq.L -1 (16.7 μg.L -1 ) at the beginning of the exposure period. At different time intervals, three specimens of each species were sampled for analysis of the pesticide in the molluscs tissues. The 14 C-chlorpyrifos residues were extracted from the digestive gland of the molluscs and analyzed by co-chromatography with pesticide standards by TLC methods described before
BNFL Report Glass Formers Characterization
Energy Technology Data Exchange (ETDEWEB)
Schumacher, R.F.
2000-07-27
The objective of this task was to obtain powder property data on candidate glass former materials, sufficient to guide conceptual design and estimate the cost of glass former handling facilities as requested under Part B1 of BNFL Technical and Development Support. Twenty-nine glass forming materials were selected and obtained from vendors for the characterization of their physical properties, durability in caustic solution, and powder flow characteristics. A glass former was selected based on the characterization for each of the ten oxide classes required for Envelope A, B, and C mixtures. Three blends (A, B, and C) were prepared based on formulations provided by Vitreous State Laboratory and evaluated with the same methods employed for the glass formers. The properties obtained are presented in a series of attached Tables. It was determined that five of the ten glass formers, (kyanite, iron oxide, titania, zircon, and zinc oxide) have the potential to cause some level of solids f low problems. The problems might include arching or ratholing in the silo/hopper. In addition, all of the blends may require consideration for their handling.
BNFL Report Glass Formers Characterization
International Nuclear Information System (INIS)
Schumacher, R.F.
2000-01-01
The objective of this task was to obtain powder property data on candidate glass former materials, sufficient to guide conceptual design and estimate the cost of glass former handling facilities as requested under Part B1 of BNFL Technical and Development Support. Twenty-nine glass forming materials were selected and obtained from vendors for the characterization of their physical properties, durability in caustic solution, and powder flow characteristics. A glass former was selected based on the characterization for each of the ten oxide classes required for Envelope A, B, and C mixtures. Three blends (A, B, and C) were prepared based on formulations provided by Vitreous State Laboratory and evaluated with the same methods employed for the glass formers. The properties obtained are presented in a series of attached Tables. It was determined that five of the ten glass formers, (kyanite, iron oxide, titania, zircon, and zinc oxide) have the potential to cause some level of solids f low problems. The problems might include arching or ratholing in the silo/hopper. In addition, all of the blends may require consideration for their handling
Immobilization of krypton-85 in zeolite 5A
International Nuclear Information System (INIS)
Christensen, A.B.; Del Debbio, J.A.; Knecht, D.A.; Tanner, J.E.; Cossel, S.C.
1983-01-01
This paper describes the technical feasibility and presents a summary of a preconceptual design and cost estimate for a process to immobilize krypton-85 by sintering in zeolite 5A at 700 0 C and 100 MPa for 2 to 4 h. Krypton loading of 30 to 60 m 3 at STP per m 3 solid can be achieved. The initial water concentration in zeolite 5A has a catalytic effect on the sintering rate and must be kept at about 1 wt% by heating prior to the encapsulation run. High initial water loadings and/or encapsulation times longer than 4 h must be avoided because the sintered zeolite 5A recrystallizes to an anorthite-type feldspar and releases the trapped krypton. Data are presented to show how the process conditions affect krypton encapsulation in zeolie 5A and how to assure the quality of the product. By adding a powdered glass frit to the commercial zeolite 5A 2 mm beads, a solid mass is formed during encapsulation, which can be further compacted using standard hot isotatic pressing techniques at 33 MPa and 600 0 C to form a fused glassy matrix enclosing the amorphous zeolite. A process for encapsulating the annual krypton-85 production at a commercial 2000 metric ton of heavy metal spent fuel reprocessing plant is developed. A hot isostatic press (HIP) with an isolated work zone of 8 or 16 L capacity is required to operate for 600 or 300 cycles per year, respectively. Existing HIP technology uses work zones from 1 to 3500 L capacity at similar production rates. A combined encapsulation/compaction cycle is proposed as an option to most effectively immobilize the krypton and the zeolite. A preconceptual design and cost estimate is given for a commercial-scale Kr encapsulation facility. The facility is designed to withstand a worst case rupture of the HIP. The maximum lease is estimated to result in an off-site dose well below accident protective action guidance levels
Beam depolarization and gain saturation in neodymium rods with a diameter of 85 mm
Energy Technology Data Exchange (ETDEWEB)
Sukhanov, V N; Ugodenko, A A
1990-04-01
Depolarization and gain saturation were investigated in rod amplifiers using phosphate and silicate Nd glasses 85 mm in diameter and 300 mm in length at a pulse duration of 35 ns. Total depolarization losses over the rod cross section were measured for various radial distributions of the small-signal gain. For the phosphate glass the losses amounted to 3-6 percent; for the silicate glass, they amounted to 4-7 percent. Saturation energy densities of 4.5 + or - 0.4 and 8.0 + or - 0.7 J/sq cm were obtained for the phosphate and silicate glass, respectively. 8 refs.
Directory of Open Access Journals (Sweden)
Savinska L. O.
2015-08-01
Full Text Available Aim. Generation of polyclonal antibodies specific to the ribosomal protein S6 kinase isoform – p85S6K1 and directed to the N-terminal (1–23 aa extension of p85S6K1. Methods. Animal immunization with synthetic (1–23 aa peptide, ELISA, Western blot, Immunoprecipitation, immunofluorescent analysis. Results. Polyclonal antibodies have been generated, which specifically recognize only p85 but not p70 isoform of S6K1 in western blot, immunoprecipitation and immunofluorescence analysis. Conclusions. The obtained antibodies can be recommended for studies on the p85S6K1 and other S6K1 isoforms possessing the N-terminal extension – the identification of binding protein partners, analysis of subcellular localization under different physiological conditions, elucidation of the signal transduction pathways involving different S6K1 isoforms.
Glass containing radioactive nuclear waste
International Nuclear Information System (INIS)
Boatner, L.A.; Sales, B.C.
1985-01-01
Lead-iron phosphate glasses containing a high level of Fe 2 O 3 for use as a storage medium for high-level-radioactive nuclear waste. By combining lead-iron phosphate glass with various types of simulated high-level nuclear waste, a highly corrosion resistant, homogeneous, easily processed glass can be formed. For corroding solutions at 90 C, with solution pH values in the range between 5 and 9, the corrosion rate of the lead-iron phosphate nuclear waste glass is at least 10 2 to 10 3 times lower than the corrosion rate of a comparable borosilicate nuclear waste glass. The presence of Fe 2 O 3 in forming the lead-iron phosphate glass is critical. Lead-iron phosphate nuclear waste glass can be prepared at temperatures as low as 800 C, since they exhibit very low melt viscosities in the 800 to 1050 C temperature range. These waste-loaded glasses do not readily devitrify at temperatures as high as 550 C and are not adversely affected by large doses of gamma radiation in H 2 O at 135 C. The lead-iron phosphate waste glasses can be prepared with minimal modification of the technology developed for processing borosilicate glass nuclear waste forms. (author)
Ion transport studies in lithium phospho-molybdate glasses containing Cl{sup −} ion
Energy Technology Data Exchange (ETDEWEB)
Gowda, V.C. Veeranna [Department of Physics, Government College for Women, Chintamani (India); Chethana, B.K. [Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore (India); Reddy, C. Narayana, E-mail: nivetejareddy@gmail.com [Department of Physics, Maharani' s Science College for Women, Bangalore (India)
2013-07-01
Highlights: • Addition of LiCl creates more conducting channels for Li{sup +} ion movement. • The decrease in E{sub dc} with increasing LiCl concentration could be due to Li{sup +} ions present in the columbic wells surrounded by Cl{sup −} ions are expected to be shallow. • Examined the power law fits using both two term and three term equation with fixed and floated parameters. -- Abstract: Ion conducting glasses in xLiCl–20Li{sub 2}O–(80−x) [0.80P{sub 2}O{sub 5}–0.20MoO{sub 3}] glass system have been prepared over a wide range of composition (X = 5, 10, 15, 20 and 25 mol%). The electrical conductivity and dielectric relaxation of these glasses were analyzed using impedance spectroscopy in the frequency range of 10 Hz–10 MHz and in the temperature range of 313–353 K. D.c. activation energies extracted from Arrhenius plots using regression analysis, decreases with increasing LiCl mol%. A.c. conductivity data has been fitted to both single and double power law equation with both fixed and variable parameters. The increased conductivity in the present glass system has been correlated with the volume increasing effect and the coordination changes that occur due to structural modification resulting in the creation of non-bridging oxygens (NBO's) of the type O-Mo-O{sup −} bonds in the glass network. Dielectric relaxation mechanism in these glasses is analyzed using Kohlrausch–Williams–Watts (KWW) stretched exponential function and stretched exponent (β) is found to be insensitive to temperature.
2010-01-01
... operating exclusively through the Internet. 7.5009 Section 7.5009 Banks and Banking COMPTROLLER OF THE... under 12 U.S.C. 85 of national banks operating exclusively through the Internet. For purposes of 12 U.S.C. 85, the main office of a national bank that operates exclusively through the Internet is the...
Establishing release limits for 3H, 14C, 85Kr, and 129I
International Nuclear Information System (INIS)
Kocher, D.C.; Killough, G.G.
1983-01-01
Tritium ( 3 H), 14 C, 85 Kr, and 129 I are the most important globally dispersed radionuclides released from the nuclear fuel cycle. In this paper, we investigate whether global transport of these radionuclides could also be important in assessing doses to individuals in critical groups of the population
Energy Technology Data Exchange (ETDEWEB)
KRUGER AA; MATLACK KS
2012-02-07
by Optima Chemicals according to VSL specifications. Sufficient feed was prepared to produce over nineteen hundred kilograms of glass during melter tests. The nominal reductant concentration (stoichiometric ratio of 0.5 {approx} 1 mole sucrose per 16 mole NOx or 3 mole carbon per 4 mole NOx) was maintained in all the tests by the addition of sugar at VSL. The DM 10 was used to screen the optimized glass formulation with two alternative aluminum sources (kyanite and zeolite) over a wide range of target sulfur concentrations. Subsequently, based on the DM10 results, nine 12- to 34-hour DM100 tests were conducted; six with kyanite as the aluminum additive at glass sulfur concentrations ranging from 0.75 to 1.5 wt.% SO{sub 3}, and the other three with zeolite as the aluminum additive at glass sulfur concentrations ranging from 0.75 to 1.5 wt. % SO{sub 3}. The DM 100-WV melter was used in order to provide a direct comparison with the LAW tests previously conducted on the same melter. Key operating parameters such as glass temperature and production rate were held constant to investigate the sulfur incorporation into the glass and the effects of varying the aluminum additive source. The bubbling rate was adjusted to achieve a production rate of 2000 kg/m{sup 2}/day with a near-complete cold cap (90-100% of melt surface covered with feed). Quantitative measurements of glass production rates, melter operating conditions (temperatures, pressures, power, flows, etc.), and off-gas characteristics (NOx, SO{sub 2}, CO, particulate load and composition, and acid gases) were made for each test. Glass samples taken from the glass pool and the discharge chamber were inspected throughout testing to determine the limit of salt-free operation in the melter.
International Nuclear Information System (INIS)
Noda, Kohki; Kadokura, Sadao; Naoe, Masahiko
2001-01-01
Co 85 Cr 13 Ta 2 /Cr bilayered films for longitudinal recording disks were deposited by plasma-enhanced facing targets sputtering apparatus on 2.5 in and ultra-flat disk substrates of glass-ceramic and single-crystal silicon. Their noise and read/write characteristics were almost comparable with those of the high-performance disks using Co-Cr-Pt films, with coercivity H c of 2.4 kOe, as a reference disk, even though the Co-Cr-Ta films exhibited macroscopic H c of only 800 Oe. Co 85 Cr 13 Ta 2 films are known as low-noise media. This study addresses the problem of how to obtain low-noise media, using excellent sputtering apparatus and disk substrate materials, to allow practical applications in ultra-high-density recording systems, including 1 in microdrives for mobile applications
Composition and property measurements for PHA Phase 4 glasses
International Nuclear Information System (INIS)
Edwards, T.B.
2000-01-01
The results presented in this report are for nine Precipitate Hydrolysis Aqueous (PHA) Phase 4 glasses. Three of the glasses contained HM sludge at 22, 26, and 30 wt% respectively, 10 wt% PHA and 1.25 wt% monosodium titanate (MST), all on an oxide basis. The remaining six glasses were selected from the Phase 1 and Phase 2 studies (Purex sludge) but with an increased amount of MST. The high-end target for MST of 2.5 wt% oxide was missed in Phases 1 and 2 due to ∼30 wt% water content of the MST. A goal of this Phase 4 study was to determine whether this increase in titanium concentration from the MST had any impact on glass quality or processibility. Two of the glasses, pha14c and pha15c, were rebatched and melted due to apparent batching errors with pha14 and pha15. The models currently in the Defense Waste Processing Facility's (DWPF) Product Composition Control System (PCCS) were used to predict durability, homogeneity, liquidus, and viscosity for these nine glasses. All of the HM glasses and half of the Purex glasses were predicted to be phase separated, and consequently prediction of glass durability is precluded with the cument models for those glasses that failed the homogeneity constraint. If one may ignore the homogeneity constraint, the measured durabilities were within the 95% prediction limits of the model. Further efforts will be required to resolve this issue on phase separation (inhomogeneity). The liquidus model predicted unacceptable liquidus temperatures for four of the nine glasses. The approximate, bounding liquidus temperatures measured for all had upper limits of 1,000 C or less. Given the fact that liquidus temperatures were only approximated, the 30 wt% loading of Purex may be near or at the edge of acceptability for liquidus. The measured viscosities were close to the predictions of the model. For the Purex glasses, pha12c and pha15c, the measured viscosities of 28 and 23 poise, respectively, indicate that DWPF processing may be compromised
Improving yield of PZT piezoelectric devices on glass substrates
Johnson-Wilke, Raegan L.; Wilke, Rudeger H. T.; Cotroneo, Vincenzo; Davis, William N.; Reid, Paul B.; Schwartz, Daniel A.; Trolier-McKinstry, Susan
2012-10-01
The proposed SMART-X telescope includes adaptive optics systems that use piezoelectric lead zirconate titanate (PZT) films deposited on flexible glass substrates. Several processing constraints are imposed by current designs: the crystallization temperature must be kept below 550 °C, the total stress in the film must be minimized, and the yield on 1 cm2 actuator elements should be work, RF magnetron sputtering was used to deposit films since chemical solution deposition (CSD) led to warping of large area flexible glass substrates. A PZT 52/48 film that wasdeposited at 4 mTorr and annealed at 550 °C for 24 hours showed no detectable levels of either PbO or pyrochlore second phases. Large area electrodes (1cm x 1 cm) were deposited on 4" glass substrates. Initially, the yield of the devices was low, however, two methods were employed to increase the yield to near 100 %. The first method included a more rigorous cleaning to improve the continuity of the Pt bottom electrode. The second method was to apply 3 V DC across the capacitor structure to burn out regions of defective PZT. The result of this latter method essentially removed conducting filaments in the PZT but left the bulk of the material undamaged. By combining these two methods, the yield on the large area electrodes improved from < 10% to nearly 100%.
High temperature oxidation and crystallization behavior of phosphate glass compositions
International Nuclear Information System (INIS)
Russo, Diego; Rodriguez, Diego; Grumbaum, N.; Gonzalez Oliver, Carlos
2003-01-01
We analyzed the thermal transformation of three iron phosphate glasses having the following nominal compositions: M4 [70% P 2 O 5 , 30% Fe 2 O 3 ], M5 [85% M4, 15% UO 2 ] y M7 [69.7% P 2 O 5 , 28.6% Fe 2 O 3 , 1,7% Al 2 O 3 ]. Thermogravimetric analysis, DTA (differential thermal analysis) and SAXS (Small Angle X-ray Scattering) were performed.It was observed that it is easily possible to produce glasses in these systems having very low crystallinity.We could determine the final stable crystalline phases [Fe 4 (P 2 O 7 ) 3 , Fe(PO 3 ) 3 and Fe 3 (P 2 O 7 ) 2 ].The presence of uranium ions affects not only the redox effects but also the crystallization of the system.SAXS data obtained during the heating in vacuum up to ∼600degC, gave some variation of scattering intensities vs. scattering vector suggesting the development of an extra phase or some kind inhomogeneities that seems to disappear on heating
Role of structure in ion movement of glasses. Final report, July 1, 1990--December 31, 1995
International Nuclear Information System (INIS)
Jain, H.
1996-05-01
The ion movement in inorganic glasses is key to their optimum use in various applications such as solid electrolytes, durable nuclear waste form, stable insulation in electronic devices etc. The primary objective of this project was to understand ion movement in relation to the physical structure of inorganic glasses. Five different glass forming systems were selected for systematically varying different aspects of the structure and determining their influence on ion dynamics: (1) binary Rb and K germanate glass series; (2) mixed (Rb, Ag) and (Rb, K) germanate glass series (3) high purity quartz amorphized by neutron irradiation (4) sodium triborate glasses with different melt conditions and (5) heavy metal fluoride glasses. A two-pronged research program was developed: on the one hand dc ionic conductivity and ac relaxation were measured for a variety of oxide and fluoride glasses as a function of composition, temperature and frequency to characterize long and short range ion transport phenomena. The ion movement was also observed in terms of nuclear spin relaxation rate at University of Dortmund, Germany. On the other hand, the structure was characterized by high resolution x-ray photoelectron spectroscopy (XPS) at Lehigh, infra-red (IR) and Raman spectroscopy at National Hellenic Research Foundation, Athens, Greece, and extended x-ray absorption fine structure (EXAFS) experiments at National Synchrotron Light Source, Brookhaven National Laboratory. The most significant results of the project are briefly summarized
16 CFR 1.85 - Final environmental impact statements.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Final environmental impact statements. 1.85... Final environmental impact statements. (a) After the close of the comment period, the Bureau responsible for the matter will consider the comments received on the draft environmental impact statement and...
Preparation method and thermal properties of samarium and europium-doped alumino-phosphate glasses
Energy Technology Data Exchange (ETDEWEB)
Sava, B.A., E-mail: savabogdanalexandru@yahoo.com [National Institute of Research and Development for Optoelectronics, Department for Optospintronics, 409 Atomistilor Street, P.O. Box MG – 5, RO-77125 Magurele (Romania); Elisa, M., E-mail: astatin18@yahoo.com [National Institute of Research and Development for Optoelectronics, Department for Optospintronics, 409 Atomistilor Street, P.O. Box MG – 5, RO-77125 Magurele (Romania); Boroica, L., E-mail: boroica_lucica@yahoo.com [National Institute for Lasers, Plasma and Radiation Physics, 77125 Magurele (Romania); Monteiro, R.C.C., E-mail: rcm@fct.unl.pt [Center of Materials Research/Institute for Nanostructures, Nanomodelling and Nanofabrication, (CENIMAT/I3N), Department of Materials Sciences, Faculty of Sciences and Technology, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal)
2013-12-01
Highlights: • Improved preparation method of rare-earth-doped phosphate glasses was done. • Working and annealing temperatures were lower than for undoped phosphate glass. • Doped glass viscosity is also lower and has quasi-linear variation with temperature. • Exothermic peak appears at about 555 °C and 685 °C, due to devitrification in glass. -- Abstract: The present work investigates alumino-phosphate glasses from Li{sub 2}O–BaO–Al{sub 2}O{sub 3}–La{sub 2}O{sub 3}–P{sub 2}O{sub 5} system containing Sm{sup 3+} and Eu{sup 3+} ions, prepared by two different ways: a wet raw materials mixing route followed by evaporation and melt-quenching, and by remelting of shards. The linear thermal expansion coefficient measured by dilatometry is identical for both rare-earth-doped phosphate glasses. Comparatively to undoped phosphate glass the linear thermal expansion coefficient increases with 2 × 10{sup −7} K{sup −1} when dopants are added. The characteristic temperatures very slowly decrease but can be considered constant with atomic weight, atomic number and f electrons number of the doping ions in the case of T{sub g} (vitreous transition temperature) and T{sub sr} (high annealing temperature) but slowly increase in the case of T{sub ir} (low annealing temperature–strain point) and very slowly increase, being practically constant in the case of T{sub D} (dilatometric softening temperature). Comparatively to undoped phosphate glass the characteristic temperatures of Sm and Eu-doped glasses present lower values. The higher values of electrical conductance for both doped glasses, comparatively to usual soda-lime-silicate glass, indicate a slightly reduced stability against water. The viscosity measurements, showed a quasi-linear variation with temperature the mean square deviation (R{sup 2}) being ranged between 0.872% and 0.996%. The viscosity of doped glasses comparatively to the undoped one is lower at the same temperature. Thermogravimetric
Formation and partial melting of two types of spin-cluster glass behavior in vanadate spinel
International Nuclear Information System (INIS)
Huang Yuanjie; Pi Li; Tan Shun; Zhang Yuheng; Yang Zhaorong
2012-01-01
We report the doping effect on the various properties of spinels Co 1-x Zn x V 2 O 4 (0 ≤ x ≤ 0.2). For the parent compounds, the rise in magnetization, the valley in thermal conductance, the transition from the ferromagnetic arrangement to non-collinear alignment indicated by the specific heat for the V sublattice, especially the frequency dependence of AC susceptibility around T 1 = 59 K, verify the occurrence of the transition at T 1 besides the ferrimagnetic transition at T C . The ferrimagnetic transition at T C induces the spin-cluster glass behavior and the transition at T 1 yields the new spin-cluster glass (NSCG) behavior. As the Zn 2+ -doped content increases, the above phenomena are gradually weakening to vanishing, but the glassy behavior at T C still exists for all samples. Through the fourth-order perturbation theory, we discuss the reasons for the gradual vanishing of the transition at T 1 . (paper)
Search for narrow resonances in e+e- annihilation between 1.85 and 3.1 GeV with the KEDR detector
International Nuclear Information System (INIS)
Anashin, V.V.; Aulchenko, V.M.; Baldin, E.M.; Barladyan, A.K.; Barnyakov, A.Yu.; Barnyakov, M.Yu.; Baru, S.E.; Basok, I.Yu.; Beloborodova, O.L.; Blinov, A.E.; Blinov, V.E.; Bobrov, A.V.; Bobrovnikov, V.S.; Bogomyagkov, A.V.; Bondar, A.E.; Buzykaev, A.R.; Eidelman, S.I.; Grigoriev, D.N.; Glukhovchenko, Yu.M.; Gulevich, V.V.
2011-01-01
We report results of a search for narrow resonances in e + e - annihilation at center-of-mass energies between 1.85 and 3.1 GeV performed with the KEDR detector at the VEPP-4M e + e - collider. The upper limit on the leptonic width of a narrow resonance Γ ee R .Br(R→hadr)<120 eV has been obtained (at 90% C.L.).
Complex of MUC1, CIN85 and Cbl in Colon Cancer Progression and Metastasis
International Nuclear Information System (INIS)
Cascio, Sandra; Finn, Olivera J.
