Energy Technology Data Exchange (ETDEWEB)
Hashimoto, K.; Hasegawa, H.; Saikawa, M.; Iwatsubo, T.; Mimaki, T. [Central Research Institute of Electric Power Industry, Tokyo (Japan)
1996-03-01
Performance of two-stage compression and cascade heating heat pump cycle was evaluated in the case using alternative refrigerant, HFC-134a, instead of CFC-12 through calculations and experiments. Heat source and heat load temperature conditions of CFC-12, HFC-134a, and HCFC-22 were calculated. As a result, this cycle provided equivalent coefficient of performance to use of CFC-12 and HCFC-22. Especially for HFC-134a, discharge gas temperature from compressor was much lower than that of the others, which prevented the heat decomposition of refrigerant. It was found that HFC-134a was suitable refrigerant for high temperature output equipment like this cycle. To grasp the possibility of hot water supply at 65 {degree}C and behavior of lubricating oil which can not be obtained only from calculations, applicability of HFC-134a was investigated. Experiments were conducted using a small test apparatus with electric input of 2 kW. As a result, satisfactory performance was obtained for each evaluation item. Applicability of HFC-134a to the two-stage compression cycle was confirmed. 9 refs., 21 figs., 16 tabs.
Complexon Solutions in Freon for Decontamination of Solids and SNF Treatment
International Nuclear Information System (INIS)
Kamachev, V.; Shadrin, A.; Murzin, A.
2008-01-01
Full text of publication follows: The possibility of using complexon solutions in supercritical and compressed carbon dioxide for decontamination of solid surfaces and for spent nuclear fuel (SNF) treatment was demonstrated in the works of Japanese, Russian and American researchers. The obtained data showed that the use of complexon solutions in carbon dioxide sharply decreases the volume of secondary radioactive wastes because it can be easily evaporated, purified and recycled. Moreover, high penetrability of carbon dioxide allows decontamination of surfaces with complex shape. However, one of the disadvantages of carbon dioxide is its high working pressure (10-20 MPa for supercritical CO 2 and 7 MPa for compressed CO 2 ). Moreover, in case of SNF treatment, carbon dioxide solvent will be contaminated with 14 C, which in the course of SNF dissolution in CO 2 containing TBP*HNO 3 adduct stage will be oxidized into CO 2 . These main disadvantages can be eliminated by using complexon solutions in ozone-friendly Freon HFC-134a for decontamination and SNF treatment. Our experimental data for real contaminated materials showed that the decontamination factor for complexon solutions in liquid Freon HFC-134a at 1,2 MPa and 25 deg. C is close to that attained in carbon dioxide. Moreover, the possibility of SNF treatment in Freon HFC-134a was demonstrated in trials using real SNF and its imitators. (authors)
Isothermal phase equilibria for the (HFC-32 + HFC-134a) mixed-gas hydrate system
International Nuclear Information System (INIS)
Miyauchi, Hiroshi; Yasuda, Kenjiro; Matsumoto, Yuuki; Hashimoto, Shunsuke; Sugahara, Takeshi; Ohgaki, Kazunari
2012-01-01
Highlights: ► Structural phase transition results in the heterogeneous azeotropic-like behaviour. ► HFC-134a molecules, in spite of an s-II former, occupy the large cages of s-I. ► Negative azeotropic-like behaviour becomes more remarkable at higher temperatures. - Abstract: Isothermal phase equilibria (pressure-composition relations in hydrate, gas, and aqueous phases) in the {difluoromethane (HFC-32) + 1,1,1,2-tetrafluoroethane (HFC-134a)} mixed-gas hydrate system were measured at the temperatures 274.15 K, 279.15 K, and 283.15 K. The heterogeneous azeotropic-like behaviour derived from the structural phase transition of (HFC-32 + HFC-134a) mixed-gas hydrates appears over the whole temperature range of the present study. In addition to the heterogeneous azeotropic-like behaviour, the isothermal phase equilibrium curves of the (HFC-32 + HFC-134a) mixed-gas hydrate system exhibit the negative homogeneous azeotropic-like behaviour at temperatures 279.15 K and 283.15 K. The negative azeotropic-like behaviour, which becomes more remarkable at higher temperatures, results in the lower equilibrium pressure of (HFC-32 + HFC-134a) mixed-gas hydrates than those of both simple HFC-32 and HFC-134a hydrates. Although the HFC-134a molecule forms the simple structure-II hydrate at the temperatures, the present findings reveal that HFC-134a molecules occupy a part of the large cages of the structure-I mixed-gas hydrate.
Rate constants for the reactions of OH with HFC-134a (CF3CH2F) and HFC-134 (CHF2CHF2)
Demore, W. B.