2015-01-01
We previously reported that CIN85, an 85 KDa protein known to be involved in tumor cell migration and metastasis through its interaction with Cbl, associates with MUC1 in tumor cells. MUC1/CIN85 complex also regulates migration and invasion of tumor cells in vitro. Here, we examined specifically human colon carcinoma tissue microarrays (TMA) by immunohistochemistry for the expression of MUC1 and CIN85 and their potential role in cancer progression and metastasis. We detected a significant increase in expression of both MUC1 and CIN85 associated with advanced tumor stage and lymph node metastasis. We further investigated if Cbl could also be present in the MUC1/CIN85 complex. Co-immunoprecipitation assay showed that Cbl co-localized both with CIN85 and with MUC1 in a human colon cancer cell line. To begin to investigate the in vivo relevance of MUC1 overexpression and association with CIN85 and Cbl in cancer development and progression, we used human MUC1 transgenic mice that express MUC1 on the colonic epithelial cells, treated with azoxymethane to initiate and dextran sulfate sodium (AOM/DSS) to promote colorectal carcinogenesis. MUC1.Tg mice showed higher tumor incidence and decreased survival when compared with wild-type mice. Consistent with the in vitro data, the association of MUC1, CIN85 and Cbl was detected in colon tissues of AOM/DSS-treated MUC1 transgenic mice. MUC1/CIN85/Cbl complex appears to contribute to promotion and progression of colon cancer and thus increased expression of MUC1, CIN85 and Cbl in early stage colon cancer might be predictive of poor prognosis
Complex of MUC1, CIN85 and Cbl in Colon Cancer Progression and Metastasis
Energy Technology Data Exchange (ETDEWEB)
Cascio, Sandra, E-mail: sac131@pitt.edu [Department of Immunology, University of Pittsburgh School of Medicine, E1040 Biomedical Science Tower, Pittsburgh, PA 15261 (United States); Fondazione Ri.Med, via Bandiera, Palermo 90133 (Italy); Finn, Olivera J., E-mail: sac131@pitt.edu [Department of Immunology, University of Pittsburgh School of Medicine, E1040 Biomedical Science Tower, Pittsburgh, PA 15261 (United States)
2015-02-10
We previously reported that CIN85, an 85 KDa protein known to be involved in tumor cell migration and metastasis through its interaction with Cbl, associates with MUC1 in tumor cells. MUC1/CIN85 complex also regulates migration and invasion of tumor cells in vitro. Here, we examined specifically human colon carcinoma tissue microarrays (TMA) by immunohistochemistry for the expression of MUC1 and CIN85 and their potential role in cancer progression and metastasis. We detected a significant increase in expression of both MUC1 and CIN85 associated with advanced tumor stage and lymph node metastasis. We further investigated if Cbl could also be present in the MUC1/CIN85 complex. Co-immunoprecipitation assay showed that Cbl co-localized both with CIN85 and with MUC1 in a human colon cancer cell line. To begin to investigate the in vivo relevance of MUC1 overexpression and association with CIN85 and Cbl in cancer development and progression, we used human MUC1 transgenic mice that express MUC1 on the colonic epithelial cells, treated with azoxymethane to initiate and dextran sulfate sodium (AOM/DSS) to promote colorectal carcinogenesis. MUC1.Tg mice showed higher tumor incidence and decreased survival when compared with wild-type mice. Consistent with the in vitro data, the association of MUC1, CIN85 and Cbl was detected in colon tissues of AOM/DSS-treated MUC1 transgenic mice. MUC1/CIN85/Cbl complex appears to contribute to promotion and progression of colon cancer and thus increased expression of MUC1, CIN85 and Cbl in early stage colon cancer might be predictive of poor prognosis.
KCNE1 D85N polymorphism — a sex-specific modifier in type 1 long QT syndrome?
Directory of Open Access Journals (Sweden)
Marjamaa Annukka
2011-01-01
Full Text Available Abstract Background Long QT syndrome (LQTS is an inherited ion channel disorder manifesting with prolongation of the cardiac repolarization phase and severe ventricular arrhythmias. The common KCNE1 D85N potassium channel variant prolongs QT interval by inhibiting IKs (KCNQ1 and IKr (KCNH2 currents and is therefore a suitable candidate for a modifier gene in LQTS. Methods We studied the effect of D85N on age-, sex-, and heart rate-adjusted QT-interval duration by linear regression in LQTS patients carrying the Finnish founder mutations KCNQ1 G589D (n = 492, KCNQ1 IVS7-2A>G (n = 66, KCNH2 L552S (n = 73, and KCNH2 R176W (n = 88. We also investigated the association between D85N and clinical variables reflecting the severity of the disease. Results D85N was associated with a QT prolongation by 26 ms (SE 8.6, p = 0.003 in males with KCNQ1 G589D (n = 213, but not in females with G589D (n = 279. In linear regression, the interaction between D85N genotype and sex was significant (p = 0.028. Within the KCNQ1 G589D mutation group, KCNE1 D85N carriers were more often probands of the family (p = 0.042 and were more likely to use beta blocker medication (p = 0.010 than non-carriers. The number of D85N carriers in other founder mutation groups was too small to assess its effects. Conclusions We propose that KCNE1 D85N is a sex-specific QT-interval modifier in type 1 LQTS and may also associate with increased severity of disease. Our data warrant additional studies on the role of KCNE1 D85N in other genetically homogeneous groups of LQTS patients.
Krypton-85 pollution and atmospheric electricity
International Nuclear Information System (INIS)
Harrison, R.G.; ApSimon, H.M.
1994-01-01
Krypton-86 is a chemically inert radioactive gas present in the atmosphere, concentrations of which have been greatly increased by nuclear reprocessing and weapons testing since 1945. The long half-life (10.7 yr), allows the gas to mix thoroughly in the atmosphere. Ionization caused by krypton-85 increases the electrical conductivity of atmospheric air. Further increases in krypton-85 emissions seem inevitable. The increase in air conductivity due to release of krypton-85 will vary with height, and be larger over the oceans than over the land. Increases in conductivity will produce uncertain effects on atmospheric phenomena, so changes are compared in magnitude with other factors perturbing the conductivity, such as combustion aerosol burdens, volcanic eruptions and nuclear weapons testing. Conductivity changes are expected to have the greatest significance for meteorological phenomena close to the source. (Author)
Effect of clayey groundwater on the dissolution rate of SON68 simulated nuclear waste glass at 70 °C
De Echave, T.; Tribet, M.; Jollivet, P.; Marques, C.; Gin, S.; Jégou, C.
2018-05-01
To predict the long-term behavior of high-level radioactive waste glass, it is necessary to study aqueous dissolution of the glass matrix under geological repository conditions. The present article focuses on SON68 (an inactive surrogate of the R7T7 glass) glass alteration in synthetic clayey groundwater at 70 °C. Experiments in deionized water as reference were also performed in the same conditions. Results are in agreement with those of previous studies showing that magnesium present in the solution is responsible for higher glass alteration. This effect is transient and pH-dependent: Once all the magnesium is consumed, the glass alteration rate diminishes. Precipitation of magnesium silicate of the smectite group seems to be the main factor for the increased glass alteration. A pH threshold of 7.5-7.8 was found, above which precipitation of these magnesium silicates at 70 °C is possible. TEM observations reveal that magnesium silicates grow at the expense of the passivating gel, which partly dissolves, forming large pores which increase mass transfer between the reacting glass surface and the bulk solution.
Solubility of actinides and surrogates in nuclear glasses
International Nuclear Information System (INIS)
Lopez, Ch.
2003-01-01
The nuclear wastes are currently incorporated in borosilicate glass matrices. The resulting glass must be perfectly homogeneous. The work discussed here is a study of actinide (thorium and plutonium) solubility in borosilicate glass, undertaken to assess the extent of actinide solubility in the glass and to understand the mechanisms controlling actinide solubilization. Glass specimens containing; actinide surrogates were used to prepare and optimize the fabrication of radioactive glass samples. These preliminary studies revealed that actinide Surrogates solubility in the glass was enhanced by controlling the processing temperature, the dissolution kinetic of the surrogate precursors, the glass composition and the oxidizing versus reducing conditions. The actinide solubility was investigated in the borosilicate glass. The evolution of thorium solubility in borosilicate glass was determined for temperatures ranging from 1200 deg C to 1400 deg C.Borosilicate glass specimens containing plutonium were fabricated. The experimental result showed that the plutonium solubility limit ranged from 1 to 2.5 wt% PuO 2 at 1200 deg C. A structural approach based on the determination of the local structure around actinides and their surrogates by EXAFS spectroscopy was used to determine their structural role in the glass and the nature of their bonding with the vitreous network. This approach revealed a correlation between the length of these bonds and the solubility of the actinides and their surrogates. (author)
Magnetic Glass Ceramics by Sintering of Borosilicate Glass and Inorganic Waste
Directory of Open Access Journals (Sweden)
Inès M. M. M. Ponsot
2014-07-01
Full Text Available Ceramics and glass ceramics based on industrial waste have been widely recognized as competitive products for building applications; however, there is a great potential for such materials with novel functionalities. In this paper, we discuss the development of magnetic sintered glass ceramics based on two iron-rich slags, coming from non-ferrous metallurgy and recycled borosilicate glass. The substantial viscous flow of the glass led to dense products for rapid treatments at relatively low temperatures (900–1000 °C, whereas glass/slag interactions resulted in the formation of magnetite crystals, providing ferrimagnetism. Such behavior could be exploited for applying the obtained glass ceramics as induction heating plates, according to preliminary tests (showing the rapid heating of selected samples, even above 200 °C. The chemical durability and safety of the obtained glass ceramics were assessed by both leaching tests and cytotoxicity tests.
Dicty_cDB: Contig-U16177-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available M01F05_RP Sugar Beet germination cDNA library Be... 54 1e-04 2 ( EG012316 ) STDB003A10u STDB Solanum tuberos...hytophthor... 52 0.048 1 ( CF858202 ) psMY010iA08r Agriculture Canada Phytophthora soja... 52 0.048 1 ( CF85...8120 ) psMY008iH11r Agriculture Canada Phytophthora soja... 52 0.048 1 ( CF857916 ) psMY006iB06r Agriculture...01618 ) MM10_C09 Young roots probed with 3 week old root ... 54 5e-05 2 ( EG552289 ) MM04F20_RP Sugar Beet germination cDNA library... Be... 54 5e-05 2 ( EG552173 ) MM04F20_XP Sugar Beet germination cDNA library
Casalegno, Valentina; Kondo, Sosuke; Hinoki, Tatsuya; Salvo, Milena; Czyrska-Filemonowicz, Aleksandra; Moskalewicz, Tomasz; Katoh, Yutai; Ferraris, Monica
2018-04-01
The aim of this work was to investigate and discuss the microstructure and interface reaction of a calcia-alumina based glass-ceramic (CA) with SiC. CA has been used for several years as a glass-ceramic for pressure-less joining of SiC based components. In the present work, the crystalline phases in the CA glass-ceramic and at the CA/SiC interface were investigated and the absence of any detectable amorphous phase was assessed. In order to provide a better understanding of the effect of irradiation on the joining material and on the joints, Si ion irradiation was performed both on bulk CA and CA joined SiC. CA glass-ceramic and CA joined SiC were both irradiated with 5.1 MeV Si2+ ions to 3.3 × 1020 ions/m2 at temperatures of 400 and 800 °C at DuET facility, Kyoto University. This corresponds to a damage level of 5 dpa for SiC averaged over the damage range. This paper presents the results of a microstructural analysis of the irradiated samples as well as an evaluation of the dimensional stability of the CA glass-ceramic and its irradiation temperature and/or damage dependence.
Conductivity studies in SnO–NaPO 3 glasses
Indian Academy of Sciences (India)
D.c. activation barriers seem to reflect the structural changes in system. A.c. conductivity analysis has revealed that while the power law exponent, , seem to bear correlation to the structural changes, the exponent of the stretched exponential function describing the dielectric relaxation is largely insensitive to the structure.
Conductivity studies of lithium zinc silicate glasses with varying ...
Indian Academy of Sciences (India)
WINTEC
Values of activation energy derived from σd.c., ωh and τ are almost equal within the ... materials can be changed by varying the proportion of the .... The solid line is a guide to the eye. ... does not show a maximum as d.c. conductivity drops to a.
Glass-Glass Transitions by Means of an Acceptor-Donor Percolating Electric-Dipole Network
Zhang, Le; Lou, Xiaojie; Wang, Dong; Zhou, Yan; Yang, Yang; Kuball, Martin; Carpenter, Michael A.; Ren, Xiaobing
2017-11-01
We report the ferroelectric glass-glass transitions in KN (K+/Nb5 +) -doped BaTiO3 ferroelectric ceramics, which have been proved by x-ray diffraction profile and Raman spectra data. The formation of glass-glass transitions can be attributed to the existence of cubic (C )-tetragonal (T )-orthorhombic (O )-rhombohedral (R ) ferroelectric transitions in short-range order. These abnormal glass-glass transitions can perform very small thermal hysteresis (approximately 1.0 K ) with a large dielectric constant (approximately 3000), small remanent polarization Pr , and relative high maximum polarization Pm remaining over a wide temperature range (220-350 K) under an electrical stimulus, indicating the potential applications in dielectric recoverable energy-storage devices with high thermal reliability. Further phase field simulations suggest that these glass-glass transitions are induced by the formation of a percolating electric defect-dipole network (PEDN). This proper PEDN breaks the long-range ordered ferroelectric domain pattern and results in the local phase transitions at the nanoscale. Our work may further stimulate the fundamental physical theory and accelerate the development of dielectric energy-storing devices.
International Nuclear Information System (INIS)
Marra, J.C.; Harbour, J.R.
1995-01-01
The Defense Waste Processing Facility (DWPF) will immobilize high-level radioactive waste currently stored in underground tanks at the Savannah River Site by incorporating the waste into a glass matrix. The molten waste glass will be poured into stainless steel canisters which will be welded shut to produce the final waste form. One specification requires that any volatiles produced as a result of accidentally heating the waste glass to the glass transition temperature be identified. Glass samples from five melter campaigns, run as part of the DWPF Startup Test Program, were analyzed to determine glass transition temperatures and to examine the volatilization (by weight loss). Glass transition temperatures (T g ) for the glasses, determined by differential scanning calorimetry (DSC), ranged between 445 C and 474 C. Thermogravimetric analysis (TGA) scans showed that no overall weight loss occurred in any of the glass samples when heated to 500 C. Therefore, no volatility will occur in the final glass product when heated up to 500 C
Interpretation of dc and ac conductivity of Ag2O–SeO2–MoO3 glass-nanocomposite-semiconductor
International Nuclear Information System (INIS)
Bhattacharya, Sanjib; Kundu, Ranadip; Das, Anindya Sundar; Roy, Debasish
2015-01-01
Highlights: • Polaron hopping. • Dc and ac conductivity. • Mott's model and Greave's model. • Ag 2 MoO 4 , Ag 2 Mo 2 O 7 and Ag 6 Mo 10 O 33 nanoparticles and SeO 3 and SeO 4 nanoclusters. • XRD and FESEM studies. - Abstract: A new type of semiconducting glass-nanocomposites 0.3Ag 2 O–0.7 (xMoO 3 –(1 − x) SeO 2 ) is prepared by melt-quenching route. The formation of Ag 2 MoO 4 , Ag 2 Mo 2 O 7 and Ag 6 Mo 10 O 33 nanoparticles and SeO 3 and SeO 4 nanoclusters in glass-nanocomposites has been confirmed from X-ray diffraction (XRD) and field emission scanning electron microscopic (FESEM) studies. Fourier transform infrared (FTIR) spectroscopy is employed to find out Se−O stretching vibration as well as stretching vibrations of Mo 2 O 7 2− ions. The dc conductivity of them is studied on the light of polaron hopping approach in a wide temperature range. At low temperatures, variable range hopping model (Mott's model) is employed to analyze the conductivity data. Greave's model is used to predict temperature dependent variable range hopping in the high temperature region. Frequency dependent ac conductivity is well explained on the basis of tunneling. I–V characteristics of the as-prepared samples have also been investigated
DEFF Research Database (Denmark)
Agersted, Karsten; Balic-Zunic, Tonci
2018-01-01
Sealing performance in solid oxide cell (SOC) stacks and the devitrification process of commercially available alkaline earth boroaluminosilicate glasses containing 48‐61 mol% SiO2, 18‐28 mol% CaO, 1‐7 mol% MgO, 7‐10 mol% Al2O3, 1‐11 mol% B2O3 plus minor amounts of Na2O, K2O, FeO, and TiO2 were...... investigated and quantified through analysis of phase assemblages as function of heat treatments above the glass transition temperatures using the electron microprobe and powder X‐ray diffraction. For two of these glasses devitrification behavior was compared to the devitrification behavior of similar glasses...... produced in the laboratory. Glasses were characterized after annealing in air at 800°C and 850°C for up to 6 weeks. Even though the glasses lie within a relatively narrow compositional range, sealing performance and the resulting microstructures differed significantly. Best thermomechanical properties...
Pin, Jean-Mathieu; Behazin, Ehsan; Misra, Manjusri; Mohanty, Amar
2018-05-02
The dynamic thermal history impact of poly(vinyl chloride) (PVC) has been explored for a wide range of pre-cooling rates, from 1 to 30 °C min-1. A first macroscopic insight into the dynamic thermal history influence has been highlighted through a decrease in the apparent activation energy (Eapp) in the first stage of the glass transition. The overall glass transition Eapp surface was successfully modeled in a polynomial fashion regarding the pre-cooling range. Raman scattering was used to associate the Eapp variations along the glass transition conversion with the stereochemistry evolution during the polymeric relaxation. Herein, the selection of atactic PVC as the polymer model permits us to monitor the glassy polymer segment stereodynamics during the heating ramp through the C-Cl stretching. The intermolecular H-Cl dipole interactions, as well as intramolecular conformational reorganizations among syndiotactic, isotactic and heterotactic polymer sequences, have been associated with non-cooperative and cooperative motions, i.e. the β- and α-process, respectively. The fruitful comparison of the two extreme values of the pre-cooling rates permits us to propose a thermokinetic scenario that explains the occurrence, intensity, and inter-dependence of β- and α-processes in the glassy state and during the glass transition. This scenario could potentially be generalized to all the other polymeric glass-formers.
3H, 14C, 85Kr and 129I production in nuclear facilities
International Nuclear Information System (INIS)
Castellani, F.; Ocone, R.
1984-01-01
The production of 3 H, 14 C, 85 Kr and 129 I in nuclear power plants is evaluated. In particular the plant components where these radioisotopes can be formed and the formation processes, with corresponding cross sections, are considered. Furthermare their release in the plants and the fraction transfered to the reprocessing are examined
Dicty_cDB: Contig-U03567-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available A... 32 0.001 4 ( EL490927 ) CHUS5969.b1_A06.ab1 CHU(LMS) puzzle sunflower Hel... 56 0.001 1 ( EL489897 ) CH...US5018.b1_C07.ab1 CHU(LMS) puzzle sunflower Hel... 56 0.001 1 ( EL488260 ) CHUS34...85.b1_I07.ab1 CHU(LMS) puzzle sunflower Hel... 56 0.001 1 ( EE654588 ) CHES4477.b1_I16.ab1 CHE(LMS) serpenti
Analysis of in-situ electrical conductivity data from the HFIR TRIST-ER1 experiment
International Nuclear Information System (INIS)
Zinkle, S.J.; Snead, L.L.; Shikama, T.
1997-01-01
The current vs. applied voltage data generated from the HFIR TRIST-ER1 experiment have been analyzed to determine the electrical conductivity of the 15 aluminum oxide specimens and the MgO-insulated electrical cables as a function of irradiation dose. With the exception of the 0.05%Cr-doped sapphire (ruby) specimen, the electrical conductivity of the alumina specimens remained at the expected radiation induced conductivity (RIC) level of -6 S/m during full-power reactor irradiation (10-16 kGy/s) at 450-500 degrees C up to a maximum dose of ∼3 dpa. The ruby specimen showed a rapid initial increase in conductivity to ∼2 x 10 -4 S/m after ∼0.1 dpa, followed by a gradual decrease to -6 S/m after 2 dpa. Nonohmic electrical behavior was observed in all of the specimens, and was attributed to preferential attraction of ionized electrons in the capsule gas to the unshielded low-side bare electrical leads emanating from the subcapsules. The electrical conductivity was determined from the slope of the specimen current vs. voltage curve at negative voltages, where the gas ionization effect was minimized. Dielectric breakdown tests performed on unirradiated mineral-insulated coaxial cables identical to those used in the high voltage coaxial cables during the 3-month irradiation is attributable to thermal dielectric breakdown in the glass seals at the end of the cables, as opposed to a radiation-induced electrical degradation (RIED) effect
Analysis of in-situ electrical conductivity data from the HFIR TRIST-ER1 experiment
Energy Technology Data Exchange (ETDEWEB)
Zinkle, S.J.; Snead, L.L. [Oak Ridge National Lab., TN (United States); Shikama, T. [Tohoku Univ. (Japan)] [and others
1997-08-01
The current vs. applied voltage data generated from the HFIR TRIST-ER1 experiment have been analyzed to determine the electrical conductivity of the 15 aluminum oxide specimens and the MgO-insulated electrical cables as a function of irradiation dose. With the exception of the 0.05%Cr-doped sapphire (ruby) specimen, the electrical conductivity of the alumina specimens remained at the expected radiation induced conductivity (RIC) level of <10{sup -6} S/m during full-power reactor irradiation (10-16 kGy/s) at 450-500{degrees}C up to a maximum dose of {approximately}3 dpa. The ruby specimen showed a rapid initial increase in conductivity to {approximately}2 x 10{sup -4} S/m after {approximately}0.1 dpa, followed by a gradual decrease to <1 x 10{sup -6} S/m after 2 dpa. Nonohmic electrical behavior was observed in all of the specimens, and was attributed to preferential attraction of ionized electrons in the capsule gas to the unshielded low-side bare electrical leads emanating from the subcapsules. The electrical conductivity was determined from the slope of the specimen current vs. voltage curve at negative voltages, where the gas ionization effect was minimized. Dielectric breakdown tests performed on unirradiated mineral-insulated coaxial cables identical to those used in the high voltage coaxial cables during the 3-month irradiation is attributable to thermal dielectric breakdown in the glass seals at the end of the cables, as opposed to a radiation-induced electrical degradation (RIED) effect.
Energy Technology Data Exchange (ETDEWEB)
Bagheri, Reza; Yousefinia, Hassan [Nuclear Fuel Cycle Research School (NFCRS), Nuclear Science and Technology Research Institute (NSTRI), Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Moghaddam, Alireza Khorrami [Radiology Department, Paramedical Faculty, Mazandaran University of Medical Sciences, Sari (Iran, Islamic Republic of)
2017-02-15
In this work, linear and mass attenuation coefficients, effective atomic number and electron density, mean free paths, and half value layer and 10th value layer values of barium-bismuth-borosilicate glasses were obtained for 662 keV, 1,173 keV, and 1,332 keV gamma ray energies using MCNP-4C code and XCOM program. Then obtained data were compared with available experimental data. The MCNP-4C code and XCOM program results were in good agreement with the experimental data. Barium-bismuth-borosilicate glasses have good gamma ray shielding properties from the shielding point of view.
High-level waste borosilicate glass a compendium of corrosion characteristics. Volume 1
International Nuclear Information System (INIS)
Cunnane, J.C.
1994-03-01
Current plans call for the United States Department of Energy (DOE) to start up facilities for vitrification of high-level radioactive waste (HLW) stored in tanks at the Savannah River Site, Aiken, South Carolina, in 1995; West Valley Demonstration Project, West Valley, New York, in 1996; and at the Hanford Site, Richland, Washington, after the year 2000. The product from these facilities will be canistered HLW borosilicate glass, which will be stored, transported, and eventually disposed of in a geologic repository. The behavior of this glass waste product, under the range of likely service conditions, is the subject of considerable scientific and public interest. Over the past few decades, a large body of scientific information on borosilicate waste glass has been generated worldwide. The intent of this document is to consolidate information pertaining to our current understanding of waste glass corrosion behavior and radionuclide release. The objective, scope, and organization of the document are discussed in Section 1.1, and an overview of borosilicate glass corrosion is provided in Section 1.2. The history of glass as a waste form and the international experience with waste glass are summarized in Sections 1.3 and 1.4, respectively
International Nuclear Information System (INIS)
Lee, Keunhee; Ki, Hyungson
2016-01-01
We report a laser-based method for directly fabricating large-area, transparent conductive films with customizable electrical resistance on glass. In this method, a diamond-like carbon (DLC) film is deposited first on a glass substrate by pulsed laser deposition, which is then annealed in a helium shielding environment by a 2 kW continuous-wave fiber laser with a wavelength of 1070 nm, which is transparent to glass but is absorbed by DLC to transform the amorphous carbons to graphene. When a 510 nm thick film was annealed at a scanning speed of 1 m/s by a 200 μm top-hat laser beam, the sp 3 fraction was decreased from 43.1% to 8.1% after the annealing process, and the transformed film showed a transparency of ∼80% (at 550 nm) and a sheet resistance of ∼2050 Ω/sq. We also showed that sheet resistance and transparency can be controlled by changing processing parameters. To show the scalability of the method, a 15 mm wide line beam was used to produce a 15 mm × 15 mm film. This method is simple, fully scalable, transfer-free and catalyst-free, and we believe that the fabricated films can have many applications with further research, such as transparent heating films, electromagnetic shielding films, and transparent electrodes.
Leaching of actinides from simulated nuclear waste glass
International Nuclear Information System (INIS)
Pickering, S.; Walker, C.T.; Offermann, P.
1982-01-01
Two types of simulated nuclear waste glass doped with actinides were leached at 200 0 C in distilled water and salt solutions. Am, Np, Pu and U were all preferentially retained in the surface layer on the glass. Leaching ratios of 0.1 to 0.2 for Np and approx. 0.02 for Am were measured. The losses of Am and Np to the leachant were proportional to the total weight loss of the glass and were larger at 10 ml leachant/cm 2 glass than at 5 ml/cm 2 . Weight loss from the glass occurred only at the start of the experiments for periods ranging from 10 h to 10 days according to leachant composition and volume. Wt losses from the C31-3-EC glass were much greater in saturated NaCl solution than in distilled water. Enrichment in the outer surface layer of Al or Ca according to glass type could be correlated with leachant pH, glass composition and weight loss measurements
Silicon-to-silicon wafer bonding using evaporated glass
DEFF Research Database (Denmark)
Weichel, Steen; Reus, Roger De; Lindahl, M.
1998-01-01
Anodic bending of silicon to silicon 4-in. wafers using an electron-beam evaporated glass (Schott 8329) was performed successfully in air at temperatures ranging from 200 degrees C to 450 degrees C. The composition of the deposited glass is enriched in sodium as compared to the target material....... The roughness of the as-deposited films was below 5 nm and was found to be unchanged by annealing at 500 degrees C for 1 h in air. No change in the macroscopic edge profiles of the glass film was found as a function of annealing; however, small extrusions appear when annealing above 450 degrees C. Annealing...... of silicon/glass structures in air around 340 degrees C for 15 min leads to stress-free structures. Bonded wafer pairs, however, show no reduction in stress and always exhibit compressive stress. The bond yield is larger than 95% for bonding temperatures around 350 degrees C and is above 80% for bonding...
Femtosecond laser-induced reduction in Eu-doped sodium borate glasses
Energy Technology Data Exchange (ETDEWEB)
Lim, Ki-Soo [Department of Physics and Basic Science Research Institute, Chungbuk National University, Cheongju 361-763 (Korea, Republic of)]. E-mail: kslim@chungbuk.ac.kr; Lee, Sunkyun [Department of Physics and Basic Science Research Institute, Chungbuk National University, Cheongju 361-763 (Korea, Republic of); Trinh, Minh-Tuan [Department of Physics and Basic Science Research Institute, Chungbuk National University, Cheongju 361-763 (Korea, Republic of); Kim, Suk-Ho [Department of Physics and Basic Science Research Institute, Chungbuk National University, Cheongju 361-763 (Korea, Republic of); Lee, Myeongkyu [Departent of Materials Science and Engineering, Yonsei University, 134 Shinchon-dong, Seoul 120-749 (Korea, Republic of); Hamilton, Douglas S. [Department of Physics, University of Connecticut, Storrs, CT 06269 (United States); Gibson, George N. [Department of Physics, University of Connecticut, Storrs, CT 06269 (United States)
2007-01-15
In this work, we report permanent reduction of Eu{sup 3+} to Eu{sup 2+} in sodium borate glasses by irradiation of near-infrared femtosecond laser. Glass composition of sodium borate was 85B{sub 2}O{sub 3}-15Na{sub 2}O. The glasses were doped with 0.05, 0.1, and 0.5 mol% Eu{sub 2}O{sub 3}. Absorption and fluorescence dynamics were studied to investigate valence state change of europium ions and the energy transfer between Eu{sup 2+} and Eu{sup 3+} ions. As the femtosecond laser intensity or exposure time increases, the emission band at 400 nm becomes stronger. However, the photoreduction efficiency decreases as the dopant concentration increases. We discuss the photoreduction mechanism under multiphoton absorption.
International Nuclear Information System (INIS)
Caurel, J.
1990-01-01
The glass R7T7 is chosen in France for vitrification of solution from reprocessing. Safety requires the knowledge of R7T7 long term behavior in deep geologic formations. Temperature dependence of leaching between 50 and 300 0 C is studied by static tests for 7 days. An activation energy of 30kJ/Mole is calculated between 50; 75 or 100 0 C and 250 0 C. Results suggest similar corrosion mechanisms between 90-100 and 250 0 C by a complete change between 250 and 275 0 C. Glass corrosion kinetics at 150 0 C and 250 0 C between 1 day and 1 year evidence the precipitation of aluminosilicates and formation of thick amorphous gels progressively enriched with silica. Glass dissolution at 150 0 C and 250 0 C is simulated with the geochemical DISSOL code. Results suggest that dissolution kinetics are controlled by activity of H 4 SiO 4 in solution only. Silica contained into the gel controls corrosion kinetics different from 0. Even if the nature of dissolution mechanisms does not seem modified between 150 and 250 0 C, sample cracking at 250 0 C induces an increase of dissolved glass that does not allow a direct comparison of corrosion kinetics between 150 and 250 0 C [fr
International Nuclear Information System (INIS)
Sindhu, S.; Narasimha Rao, K.; Ahuja, Sharath; Kumar, Anil; Gopal, E.S.R.
2006-01-01
Electrochromic devices utilizing conjugated polymers as electrochromic layers have gained increasing attention owing to their optical properties, fast switching times and contrast ratios. Polyethylenedioxythiophene (PEDOT) is an excellent material from its electrochromic properties, high conductivity and high stability in the doped form. Aqueous dispersions of PEDOT were either spin coated or electro-polymerized on transparent conducting oxide coated glass and polyethylene tetraphthalate (PET) film substrates. The spectro- and opto-electrochemical studies of the films on transparent conducting oxide coated glass/PET substrates were performed. These films have application in the fabrication of electrochromic windows (smart windows). Smart window devices having excellent switching characteristics over wide range of temperature are used for glazing applications. The aerospace industry is interested in the development of visors and windows that can control glare for pilots and passengers, especially if the coatings can be made on curved surfaces and electrically conducting
Sripada, Suresh; Rani, D. Esther Kalpana; Upender, G.; Pavani, P. Gayathri
2013-03-01
Titanium boro tellurite glasses in the xB2O3 -(90- x) TeO2 - 10TiO2 (where x = 0 to 50 mol%) system were prepared by using the conventional melt-quenching technique. Glass transition temperatures were measured with differential scanning calorimetry (DSC) and found to be in the range of 300-370 °C. The Raman spectra showed a cleavage of the continuous TeO4 (tbp) network by breaking of the Te-O-Te linkages. The relative transition of TeO4 - groups to TeO3 - groups is accompanied by a change in the oxygen coordination of the boron from 3 to 4 (BO3 - to BO4 -). The impedance plots Z″( ω) versus Z'( ω) for all the glass samples were recorded and found to exhibit a single circle. The AC conductivity of all glass samples was studied in the frequency range from 100 Hz to 1 MHz and in the temperature range from room temperature (RT) to 375 °C. The AC conductivity decreased by about one order in magnitude with increasing B2O3 content. The conductivity was found to be on the order of 10-4.5 to 10-6 (Ωcm)-1 at 375 °C and 1 MHz for 10 mol% and 50 mol% B2O3 contents, respectively. The relaxation behavior in these glass samples is discussed based on the complex modulus and impedance data.
von Aulock, F. W.; Ferk, A.; Leonhardt, R.; Hess, K.-U.; Dingwell, D. B.
2009-04-01
The suitability of volcanic glass for paleointensity determinations has been proposed in many studies throughout the last years. Besides the mainly single domain magnetic remanence carriers and the pristine character of the volcanic glass, this was also reasoned by the possibility to correct paleointensity data for cooling rate dependency using relaxation geospeedometry. This method gives the cooling rate of a glass at the glass transition interval which marks the change of a ductile supercooled liquid to a brittle glass. In this study the cooling rate correction as carried out for example by Leonhardt et al. 2006 is tested on synthetic volcanic glass. In order to obtain a stable multicomponent glass with ideal magnetic properties, a natural phonolithic glass from Tenerife (Spain) was melted to avoid heterogeneity and degassing. Further it was tempered for 5 hours at 900 °C to yield a sufficient concentration of magnetic remanence carriers. To exclude nucleation or crystallisation 7 samples were then heated to about 50 °C above the glass transition temperature at around 720 °C and quenched at different rates from 0.1 to 15 K/min. After carrying out a paleointensity experiment using a modified Thellier method, which incorporated alteration, additivity and tail checks, the dependence of the thermoremance on cooling rate was investigated. Using the original cooling rates we corrected the data and obtained paleointensities of around 46 T, which is a good approximation of the ambient field of 48 T. Taking into account that the uncorrected mean paleointensity is about 57 T, this suggests that cooling rate correction is not only working, but also a necessary tool to yield the true field value. R. Leonhardt , J. Matzka, A.R.L. Nichols , D.B. Dingwell Cooling rate correction of paleointensity determination for volcanic glasses by relaxation geospeedometry; Earth and Planetary Science Letters 243 (2006) 282-292
Crystal growth in zinc borosilicate glasses
Kullberg, Ana T. G.; Lopes, Andreia A. S.; Veiga, João P. B.; Monteiro, Regina C. C.
2017-01-01
Glass samples with a molar composition (64+x)ZnO-(16-x)B2O3-20SiO2, where x=0 or 1, were successfully synthesized using a melt-quenching technique. Based on differential thermal analysis data, the produced glass samples were submitted to controlled heat-treatments at selected temperatures (610, 615 and 620 °C) during various times ranging from 8 to 30 h. The crystallization of willemite (Zn2SiO4) within the glass matrix was confirmed by means of X-ray diffraction (XRD) and scanning electron microscopy (SEM). Under specific heat-treatment conditions, transparent nanocomposite glass-ceramics were obtained, as confirmed by UV-vis spectroscopy. The influence of temperature, holding time and glass composition on crystal growth was investigated. The mean crystallite size was determined by image analysis on SEM micrographs. The results indicated an increase on the crystallite size and density with time and temperature. The change of crystallite size with time for the heat-treatments at 615 and 620 °C depended on the glass composition. Under fixed heat-treatment conditions, the crystallite density was comparatively higher for the glass composition with higher ZnO content.
Glass packages in interim storage
International Nuclear Information System (INIS)
Jacquet-Francillon, N.
1994-10-01
This report summarize the current state of knowledge concerning the behavior of type C waste packages consisting of vitrified high-level solutions produced by reprocessing spent fuel. The composition and the physical and chemical properties of the feed solutions are reviewed, and the vitrification process is described. Sodium alumino-borosilicate glass compositions are generally employed - the glass used at la Hague for LWR fuel solutions, for example, contains 45 % SiO 2 . The major physical, chemical, mechanical and thermal properties of the glass are reviewed. In order to allow their thermal power to diminish, the 3630 glass packages produced (as of January 1993) in the vitrification facilities at Marcoule and La Hague are placed in interim storage for several decades. The actual interim storage period has not been defined, as it is closely related to the concept and organization selected for the final destination of the packages: a geological repository. The glass behavior under irradiation is described. Considerable basic and applied research has been conducted to assess the aqueous leaching behavior of nuclear containment glass. The effects of various repository parameters (temperature, flow rate, nature of the environmental materials) have been investigated. The experimental findings have been used to specify a model describing the kinetics of aqueous corrosion of the glass. More generally all the ''source term'' models developed in France by the CEA or by ANDRA are summarized. (author). 152 refs., 33 figs
Oxidation of SiC/BN/SiC Composites in Reduced Oxygen Partial Pressures
Opila, Elizabeth J.; Boyd, Meredith
2010-01-01
SiC fiber-reinforced SiC composites with a BN interphase are proposed for use as leading edge structures of hypersonic vehicles. The durability of these materials under hypersonic flight conditions is therefore of interest. Thermogravimetric analysis was used to characterize the oxidation kinetics of both the constituent fibers and composite coupons at four temperatures: 816, 1149, 1343, and 1538 C (1500, 2100, 2450, and 2800 F) and in oxygen partial pressures between 5% and 0.1% (balance argon) at 1 atm total pressure. One edge of the coupons was ground off so the effects of oxygen ingress into the composite could be monitored by post-test SEM and EDS. Additional characterization of the oxidation products was conducted by XPS and TOF-SIMS. Under most conditions, the BN oxidized rapidly, leading to the formation of borosilicate glass. Rapid initial oxidation followed by volatilization of boria lead to protective oxide formation and further oxidation was slow. At 1538C in 5% oxygen, both the fibers and coupons exhibited borosilicate glass formation and bubbling. At 1538C in 0.1% oxygen, active oxidation of both the fibers and the composites was observed leading to rapid SiC degradation. BN oxidation at 1538C in 0.1% oxygen was not significant.
Dicty_cDB: Contig-U12305-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available FF728454 ) XABT43452.fwd Gateway compatible cien cDNA librar... 38 4e-08 4 ( EJ389236 ) 1092963888956 Global-Ocean-Sampli... Enchytraeus japonensis Ej-vasa1 mR... 237 1e-60 EF165011_1( EF165011 |pid:none) Paragonimus westerm...|pid:none) Zygosaccharomyces rouxii strain ... 235 4e-60 EF165012_1( EF165012 |pid:none) Paragonimus westerm...icago truncatula clone mth2-85g12, complete se... 96 5e-17 5 ( DW516753 ) GH_TMIRS_204_F11_F Cotton Normalized...ame: Full=DEAD-box ATP-dependent RNA helicase 24; ... 207 1e-51 AK292921_1( AK292921 |pid:none) Homo sapiens cDNA FLJ77678 compl
Effect of temperature and pressure on non-linear conduction in GeTeSe chalcogenide glass
International Nuclear Information System (INIS)
El-Mansy, M.K.
1998-01-01
The I-V characteristic curves were studied in the temperature range 301-359 K and pressure range up to 7.15 x 10 9 Pa which illustrate a non-linear behaviour below (high-resistance region) and beyond (negative-resistance region) a breakdown point characterising Ge 27 Te 62 Se 11 chalcogenide glasses. The general behaviour is shifted towards lower voltage and higher current when the ambient temperature and/or the applied pressure were increased. The non-linear behaviour in the pre breakdown region is discussed according to the Poole-Frenkel field emission of electrons from deep traps located at a depth equal to 0.372eV. The analysis of the effect of field on the non-linear conduction in Ge 27 Te 62 Se 11 chalcogenide glass suggests a modification of the energy difference between filled and empty sites, where the effect of pressure suggests a reduction of the energy gap width. The analysis based on simple thermal effects in the region closer to the breakdown point implies the electrothermal process initiating the negative resistance region. The results of post breakdown region (negative-resistance region) imply the electron hopping between filled and empty localised states at Fermi level. The density of localised states is estimated which lies in the range 5.7 x 10 16 -1.84 x 10 18 cm -3 /eV
Energy Technology Data Exchange (ETDEWEB)
Christensen, Sebastian; Schmøkel, Mette Stokkebro; Borup, Kasper Andersen; Christensen, Mogens, E-mail: mch@chem.au.dk, E-mail: bo@chem.au.dk; Iversen, Bo Brummerstedt, E-mail: mch@chem.au.dk, E-mail: bo@chem.au.dk [Department of Inorganic Chemistry & iNANO, Center for Materials Crystallography, Aarhus University, Langelandsgade 140, 8000 Aarhus C (Denmark); Madsen, Georg K. H. [ICAMS, Ruhr-Universität Bochum, Bochum (Germany); McIntyre, Garry J.; Capelli, Silvia C. [Institut Laue-Langevin, 71 Avenue des Martyrs, CS 20156, Grenoble Cedex 9 (France)
2016-05-14
The origin of the “glass-like” plateau in thermal conductivity of inorganic type I clathrates has been debated for more than a decade. Here, it is demonstrated that the low temperature thermal conductivity of Sr{sub 8}Ga{sub 16}Ge{sub 30} can be controlled by the synthesis method: A flux-grown sample has a “glass-like” plateau in thermal conductivity at low temperature, while a zone-melted sample instead has a crystalline peak. A combination of flux-growth and zone-melting produces an intermediate thermal conductivity. In a comprehensive study of three single crystal samples, it is shown by neutron diffraction that the transition from crystalline peak to “glass-like” plateau is related to an increase in Sr guest atom off-centering distance from 0.24 Å to 0.43 Å. By modifying ab initio calculated force constants for the guest atom to an isotropic model, we reproduce both measured heat capacity and inelastic neutron scattering data. The transition from peak to plateau in the thermal conductivity can be modeled by a combined increase of Rayleigh and disorder scattering. Measurement of heat capacity refutes simple models for tunneling of Sr between off-center sites. Furthermore, the electronic properties of the same samples are characterized by Hall carrier density, Seebeck coefficient, and resistivity. The present comprehensive analysis excludes tunneling and charge carrier scattering as dominant contributors to the “glass-like” plateau. The increased guest atom off-centering distance controlled by synthesis provides a possible microscopic mechanism for reducing the low temperature thermal conductivity of clathrates.
DEHYDRATION AND REHYDRATION OF AN ION-LEACHABLE GLASS USED IN GLASS-IONOMER CEMENTS
Directory of Open Access Journals (Sweden)
Jacek Klos
2017-03-01
Full Text Available Samples of the ionomer glass known as G338 have been heated at 240°C for 24 hours, after which they lost 1.19 % (Standard deviation 0.16% of their original mass. This loss was attributed to removal of water, as both molecular water and the product of reaction of silanol groups to form siloxane bridges. Exposing samples of glass either to air at ambient humidity or to air at 95% relative humidity showed a degree of rehydration, but mass uptake did not approach the original mass loss in either case. It is suggested that this is because of the relatively difficulty in forming new silanol groups from the siloxane bridges. Glass-ionomer cements prepared from these glass samples with aqueous poly(acrylic acid solution had different properties, depending on the glass used. Dehydrated glass gave cements which set faster but were weaker than those formed by as-received glass. The role of silanol groups in influencing reaction rate and promoting strength development is discussed.
Apparent and standard molar volumes and heat capacities of aqueous Ni(ClO4)2 from 25 to 85oC
International Nuclear Information System (INIS)
Pan, P.; Campbell, A.B.
1997-01-01
Apparent molar heat capacities and volumes of aqueous Ni(ClO 4 ) 2 were measured from 25 to 85 o C over a concentration range of 0.02 to 0.8 mol-kg -1 using a Picker flow microcalorimeter and a Picker vibrating-tube densimeter. An extended Debye-Huckel equation was fitted to the experimental data to obtain expressions for the apparent molar properties as functions of ionic strength for Ni(ClO 4 ) 2 (aq). The standard-state partial molar properties for Ni(ClO 4 ) 2 (aq) in the temperature range 25 to 85 o C were obtained and can be expressed by empirical equations. The standard partial molar heat capacities and volumes for Ni 2+ (aq) from 25 to 86 o C were obtained by using the additivity rule and data for ClO - 4 (aq) in the literature. These values were extrapolated to 300 o C by employing the Helgeson-Kirkham-Flower (HKF) equations, amended to include a standard-state correction term. (author)
Dissolution of lanthanide alumino-silicate oxynitride glasses
Bois, L.; Barré, N.; Guillopé, S.; Guittet, M. J.; Gautier-Soyer, M.; Duraud, J. P.; Trocellier, P.; Verdier, P.; Laurent, Y.
2000-01-01
The aqueous corrosion behavior of lanthanide aluminosilicate glasses has been studied under static conditions ( T=96°C, duration=1 and 3 months, glass surface area/leachate volume, S/ V=0.3 cm -1) by means of solution and solid analyses. It was found that these glasses exhibit a high chemical durability. The influence of yttrium, magnesium and nitrogen, which are supposed to improve the mechanical properties, on the chemical durability, has been investigated. After a one-month experiment, lanthanum and yttrium releases were found to be about 10 -7 mol l -1, while silicon and aluminum releases were about 10 -5 mol l -1. Yttrium seems to improve the chemical durability. The presence of nitrogen does not seem to modify the glass constituents releases, but seems to improve the surface state of the altered glass. XPS experiments reveal that lanthanum and yttrium are more concentrated near the surface (20-30 Å) of the glass after the leaching test.
Effects of thermal history and irradiation on the dc conductivity of high purity GeO2 glasses
International Nuclear Information System (INIS)
Magruder, R.H.
1985-01-01
The dc electrical properties of a series of high purity GeO 2 glasses fused and equilibrated at various temperatures (T phi) in air were measured. T phi ranged from 1350 0 C to 1690 0 C. The charge carriers are shown to be the Na ions. The mobility is found to obey an Arrhenius function with enthalpy of activation of approximately 1.01 eV in the as-quenched state for all T phi's. The changes observed in the mobilities of the Na ions for the various T phi's are suggested to be caused by changes in the configurational coordinates of the average interstitial sites through which the Na ion moves with changes in T phi. These changes are manifested in the entropy of activation. Subsequent annealing treatments at 420 0 C (15 0 below the Littleton softening point) for the times observed in these experiments do not change the general behavior of the mobility with T phi even though they do change the observed values of mobilities. These changes are suggested to result from thermal compaction changing the average well structure through which the Na ion moves. The γ irradiation of these glasses causes a decrease in the mobility of the Na ion for all T phi samples. The mobilities decreases with increasing dose. These decreases in mobilities are suggested to be caused by radiation induced compaction and by change of defect concentrations. These two processes result through relaxation processes and coulombic forces in changes in the average well structure
Mixed mobile ion effect in fluorozincate glasses
International Nuclear Information System (INIS)
Ghosh, S; Ghosh, A
2005-01-01
The mixed mobile ion effect has been investigated for the first time in zinc fluoride glasses where in addition to alkali cations fluorine anions also participate in the diffusion process, unlike mixed alkali oxide glasses. The minimum in the conductivity, conductivity relaxation frequency, crossover frequency and decoupling index indicates the existence of the mixed mobile ion effect in these fluoride glasses. It has been observed that the non-exponential parameter and the frequency exponent are independent of temperature. It has been established that alkali ions and fluorine anions exhibit lower dimensionality of the conduction pathways in mixed alkali zinc fluoride glasses than that in the single alkali lithium based zinc fluoride glasses while they are migrating. From the scaling of the conductivity spectra, it has been established that the relaxation dynamics in mixed alkali zinc fluoride glasses is independent of temperature and composition
Chemical durability of borosilicate glasses containing simulated high-level nuclear wastes, 1
International Nuclear Information System (INIS)
Hara, Shigeo; Terai, Ryohei; Yamanaka, Hiroshi
1983-01-01
The Soxhlet-type leaching test apparatus has been developed to evaluate the chemical durability of some borosilicate glasses containing simulated High-Level nuclear Wastes, HLW. After the leaching over the temperature range of 50 0 -95 0 C, the weight loss of specimens with time was determined on both the samples of blocks and grains, and various components dissolved into water were analyzed by atomic absorption and colorimetry technique. It was found that Soxhlet-type test method was more useful than JIS test method, because the specimens in Soxhlet type apparatus were forced always to react with pure water and the mechanism of leaching could be evaluate accurately. The chemical durability of commercial glasses decreases generally with increasing of alkali contents in glasses. In the case of these borosilicate glasses containing HLW, however, the leachability was apparently independent on the alkali contents because of the complexity of these glass compositions. The variation of leaching rate with temperature suggests that dissolution mechanism changes with temperature. (author)
The effect of spark plasma sintering on lithium disilicate glass-ceramics.
Al Mansour, Fatima; Karpukhina, Natalia; Grasso, Salvatore; Wilson, Rory M; Reece, Mike J; Cattell, Michael J
2015-10-01
To evaluate the effects of spark plasma sintering (SPS) on the microstructure of lithium disilicate glass-ceramics. IPS e.max CAD glass-ceramic samples were processed using spark plasma sintering (SPS) and conventionally sintered (CS) as a comparison. Specimens were sintered at varying temperatures (T1: 840°C, T2: 820°C, T3: 800°C), heating rates (HR1: 150°C/min, HR2: 300°C/min, HR3: 500°C/min) and pressures (P1: 15MPa, P2: 50MPa, P3: 70MPa). IPS e.max Press glass powder samples were densified at 750 and 800°C (50 or 200MPa pressure). Samples were characterized using XRD, HTXRD, and SEM and quantitative image analysis. There was a significant increase in median crystal size (MCS) between the CS and the SPS T1 groups. A statistical difference (p>0.05) in MCS between SPS T1 and SPS T2 groups was observed. The SPS HR3 sample produced a smaller MCS than the CS, SPS HR1 and HR2 groups (pglass samples resulted in fine fibrils or graduated lithium disilicate crystals. The effects of SPS were used to refine the microstructure of IPS e.max CAD lithium disilicate glass-ceramics. Densification by SPS of IPS e.max Press glass resulted in textured and fine nano-crystalline microstructures. SPS generated glass-ceramic microstructures may have unique properties and could be useful in the production of CAD/CAM materials for dentistry. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Hrma, P.R.; Piepel, G.F.