1993-01-01
Measurements of rate constants for HFC-134 (CF2HCF2H) relative to CH3CCl3, HFC-125, and HFC-134a are reported. The measurements were made in a slow-flow, temperature controlled photochemical reactor, and were based on relative rates of disappearance of the parent compounds as measured by FTIR spectroscopy. Hydroxyl radicals were generated by 254-nm photolysis of O3 in the presence of water vapor. NASA/JPL rate constants for the reference compounds are used to derive temperature-dependent rate constants of both compounds. Rate constants obtained from the different reference compounds are in excellent agreement. The presently recommended rate constant for HFC-134a is about 25 percent too high.
Resolution of the uncertainties in the radiative forcing of HFC-134a
International Nuclear Information System (INIS)
Forster, Piers M. de F; Burkholder, J.B.; Clerbaux, C.; Coheur, P.F.; Dutta, M.; Gohar, L.K.; Hurley, M.D.; Myhre, G.; Portmann, R.W.; Shine, K.P.; Wallington, T.J.; Wuebbles, D.
2005-01-01
HFC-134a (CF 3 CH 2 F) is the most rapidly growing hydrofluorocarbon in terms of atmospheric abundance. It is currently used in a large number of household refrigerators and air-conditioning systems and its concentration in the atmosphere is forecast to increase substantially over the next 50-100 years. Previous estimates of its radiative forcing per unit concentration have differed significantly ∼25%. This paper uses a two-step approach to resolve this discrepancy. In the first step six independent absorption cross section datasets are analysed. We find that, for the integrated cross section in the spectral bands that contribute most to the radiative forcing, the differences between the various datasets are typically smaller than 5% and that the dependence on pressure and temperature is not significant. A 'recommended' HFC-134a infrared absorption spectrum was obtained based on the average band intensities of the strongest bands. In the second step, the 'recommended' HFC-134a spectrum was used in six different radiative transfer models to calculate the HFC-134a radiative forcing efficiency. The clear-sky instantaneous radiative forcing, using a single global and annual mean profile, differed by 8%, between the 6 models, and the latitudinally-resolved adjusted cloudy sky radiative forcing estimates differed by a similar amount. We calculate that the radiative forcing efficiency of HFC-134a is 0.16+/-0.02Wm -2 ppbv -1
Experimental study of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator
International Nuclear Information System (INIS)
Wongwises, Somchai; Chimres, Nares
2005-01-01
This work presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). A refrigerator designed to work with HFC-134a with a gross capacity of 239 l is used in the experiment. The consumed energy, compressor power and refrigerant temperature and pressure at the inlet and outlet of the compressor are recorded and analysed as well as the distributions of temperature at various positions in the refrigerator. The refrigerant mixtures used are divided into three groups: the mixture of three hydrocarbons, the mixture of two hydrocarbons and the mixture of two hydrocarbons and HFC-134a. The experiments are conducted with the refrigerants under the same no load condition at a surrounding temperature of 25 deg. C. The results show that propane/butane 60%/40% is the most appropriate alternative refrigerant to HFC-134a
Experimental evaluation of automotive air-conditioning using HFC-134a and HC-134a
Nasution, Henry; Zainudin, Muhammad Amir; Aziz, Azhar Abdul; Latiff, Zulkarnain Abdul; Perang, Mohd Rozi Mohd; Rahman, Abd Halim Abdul
2012-06-01
An experimental study to evaluate the energy consumption of an automotive air conditioning is presented. In this study, these refrigerants will be tested using the experimental rig which simulated the actual cars as a cabin complete with a cooling system component of the actual car that is as the blower, evaporator, condenser, radiators, electric motor, which acts as a vehicle engine, and then the electric motor will operate the compressor using a belt and pulley system, as well as to the alternator will recharge the battery. The compressor working with the fluids HFC-134a and HC-134a and has been tested varying the speed in the range 1000, 1500, 2000 and 2500 rpm. The measurements taken during the one hour experimental periods at 2-minutes interval times for temperature setpoint of 20°C with internal heat loads 0, 500, 700 and 1000 W. The final results of this study show an overall better energy consumption of the HFC-134a compared with the HC-134a.
Global emissions of refrigerants HCFC-22 and HFC-134a: Unforeseen seasonal contributions
Xiang, Bin; Montzka, Stephen A.; Miller, Scot M.; Elkins, James W.; Moore, Fred L.; Atlas, Elliot L.; Miller, Ben R.; Weiss, Ray F.; Prinn, Ronald G.; Wofsy, Steven C.