1994-12-01
A Composition Variation Study (CVS) is being performed within the Pacific Northwest Laboratory Vitrification Technology Development (PVTD) project in support of a future high-level nuclear waste vitrification plant at the Hanford site in Washington. From 1989 to 1994, over 120 nonradioactive glasses were melted and properties measured in five statistically-designed experimental phases. Glass composition is represented by the 10 components SiO 2 , B 2 O 3 , ZrO 2 , Na 2 O, Li 2 O, CaO, MgO, and Others (all remaining components). The properties measured include viscosity (η), electrical conductivity (ε), glass transition temperature (T g ), thermal expansion of solid glass (α s ) and molten glass (α m ), crystallinity (quenched and canister centerline cooled glasses), liquidus temperature (T L ), durability based on normalized elemental releases from the Materials Characterization Center-1 28-day dissolution test (MCC-1, r mi ) and the 7-day Product Consistency Test (PCT, r pi ), and solution pHs from MCC-1 and PCT. Amorphous phase separation was also evaluated. Empirical first- and second-order mixture models were fit using the CVS data to relate the various properties to glass composition. Equations for calculating the uncertainty associated with property values predicted by the models were also developed. The models were validated using both internal and external data. Other modeling approaches (e.g., non-bridging oxygen, free energy of hydration, phase-equilibria T L ) were investigated for specific properties. A preliminary Qualified Composition Region was developed to identify glass compositions with high confidence of being processable in a melter and meeting waste form acceptance criteria
Gold nano-particles fixed on glass
International Nuclear Information System (INIS)
Worsch, Christian; Wisniewski, Wolfgang; Kracker, Michael; Rüssel, Christian
2012-01-01
Highlights: ► We produced wear resistant gold–ruby coatings on amorphous substrates. ► Thin sputtered gold layers were covered by or embedded in silica coatings. ► Annealing above T g of the substrate glass led to the formation of gold nano particles. ► A 1 1 1-texture of the gold particles is observed via XRD and EBSD. ► EBSD-patterns can be acquired from crystals covered by a thin layer of glass. - Abstract: A simple process for producing wear resistant gold nano-particle coatings on transparent substrates is proposed. Soda-lime-silica glasses were sputtered with gold and subsequently coated with SiO 2 using a combustion chemical vapor deposition technique. Some samples were first coated with silica, sputtered with gold and then coated with a second layer of silica. The samples were annealed for 20 min at either 550 or 600 °C. This resulted in the formation of round, well separated gold nano-particles with sizes from 15 to 200 nm. The color of the coated glass was equivalent to that of gold–ruby glasses. Silica/gold/silica coatings annealed at 600 °C for 20 min were strongly adherent and scratch resistant. X-ray diffraction and electron backscatter diffraction (EBSD) were used to describe the crystal orientations of the embedded particles. The gold particles are preferably oriented with their (1 1 1) planes perpendicular to the surface.
The thermoluminescence of Toshiba FD-1 and FD-7 RPL glass
International Nuclear Information System (INIS)
Croft, S.; Weaver, D.R.; Matthews, R.
1996-01-01
The thermoluminescent response of Toshiba FD-1 and Toshiba FD-7 radiophotoluminescent dosimetry glass to 60 Co γ radiation has been studied at doses of up to 66 kGy air kerma and 590 kGy air kerma respectively. The FD-1 glass was in the form of rods 1 mm in diameter by 6 mm long whereas the FD-7 glass was in the form of blocks of 4.6 mm square and 1.47 mm thick. The FD-1 rods had a pre-dose signal equivalent to 180 Gy and were useable up to the maximum dose studied although the response-dose curve was slightly supralinear at low doses. The FD-7 samples had a predose of 6.2 Gy and began to show severe saturation beyond about 1 kGy. The specific TL efficiencies (counts. mg. -1 .Gy -1 ) of the two glass types have been compared with LiF and BeO and found to be some six orders of magnitude lower. (author)
Controlled Synthesis of Monolayer Graphene Toward Transparent Flexible Conductive Film Application
Directory of Open Access Journals (Sweden)
Yu Han-Young
2010-01-01
Full Text Available Abstract We demonstrate the synthesis of monolayer graphene using thermal chemical vapor deposition and successive transfer onto arbitrary substrates toward transparent flexible conductive film application. We used electron-beam-deposited Ni thin film as a synthetic catalyst and introduced a gas mixture consisting of methane and hydrogen. To optimize the synthesis condition, we investigated the effects of synthetic temperature and cooling rate in the ranges of 850–1,000°C and 2–8°C/min, respectively. It was found that a cooling rate of 4°C/min after 1,000°C synthesis is the most effective condition for monolayer graphene production. We also successfully transferred as-synthesized graphene films to arbitrary substrates such as silicon-dioxide-coated wafers, glass, and polyethylene terephthalate sheets to develop transparent, flexible, and conductive film application.
International Nuclear Information System (INIS)
Ioki, Kimihiro; Onozuka, Masanori; Ikeda, Takeshi; Akiba, Masato.
1994-01-01
Unidirectional C/C composite named 'MFC-1' with high conductivity was developed, and full-scale armor tiles were fabricated. The thermal conductivity in the direction perpendicular to the plasma-side surface is more than 300-500 W/m·degC, which is higher than those of other C/C composites ever made, even superior to that of pyrolytic carbon. It was shown by high heat load tests done using an electron beam test facility that the unidirectional C/C composite was very resistant against both surface erosion as well as severe thermal shock. The 'MFC-1' was successfully brazed to copper substrate, and its high thermal shock resistance was observed in heat load tests (20 MW/m 2 , 3s, not cooled). A functionally gradient material has been also developed as compliant layer for the MFC-1 bonded to copper. (author)
Tsukasaki, Hirofumi; Mori, Shigeo; Shiotani, Shinya; Yamamura, Hideyuki; Iba, Hideki
2017-11-01
Crystallization of a precursor Li10GeP2S12 (LGPS) glass electrolyte by heat treatment significantly improves its ionic conductivity. The LGPS crystalline phase obtained by heat treatment above 450 °C shows an ionic conductivity on the order of 10-2 S/cm. To clarify the correlation between the crystallization behavior of precursor LGPS glasses and ionic conductivity, we developed an observation technique to visualize precipitated nanocrystallites and a new method to evaluate the crystallization degree via transmission electron microscopy (TEM). In-situ TEM observation revealed that LGPS nanocrystallites precipitated above 450 °C and their size remained fundamentally intact during heating. That is, the crystallization behavior could be characterized by only the formation of LGPS nanocrystallites in an amorphous matrix. In addition, the crystallization degree was quantitatively evaluated from electron diffraction patterns. The crystallization degree remarkably increased at around 450 °C and reached more than 60% above 450 °C. Based on these results, a high ionic conductivity of approximately 1.0 × 10-2 S/cm was confirmed to be directly associated with the appearance of the LGPS crystalline phase.
High Curie temperature Bi(1.85)Mn(0.15)Te3 nanoplates.
Cheng, Lina; Chen, Zhi-Gang; Ma, Song; Zhang, Zhi-dong; Wang, Yong; Xu, Hong-Yi; Yang, Lei; Han, Guang; Jack, Kevin; Lu, Gaoqing Max; Zou, Jin
2012-11-21
Bi(1.85)Mn(0.15)Te(3) hexagonal nanoplates with a width of ~200 nm and a thickness of ~20 nm were synthesized using a solvothermal method. According to the structural characterization and compositional analysis, the Mn(2+) and Mn(3+) ions were found to substitute Bi(3+) ions in the lattice. High-level Mn doping induces significant lattice distortion and decreases the crystal lattice by 1.07% in the a axis and 3.18% in the c axis. A high ferromagnetic state with a Curie temperature of ~45 K is observed in these nanoplates due to Mn(2+) and Mn(3+) ion doping, which is a significant progress in the field of electronics and spintronics.
Energy Technology Data Exchange (ETDEWEB)
Nakao, Shoichiro, E-mail: tg-s-nakao@newkast.or.j [Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan); Department of Chemistry, University of Tokyo, Tokyo 113-0033 (Japan); Yamada, Naoomi [Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan); Hitosugi, Taro [Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan); Advanced Institute for Materials Research, Tohoku University, Sendai 980-8577 (Japan); Hirose, Yasushi; Shimada, Toshihiro; Hasegawa, Tetsuya [Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan); Department of Chemistry, University of Tokyo, Tokyo 113-0033 (Japan)
2010-03-31
We discuss the fabrication of highly conductive Ta-doped SnO{sub 2} (Sn{sub 1-x}Ta{sub x}O{sub 2}; TTO) thin films on glass by pulse laser deposition. On the basis of the comparison of X-ray diffraction patterns and resistivity ({rho}) values between epitaxial films and polycrystalline films deposited on bare glass, we proposed the use of seed-layers for improving the conductivity of the TTO polycrystalline films. We investigated the use of rutile TiO{sub 2} and NbO{sub 2} as seed-layers; these are isostructural materials of SnO{sub 2,} which are expected to promote epitaxial-like growth of the TTO films. The films prepared on the 10-nm-thick seed-layers exhibited preferential growth of the TTO (110) plane. The TTO film with x = 0.05 on rutile TiO{sub 2} exhibited {rho} = 3.5 x 10{sup -4} {Omega} cm, which is similar to those of the epitaxial films grown on Al{sub 2}O{sub 3} (0001).
In-situ pH measurements and sample analyses in glass-iron-clay systems at 90 deg. C and 150 deg. C
International Nuclear Information System (INIS)
Rozsypal, Christophe; Mosser-Ruck, Regine; Truche, Laurent; Pignatelli, Isabella; Randi, Aurelien; Bartier, Daniele; Cathelineau, Michel; Michau, Nicolas
2012-01-01
Document available in extended abstract form only. The long term repository of long life and high activity radioactive waste consists in the burial of steel overpacks of vitrified waste in a clay-stone. As the natural interstitial fluid of the clay-stone is a potential corrosion enhancer for the containers, the viability of the repository requires previous data acquisition on the interactions between clays, water, metallic iron, and glass. A set of experiments have been performed in autoclaves at 90 deg. C (thermal peak of the site) in order to follow the pH evolution and to characterize fluids with time and solids at the end of the experiments. Another set of experiments at 150 deg. C have also been carried out in order to increase the rates of the involved chemical reactions and mineralogical transformations. The objectives of those two sets of experiments were to measure the in-situ pH, to study how it was influenced by various parameters, such as the presence of glass and/or iron, to estimate the increase of the CO 2 and H 2 pressures, and to analyze gas and liquids taken in the course or at the end of experiments and solids recovered at the end of the experiments. The initial aqueous solution simulating the natural interstitial fluid was made of 22 mM of sodium, 4 mM of calcium, 29.75 mM of chloride, and 0.25 mM of bromide as a tracer. The initial solution/clay mass ratio was 10 for all the experiments, the metallic iron/clay or glass/clay mass ratios were 0.1 or 0. The list of the experiments and their characteristics is given in Table (1). The first results concern the evolution of the in-situ pH during the A90pH experiment and are reported on Figure (1). The measurements started after a 48 hours stabilization time of the pH probe. The pH seemed to tend reaching a plateau after several weeks. (authors)
PLUTONIUM SOLUBILITY IN HIGH-LEVEL WASTE ALKALI BOROSILICATE GLASS
Energy Technology Data Exchange (ETDEWEB)
Marra, J.; Crawford, C.; Fox, K.; Bibler, N.
2011-01-04
The solubility of plutonium in a Sludge Batch 6 (SB6) reference glass and the effect of incorporation of Pu in the glass on specific glass properties were evaluated. A Pu loading of 1 wt % in glass was studied. Prior to actual plutonium glass testing, surrogate testing (using Hf as a surrogate for Pu) was conducted to evaluate the homogeneity of significant quantities of Hf (Pu) in the glass, determine the most appropriate methods to evaluate homogeneity for Pu glass testing, and to evaluate the impact of Hf loading in the glass on select glass properties. Surrogate testing was conducted using Hf to represent between 0 and 1 wt % Pu in glass on an equivalent molar basis. A Pu loading of 1 wt % in glass translated to {approx}18 kg Pu per Defense Waste Processing Facility (DWPF) canister, or about 10X the current allowed limit per the Waste Acceptance Product Specifications (2500 g/m{sup 3} of glass or about 1700 g/canister) and about 30X the current allowable concentration based on the fissile material concentration limit referenced in the Yucca Mountain Project License Application (897 g/m{sup 3}3 of glass or about 600 g Pu/canister). Based on historical process throughput data, this level was considered to represent a reasonable upper bound for Pu loading based on the ability to provide Pu containing feed to the DWPF. The task elements included evaluating the distribution of Pu in the glass (e.g. homogeneity), evaluating crystallization within the glass, evaluating select glass properties (with surrogates), and evaluating durability using the Product Consistency Test -- Method A (PCT-A). The behavior of Pu in the melter was evaluated using paper studies and corresponding analyses of DWPF melter pour samples.The results of the testing indicated that at 1 wt % Pu in the glass, the Pu was homogeneously distributed and did not result in any formation of plutonium-containing crystalline phases as long as the glass was prepared under 'well-mixed' conditions
Plutonium Solubility In High-Level Waste Alkali Borosilicate Glass
International Nuclear Information System (INIS)
Marra, J.; Crawford, C.; Fox, K.; Bibler, N.
2011-01-01
The solubility of plutonium in a Sludge Batch 6 (SB6) reference glass and the effect of incorporation of Pu in the glass on specific glass properties were evaluated. A Pu loading of 1 wt % in glass was studied. Prior to actual plutonium glass testing, surrogate testing (using Hf as a surrogate for Pu) was conducted to evaluate the homogeneity of significant quantities of Hf (Pu) in the glass, determine the most appropriate methods to evaluate homogeneity for Pu glass testing, and to evaluate the impact of Hf loading in the glass on select glass properties. Surrogate testing was conducted using Hf to represent between 0 and 1 wt % Pu in glass on an equivalent molar basis. A Pu loading of 1 wt % in glass translated to ∼18 kg Pu per Defense Waste Processing Facility (DWPF) canister, or about 10X the current allowed limit per the Waste Acceptance Product Specifications (2500 g/m 3 of glass or about 1700 g/canister) and about 30X the current allowable concentration based on the fissile material concentration limit referenced in the Yucca Mountain Project License Application (897 g/m 3 3 of glass or about 600 g Pu/canister). Based on historical process throughput data, this level was considered to represent a reasonable upper bound for Pu loading based on the ability to provide Pu containing feed to the DWPF. The task elements included evaluating the distribution of Pu in the glass (e.g. homogeneity), evaluating crystallization within the glass, evaluating select glass properties (with surrogates), and evaluating durability using the Product Consistency Test -- Method A (PCT-A). The behavior of Pu in the melter was evaluated using paper studies and corresponding analyses of DWPF melter pour samples.The results of the testing indicated that at 1 wt % Pu in the glass, the Pu was homogeneously distributed and did not result in any formation of plutonium-containing crystalline phases as long as the glass was prepared under 'well-mixed' conditions. The incorporation of 1 wt
Klein, Amanda H; Vyshnevska, Alina; Hartke, Timothy V; De Col, Roberto; Mankowski, Joseph L; Turnquist, Brian; Bosmans, Frank; Reeh, Peter W; Schmelz, Martin; Carr, Richard W; Ringkamp, Matthias
2017-05-17
Voltage-gated sodium (Na V ) channels are responsible for the initiation and conduction of action potentials within primary afferents. The nine Na V channel isoforms recognized in mammals are often functionally divided into tetrodotoxin (TTX)-sensitive (TTX-s) channels (Na V 1.1-Na V 1.4, Na V 1.6-Na V 1.7) that are blocked by nanomolar concentrations and TTX-resistant (TTX-r) channels (Na V 1.8 and Na V 1.9) inhibited by millimolar concentrations, with Na V 1.5 having an intermediate toxin sensitivity. For small-diameter primary afferent neurons, it is unclear to what extent different Na V channel isoforms are distributed along the peripheral and central branches of their bifurcated axons. To determine the relative contribution of TTX-s and TTX-r channels to action potential conduction in different axonal compartments, we investigated the effects of TTX on C-fiber-mediated compound action potentials (C-CAPs) of proximal and distal peripheral nerve segments and dorsal roots from mice and pigtail monkeys ( Macaca nemestrina ). In the dorsal roots and proximal peripheral nerves of mice and nonhuman primates, TTX reduced the C-CAP amplitude to 16% of the baseline. In contrast, >30% of the C-CAP was resistant to TTX in distal peripheral branches of monkeys and WT and Na V 1.9 -/- mice. In nerves from Na V 1.8 -/- mice, TTX-r C-CAPs could not be detected. These data indicate that Na V 1.8 is the primary isoform underlying TTX-r conduction in distal axons of somatosensory C-fibers. Furthermore, there is a differential spatial distribution of Na V 1.8 within C-fiber axons, being functionally more prominent in the most distal axons and terminal regions. The enrichment of Na V 1.8 in distal axons may provide a useful target in the treatment of pain of peripheral origin. SIGNIFICANCE STATEMENT It is unclear whether individual sodium channel isoforms exert differential roles in action potential conduction along the axonal membrane of nociceptive, unmyelinated peripheral nerve
International Nuclear Information System (INIS)
Steen, M.
1989-01-01
A suspension of glass fibers in alcohol has been used to investigate a upward vertical developing pipe flow. The refractive index of the alcohol was matched to that of the glass fibers, making the whole suspension transparent. Laser Doppler Anemometry (LDA) was applied, and fluid velocities could then be measured for consistencies up to c = 12 g/l. Radial profiles of axial U-velocity and turbulence spectra have been recorded at various positions (z/D = 2, 5, 36) downstream of an orifice (step) with 64% open area. Measurements were taken for different consistencies (c = 1.2, 12 g/l), fiber lengths (l = 1, 3 mm) and Reynolds numbers (R e = 8.5 ⋅ 10 3 , 6.5 ⋅ 10 4 ). The fiber crowding factor (n f ) has been used to discuss the observed effects of the present fibers on momentum transfer and turbulence structure. The results show both an increase (l= 1 mm, c= 1.2 g/l) and decrease (l=3 mm, c = 12 g/l) in turbulence levels in the presence of fibers. Suspensions with long fibers at the highest consistency show plug flow in parts of the core. This causes damping of the turbulence mainly at smaller length scales. For short fibers at low consistency, the increased turbulent energy was mainly observed at small length scales in the spectrum. (author)
Bouclier, Roger; Hoch, M; Million, G; Ropelewski, L; Sauli, F; Sharma, A; Shekhtman, L
1996-01-01
The present study aims to create reproducible and controlled polluted conditions in a clean gas system in order to be able to compare the behaviour of an MSGC plate operating with Ar-DME and Ne-DME gas mixtures. The achievement of such conditions seems to be more difficult than would be expected from the long term behaviour shown by MSGCs years ago in the same gas system. The pollutants present in the gas rack, possibly originating the dramatic losses reported then, are not present anymore in the gas system after four years of continuous operation with the Ar-DME mixture. The use of new and supposedly clean stainless steel gas pipes of smaller diameter might affect the chamber operation, although the lines are rapidly cleaned ( ~weeks) after being flushed with DME. The back-diffusion of pollutants due to the use of a Si-Oil bubbler affects dramatically the chamber operation, which behave s slightly better with argon than with neon; in view of the other variables, we do not consider this difference as signific...
Bending strength of glass-ceramics based on 3CaO.P2O5-SiO2-MgO glass system
International Nuclear Information System (INIS)
Daguano, J.K.M.F.; Suzuki, P.A.; Santos, C.; Fernandes, M.H.V.; Elias, C.N.
2009-01-01
In this work, the Modulus of Rupture of bioactive glass-ceramic based on 3CaO.P 2 O 5 -SiO 2 -MgO system was investigated, aiming its use in bone-restorations. The mechanical property was correlated with microstructural and crystallographic features of this material. High-purity starting-powders, CaCO 3 , SiO 2 , MgO, Ca (H 2 PO 4 ).H 2 O, were used in this study. The powders were mixed in a stoichiometric ratio, using planetary ball-mill. The suspensions were dried, sieved and melted at 1600 deg C, for 4h. The casting ones were cooled quickly until annealing temperature 700 deg C, in which remained for 2h, with controlled cooling-rate until ambient temperature. Bulks of glass were heat-treated with temperatures varying between 700 deg C and 1100 deg C, for 4h, being after that, cooled at 3 deg C/min. Bioactive glass and glass-ceramic were characterized by HRXRD (high resolution X-ray diffraction), where whitlockite was main phase. The microstructure was analyzed by scanning electronic microscopy. Modulus of Rupture was determined by four-point bending testing using specimens of 1.5 x 2 x 25 mm and glasses presented strength near to 70MPa, while glass ceramics treated at 975 deg C-4h, presented bending strength of 120MPa. (author)
Complex Heat Capacity of Lithium Borate Glasses Studied by Modulated DSC
International Nuclear Information System (INIS)
Matsuda, Yu; Ike, Yuji; Matsui, Chihiro; Kodama, Masao; Kojima, Seiji
2006-01-01
Complex heat capacity, C p * = C p ' - iC p '', of lithium borate glasses Li2O·(1-x)B2O3 (x = 0.00 - 0.33) has been investigated by Modulated DSC (MDSC). We have successfully observed the frequency dependent C p * by MDSC in the frequency range 0.01 to 0.1 Hz, and the average relaxation time of glass transition has been determined as a function of temperature. Moreover, the composition dependence of the thermal properties has been investigated. The calorimetric glass transition temperatures become higher with the increase of concentration of Li2O and show the board maximum around x = 0.26-0.28. The width of glass transition region becomes narrower as Li2O increases. These results relate to the change of the fragility of the system. It has been proven that the complex heat capacity spectroscopy by MDSC is a powerful tool to investigate the glass transition phenomena
Evaluation of 3D printed optofluidic smart glass prototypes.
Wolfe, Daniel; Goossen, K W
2018-01-22
Smart glass or smart windows are an innovative technology used for thermal management, energy efficiency, and privacy applications. Notable commercially available smart glass relies on an electric stimuli to modulate the glass from a transparent to a translucent mode of operation. However, the current market technologies, such as electrochromic, polymer dispersed liquid crystal, and suspended particle devices are expensive and suffer from solar absorption, poor transmittance modulation, and in some cases, continuous power consumption. The authors of this paper present a novel optofluidic smart glass prototype capable of modulating visible light transmittance from 8% to 85%.
Directory of Open Access Journals (Sweden)
Reza Bagheri
2017-02-01
Full Text Available In this work, linear and mass attenuation coefficients, effective atomic number and electron density, mean free paths, and half value layer and 10th value layer values of barium–bismuth–borosilicate glasses were obtained for 662 keV, 1,173 keV, and 1,332 keV gamma ray energies using MCNP-4C code and XCOM program. Then obtained data were compared with available experimental data. The MCNP-4C code and XCOM program results were in good agreement with the experimental data. Barium–bismuth–borosilicate glasses have good gamma ray shielding properties from the shielding point of view.
International Nuclear Information System (INIS)
Assem, E E
2005-01-01
Two glass samples were prepared according to the molar formula (20%X-40%B 2 O 3 -40%SiO 2 ), where X = CaO or CaF 2 . The glass was melted at 1300 deg. C for 3 h until homogenous glass was obtained. The glass samples were heat-treated at 700 deg. C for 2 h and at 850 deg. C for different times. The green glass obtained has low dielectric constant and positive magnetic susceptibility. The molar volume, scanning electron microscope and differential thermal analysis studies showed that the crystallization rate increases with an increase in the sintering time. The replacement of CaO by CaF 2 improves the physical properties of the glass. The existence of fluorine ions increases the electrical conductivity, magnetic susceptibility, molar volume, dielectric constant and effective overall reaction rate (κ). All measured properties have a random behaviour with sintering time due to phase separation and asymmetry of crystallization
Energy Technology Data Exchange (ETDEWEB)
Ioki, Kimihiro (Mitsubishi Atomic Power Industries, Inc., Tokyo (Japan)); Onozuka, Masanori; Ikeda, Takeshi; Akiba, Masato
1994-03-01
Unidirectional C/C composite named 'MFC-1' with high conductivity was developed, and full-scale armor tiles were fabricated. The thermal conductivity in the direction perpendicular to the plasma-side surface is more than 300-500 W/m[center dot]degC, which is higher than those of other C/C composites ever made, even superior to that of pyrolytic carbon. It was shown by high heat load tests done using an electron beam test facility that the unidirectional C/C composite was very resistant against both surface erosion as well as severe thermal shock. The 'MFC-1' was successfully brazed to copper substrate, and its high thermal shock resistance was observed in heat load tests (20 MW/m[sup 2], 3s, not cooled). A functionally gradient material has been also developed as compliant layer for the MFC-1 bonded to copper. (author).
Energy Technology Data Exchange (ETDEWEB)
Jaiswal, Nandini; Gupta, Brijesh; Kumar, Devendra; Parkash, Om, E-mail: oprakash.cer@itbhu.ac.in
2015-06-05
Highlights: • Bi{sub 0.8}Er{sub 0.2}O{sub 1.5} doped Ce{sub 0.85}La{sub 0.15}O{sub 1.925} system has been studied for the first time. • Composition 0.5ECLO has maximum conductivity. • Its conductivity is almost equal to that of SDC and GDC. • This makes 0.5ECLO is a potential candidate as a solid electrolyte for ITSOFCs. - Abstract: Nanosized powders of compositions, Bi{sub 0.8}Er{sub 0.2}O{sub 1.5} (ESB) and Ce{sub 0.85}La{sub 0.15}O{sub 1.925} (CLO) have been prepared using citrate–nitrate auto combustion method. ESB added CLO (ECLO) samples have been prepared by mixing nanosized CLO powder with 0.5, 1, 2 and 3 wt.% of ESB. X-ray diffraction patterns confirm that all the samples are single phase having cubic fluorite structure similar to CeO{sub 2}. Density of Ce{sub 0.85}La{sub 0.15}O{sub 1.925} increases with increasing ESB content. All the samples have been sintered at 1350 °C. All the ECLO samples have density more than 97% of the theoretical value. Field emission scanning electron microscope images show dense microstructure with distinct grains and grain boundaries. Impedance measurements have been made in the temperature range 200–700 °C in air. Addition of ESB increases the conductivity of the bulk as well as of grain boundaries. Ce{sub 0.85}La{sub 0.15}O{sub 1.925} with 0.5 wt.% of ESB exhibits the maximum conductivity 1.41 × 10{sup −2} S cm{sup −1} at 600 °C of all the compositions. This value is one order of magnitude higher than the conductivity of Ce{sub 0.85}La{sub 0.15}O{sub 1.925} (1.99 × 10{sup −3} S cm{sup −1})
The formation of crystals in glasses containing rare earth oxides
Energy Technology Data Exchange (ETDEWEB)
Fadzil, Syazwani Mohd [Pohang University of Science and Technology (POSTECH), Pohang (Korea, Republic of); Hrma, Pavel [Pohang University of Science and Technology (POSTECH), Pohang, South Korea and Pacific Northwest National Laboratory, Richland, Washington (United States); Crum, Jarrod [Pacific Northwest National Laboratory, Richland, Washington (United States); Siong, Khoo Kok; Ngatiman, Mohammad Fadzlee; Said, Riduan Mt [National University of Malaysia, Bandar Baru Bangi, Selangor (Malaysia)
2014-02-12
Korean spent nuclear fuel will reach the capacity of the available temporary storage by 2016. Pyroprocessing and direct disposal seems to be an alternative way to manage and reuse spent nuclear fuel while avoiding the wet reprocessing technology. Pyroprocessing produces several wastes streams, including metals, salts, and rare earths, which must be converted into stabilized form. A suitable form for rare earth immobilization is borosilicate glass. The borosilicate glass form exhibits excellent durability, allows a high waste loading, and is easy to process. In this work, we combined the rare earths waste of composition (in wt%) 39.2Nd{sub 2}O{sub 3}–22.7CeO{sub 2}–11.7La{sub 2}O{sub 3}–10.9PrO{sub 2}–1.3Eu{sub 2}O{sub 3}–1.3Gd{sub 2}O{sub 3}–8.1Sm{sub 2}O{sub 3}–4.8Y{sub 2}O{sub 3} with a baseline glass of composition 60.2SiO{sub 2}–16.0B{sub 2}O{sub 3}–12.6Na{sub 2}O–3.8Al{sub 2}O{sub 3}–5.7CaO–1.7ZrO{sub 2}. Crystallization in waste glasses occurs as the waste loading increases. It may produce complicate glass processing and affect the product quality. To study crystal formation, we initially made glasses containing 5%, 10% and 15% of La{sub 2}O{sub 3} and then glasses with 5%, 10% and 15% of the complete rare earth mix. Samples were heat-treated for 24 hours at temperatures 800°C to 1150°C in 50°C increments. Quenched samples were analyzed using an optical microscope, scanning electron microscope with energy dispersive spectroscopy, and x-ray diffraction. Stillwellite (LaBSiO{sub 5}) and oxyapatite (Ca{sub 2}La{sub 8}Si{sub 6}O{sub 26}) were found in glasses containing La{sub 2}O{sub 3}, while oxyapatite (Ca{sub 2}La{sub 8}Si{sub 6}O{sub 26} and NaNd{sub 9}Si{sub 6}O{sub 26}) precipitated in glasses with additions of mixed rare earths. The liquidus temperature (T{sub L}) of the glasses containing 5%, 10% and 15% La{sub 2}O{sub 3} were 800°C, 959°C and 986°C, respectively; while T{sub L} was 825°C, 1059°C and 1267°C for glasses
12C-12C total and reaction cross-section between 6 and 85 MeV/A from an optical model analysis
International Nuclear Information System (INIS)
Brandan, M.E.
1982-07-01
Values of σsub(R) and σsub(T) are obtained from an optical model analysis of 12 C- 12 C elastic scattering data between 6 and 85 MeV/A. They confirm the general trends predicted by DeVries and collaborators but show discrepancies at the region of the maxima. The o.m. analysis indicates a significant decrease of the real potential strength with energy
International Nuclear Information System (INIS)
Varela, M.E.; Mosbah, M.; Metrich, N.; Duraud, J.P.; Kurat, G.
1999-01-01
Proton-induced X-ray emission (PIXE) and light element analysis have been performed with the nuclear microprobe at the Laboratoire Pierre Suee (Saclay-France) in glass inclusions of the carbonaceous chondrites: Allende, Kaba and Renazzo, and in the achondrite meteorite: Chassigny. Carbon contents in olivine of chondrules are below the nuclear reactions analysis (NRA) detection limit, however, glasses from glass inclusions hosted by these grains, contain an appreciable and highly variable quantities of carbon (200-1600 ppm). This could indicate variable amounts of C trapped during glass inclusion formation. On the other hand, nitrogen is present in highly variable amounts in glasses of both, chondrites and achondrites minerals. Its abundance, correlated with depth from the section surface which suggests loss of N during analyses and therefore the possible existence of a very mobile (volatile?) species. A chondritic Rb/Sr and K/Rb ratio obtained by PIXE analyses in the glass-bearing inclusions of the Chassigny meteorite points towards a primitive source for the glass precursor of Chassigny inclusions
International Nuclear Information System (INIS)
Advocat, T.; Ghaleb, D.; Vernaz, E.
1993-02-01
The initial dissolution rate of inactive R7T7 reference glass was measured at 90 deg C in dilute aqueous solutions first at unspecified pH, then with imposed pH values. In distilled water, R7T7 glass corrosion initially involved preferential extraction of boron and network modifier elements (Li, Na, Ca) as long as the solution pH remained acid. When the solution pH became alkaline, glass dissolution was stoichiometric. These two mechanisms were confirmed by dissolution tests in aqueous solutions at imposed pH values under acid and alkaline conditions. The initial dissolution rate r 0 in mole.cm -3 .s -1 also increased significantly in alkaline media when the pH of the aqueous phase increased: in slightly acid media, selective glass dissolution formed a residual, de-alkalinized, hydrated glass that was characterized by transmission electron microscopy and secondary ion mass spectrometry. Under steady-state dissolution conditions, the initial glass corrosion rate (in mole.cm -3 .s -1 ) was: in acid and alkaline media, amorphous and crystallized alteration products formed after complete dissolution of the silicated glass network. The first products formed consisted mainly of Zr, Rare Earths, Fe and Al. (author). 67 refs., 29 figs., 26 tabs., 21 plates
Chemical durability of lead borosilicate glass matrix under simulated geological conditions
International Nuclear Information System (INIS)
Yalmali, Vrunda S.; Deshingkar, D.S.; Wattal, P.K.
2002-03-01
The lead borosilicate glass has been developed for vitrification of High Level Waste (HLW) stored at Trombay. This waste is contains especially high contents of sodium, uranium sulphate and iron. The glasses containing HLW are to be ultimately disposed into deep geological repositories. Long term leach rates under simulated geological conditions need to be evaluated for glass matrix. Studies were taken up to estimate the lead borosilicate glass WTR-62 matrix for chemical durability in presence of synthetic ground water. The leachant selected was based on composition of ground water sample near proposed repository site. In the first phase of these tests, the experiments were conducted for short duration of one and half month. The leaching experiments were conducted in presence of a) distilled water b) synthetic ground water c) synthetic ground water containing granite, bentonite and ferric oxide and d) synthetic ground water containing humic acid at 100 0 C. The leachate samples were analysed by pHmetry , ion chromatography and UV -VIS spectrophotometry. The normalised leach rates for lead borosilicate WTR- 62 glass matrix based on silica, boron and sulphate analyses of leachates were of the order of 10 -3 to 10 -5 gms/cm 2 /day for 45 days test period in presence of synthetic ground water as well as in presence of other materials likely to be present along with synthetic ground water. These rates are comparable to those of sodium borsilicate glass matrices reported in literature. It is known that the leach rates of glass matrix decrease with longer test durations due to formation of leached layer on its surface. The observed leach rates of lead borosilicate WTR- 62 glass matrix for 45 day tests under simulated geological conditions were found to be sufficiently encouraging to take up long term tests for evaluating its performances under repository conditions. (author)
Rare earth ion controlled crystallization of mica glass-ceramics
International Nuclear Information System (INIS)
Garai, Mrinmoy; Karmakar, Basudeb
2016-01-01
In understanding the effects of rare earth ions to control the crystallization and microstructure of alkaline boroaluminosilicate system, the CeO_2, Nd_2O_3, Sm_2O_3 and Gd_2O_3 doped K_2O−MgO−B_2O_3−Al_2O_3−SiO_2−F glasses were synthesized by melt-quenching at 1550 °C. Higher density (2.82–3.06 g cm"−"3) and thermal stability (glass phase) is experiential on addition of rare earth content, which also affects in increasing the glass transition temperature (T_g) and crystallization temperature (T_c). Decrease of thermal expansion in glasses with rare earth ion content is maintained by the stabilization of glass matrix owing to their large cationic field strength. A significant change in the non-isothermal DSC thermogram observed at 750–1050 °C is attributed to fluorophlogopite crystallization. Opaque glass-ceramics were prepared from such glasses by single step heat-treatment at 1050 °C; and the predominant crystalline phases are identified as fluorophlogopite mica, KMg_3(AlSi_3O_1_0)F_2 by XRD and EDX analysis. The compact glass-ceramic microstructure by the agglomeration of fluorophlogopite mica crystallites (crystal size ∼ 100–500 nm, FESEM) is achieved in attendance of rare earth ion; and such microstructure controlled the variation of density, thermal expansion and microhardness value. Higher thermal expansion (11.11–14.08 × 10"−"6/K at 50–800 °C and 50–900 °C) of such glass-ceramics approve that these rare earth containing glasses can be useful for high temperature vacuum sealing application with metal or solid electrolyte. The increase of Vickers microhardness (5.27–5.61 GPa) in attendance of rare earth ions is attributed to the compact crystallinity of fluorophlogopite mica glass-ceramic microstructure. - Highlights: • Synthesis of rare earth oxide doped alkaline boroaluminosilicate glasses. • Development of opaque fluorophlogopite mica glass-ceramics by single-step heat treatment. • Nanocrystalline glass
Comprehensive thermal and structural characterization of antimony-phosphate glass
Moustafa, S. Y.; Sahar, M. R.; Ghoshal, S. K.
For the first time, we prepare new ternary glass systems of composition (95-x)Sb2O3-xP2O5-5MgO, where x = 45, 40, 35 mol%; (85-x)Sb2O3-xP2O5-15MgO, where x = 55, 35, 25 mol%; (75-x)Sb2O3-xP2O5-25MgO, where x = 45, 35, 25 mol%; and 60Sb2O3-(40-x)P2O5-xMgO, where x = 10, 20 mol% via melt-quenching method. Synthesized glasses are characterized using XRD, FESEM, EDX, and TG/DTA measurements. The influence of varying modifier concentrations on their thermal properties is evaluated. The XRD patterns confirmed the amorphous nature of samples. SEM images demonstrated interesting phase formation with ribbons-like texture. Five crystalline phases are evidenced in the ternary diagram which are antimony phosphate and antimony orthophosphate as major phases as well as magnesium phosphate, magnesium cyclo-tetraphosphate and cervantite as minor phases. EDX spectra detected the right elemental traces. Detailed thermal analysis of these glasses revealed their high-molecular polymer character for Sb2O3 content greater than 50 mol%. Three different glass transition temperatures are achieved around 276, 380-381 and 422-470 °C depending on the composition. Furthermore, the solidus and liquidus temperature are found to decrease with increasing Sb2O3 and increases for MgO contents till 15 mol% and then decrease, where the lowest recorded solidus temperature is 426 °C. This observation may open up new research avenues for antimony based ternary glasses and an exploitation of the derived results for optoelectronics applications, photonic devices and non-linear optical devices.
Synthesis of nucleated glass-ceramics using oil shale fly ash
International Nuclear Information System (INIS)
Luan Jingde; Li Aimin; Su Tong; Cui Xiaobo
2010-01-01
Nucleated glass-ceramics materials were produced from oil shale fly ash obtained from Huadian thermal power plant in China with the addition of analytic reagent CaO. On basis of differential thermal analysis (DTA) results, the nucleation and crystallization temperature of two parent glass samples with different alkalinity (Ak=m CaO /m SiO 2 ) were identified as Tn 1 = 810 deg. C, Tc 1 = 956 deg. C and Tn 2 = 824 o C, Tc 2 = 966 deg. C, respectively. X-ray diffraction (XRD) analysis of the produced nucleated glass-ceramics materials revealed that there was a coexistence phenomenon of multi-crystalline phase and the main crystalline phase was anorthite ([Ca,Na][AI,Si] 2 Si 2 O 8 ). The microstructure of the glass-ceramics materials was examined by scanning electron microscope (SEM). SEM observation indicated that there was an increase in the quantity of sphere-shaped crystals when crystallization time increased. Furthermore, the increase of alkalinity caused more amorphous phase occurring in glass-ceramics materials. Through the tests of physical and mechanical properties, the glass-ceramics materials with more crystalline phase and fine microstructure had high density, fine performance of resisting compression (328.92 MPa) and negligible water absorption. Through chemical resistance tests, the glass-ceramics samples showed strong corrosion resistance. Overall results indicated that it was a feasible attempt to produce nucleated glass-ceramics materials for building and decorative materials from oil shale fly ash.
Oxide glass to high temperature ceramic superconductors - a novel route
International Nuclear Information System (INIS)
Chaudhuri, B.K.; Som, K.K.
1992-01-01
Recently it has been discovered that many of transition metal oxide (TMO) glasses like Bi-Sr-Ca-Cu-O, Y-Ba-Cu-O, Bi-Pb-Sr-Ca-Cu-O etc. can be directly converted to the corresponding high temperature superconducting phases by properly annealing the respective glasses. In this review recent developements in this field are summarised. The structural, electrical, dielectrical, magnetic, optical, and other properties of these new type of (TMO) glass systems have been elucidated comparing them with the corresponding results of already known (TMO) glasses which do not become superconductors on annealing above their glass transition temperatures (T g ). The electrical properties of this novel glass system have been analysed with reference to the various existing theoretical models based on polaron hopping conduction mechanism. The electrical, magnetic, and other properties of the respective superconductors obtained from their corresponding glass phases by annealing above (T g ) and the possibility of drawing wires, ribbons etc. from these glass matrices and then converting them to their high T c superconducting phases have also been discussed. (author). 107 refs., 32 figs., 5 tabs
International Nuclear Information System (INIS)
Godon, N.; Vernaz, E.Y.
1992-01-01
Recent glass dissolution experiments, conducted at 90 deg C in the presence of potential backfill materials, indicate remarkably faster glass corrosion in the presence of clay, compared to tests where the glass is leached either alone or with alternative backfill materials. This effect correlates with the clay content in the backfill, and may be attributed to the removal of silica from solution. Scorpion, or dissolution with reprecipitation of a silica-rich clay, have been proposed as possible mechanisms for the silica consumption. The results of some experiments have been tested against a glass dissolution model, in which a widely used kinetic equation for glass corrosion is coupled with diffusive silica transport through a single porosity, linearly sorbing medium, which represents the backfilling. Because the glass corrosion rates imposed by the kinetic equation are inversely proportional to the silicic acid concentration of the leachant contacting the glass, the model predicts enhanced glass dissolution if silica is sorbed by the porous medium. The experimental data proved to be consistent with the predicted enhancement of the glass dissolution. Moreover, the model-estimated distribution coefficients for silica sorption (K d ) fall within the range of values extracted from available literature data, thus supporting the hypothesis that the observed high corrosion rates are due to sorption of silica on the clay mineral surfaces. (author)
Interface Resistance between FeCr Interconnects and La0.85Sr0.15Mn1.1O3
DEFF Research Database (Denmark)
Mikkelsen, Lars; Neufeld, Kai; Hendriksen, Peter Vang
2009-01-01
The long term oxidation behaviour and the electrical interface resistance between FeCr interconnects and La0,85Sr0,15Mn1,1O3 plates was studied by a DC four-point method in air at 750{degree sign}C for 10000 h. The tested FeCr alloys were: Crofer 22 APU, Sanergy HT, Plansee IT10, Plansee IT11, an....... Low degradation rates of less than 1 mcm2/1000 h were measured on all interfaces. The microstructure analysis showed that a duplex Cr2O3-(Mn,Co,Cr)3O4 oxide scale with a thickness of 3-5 µm had evolved on the alloys....
Hale, Benjamin G; Batty, Ian H; Downes, C Peter; Randall, Richard E
2008-01-18
Influenza A virus NS1 protein stimulates host-cell phosphoinositide 3-kinase (PI3K) signaling by binding to the p85beta regulatory subunit of PI3K. Here, in an attempt to establish a mechanism for this activation, we report further on the functional interaction between NS1 and p85beta. Complex formation was found to be independent of NS1 RNA binding activity and is mediated by the C-terminal effector domain of NS1. Intriguingly, the primary direct binding site for NS1 on p85beta is the inter-SH2 domain, a coiled-coil structure that acts as a scaffold for the p110 catalytic subunit of PI3K. In vitro kinase activity assays, together with protein binding competition studies, reveal that NS1 does not displace p110 from the inter-SH2 domain, and indicate that NS1 can form an active heterotrimeric complex with PI3K. In addition, it was established that residues at the C terminus of the inter-SH2 domain are essential for mediating the interaction between p85beta and NS1. Equivalent residues in p85alpha have previously been implicated in the basal inhibition of p110. However, such p85alpha residues were unable to substitute for those in p85beta with regards NS1 binding. Overall, these data suggest a model by which NS1 activates PI3K catalytic activity by masking a normal regulatory element specific to the p85beta inter-SH2 domain.
Glass dissolution rate measurement and calculation revisited
Energy Technology Data Exchange (ETDEWEB)
Fournier, Maxime, E-mail: maxime.fournier@cea.fr [CEA, DEN, DTCD, SECM, F-30207, Bagnols sur Cèze (France); Ull, Aurélien; Nicoleau, Elodie [CEA, DEN, DTCD, SECM, F-30207, Bagnols sur Cèze (France); Inagaki, Yaohiro [Department of Applied Quantum Physics & Nuclear Engineering, Kyushu University, Fukuoka, 819-0395 (Japan); Odorico, Michaël [ICSM-UMR5257 CEA/CNRS/UM2/ENSCM, Site de Marcoule, BP17171, F-30207, Bagnols sur Cèze (France); Frugier, Pierre; Gin, Stéphane [CEA, DEN, DTCD, SECM, F-30207, Bagnols sur Cèze (France)
2016-08-01
Aqueous dissolution rate measurements of nuclear glasses are a key step in the long-term behavior study of such waste forms. These rates are routinely normalized to the glass surface area in contact with solution, and experiments are very often carried out using crushed materials. Various methods have been implemented to determine the surface area of such glass powders, leading to differing values, with the notion of the reactive surface area of crushed glass remaining vague. In this study, around forty initial dissolution rate measurements were conducted following static and flow rate (SPFT, MCFT) measurement protocols at 90 °C, pH 10. The international reference glass (ISG), in the forms of powders with different particle sizes and polished monoliths, and soda-lime glass beads were examined. Although crushed glass grains clearly cannot be assimilated with spheres, it is when using the samples geometric surface (S{sub geo}) that the rates measured on powders are closest to those found for monoliths. Overestimation of the reactive surface when using the BET model (S{sub BET}) may be due to small physical features at the atomic scale—contributing to BET surface area but not to AFM surface area. Such features are very small compared with the thickness of water ingress in glass (a few hundred nanometers) and should not be considered in rate calculations. With a S{sub BET}/S{sub geo} ratio of 2.5 ± 0.2 for ISG powders, it is shown here that rates measured on powders and normalized to S{sub geo} should be divided by 1.3 and rates normalized to S{sub BET} should be multiplied by 1.9 in order to be compared with rates measured on a monolith. The use of glass beads indicates that the geometric surface gives a good estimation of glass reactive surface if sample geometry can be precisely described. Although data clearly shows the repeatability of measurements, results must be given with a high uncertainty of approximately ±25%. - Highlights: • Initial dissolution
Analysis of early medieval glass beads - Glass in the transition period
Energy Technology Data Exchange (ETDEWEB)
Smit, Ziga, E-mail: ziga.smit@ijs.si [Faculty of Mathematics and Physics, University of Ljubljana, Jadranska 19, SI-1000 Ljubljana (Slovenia); Jozef Stefan Institute, Jamova 39, P.O.B. 3000, SI-1001 Ljubljana (Slovenia); Knific, Timotej [National Museum of Slovenia, Presernova 20, SI-1000 Ljubljana (Slovenia); Jezersek, David [Jozef Stefan Institute, Jamova 39, P.O.B. 3000, SI-1001 Ljubljana (Slovenia); Istenic, Janka [National Museum of Slovenia, Presernova 20, SI-1000 Ljubljana (Slovenia)
2012-05-01
Glass beads from graves excavated in Slovenia and dated archaeologically to the 7th-10th century AD were analysed by the combined PIXE-PIGE method. The results indicate two groups of glass; natron glass made in the Roman tradition and glass made with alkalis from the ash of halophytic plants, which gradually replaced natron glass after c. 800 AD. The alkalis used in the second group of glass seem to be in close relation to a variant of the Venetian white glass that appeared several centuries later. The origin of this glass may be traced to glass production in Mesopotamia and around the Aral Sea. All the mosaic beads with eye decoration, as well as most of the drawn-segmented and drawn-cut beads analysed, are of plant-ash glass, which confirms their supposed oriental origin.
Shokoufi, Nader; Adeleh, Sara
2017-12-01
We demonstrate that gold nanoparticles (GNPs) immobilized on silanized glass act as an optical sensor that is able to quantify 1-butanethiol vapor. GNPs optical properties in the visible region are dominated by the surface plasmon resonance (SPR). The high affinity between 1-butanethiol and GNPs through Au-s bond leads to change in plasmon feature of GNPs that immobilized on silanized glass and causes absorption decrease at 542 nm in SPR spectrum of GNPs. It can be used as an optical sensor for quantitative detection. In this research, the glass slide surface activated by aminopropyltriethoxysilane (APTES). Spherical GNPs immobilized on silanized glass by silanization agent. The sensor is based on the spectrophotometry and digital color analysis (DCA) through RGB. We monitored R value and linear range 50-700 µM (R 2 = 0.97) with 2.05% relative standard deviation and 26.5 µM value was achieved, for the limit of detection. This method represents advantages of metal gold nanoparticles and solid substrate stability in one package, being inexpensive and low time consuming is another advantage of our method that can be conducted in petrochemical, pharmaceutical industries, and for detection of rotten food in food industries.
International Nuclear Information System (INIS)
Goldschmidt, F.
1991-01-01
The behaviour of borosilicate glasses upon aqueous corrosion is controlled for long periods of time (>10,000 years) by processes which are not directly accessible by means of laboratory experiments. The analogical approach consists here to compare leaching performances between the french nuclear waste glass R7T7 and natural volcanic glasses, basaltic and rhyolitic ones. The three glasses were leached in the same conditions; open system, 90 deg C, initial pH of 9.7. Basaltic and R7T7 glasses having the same kinetic of dissolution, the basaltic glass was chosen as the best analogue. (author). refs., figs., tabs
Purely hopping conduction in c-axis oriented LiNbO3 thin films
Shandilya, Swati; Tomar, Monika; Sreenivas, K.; Gupta, Vinay
2009-05-01
Dielectric constant and ac conductivity of highly c-axis oriented LiNbO3 thin film grown by pulsed laser deposition were studied in a metal-insulator-metal configuration over a wide temperature (200 to 450 K) and frequency (100 Hz to 1 MHz) range. The preferred oriented Al (1%) doped ZnO film with electrical conductivity 1.1×103 Ω-1 cm-1 was deposited for dual purpose: (1) to serve as nucleating center for LiNbO3 crystallites along preferred c-axis growth direction, and (2) to act as a suitable bottom electrode for electrical studies. The room temperature dc conductivity (σdc) of LiNbO3 film was about 5.34×10-10 Ω-1 cm-1 with activation energy ˜0.3 eV, indicating extrinsic conduction. The ac conductivity σac was found to be much higher in comparison to σdc in the low temperature region (300 K), σac shows a weak frequency dependence, whereas dielectric constant exhibits a strong frequency dispersion. The dielectric dispersion data has been discussed in the light of theoretical models based on Debye type mixed conduction and purely hopping conduction. The dominant conduction in c-axis oriented LiNbO3 thin film is attributed to the purely hopping where both σdc and σac arise due to same mechanism.
Surface analysis of thin film coatings on container glass
Energy Technology Data Exchange (ETDEWEB)
Bhargava, A. [GCC Pty Ltd., Jindalee, QLD (Australia); Wood, B. [The University of Queensland, Brisbane, QLD (Australia). Department of Chemistry
1999-12-01
Full text: Container glass is generally coated with a tin oxide layer followed by a coating of polymer. These coatings are believed to improve the mechanical properties of container glass as well as aid in the application of advertising labels to glass. The tin oxide layer on commercial beer bottles has a total thickness of about 15-20nm which consists of an interfacial layer comprising 70-85% of the total thickness. The polymer coating is about 2-5nm thick and also possesses an interfacial layer with tin oxide. A PHI Model 560 XPS/ SAM/ SIMS multi-technique system Is used to estimate concentration profiles of Sn, O, C, Si, Ca, Na and O. A combination of XPS, AES and SIMS is necessary to describe the coatings. Instrumental conditions and sample preparation methods are developed to optimize the analysis of thin films on glass. The coating comprises of three areas, namely (A) where polymer and tin co-exist (B) a pure tin oxide layer and (C) where tin co-exists with glass. By varying the chemical source of tin, it is possible to systematically vary the thickness of the interface and the concentration profile of Sn. Using XRD, crystalline phase(s) could be detected in tin oxide films as thin as 15nm. While the principle phase is cassiterite, a second phase is also detected which is believed to originate from the interface. Using a UMIS 2000 nanoindentor system, instrumental parameters are optimized for measurement of elastic modulus of films at varying depths, i.e. from surface of coating to the bulk of the glass. A sharp rise is observed at depth corresponding to the interface which is indicative of the significance of the interfacial layer. Samples are prepared by systematic ion-milling which are representative of various regions of the coating, namely (A), (B) and (C). These samples are analyzed by XRD and TEM. Based on these studies, a structural model of tin oxide layer and interface is presented to explain increase in elastic modulus at the interface. Copyright
Surface analysis of thin film coatings on container glass
International Nuclear Information System (INIS)
Bhargava, A.; Wood, B.
1999-01-01
Full text: Container glass is generally coated with a tin oxide layer followed by a coating of polymer. These coatings are believed to improve the mechanical properties of container glass as well as aid in the application of advertising labels to glass. The tin oxide layer on commercial beer bottles has a total thickness of about 15-20nm which consists of an interfacial layer comprising 70-85% of the total thickness. The polymer coating is about 2-5nm thick and also possesses an interfacial layer with tin oxide. A PHI Model 560 XPS/ SAM/ SIMS multi-technique system Is used to estimate concentration profiles of Sn, O, C, Si, Ca, Na and O. A combination of XPS, AES and SIMS is necessary to describe the coatings. Instrumental conditions and sample preparation methods are developed to optimize the analysis of thin films on glass. The coating comprises of three areas, namely (A) where polymer and tin co-exist (B) a pure tin oxide layer and (C) where tin co-exists with glass. By varying the chemical source of tin, it is possible to systematically vary the thickness of the interface and the concentration profile of Sn. Using XRD, crystalline phase(s) could be detected in tin oxide films as thin as 15nm. While the principle phase is cassiterite, a second phase is also detected which is believed to originate from the interface. Using a UMIS 2000 nanoindentor system, instrumental parameters are optimized for measurement of elastic modulus of films at varying depths, i.e. from surface of coating to the bulk of the glass. A sharp rise is observed at depth corresponding to the interface which is indicative of the significance of the interfacial layer. Samples are prepared by systematic ion-milling which are representative of various regions of the coating, namely (A), (B) and (C). These samples are analyzed by XRD and TEM. Based on these studies, a structural model of tin oxide layer and interface is presented to explain increase in elastic modulus at the interface. Copyright
ILAW Glass Testing for Disposal at IDF: Phase 1 Testing
Energy Technology Data Exchange (ETDEWEB)
Papathanassiu, Adonia [The Catholic Univ. of America, Washington, DC (United States). Virteous State Lab.; Muller, Isabelle S. [The Catholic Univ. of America, Washington, DC (United States). Virteous State Lab.; Brandys, Marek [The Catholic Univ. of America, Washington, DC (United States). Virteous State Lab.; Gilbo, Konstantin [The Catholic Univ. of America, Washington, DC (United States). Virteous State Lab.; Barkatt, Aaron [The Catholic Univ. of America, Washington, DC (United States). Virteous State Lab.; Joseph, Innocent [EnergySolutions Federal EPC, Inc., Columbia, MD (United States); The Catholic Univ. of America, Washington, DC (United States). Virteous State Lab.; Pegg, Ian L. [The Catholic Univ. of America, Washington, DC (United States). Virteous State Lab.; Brown, Elvie E. [Washington River Protection Solutions, LLC, Richland, WA (United States); Swanberg, David J. [Washington River Protection Solutions, LLC, Richland, WA (United States)
2011-04-11
This document reports the results of the testing of phase 1 ORP LAW (low activity waste) glasses, also identified as enhanced LAW glasses. Testing involved are SPFT (Single Pass Flow Through), VHT (Vapor Hydration Test), and PCT (Product Consistency Test), along with the analytical tests (XRD and SEM-EDS). This report contains the data of the high waste loading ORP LAW glasses that will be used for the performance assessment of the IDF (Integrated Disposal Facility).
ILAW Glass Testing for Disposal at IDF: Phase 1 Testing
International Nuclear Information System (INIS)
Papathanassiu, Adonia; Swanberg, David J.
2011-01-01
This document reports the results of the testing of phase 1 ORP LAW (low activity waste) glasses, also identified as enhanced LAW glasses. Testing involved are SPFT (Single Pass Flow Through), VHT (Vapor Hydration Test), and PCT (Product Consistency Test), along with the analytical tests (XRD and SEM-EDS). This report contains the data of the high waste loading ORP LAW glasses that will be used for the performance assessment of the IDF (Integrated Disposal Facility).
Optical and structural characterization of rare earth doped niobium phosphate glasses
International Nuclear Information System (INIS)
Sene, F.F.; Martinelli, J.R.; Gomes, L.
2004-01-01
Phosphate glasses containing up to 45mol% of niobium were obtained. X-ray diffraction, infrared, Raman, and optical absorption spectroscopy were used to analyze those materials. The refractive index varies from 1.70 to 1.85 as the amount of Nb increases. Niobium phosphate glasses with optical transparence in the (400-2500nm) range were produced. The cut off varied from 342nm to 378nm as a function of the Nb concentration. The cut off is due to the charge transfer O 2 ->Nb 5+ . Glasses containing 10mol% of Nb 2 O 5 are the most promising materials to be used as rare-earth ions hosts because they are chemically resistant, and show optical transparency in the spectral range of visible to infrared. Doping the glasses with 1-5mol% of Er, Ho, Pr, and Yb ions does not change the glass structure, as measured by X-ray diffraction, infrared, and Raman spectroscopy. The fluorescence lifetimes were determined for Nd, Yb, and Er, and the absorption cross-section were determined for all ions. The energy transfer in co-doped Yb-Er system was measured, and the lifetime of excited states and the luminescence efficiency were determined to be 91% for the Er 4 I 11/2 level, in the Yb-Er co-doped glasses
Glass Ceramic Formulation Data Package
International Nuclear Information System (INIS)
Crum, Jarrod V.; Rodriguez, Carmen P.; McCloy, John S.; Vienna, John D.; Chung, Chul-Woo
2012-01-01
A glass ceramic waste form is being developed for treatment of secondary waste streams generated by aqueous reprocessing of commercial used nuclear fuel (Crum et al. 2012b). The waste stream contains a mixture of transition metals, alkali, alkaline earths, and lanthanides, several of which exceed the solubility limits of a single phase borosilicate glass (Crum et al. 2009; Caurant et al. 2007). A multi-phase glass ceramic waste form allows incorporation of insoluble components of the waste by designed crystallization into durable heat tolerant phases. The glass ceramic formulation and processing targets the formation of the following three stable crystalline phases: (1) powellite (XMoO4) where X can be (Ca, Sr, Ba, and/or Ln), (2) oxyapatite Yx,Z(10-x)Si6O26 where Y is alkaline earth, Z is Ln, and (3) lanthanide borosilicate (Ln5BSi2O13). These three phases incorporate the waste components that are above the solubility limit of a single-phase borosilicate glass. The glass ceramic is designed to be a single phase melt, just like a borosilicate glass, and then crystallize upon slow cooling to form the targeted phases. The slow cooling schedule is based on the centerline cooling profile of a 2 foot diameter canister such as the Hanford High-Level Waste canister. Up to this point, crucible testing has been used for glass ceramic development, with cold crucible induction melter (CCIM) targeted as the ultimate processing technology for the waste form. Idaho National Laboratory (INL) will conduct a scaled CCIM test in FY2012 with a glass ceramic to demonstrate the processing behavior. This Data Package documents the laboratory studies of the glass ceramic composition to support the CCIM test. Pacific Northwest National Laboratory (PNNL) measured melt viscosity, electrical conductivity, and crystallization behavior upon cooling to identify a processing window (temperature range) for melter operation and cooling profiles necessary to crystallize the targeted phases in the
2004-01-01
This document concerns the award of a contract, without competitive tendering, for the supply of eight glass-coated beryllium mirrors for the LHCb RICH1 detector. The Finance Committee is invited to agree to the negotiation of a contract, without competitive tendering, with the ISTC Moscow (RU) for the supply of eight glass-coated beryllium mirrors for a total amount of 282 000 US dollars, not subject to revision. At the present rate of exchange this is equivalent to approximately 370 000 Swiss francs. The contract will be financed by PPARC (GB) and CERN. PPARC will contribute 65 000 US dollars (approximately 85 000 Swiss francs) and CERN will contribute 217 000 US dollars (approximately 285 000 Swiss francs).
The candidate TB vaccine, MVA85A, induces highly durable Th1 responses.
Directory of Open Access Journals (Sweden)
Michele Tameris
Full Text Available Vaccination against tuberculosis (TB should provide long-term protective immunity against Mycobacterium tuberculosis (M.tb. The current TB vaccine, Bacille Calmette-Guerin (BCG, protects against disseminated childhood TB, but protection against lung TB in adolescents and adults is variable and mostly poor. One potential reason for the limited durability of protection may be waning of immunity through gradual attrition of BCG-induced T cells. We determined if a MVA85A viral-vector boost could enhance the durability of mycobacteria-specific T cell responses above those induced by BCG alone.We describe a long-term follow-up study of persons previously vaccinated with MVA85A. We performed a medical history and clinical examination, a tuberculin skin test and measured vaccine-specific T cell responses in persons previously enrolled as adults, adolescents, children or infants into three different Phase II trials, between 2005 and 2011.Of 252 potential participants, 183 (72.6% consented and completed the study visit. Vaccine-induced Ag85A-specific CD4+ T cell responses were remarkably persistent in healthy, HIV-uninfected adults, adolescents, children and infants, up to 6 years after MVA85A vaccination. Specific CD4+ T cells expressed surface markers consistent with either CD45RA-CCR7+ central memory or CD45RA-CCR7- effector memory T cells. Similarly durable Ag85A-specific CD4+ T cell responses were detected in HIV-infected persons who were on successful antiretroviral therapy when MVA85A was administered. By contrast, Ag85A-specific CD4+ T cell frequencies in untreated MVA85A-vaccinated HIV-infected persons were mostly undetectable 3-5 years after vaccination.MVA85A induces remarkably durable T cell responses in immunocompetent persons. However, results from a recent phase IIb trial of MVA85A, conducted in infants from the same geographic area and study population, showed no vaccine efficacy, suggesting that these durable T cell responses do not
Microstrip gas chamber on thin-film Pestov glass and micro gap chamber
International Nuclear Information System (INIS)
Gong, W.G.; Harris, J.W.; Wieman, H.
1994-07-01
The authors report developments of the Microstrip Gas Chamber on thin-film Pestov glass and the Micro Gap Chamber. By coating a thin-layer of low-resistive, electronically-conductive glass on various substrates (including quartz and ceramics), they built MSGCs of high gain stability and low leakage current. They were tested in Ar-CH 4 (10%) and He-C 2 H 6 (50%) gas mixtures. Energy resolutions of 17-20% were measured for 6keV x-rays. This design can make the choice of substrate less important, save the cost of ion-implantation, and use less glass material. Micro Gap Chamber was successfully tested in He-C 2 H 6 (50%) and Ar-C 2 H 6 (50%) gas mixtures. Energy resolutions of about 20% were obtained. Both detectors are expected to have high rate capability
Ageing effects in As10Se90 chalcogenide glasses induced by gamma-irradiation
International Nuclear Information System (INIS)
Golovchak, R.; Shpotyuk, O.; Shpotyuk, M.; Gorecki, Cz.; Kozdras, A.
2005-01-01
The peculiarities of gamma-induced (Co 60 source, 1.85 MGy absorbed dose) ageing phenomena in As 10 Se 90 chalcogenide glasses are investigated for the first time. The analogy between the observed radiation-induced ageing and the thermally induced one in vitreous selenium is emphasized. Like to thermal treatment, gamma-irradiation leads to an increase in the glass transition temperature and the relaxation rate towards a thermodynamic equilibrium of supercooled liquid, the value of this increase being greater in the case of radiation influence
International Nuclear Information System (INIS)
Mookerjee, Abhijit
1976-01-01
''Spin glasses'', are entire class of magnetic alloys of moderate dilution, in which the magnetic atoms are far enough apart to be unlike the pure metal, but close enough so that the indirect exchange energy between them (mediated by the s-d interaction between local moments and conduction electrons) dominates all other energies. Characteristic critical phenomena displayed such as freezing of spin orientation at 'Tsub(c)' and spreading of magnetic ordering, are pointed out. Anomalous behaviour, associated with these critical phenomena, as reflected in : (i) Moessbauer spectroscopy giving hyperfine splitting at Tsub(c), (ii) maxima in susceptibility and remanent magnetism, (iii) thermopower maxima and change in slope, (iv) Characteristic cusp in susceptibility and its removal by very small magnetic fields, and (v) conductivity-resistivity measurements, are discussed. Theoretical developments aimed at explaining these phenomena, in particular, the ideas from percolation and localisation theories, and the approach based on the gellations of polymers, are discussed. Finally, a new approach based on renormalisation group in disordered systems is also briefly mentioned. (K.B.)
Non-Fermi liquid and spin-glass behavior of the Sc1-xUxPd3 system
International Nuclear Information System (INIS)
Gajewski, D.A.; Allenspach, P.; Seaman, C.L.; Maple, M.B.
1994-01-01
Previous electrical resistivity ρ(T), magnetic susceptibility χ(T), and specific heat C(T) measurements on the Y 1-x U x Pd 3 system have revealed Kondo behavior for 0 K , where T K is the Kondo temperature: ρ(T)/ρ(0)∼1-T/(aT K ) and C(T)/T∼-(1/T K )ln T with evidence for a finite T=0 residual entropy S(0)=(R/2)ln(2). We report measurements of ρ(T), χ(T), and C(T) on the Sc 1-x U x Pd 3 system which reveal similar Kondo, non-Fermi liquid, and spin-glass behaviors. ((orig.))
Structure and transport investigations on lithium-iron-phosphate glasses
International Nuclear Information System (INIS)
Banday, Azeem; Sharma, Monika; Murugavel, Sevi
2016-01-01
Cathode materials for Lithium Ion Batteries (LIB’s) are being constantly studied and reviewed especially in the past few decades. LiFePO_4 (LFP) is one of the most potential candidates in the pedigree of cathode materials and has been under extensive study ever since. In this work, we report the synthesis of amorphous analogs of crystallite LFP by conventional melt quenching method. Thermal study by using differential scanning calorimetry (DSC) was used to determine the glass transition T_g and crystallization T_c temperatures on the obtained glass sample Fourier transform infrared (FTIR) absorption spectroscopy is being used to investigate the structural properties of the glass sample. The intrinsic electrical conductivity measurements were done using broad-band impedance spectroscopy with wide different temperature ranges. The conduction mechanism is described by non-adiabatic small polaron hopping between nearest neighbors. Based on the obtained results, we suggest that the glassy LFP is more suitable cathode material as compared to its crystalline counterpart.
Investigation of Performance of SCN-1 Pure Glass as Sealant Used in SOFC
Energy Technology Data Exchange (ETDEWEB)
Liu, Wenning N.; Sun, Xin; Stephens, Elizabeth V.; Khaleel, Mohammad A.
2010-03-01
As its name implies, self-healing glass seal has the potential of restoring its mechanical properties upon being reheated to stack operating temperature, even when it has experienced some cooling induced damage/crack at room temperature. Such a self-healing feature is desirable for achieving high seal reliability during thermal cycling. On the other hand, self-healing glass is also characterized by its low mechanical stiffness and high creep rate at the typical operating temperature of SOFCs. Therefore, from a design’s perspective, it is important to know the long term geometric stability and thermal mechanical behaviors of the self-healing glass under the stack operating conditions. These predictive capabilities will guide the design and optimization of a reliable sealing system that potentially utilizes self-healing glass as well as other ceramic seal components in achieving the ultimate goal of SOFC. In this report, we focused on predicting the effects of various generic seal design parameters on the stresses in the seal. For this purpose, we take the test cell used in the leakage test for compliant glass seals conducted in PNNL as our initial modeling geometry. The effect of the ceramic stopper on the geometry stability of the self-healing glass sealants is studied first. Then we explored the effect of various interfaces such as stopper and glass, stopper and PEN, as well stopper and IC plate, on the geometry stability and reliability of glass during the operating and cooling processes.
Directory of Open Access Journals (Sweden)
Cesar Salge Ghilardi
2012-01-01
Full Text Available OBJETIVO: Análise retrospectiva de prontuários de pacientes com instabilidade C1-C2 de causas traumáticas e não-traumáticas, submetidos à artrodese C1-C2. MÉTODOS: Foi realizada análise retrospectiva de prontuários de 20 pacientes do ambulatório de coluna do IOT-HCFMUSP com idades entre 7 e 83 anos (média de 43 anos, de ambos os sexos. Os parâmetros radiográficos para instabilidade foram baseados na medida do intervalo atlanto-axial superior a 3 mm em adultos e a 5 mm em crianças, utilizando-se medidas obtidas através de radiografia simples analisada no perfil. RESULTADOS: Foram operados 20 pacientes com instabilidade cervical alta, a maioria de origem traumática. A técnica cirúrgica mais utilizada foi a artrodese descrita por Magerl. Não foram observadas lesões vasculares. Foi registrada complicação infecciosa em dois pacientes. Obteve-se uma taxa de consolidação da artrodese de 85% e não foram necessárias cirurgias de revisão. CONCLUSÃO: Todas as técnicas utilizadas produziram a consolidação óssea satisfatória e foram excelentes para controlar a instabilidade atlanto-axial.OBJETIVO: Estudio retrospectivo de fichas depacientes con inestabilidad C1-C2, de causas traumáticas y no traumáticas, quienes se sometieron a artrodesis C1-C2. MÉTODOS: Se realizó un análisis retrospectivo de los historiales clínicos de 20 pacientes externos de la columna en el IOT-HC.FM.USP de edades comprendidas entre 07 y 83 años (promedio de 43 años de ambos sexos. Los parámetros radiológicos de inestabilidad se basaron en la medición del intervalo atlantoaxial superior a 3 mm en adultos y a 5 mm en niños, utilizándose medidas obtenidas a partir de radiografías simples analizadas en el perfil. RESULTADOS: Se operaron 20 pacientes con inestabilidad cervical alta, la mayoría con inestabilidad de origen traumático. La técnica quirúrgica más utilizada fue la artrodesis descrita por Magerl. No se observaron lesiones
26 CFR 1.85-1 - Unemployment compensation.
2010-04-01
.... (a) Introduction. Section 85 prescribes rules relating to the inclusion in gross income of... than in cash or on some other basis. (ii) Disability and worker's compensation payments. Amounts in the nature of unemployment compensation also include cash disability payments made pursuant to a governmental...
Dicty_cDB: Contig-U15861-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available lmmnkakldyticdnegtpaihiaaasnniplitmllkgsdarvsirdqhgntplh lfvqknvslncediinklie... X70831 ) C.elegans IFA3 gene for intermediate filament protein. 46 7.1 1 ( AC181799 ) Strongylocentrotus pu... ) 1095439023029 Global-Ocean-Sampling_GS-26-01-01-1... 40 0.071 2 ( CR936240 ) Z... 0.85 9 ( EJ288041 ) 1095370001506 Global-Ocean-Sampling_GS-27-01-01-1... 42 0.95 2 ( AY242996 ) Antheraea p...2996300114 Global-Ocean-Sampling_GS-31-01-01-1... 36 4.7 3 ( AL407498 ) T3 end of clone AV0AA001F06 of li
High thermal conductivity SiC/SiC composites for fusion applications -- 2
International Nuclear Information System (INIS)
Kowbel, W.; Tsou, K.T.; Withers, J.C.; Youngblood, G.E.
1998-01-01
This report covers material presented at the IEA/Jupiter Joint International Workshop on SiC/SiC Composites for Fusion Structural Applications held in conjunction with ICFRM-8, Sendai, Japan, Oct. 23--24, 1997. An unirradiated SiC/SiC composite made with MER-developed CVR SiC fiber and a hybrid PIP/CVI SiC matrix exhibited room temperature transverse thermal conductivity of 45 W/mK. An unirradiated SiC/SiC composite made from C/C composite totally CVR-converted to a SiC/SiC composite exhibited transverse thermal conductivity values of 75 and 35 W/mK at 25 and 1000 C, respectively. Both types of SiC/SiC composites exhibited non-brittle failure in flexure testing
Mallamace, Francesco; Branca, Caterina; Corsaro, Carmelo; Leone, Nancy; Spooren, Jeroen; Chen, Sow-Hsin; Stanley, H Eugene
2010-12-28
It is becoming common practice to partition glass-forming liquids into two classes based on the dependence of the shear viscosity η on temperature T. In an Arrhenius plot, ln η vs 1/T, a strong liquid shows linear behavior whereas a fragile liquid exhibits an upward curvature [super-Arrhenius (SA) behavior], a situation customarily described by using the Vogel-Fulcher-Tammann law. Here we analyze existing data of the transport coefficients of 84 glass-forming liquids. We show the data are consistent, on decreasing temperature, with the onset of a well-defined dynamical crossover η(×), where η(×) has the same value, η(×) ≈ 10(3) Poise, for all 84 liquids. The crossover temperature, T(×), located well above the calorimetric glass transition temperature T(g), marks significant variations in the system thermodynamics, evidenced by the change of the SA-like T dependence above T(×) to Arrhenius behavior below T(×). We also show that below T(×) the familiar Stokes-Einstein relation D/T ∼ η(-1) breaks down and is replaced by a fractional form D/T ∼ η(-ζ), with ζ ≈ 0.85.
Spin glass transition in the rhombohedral LiNi1/3Mn1/3Co1/3O2
International Nuclear Information System (INIS)
Bie, Xiaofei; Yang, Xu; Han, Bing; Chen, Nan; Liu, Lina; Wei, Yingjin; Wang, Chunzhong; Chen, Hong; Du, Fei; Chen, Gang
2013-01-01
Highlights: •The Rietveld analysis of XRD data reveals a single phase with rhombohedral structure. •Dc susceptibility data suggest a spin glass behavior at low T in the 333 compound. •The ac susceptibility measurements have been observed in the typical SG system. •Three models have been employed to study the behavior of the spin glass state. •Both geometrical frustration and disorder play important role in the formation of SG. -- Abstract: Layered LiNi 1/3 Mn 1/3 Co 1/3 O 2 has been synthesized by co-precipitation method, and the magnetic properties were comprehensively studied by dc and ac susceptibilities. The dc magnetization curves show the irreversibility and spin freezing behavior at 109 K and 9 K. The evolution of real and imaginary part of ac susceptibility under different frequencies indicates a spin glass transition at low temperature. Three models (the Néel–Arrhenius law, the Vogel–Fulcher law, and the power law) have been employed to study the relaxation behavior of the spin glass state. Both frustration and disorder play important role in the formation of spin glass
Structural characterizations and optical properties of new Li–Sr–Nb-phosphate glasses
Energy Technology Data Exchange (ETDEWEB)
Lee, Yi-Mu [Department of Electronic Engineering, National United University, Miao-Li 36003, Taiwan, ROC (China); Hsu, S.M. [Department of Biomedical Imaging and Radiological Sciences, National Yang-Ming University, Taipei 11221, Taiwan, ROC (China); Yung, S.W., E-mail: hwyang@nuu.edu.tw [Department of Material Science and Engineering, National United University, Miao-Li 36003, Taiwan, ROC (China); Zhang, T. [Institute for Materials Research, Fuzhou University, Fujian (China); Huang, Y.S.; Wu, J.J. [Department of Material Science and Engineering, National United University, Miao-Li 36003, Taiwan, ROC (China); Hsu, C.H. [Department of Electrical Engineering, National United University, Miao-Li 36003, Taiwan, ROC (China); Chin, T.S. [Department of Materials Science and Engineering, Feng Chia University, Taichung, Taiwan, ROC (China)
2014-04-01
A new Li{sub 2}O–SrO–Nb{sub 2}O{sub 5}–P{sub 2}O{sub 5} glass system was prepared by a high-temperature alumina crucible, and structural characterization and optical properties were investigated. Proper content of Li{sub 2}O and Nb{sub 2}O{sub 5} was employed to replace partial SrO and P{sub 2}O{sub 5} to improve the optical properties. It was observed that the enhancement of the refractive index from 1.75 to 1.85 is mainly due to the Nb{sub 2}O{sub 5} content. An addition of Li{sub 2}O significantly increases the optical transmittance; optical transparency can be enhanced from 60% to higher than 85% in the UV–visible region with addition of 20–40 mol% Li{sub 2}O species. However, optical transmittance is monotonically decreased from about 90% to 80% under 10–30 mol% Nb{sub 2}O{sub 5} addition. The 40P{sub 2}O{sub 5}–20Nb{sub 2}O{sub 5}–20SrO–20Li{sub 2}O glasses demonstrate the optimum refractive index (n > 1.75) and high optical transparency (>80%) in the UV–visible region. Furthermore, the effect of Nb{sub 2}O{sub 5} on the structural transition was focused on the (60 − y)P{sub 2}O{sub 5}–yNb{sub 2}O{sub 5}–20SrO–20Li{sub 2}O vitreous system since the transition of FTIR spectra reveals that the Nb{sub 2}O{sub 5} has more pronounced effect than Li{sub 2}O in the glass network due to the higher covalent extent and electronegativity. Addition of Nb{sub 2}O{sub 5} generates Nb–O bonds by dissociating P–O chains and results in the decrease in the intensity of the (PO{sub 2}), (POP), and (PO{sub 3}) absorption bands. The O1s-XPS analysis shows that Nb{sub 2}O{sub 5} addition dissociates symmetric bridging oxygens in P–O–P bonding and forms asymmetric bridging oxygens in P–O–Nb and non-bridging Nb–O{sup -} bonds, in which octahedral [NbO{sub 6}] unit is eventually substituted by [NbO{sub 4}] tetrahedral unit in the Li–Sr–Nb phosphate glasses. - Highlights: • The prepared glasses demonstrate great optical properties
The characterization of ceramic alumina prepared by using additive glass beads
Suprapedi; Muljadi; Sardjono, Priyo
2018-01-01
The ceramic alumina has been made by using additive glass bead (5 and 10 % wt.). There are two kinds of materials, such as : gamma Alumina and glass bead. Synthesis of alumina was done by ball milling for 24 hours, then the mixed powder was dried in drying oven at 100 °C for 6 hours. Furthermore, the dried powder was mixed by using 2 % of PVA and continued with compacted to form a pellet with pressure of 50 MPA. The next step is sintering process with variation temperature of 1150, 1200, 1250, 1300 and 1400 °C and holding time for 2 hours. The characterization conducted are consist of test density, hardness, shrinkage, and microstructure. The results show that ceramic alumina with addition of 10 % wt. glass bead has the higher value of density, hardness and shrinkage than addition of 5% wt. glass bead. The highest characterization of ceramic alumina with addition 10 % glass bead was achieved at sintering temperature of 1400 °C with density 3.68 g/cm3, hardness vickers 780.40 Hv and shrinkage 15.23 %. The XRD results show that it was founds a corrundum (alpha Alumina) as dominant phase and mullite as minor phase.
BNFL Report Glass Formers Characterization
Energy Technology Data Exchange (ETDEWEB)
Schumacher, R.F.
2000-07-27
The objective of this task was to obtain powder property data on candidate glass former materials, sufficient to guide conceptual design and estimate the cost of glass former handling facilities as requested under Part B1 of BNFL Technical and Development Support. Twenty-nine glass forming materials were selected and obtained from vendors for the characterization of their physical properties, durability in caustic solution, and powder flow characteristics. A glass former was selected based on the characterization for each of the ten oxide classes required for Envelope A, B, and C mixtures. Three blends (A, B, and C) were prepared based on formulations provided by Vitreous State Laboratory and evaluated with the same methods employed for the glass formers. The properties obtained are presented in a series of attached Tables. It was determined that five of the ten glass formers, (kyanite, iron oxide, titania, zircon, and zinc oxide) have the potential to cause some level of solids f low problems. In addition, all of the blends may require consideration for their handling. A number of engineering considerations and recommendations were prepared based on the experimental findings, experience, and other process considerations. Recommendations for future testing are included. In conjunction with future work, it is recommended that a professional consultant be engaged to guide and assist with testing and design input.
BNFL Report Glass Formers Characterization
International Nuclear Information System (INIS)
Schumacher, R.F.
2000-01-01
The objective of this task was to obtain powder property data on candidate glass former materials, sufficient to guide conceptual design and estimate the cost of glass former handling facilities as requested under Part B1 of BNFL Technical and Development Support. Twenty-nine glass forming materials were selected and obtained from vendors for the characterization of their physical properties, durability in caustic solution, and powder flow characteristics. A glass former was selected based on the characterization for each of the ten oxide classes required for Envelope A, B, and C mixtures. Three blends (A, B, and C) were prepared based on formulations provided by Vitreous State Laboratory and evaluated with the same methods employed for the glass formers. The properties obtained are presented in a series of attached Tables. It was determined that five of the ten glass formers, (kyanite, iron oxide, titania, zircon, and zinc oxide) have the potential to cause some level of solids f low problems. In addition, all of the blends may require consideration for their handling. A number of engineering considerations and recommendations were prepared based on the experimental findings, experience, and other process considerations. Recommendations for future testing are included. In conjunction with future work, it is recommended that a professional consultant be engaged to guide and assist with testing and design input
Encapsulation of krypton-85 in zeolite molecular sieve with a hot isostatic press
International Nuclear Information System (INIS)
Christensen, A.B.; DelDebbio, J.A.; Knecht, D.A.; Tanner, J.E.
1986-01-01
This paper describes pilot and full-scale experiments which demonstrated the feasibility of immobilizing Kr-85 in a zeolite 5A/glass mixture and compacting it before disposal. The full volume of a one-liter hot isostatic press (HIP) was used to trap argon in zeolite 5A. For radioactive krypton the HIP was modified to isolate the Kr-85 in the work zone. Details of the HIP modifications, experimental procedure, and sample analysis are reported
Solid-state superionic stamping with silver iodide-silver metaphosphate glass
International Nuclear Information System (INIS)
Jacobs, K E; Hsu, K H; Han, X; Azeredo, B P; Ferreira, P M; Kumar, A; Fang, N X
2011-01-01
This paper demonstrates and analyzes the new use of the glassy solid electrolyte AgI-AgPO 3 for direct nanopatterning of thin silver films with feature resolutions of 30 nm. AgI-AgPO 3 has a high room temperature ionic conductivity with Ag + as the mobile ion, leading to silver etch/patterning rates of up to 20 nm s -1 at an applied bias of 300 mV. The glass can be melt-processed at temperatures below 200 deg. C, providing a facile and economical pathway for creating large area stamps, including the 25 mm 2 stamps shown in this study. Further, the glass is sufficiently transparent to permit integration with existing tools such as aligners and imprint tools, enabling high overlay registration accuracy and facilitating insertion into multi-step fabrication recipes.
Phase formation during corrosion experiments with two simulated borosilicate nuclear waste glasses
International Nuclear Information System (INIS)
Haaker, R.F.
1985-10-01
Corrosion products resulting from the reaction of simulated high-level radioactive waste glasses with various solutions have been identified. At 200degC, in saturated NaCl, a degree of reaction of 10 g C31-3 glass or 2.6 g SON 68 glass per liter of solution was obtained. Analcime, vermiculite (a phyllosilicate) and a 2:1 zinc silicate are the major silica containing alteration products for the C31-3 glass. Analcime was the only silicate alteration product which could be identified for SON 68 glass. C31-3 glass appeared to be less reactive with a quinary brine containing Mg ++ than with NaCl. With the quinary brine, montmorillonite (a phyllosilicate) was the predominant silica containing alteration product. Hydrotalcite (a Mg-Al hydroxysulfate) and montmorillonite were the major Al-containing phases. A phyllosilicate, probably montmorillonite, was observed to form during the reaction of SON 68 glass with quinary brine. With either glass, modified NaCl brines which contained small amounts of MgCl 2 seem to have the effect of decreasing the amount of analcime and increasing the amount of phyllosilicate which is formed. In the case of C31-3 glass, there is approximately enough Mg, Al and Zn to precipitate most of the leached Si; measured Si concentrations remain well below that expected for amorphous silica. SON 68 glass has less Zn, Al and Mg than C31-3 glass and much higher Si concentrations of the leachates. (orig./RB)
Formulation and Characterization of Waste Glasses with Varying Processing Temperature
Energy Technology Data Exchange (ETDEWEB)
Kim, Dong-Sang; Schweiger, M. J.; Rodriguez, Carmen P.; Lepry, William C.; Lang, Jesse B.; Crum, Jarrod V.; Vienna, John D.; Johnson, Fabienne; Marra, James C.; Peeler, David K.
2011-10-17
This report documents the preliminary results of glass formulation and characterization accomplished within the finished scope of the EM-31 technology development tasks for WP-4 and WP-5, including WP-4.1.2: Glass Formulation for Next Generation Melter, WP-5.1.2.3: Systematic Glass Studies, and WP-5.1.2.4: Glass Formulation for Specific Wastes. This report also presents the suggested studies for eventual restart of these tasks. The initial glass formulation efforts for the cold crucible induction melter (CCIM), operating at {approx}1200 C, with selected HLW (AZ-101) and LAW (AN-105) successfully developed glasses with significant increase of waste loading compared to that is likely to be achieved based on expected reference WTP formulations. Three glasses formulated for AZ-101HLW and one glass for AN-105 LAW were selected for the initial CCIM demonstration melter tests. Melter tests were not performed within the finished scope of the WP-4.1.2 task. Glass formulations for CCIM were expanded to cover additional HLWs that have high potential to successfully demonstrate the unique advantages of the CCIM technologies based on projected composition of Hanford wastes. However, only the preliminary scoping tests were completed with selected wastes within the finished scope. Advanced glass formulations for the reference WTP melter, operating at {approx}1200 C, were initiated with selected specific wastes to determine the estimated maximum waste loading. The incomplete results from these initial formulation efforts are summarized. For systematic glass studies, a test matrix of 32 high-aluminum glasses was completed based on a new method developed in this study.
Formulation and Characterization of Waste Glasses with Varying Processing Temperature
International Nuclear Information System (INIS)
Kim, Dong-Sang; Schweiger, M.J.; Rodriguez, Carmen P.; Lepry, William C.; Lang, Jesse B.; Crum, Jarrod V.; Vienna, John D.; Johnson, Fabienne; Marra, James C.; Peeler, David K.
2011-01-01
This report documents the preliminary results of glass formulation and characterization accomplished within the finished scope of the EM-31 technology development tasks for WP-4 and WP-5, including WP-4.1.2: Glass Formulation for Next Generation Melter, WP-5.1.2.3: Systematic Glass Studies, and WP-5.1.2.4: Glass Formulation for Specific Wastes. This report also presents the suggested studies for eventual restart of these tasks. The initial glass formulation efforts for the cold crucible induction melter (CCIM), operating at ∼1200 C, with selected HLW (AZ-101) and LAW (AN-105) successfully developed glasses with significant increase of waste loading compared to that is likely to be achieved based on expected reference WTP formulations. Three glasses formulated for AZ-101HLW and one glass for AN-105 LAW were selected for the initial CCIM demonstration melter tests. Melter tests were not performed within the finished scope of the WP-4.1.2 task. Glass formulations for CCIM were expanded to cover additional HLWs that have high potential to successfully demonstrate the unique advantages of the CCIM technologies based on projected composition of Hanford wastes. However, only the preliminary scoping tests were completed with selected wastes within the finished scope. Advanced glass formulations for the reference WTP melter, operating at ∼1200 C, were initiated with selected specific wastes to determine the estimated maximum waste loading. The incomplete results from these initial formulation efforts are summarized. For systematic glass studies, a test matrix of 32 high-aluminum glasses was completed based on a new method developed in this study.
Energy Technology Data Exchange (ETDEWEB)
KRUGER AA; MATLACK KS; KOT W; PEGG IL; JOSEPH I; BARDAKCI T; GAN H; GONG W; CHAUDHURI M
2010-01-04
. The WTP HLW melter design, unlike earlier DOE melter designs, incorporates an active glass bubbler system. The bubblers create active glass pool convection and thereby improve heat transfer and glass melting rate. The WTP HLW melter has a glass surface area of 3.75 m{sup 2} and depth of {approx}1.1 m. The two melters in the HLW facility together are designed to produce up to 7.5 MT of glass per day at 100% availability. Further increases in HLW waste processing rates can potentially be achieved by increasing the melter operating temperature above 1150 C and by increasing the waste loading in the glass product. Increasing the waste loading also has the added benefit of decreasing the number of canisters for storage. The current estimates and glass formulation efforts have been conservative in terms of achievable waste loadings. These formulations have been specified to ensure that the glasses are homogenous, contain essentially no crystalline phases, are processable in joule-heated, ceramic-lined melters and meet WTP Contract terms. The WTP's overall mission will require the immobilization of tank waste compositions that are dominated by mixtures of aluminum (Al), chromium (Cr), bismuth (Bi), iron (Fe), phosphorous (P), zirconium (Zr), and sulfur (S) compounds as waste-limiting components. Glass compositions for these waste mixtures have been developed based upon previous experience and current glass property models. Recently, DOE has initiated a testing program to develop and characterize HLW glasses with higher waste loadings. Results of this work have demonstrated the feasibility of increases in wasteloading from about 25 wt% to 33-50 wt% (based on oxide loading) in the glass depending on the waste stream. It is expected that these higher waste loading glasses will reduce the HLW canister production requirement by about 25% or more.
International Nuclear Information System (INIS)
Kruger, A.A.; Matlack, K.S.; Kot, W.; Pegg, I.L.; Joseph, I.; Bardakci, T.; Gan, H.; Gong, W.; Chaudhuri, M.
2010-01-01
. The WTP HLW melter design, unlike earlier DOE melter designs, incorporates an active glass bubbler system. The bubblers create active glass pool convection and thereby improve heat transfer and glass melting rate. The WTP HLW melter has a glass surface area of 3.75 m 2 and depth of ∼1.1 m. The two melters in the HLW facility together are designed to produce up to 7.5 MT of glass per day at 100% availability. Further increases in HLW waste processing rates can potentially be achieved by increasing the melter operating temperature above 1150 C and by increasing the waste loading in the glass product. Increasing the waste loading also has the added benefit of decreasing the number of canisters for storage. The current estimates and glass formulation efforts have been conservative in terms of achievable waste loadings. These formulations have been specified to ensure that the glasses are homogenous, contain essentially no crystalline phases, are processable in joule-heated, ceramic-lined melters and meet WTP Contract terms. The WTP's overall mission will require the immobilization of tank waste compositions that are dominated by mixtures of aluminum (Al), chromium (Cr), bismuth (Bi), iron (Fe), phosphorous (P), zirconium (Zr), and sulfur (S) compounds as waste-limiting components. Glass compositions for these waste mixtures have been developed based upon previous experience and current glass property models. Recently, DOE has initiated a testing program to develop and characterize HLW glasses with higher waste loadings. Results of this work have demonstrated the feasibility of increases in wasteloading from about 25 wt% to 33-50 wt% (based on oxide loading) in the glass depending on the waste stream. It is expected that these higher waste loading glasses will reduce the HLW canister production requirement by about 25% or more.
Influence of heat treatment on structure and some physical properties of lithium boro-niobate glass
Kashif, I.; Sakr, E. M.; Soliman, A. A.; Ratep, A.
2012-08-01
The glass composition (90 mol% Li2B4O7-10 mol% Nb2O5) was prepared by the melt quenching technique. The quenched sample was heat treated at 480°C, 545°C and 630°C for 5 h and heat treated at 780°C with different time. The times were 5, 10, 15, 20, 28, and 36 h. The glass and glass ceramics were studied by differential thermal analysis (DTA), X-ray diffraction (XRD), and dc conductivity as a function of temperature. Lithium niobate (LiNbO3) and lithium diborate (Li2B4O7) were the main phases in glass ceramic addition to traces from LiNb3O8. Crystallite size of the main phases determined from the X-ray diffraction peaks are in the range <100 nm. The fraction of crystalline (LiNbO3) phase increases with increase the heat treatment temperature and time. The relation between physical properties and structure were studied.
Development of high conductive C/C composite tiles for plasma facing armor
International Nuclear Information System (INIS)
Ioki, K.; Namiki, K.; Tsujimura, S.; Toyoda, M.; Seki, M.; Takatsu, H.
1991-01-01
C/C composites with high thermal conductivity were developed in unidirectional, two-dimensional and felt types, and were fabricated as full-scale armor tile. Their thermal conductivity in the direction perpendicular to the plasma-side surface is 250∝550 W/mdeg C, that is comparable to that of pyrolytic graphite. It was shown by heat load tests that the C/C composites have low surface erosion characteristics and high thermal shock resistance. Various kinds of C/C composites were successfully bonded to metal substrate, and their mechanical strength and thermal shock resistance were tested. (orig.)
The effect of SiC particle size on the properties of Cu–SiC composites
International Nuclear Information System (INIS)
Celebi Efe, G.; Zeytin, S.; Bindal, C.
2012-01-01
Graphical abstract: The relative densities of Cu–SiC composites sintered at 700 °C for 2 h are ranged from 97.3% to 91.8% for SiC with 1 μm particle size and 97.5% to 95.2% for SiC with 5 μm particle size, microhardness of composites ranged from 143 to 167 HV for SiC having 1 μm particle size and 156–182 HVN for SiC having 5 μm particle size and the electrical conductivity of composites changed between 85.9% IACS and 55.7% IACS for SiC with 1 μm particle size, 87.9% IACS and 65.2%IACS for SiC with 5 μm particle size. It was found that electrical conductivity of composites containing SiC with 5 μm particle size is better than that of Cu–SiC composites containing SiC with particle size of 1 μm. Highlights: ► In this research, the effect of SiC particle size on some properties of Cu–SiC composites were investigated. ► The mechanical properties were improved. ► The electrical properties were obtained at desirable level. -- Abstract: SiC particulate-reinforced copper composites were prepared by powder metallurgy (PM) method and conventional atmospheric sintering. Scanning electron microscope (SEM), X-ray diffraction (XRD) techniques were used to characterize the sintered composites. The effect of SiC content and particle size on the relative density, hardness and electrical conductivity of composites were investigated. The relative densities of Cu–SiC composites sintered at 700 °C for 2 h are ranged from 97.3% to 91.8% for SiC with 1 μm particle size and from 97.5% to 95.2% for SiC with 5 μm particle size. Microhardness of composites ranged from 143 to 167 HV for SiC having 1 μm particle size and from 156 to 182 HV for SiC having 5 μm particle size. The electrical conductivity of composites changed between 85.9% IACS and 55.7% IACS for SiC with 1 μm particle size, between 87.9% IACS and 65.2% IACS for SiC with 5 μm particle size.
Dicty_cDB: Contig-U12691-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available le sunflower Hel... 44 8.5 1 ( EL473924 ) CHUL1852.b1_H08.ab1 CHU(LMS) puzzle sunfl...ower Hel... 44 8.5 1 ( EL473578 ) CHUL1499.b1_F16.ab1 CHU(LMS) puzzle sunflower H..... 44 8.5 1 ( CG928985 ) MBEKA23TRB mth2 Medicago truncatula genomic clone... 44 8.5 1 ( EL476161 ) CHUL4104.b1_O18.ab1 CHU(LMS) puzz
Habous, Mohamad; Tal, Raanan; Tealab, Alaa; Soliman, Tarek; Nassar, Mohammed; Mekawi, Zenhom; Mahmoud, Saad; Abdelwahab, Osama; Elkhouly, Mohamed; Kamr, Hatem; Remeah, Abdallah; Binsaleh, Saleh; Ralph, David; Mulhall, John
2018-02-01
To re-evaluate the role of diabetes mellitus (DM) as a risk factor for penile implant infection by exploring the association between glycated haemoglobin (HbA1c) levels and penile implant infection rates and to define a threshold value that predicts implant infection. We conducted a multicentre prospective study including all patients undergoing penile implant surgery between 2009 and 2015. Preoperative, perioperative and postoperative management were identical for the entire cohort. Univariate analysis was performed to define predictors of implant infection. The HbA1c levels were analysed as continuous variables and sequential analysis was conducted using 0.5% increments to define a threshold level predicting implant infection. Multivariable analysis was performed with the following factors entered in the model: DM, HbA1C level, patient age, implant type, number of vascular risk factors (VRFs), presence of Peyronie's disease (PD), body mass index (BMI), and surgeon volume. A receiver operating characteristic (ROC) curve was generated to define the optimal HbA1C threshold for infection prediction. In all, 902 implant procedures were performed over the study period. The mean patient age was 56.6 years. The mean HbA1c level was 8.0%, with 81% of men having a HbA1c level of >6%. In all, 685 (76%) implants were malleable and 217 (24%) were inflatable devices; 302 (33.5%) patients also had a diagnosis of PD. The overall infection rate was 8.9% (80/902). Patients who had implant infection had significantly higher mean HbA1c levels, 9.5% vs 7.8% (P HbA1c level, we found infection rates were: 1.3% with HbA1c level of 9.5% (P HbA1c level, whilst a high-volume surgeon had a protective effect and was associated with a reduced infection risk. Using ROC analysis, we determined that a HbA1c threshold level of 8.5% predicted infection with a sensitivity of 80% and a specificity of 65%. Uncontrolled DM is associated with increased risk of infection after penile implant surgery
Zhou, Ting; Cheng, Xudong; Pan, Yuelei; Li, Congcong; Gong, Lunlun; Zhang, Heping
2018-04-01
In order to maintain the integrity, glass fiber (GF) reinforced silica aerogel composites were synthesized using methltrimethoxysilane (MTMS) and water glass co-precursor by freeze drying method. The composites were characterized by scanning electron microscopy, Brunauer-Emmett-Teller analysis, uniaxial compressive test, three-point bending test, thermal conductivity analysis, contact angle test, TG-DSC analysis. It was found that the molar ratio of MTMS/water glass could significantly affect the properties of composites. The bulk density and thermal conductivity first decreased and then increased with the increasing molar ratio. The composites showed remarkable mechanical strength and flexibility compared with pure silica aerogel. Moreover, when the molar ratio is 1.8, the composites showed high specific surface area (870.9 m2/g), high contact angle (150°), great thermal stability (560 °C) and low thermal conductivity (0.0248 W/m·K). These outstanding properties indicate that GF/aerogels have broad prospects in the field of thermal insulation.
Nanoporous Glasses for Nuclear Waste Containment
Directory of Open Access Journals (Sweden)
Thierry Woignier
2016-01-01
Full Text Available Research is in progress to incorporate nuclear waste in new matrices with high structural stability, resistance to thermal shock, and high chemical durability. Interactions with water are important for materials used as a containment matrix for the radio nuclides. It is indispensable to improve their chemical durability to limit the possible release of radioactive chemical species, if the glass structure is attacked by corrosion. By associating high structural stability and high chemical durability, silica glass optimizes the properties of a suitable host matrix. According to an easy sintering stage, nanoporous glasses such as xerogels, aerogels, and composite gels are alternative ways to synthesize silica glass at relatively low temperatures (≈1,000–1,200°C. Nuclear wastes exist as aqueous salt solutions and we propose using the open pore structure of the nanoporous glass to enable migration of the solution throughout the solid volume. The loaded material is then sintered, thereby trapping the radioactive chemical species. The structure of the sintered materials (glass ceramics is that of nanocomposites: actinide phases (~100 nm embedded in a vitreous silica matrix. Our results showed a large improvement in the chemical durability of glass ceramic over conventional nuclear glass.
V sub 2 O sub 5 -based glasses as cathodes for lithium batteries
Energy Technology Data Exchange (ETDEWEB)
Levy, M; Duclot, M J; Rousseau, F [British Columbia Univ., Vancouver (Canada)
1989-05-01
The electronic conductivities of glasses in the TeO2-V2O5 and TeO2-V2O5-MoO3 systems have been determined in the 20-200 C temperature range to give simple Arrhenius relationships. Chemical and electrochemical lithium intercalations have been performed, showing that V2O5-based glasses are suitable positive electrode materials for lithium batteries. 20 refs.
Reaction of water with a simulated high-level nuclear waste glass at 3000C, 300 bars
International Nuclear Information System (INIS)
McCarthy, G.J.; Scheetz, B.E.; Komarneni, S.; Smith, D.K.
1978-01-01
The hydrothermal stability of high-level nuclear wastes is an important consideration in establishing waste form acceptance criteria for a geological repository in basalt. A detailed examination of the stability of a typical simulated high-level waste glass and pressurized water at 300 0 C in a closed system has shown that extensive reaction occurred within a few weeks. The water acted first as a catalyst-solvent in devitrification of the glass and in dissolution, transport, and recrystallization of some of its constituents, and, second, as a reactant in forming hydrated and hydroxylated phases. This reaction with water resulted in the conversion of a solid shard of glass into a fragmented and partially dispersed mass of crystalline and noncrystalline material plus dissolved species within two weeks. The major crystalline reaction products were found to be analogs of naturally occurring minerals: (Cs,Na,Rb) 2 (UO 2 ) 2 .(Si 2 O 5 ) 3 .4H 2 O (weeksite) and a series of pyroxene-structure phases, (Na,Ca) (Fe,Zn,Ti)Si 2 O 6 (acmite, acmite--augites). Weeksite, however, is not expected to have long-term stability in the basalt environment. Much of the Na and Mo, and almost all of the B, in the original glass was identified in the product solutions. Of the elements or analogs of long-lived, hazardous radionuclides studied in this work, only Cs was observed in these solutions in substantial amounts. Although the comparatively rapid and extensive reactions at 300 0 C would appear to require that an acceptable glass would have low waste and heat loading, it is suggested that there is good potential for favorable glass--basalt--water hydrothermal interactions. Favorable interactions would mean that, in the event of a hydrothermal incident, the interaction products would be more stable than the original waste form and would remain in the immediate repository
International Nuclear Information System (INIS)
Serra, Andre
1977-01-01
We present a study of natural and 60 Co induced conductions in radiofrequency sputtering deposed layers. Capacimetry and electronic microscopy observations permit a knowledge of the physical characteristics, mainly: homogeneity and thickness of these layers. A study of the natural current permit to characterise electrically the deposited films, the electrode and bulk insulator effects. In induced conduction, the behaviour of currents as a function of dose rate is interpreted in terms of ROSE'S and FOWLER'S photoconductivity theories. Induced currents versus applied fields are observed and compared with these obtained in the case of dielectric liquids and glasses. (author) [fr
International Nuclear Information System (INIS)
Khan, M.N.
1988-01-01
Various transition metal oxides, such as TiO 2 , V 2 O 5 , NiO, CuO, and ZnO are added to germanium-tellurite glass and measurements are reported of the electrical conductivity, density, optical absorption, infra-red absorption spectra, and electron spin resonance. It is found that the d.c. conductivity of glasses containing the same amount of V 2 O 5 is higher than that of germanium tellurite glasses containing a similar amount of other transition metal oxides, and is due to hopping between localized states. The optical absorption measurements show that the fundamental absorption edge is a function of glass composition and the optical absorption is due to forbidden indirect transitions. From the infra-red absorption spectra, it is found that the addition of transition metal oxides does not introduce any new absorption band in the infra-red spectrum of germanium tellurite glasses. A small shift of existing absorptions toward higher wave number is observed. The ESR measurements revealed that some transition metal ions are diamagnetic while others are paramagnetic in the glass network. (author)
Chemical stability of soda-alumina-zirconia-silica glasses to Na, Na2S4, and S
International Nuclear Information System (INIS)
Bloom, S.I.; Bradley, J.; Nelson, P.A.; Roche, M.F.
1985-01-01
Twenty-two glasses with a broad range of compositions, spanning the quaternary soda-alumina-zirconia-silica system, have been prepared to allow characterization of the various properties of the system. The glasses were characterized by their resistivities, energies of activation for conduction, and glass transition temperatures. The glasses were screened for compositions of especially high chemical stability of static corrosion tests in Na, S, and Na 2 S 4 for 1000h at 400 0 C. Among the glasses tested, the high soda glasses showed the smallest weight change after exposure to the three media. The weight change observed was comparable to that seen in the Dow borate glass and beta'' alumina
International Nuclear Information System (INIS)
Boltynjuk, E. V.; Ubyivovk, E. V.; Kshumanev, A. M.; Gunderov, D. V.; Lukianov, A. V.; Bednarz, A.; Valiev, R. Z.
2016-01-01
The structural properties of a Zr_6_2Cu_2_2Al_1_0Fe_5Dy_1 bulk metallic glasses were investigated. Cylindrical rods of the Zr_6_2Cu_2_2Al_1_0Fe_5Dy_1 BMG were subjected to high pressure torsion at temperatures of 20°C and 150°C. X-ray diffraction, transmission electron microscopy were used to determine peculiarities of the modified structure. Analysis of fracture surfaces, nanohardness measurements were conducted to investigate the influence of structural changes on mechanical behavior of processed samples.
Preparation of fullerene/glass composites
Mattes, Benjamin R.; McBranch, Duncan W.; Robinson, Jeanne M.; Koskelo, Aaron C.; Love, Steven P.
1995-01-01
Synthesis of fullerene/glass composites. A direct method for preparing solid solutions of C.sub.60 in silicon dioxide (SiO.sub.2) glass matrices by means of sol-gel chemistry is described. In order to produce highly concentrated fullerene-sol-gel-composites it is necessary to increase the solubility of these "guests" in a delivery solvent which is compatible with the starter sol (receiving solvent). Sonication results in aggregate disruption by treatment with high frequency sound waves, thereby accelerating the rate of hydrolysis of the alkoxide precursor, and the solution process for the C.sub.60. Depending upon the preparative procedure, C.sub.60 dispersed within the glass matrix as microcrystalline domains, or dispersed as true molecular solutions of C.sub.60 in a solid glass matrix, is generated by the present method.
Energy Technology Data Exchange (ETDEWEB)
Moriarty, K.; Johnson, C.; Sears, T.; Bergeron, P.
2009-12-01
This study reviews E85 dispensing infrastructure advances and issues and evaluates the geographic concentration of flexible fuel vehicles (FFVs), E85 stations, ethanol production facilities, and E85 suppliers. Costs, space, financial incentives, and barriers to adding E85 fueling equipment at existing stations are also assessed. This study found that E85 is increasingly available in the U.S. in half of the states; however, the other half have minimal or no E85 fueling options. Despite these gains, E85 is only available at 1% of U.S. gasoline stations. Ethanol production reached 9.5 billion gallons in 2008, but less than 1% is consumed as E85. FFVs have not reached a significant concentration in any county, metropolitan area, or state.
Shen, J.T.; Pei, Y.T.; Hosson, J.Th.M. De
2013-01-01
Tribological experiments on phenol-formaldehyde composite reinforced with polytetrafluoroethylene (PTFE) and glass fibers were performed against 100Cr6 steel and TiC/a-C:H thin film-coated 100Cr6 steel. In both cases, the coefficient of friction increases with increasing sliding distance until a
Corrosion behaviour of the WAK-HLW glass
International Nuclear Information System (INIS)
Grambow, B.; Luckscheiter, B.; Nesovic, M.
1997-01-01
Sorption studies were performed on corrosion products from the glass GP WAK1 formed over a period of 40 days in deionized water at 80 C and S/V=1000 m -1 . After 40 days the pH of the solution was adjusted to various preselected values in the pH range 2-10. The pH was kept constant during the experiments by daily addition of either HNO 3 or NaOH. The sorption experiments were run at ambient temperature and 80 C for up to 10 days using various starting concentrations of Eu, Th and U. Sorption isotherms of Eu, Th and U(VI) on corrosion products were determined in deionized water, in NaCl-rich and MgCl 2 -rich solution. Presently, data of the sorption studies in deionized water are available.Furthermore the investigations of the pH dependence of saturation concentration of silica and of the release of various glass constituent of the glass GP WAK1 were continued with studies in the MgCl 2 -rich solution 1 at 80 C. Results of these studies (30 days) are given in terms of normalized elemental mass losses. (MM)
Raman and infrared investigations of glass and glass-ceramics with composition 2Na2O·1CaO·3SiO2
Ziemath, Ervino C.; Aegerter, Michel A.
1994-01-01
Precursor glass and glass-ceramics with molar composition 2Na2O·1CaO·3SiO2 are studied by infrared, conventional, and microprobe Raman techniques. The Gaussian deconvoluted Raman spectrum of the glass presents bands at 625 and 660 cm-1, attributed to bending vibrations of Si-O-Si bonds, and at 860, 920, 975 and 1030 cm-1, attributed to symmetric stretching vibrations of SiO4 tetrahedra with 4, 3, 2, and 1 nonbridging oxygens, respectively. The Raman microprobe spectrum of a highly crystalliz...
11 CFR 100.85 - Legal or accounting services to political party committees.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Legal or accounting services to political party committees. 100.85 Section 100.85 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) Exceptions to Contributions § 100.85 Legal or accounting services to political party...
International Nuclear Information System (INIS)
Abdelouas, A.
1996-01-01
The purpose of this work is to complement an experimental program on the R7T7 nuclear waste glass alteration in brines at 190 deg C in Germany by the analysis of the structure and the chemical composition of the alteration layers, and to study the alteration of rhyolitic glasses in natural brines from Bolivia as analogue for nuclear waste glasses disposed in salt formations. Alteration experiments with the R7T7 and basaltic glasses and obsidian in MgCl 2 -CaCl 2 -saturated brine at 190 deg. C were also conducted in order to study the influence of the glass composition on the nature of the secondary phases. The experiments with the R7T7 glass in three salt brines, saturated respectively in MgCl 2 , MgCl 2 -CaCl 2 and NaCl, showed that the solubilities of most radionuclides are controlled by the secondary phases. Nd, La, and Pr are trapped in powellite, Ce in cerianite, U in coffinite, and Sr is partially immobilized in barite. These phases are stable for more than one year. There is a good similarity between the secondary phases formed experimentally on volcanic glasses and the R7T7 glass altered in MgCl 2 -CaCl 2 -saturated brine. The abundance of Mg in solution permits the formation of similar magnesian clays on the glass samples independently of the nature of the initial glasses. These results support the use of volcanic glasses alteration patterns in Mg-rich solutions to understand the long-term behavior of nuclear waste glasses and to evaluate the stability of the secondary phases. The study of the sediments of Uyuni (Bolivia) showed that the corrosion rate of the rhyolitic glass in brines at 10 deg. C is 12 to 30 time lower than those of rhyolitic glasses altered in high dilute conditions. The low alteration rate of rhyolitic glasses in brines and the formation of secondary phases such as smectite, barite and cerianite (also formed during the experimental alteration of the R7T7 glass), permit us to expect the low alteration of nuclear waste glasses at long
Stability of medium range order in Al-based metallic glass compacted by severe plastic deformation
Energy Technology Data Exchange (ETDEWEB)
Kovács, Zs.; Henits, P. [Department of Materials Physics, Eötvös University, P.O.B. 32, H-1518 Budapest (Hungary); Varga, L.K. [Research Institute for Solid state Physics and Optics, Hungarian Academy of Sciences, P.O.B. 49, H-1525 Budapest (Hungary); Schafler, E. [Physics of Nanostructured Materials, Faculty of Physics, University of Vienna, A-1090 Vienna (Austria); Révész, Á., E-mail: reveszadam@ludens.elte.hu [Department of Materials Physics, Eötvös University, P.O.B. 32, H-1518 Budapest (Hungary)
2013-06-05
Highlights: ► High pressure torsion has been applied to produce low-porosity bulk Al-based amorphous specimens. ► The compacted disks possess higher hardness than the original glass. ► Mechanical and thermal impacts have only minor effects on the glassy structure. ► Medium range order is an inherent feature of the amorphous state. -- Abstract: High pressure torsion has successfully been applied to produce low-porosity, bulk specimens from Al-based metallic glass ribbons (Al{sub 85}Y{sub 8}Ni{sub 5}Co{sub 2}, Al{sub 85}Ce{sub 8}Ni{sub 5}Co{sub 2} and Al{sub 85}Gd{sub 8}Ni{sub 5}Co{sub 2}). The compacted disks possess higher hardness than the original glass and have substantial glass fraction with nanocrystalline precipitations. Mechanical and thermal impacts have only minor effects on the glassy structure as demonstrated by the stability of the X-ray diffraction halo positions. Unchanged halos reveal that medium range order is a key characteristic of the amorphous state.
Wine glass size and wine sales: a replication study in two bars.
Pechey, Rachel; Couturier, Dominique-Laurent; Hollands, Gareth J; Mantzari, Eleni; Zupan, Zorana; Marteau, Theresa M
2017-08-01
Wine glass size may influence perceived volume and subsequently purchasing and consumption. Using a larger glass to serve the same portions of wine was found to increase wine sales by 9.4% (95% CI 1.9, 17.5) in a recent study conducted in one bar. The current study aimed to replicate this previous work in two other bars using a wider range of glass sizes. To match the previous study, a repeated multiple treatment reversal design, during which wine was served in glasses of the same design but different sizes, was used. The study was conducted in two bars in Cambridge, England, using glass sizes of 300, 370, 510 ml (Bar 1) and 300 and 510 ml (Bar 2). Customers purchased their choice of a 750 ml bottle, or standard UK measures of 125, 175 or 250 ml of wine, each of which was served with the same glass. Bar 1 Daily wine volume (ml) purchased was 10.5% (95% CI 1.0, 20.9) higher when sold in 510 ml compared to 370 ml glasses; but sales were not significantly higher with 370 ml versus 300 ml glasses (6.5%, 95% CI -5.2, 19.6). Bar 2 Findings were inconclusive as to whether daily wine purchased differed when using 510 ml versus 300 ml glasses (-1.1%, 95% CI -12.6, 11.9). These results provide a partial replication of previous work showing that introducing larger glasses (without manipulating portion size) increases purchasing. Understanding the mechanisms by which wine glass size influences consumption may elucidate when the effect can be expected and when not. Trial registration This study is a replication study, based on the procedure set out in the trial registration for the study that it attempts to replicate (ISRCTN registry: ISRCTN12018175).
Dicty_cDB: Contig-U10823-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1
Conduction Mechanisms and Structure of Ionomeric Single-Ion Conductors
Energy Technology Data Exchange (ETDEWEB)
Colby, Ralph H. [Pennsylvania State Univ., University Park, PA (United States); Maranas, Janna K. [Pennsylvania State Univ., University Park, PA (United States); Mueller, Karl T. [Pennsylvania State Univ., University Park, PA (United States); Runt, James [Pennsylvania State Univ., University Park, PA (United States); Winey, Karen I. [Univ. of Pennsylvania, Philadelphia, PA (United States)
2015-03-01
Our team has designed using DFT (Gaussian) and synthesized low glass transition temperature single-ion conductors that are either polyanions that conduct small cations Li+, Na+, Cs+ or polycations that conduct small anions F-, OH-, Br-. We utilize a wide range of complimentary experimental materials characterization tools to understand ion transport; differential scanning calorimetry, dielectric relaxation spectroscopy, infrared spectroscopy, nuclear magnetic resonance spectroscopy, linear viscoelasticity, X-ray scattering and molecular dynamics simulations. The glass transition temperature Tg needs to be as low as possible to facilitate ion transport, so the nonionic parts of the polymer need to be polar, flexible and have strong solvation interactions with the ions. The lowest Tg we have managed for polyanions conducting Li+ is -60 °C. In contrast, polysiloxanes with PEO side chains and tetrabutylphosphonium cationic side groups have Tg ≈ -75 °C that barely increases with ion content, as anticipated by DFT. A survey of all polyanions in the literature suggests that Tg < -80 °C is needed to achieve the 10-4 S/cm conductivity needed for battery separators.
Modeling of solution renewal with the Kindis code: example of R7T7 glass dissolution at 90 deg C
International Nuclear Information System (INIS)
Advocat, T.; Vernaz, E.; Crovisier, J.L.; Clement, A.; Gerard, F.
1994-01-01
The deep underground environment that would correspond to a geological repository is a system open to fluid flow. It is therefore necessary to investigate the effects of solution renewal on the long-term behavior of glass in contact with water. These effects can now be simulated using the new version of the geochemical KINDIS model (thermodynamic and kinetic model). We tested the model at 90 deg C with an SA/V ratio of 400 m -1 at twelve renewal rates of pure water ranging from 200 to 0 vol% per day. With renewal rates between 200 and 0.065 vol% per day, steady-state conditions were obtained in the reaction system: i.e. the glass corrosion rate remained constant as did the concentrations of the dissolved species in solution (although at different values depending on the renewal rate). The ionic strength never exceeded 1 (the validity limit for the DEBYE-HUCKEL law) and long term predictions of the dissolved glass mass, the solution composition and the potential secondary mineral sequence are possible. For simulated renewal rates of less than 0.065 vol% per day (27% per year), the ionic strength rose above 1 (as in a closed system) before steady-state conditions were reached, making it critical to calculate long-term rates; A constant and empirical long-term rate, derived from laboratory measurement, have to be extrapolated. These calculations were based on a first order equation to describe the glass dissolution kinetic. The results obtained with the KINDIS code show discrepancies with some major experimental kinetic data (the long term rate must decrease with the ''glass-water'' reaction progress, under silica saturation conditions). This clearly indicates that a more refine kinetic relation is needed for the glass matrix. (authors). 16 refs., 4 figs., 4 tabs
Effect of Chemical Reactions on the Hydrologic Properties of Fractured and Rubbelized Glass Media
International Nuclear Information System (INIS)
Saripalli, Prasad; Meyer, P D.; Parker, Kent E.; Lindberg, Michael J.
2005-01-01
Understanding the effect of chemical reactions on the hydrologic properties of geological media, such as porosity, permeability and dispersivity, is critical to many natural and engineered sub-surface systems. Influence of glass corrosion (precipitation and dissolution) reactions on fractured and rubbelized (crushed) forms HAN28 and LAWBP1, two candidate waste glass forms for a proposed immobilized low-activity waste (ILAW) disposal facility at the Hanford, WA site, was investigated. Flow and tracer transport experiments were conducted using fractured and rubbelized forms, before and after subjecting them to corrosion using Vapor Hydration Testing (VHT) at 200 C temperature and 200 psig pressure, causing the precipitation of alteration products. Data were analyzed using analytical expressions and CXTFIT, a transport parameter optimization code, for the estimation of the hydrologic characteristics before and after VHT. It was found that glass reactions significantly influence the hydrologic properties of ILAW glass media. Hydrologic properties of rubbelized glass decreased due to precipitation reactions, whereas those of fractured glass media increased due to reaction which led to unconfined expansion of fracture aperture. The results are unique and useful to better understand the effect of chemical reactions on the hydrologic properties of fractured and rubbelized stony media in general and glass media in particular
International Nuclear Information System (INIS)
Haskel, D.; Stern, E.A.; Polinger, V.; Dogan, F.
2001-01-01
The effect of Ni substitution upon the local structure of La 1.85 Sr 0.15 Cu 1-y Ni y O 4 is commonly neglected when addressing the Ni-induced destruction of the superconducting state at y≅0.03 and a metal-insulator transition at y≅0.05. It is also sometimes assumed that direct substitution of a dopant into the CuO 2 planes has a detrimental effect on superconductivity due to in-plane lattice distortions around the dopants. We present here results from angular-dependent x-ray absorption fine structure (XAFS) measurements at the Ni, La and Sr K-edges of oriented powders of La 1.85 Sr 0.15 Cu 1-y Ni y O 4 with y=0.01, 0.03, 0.06. A special magnetic alignment geometry allowed us to measure pure c and (subform(ab)) oriented XAFS at the Ni K-edge in identical fluorescence geometries. Both the near-edge absorption spectra (XANES) and the XAFS unequivocally show that the NiO 6 octahedra are largely contracted along the c-axis, by ≅ 0.16 Aa. Surprisingly, the Ni-O planar bonds and the Ni-O-Cu/Ni planar buckling angle are nearly identical to their Cu counterparts. The NiO 6 octahedral contraction drives the macroscopic c-axis contraction observed with Ni-doping. The local c-axis strongly fluctuates, due to the different NiO 6 and CuO 6 octahedral configurations and the much stronger bonding of a La +3 ion than a Sr +2 ion to the O(2) apical oxygens. We discuss the relevance of these findings to the mechanisms of T c suppresion and hole-localization by Ni dopants
Energy Technology Data Exchange (ETDEWEB)
Bahgat, A.A., E-mail: alaabahgat@hotmail.com; Heikal, Sh.; Mahdy, Iman A.; Abd-Rabo, A.S.; Abdel Ghany, A.
2014-08-15
In this present work a glass of the composition 22.5 BaTiO{sub 3}+7.5 PbTiO{sub 3}+70 V{sub 2}O{sub 5} was prepared by applying the conventional melt quashing technique. Isothermal annealing of the glass was applied at 732 K following differential scanning calorimetric analysis. The annealing was performed during different time intervals in the range of 0.25–24.0 h. X-ray diffraction and transmission electron microscopy were used to identify different phases as well as particle size precipitated during the annealing process. Nanocomposite glass-ceramic precipitation was recognized with nonperiodic cyclic particle sizes as a function of the annealing period. DC electrical conductivity, on the other hand, was conducted in the temperature range from 300 to 625 K. Electrical conductivity enhancement of the order 3×10{sup 3} times after 2.5 h of annealing was observed. Nonperiodic cyclic DC electrical conductivity behavior was also observed and which was encountered in a reverse manner with particle size development. Furthermore, the analysis of the electrical conduction mechanism predicts that both adiabatic and nonadiabatic small polaron hopping trend may describe the experimental data depending on the particle size.
Fragility, anharmonicity and anelasticity of silver borate glasses
International Nuclear Information System (INIS)
Carini, Giovanni; Carini, Giuseppe; D'Angelo, Giovanna; Tripodo, Gaspare; Bartolotta, Antonio; Marco, Gaetano Di
2006-01-01
The fragility and the anharmonicity of (Ag 2 O) x (B 2 O 3 ) 1-x borate glasses have been quantified by measuring the change in the specific heat capacity at the glass transition temperature T g and the room-temperature thermodynamic Grueneisen parameter. Increasing the silver oxide content above X = 0.10 leads to an increase of both the parameters, showing that a growing fragility of a glass-forming liquid is predictive of an increasing overall anharmonicity of its glassy state. The attenuation and velocity of ultrasonic waves of frequencies in the range of 10-70 MHz have also been measured in silver borate glasses as a function of temperature between 1.5 and 300 K. The experimental data reveal anelastic behaviours which are governed by (i) quantum-mechanical tunnelling below 20 K (ii) thermally activated relaxations between 20 and 200 K and (iii) vibrational anharmonicity at even higher temperatures. Evaluation of tunnelling (C) and relaxation (C * ) strengths shows that C is independent of the structural changes affecting the borate network with increasing metal oxide content and is at least one order of magnitude smaller than C * . The latter observation implies that only a small fraction of the locally mobile defects are subjected to tunnelling motions