2014-01-01
HCFC-22 (CHClF2) and HFC-134a (CH2FCF3) are two major gases currently used worldwide in domestic and commercial refrigeration and air conditioning. HCFC-22 contributes to stratospheric ozone depletion, and both species are potent greenhouse gases. In this work, we study in situ observations of HCFC-22 and HFC-134a taken from research aircraft over the Pacific Ocean in a 3-y span [HIaper-Pole-to-Pole Observations (HIPPO) 2009–2011] and combine these data with long-term ground observations from global surface sites [National Oceanic and Atmospheric Administration (NOAA) and Advanced Global Atmospheric Gases Experiment (AGAGE) networks]. We find the global annual emissions of HCFC-22 and HFC-134a have increased substantially over the past two decades. Emissions of HFC-134a are consistently higher compared with the United Nations Framework Convention on Climate Change (UNFCCC) inventory since 2000, by 60% more in recent years (2009–2012). Apart from these decadal emission constraints, we also quantify recent seasonal emission patterns showing that summertime emissions of HCFC-22 and HFC-134a are two to three times higher than wintertime emissions. This unforeseen large seasonal variation indicates that unaccounted mechanisms controlling refrigerant gas emissions are missing in the existing inventory estimates. Possible mechanisms enhancing refrigerant losses in summer are (i) higher vapor pressure in the sealed compartment of the system at summer high temperatures and (ii) more frequent use and service of refrigerators and air conditioners in summer months. Our results suggest that engineering (e.g., better temperature/vibration-resistant system sealing and new system design of more compact/efficient components) and regulatory (e.g., reinforcing system service regulations) steps to improve containment of these gases from working devices could effectively reduce their release to the atmosphere. PMID:25422438
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
This survey was aimed at collecting the basic data for studying a possibility of conversion of the recovery system of refrigerant freons, mostly DFC, into HFC, etc., which has been proceeded with in Japan. Of HFCs, PFCs and SF{sub 6} used for survey, only SF{sub 6} is now being recovered and processed. As to HFCs, HFC-134a was arranged, and the recovery/destruction to meet users' handling methods are requested because of the diverse usage and users. The points of the control of emissions of chemical substances into the atmosphere are the decrease in number of times of transport/filling-up at the time of materials handling and the closed system in plants and installation. If considering the heightening of efficiency of materials flow, requested are the decrease in number of times of transport/filling-up, the increase in quantity received by users, and measures to be taken for leakage at the time of receiving. In relation to the conversion of the recovery system of refrigerant freons, mainly CFC, into HFC, etc., all the industries concerned with the generation of the used substances to the materials flow have to promote the technical development for the structure and recovery in cooperation with each other. (NEDO)
Haase, Karl B.; Busenberg, Eurybiades; Plummer, Niel; Casile, Gerolamo; Sanford, Ward E.
2014-01-01
A new analytical method using gas chromatography with an atomic emission detector (GC–AED) was developed for measurement of ambient concentrations of hydrochlorofluorocarbons (HCFCs) and hydrofluorocarbons (HFCs) in soil, air, and groundwater, with the goal of determining their utility as groundwater age tracers. The analytical detection limits of HCFC-22 (difluorochloromethane, CHClF2) and HFC-134a (1,2,2,2-tetrafluoroethane, C2H2F4) in 1 L groundwater samples are 4.3 × 10− 1 and 2.1 × 10− 1 pmol kg− 1, respectively, corresponding to equilibrium gas-phase mixing ratios of approximately 5–6 parts per trillion by volume (pptv). Under optimal conditions, post-1960 (HCFC-22) and post-1995 (HFC-134a) recharge could be identified using these tracers in stable, unmixed groundwater samples. Ambient concentrations of HCFC-22 and HFC-134a were measured in 50 groundwater samples from 27 locations in northern and western parts of Virginia, Tennessee, and North Carolina (USA), and 3 unsaturated-zone profiles were collected in northern Virginia. Mixing ratios of both HCFC-22 and HFC-134a decrease with depth in unsaturated-zone gas profiles with an accompanying increase in CO2 and loss of O2. Apparently, ambient concentrations of HCFC-22 and HFC-134a are readily consumed by methanotrophic bacteria under aerobic conditions in the unsaturated zone. The results of this study indicate that soils are a sink for these two greenhouse gases. These observations contradict the previously reported results from microcosm experiments that found that degradation was limited above-ambient HFC-134a. The groundwater HFC and HCFC concentrations were compared with concentrations of chlorofluorocarbons (CFCs, CFC-11, CFC-12, CFC-113) and sulfur hexafluoride (SF6). Nearly all samples had measured HCFC-22 or HFC-134a that were below concentrations predicted by the CFCs and SF6, with many samples showing a complete loss of HCFC-22 and HFC-134a. This study indicates that HCFC-22 and HFC-134
Brunner, Dominik; Arnold, Tim; Henne, Stephan; Manning, Alistair; Thompson, Rona L.; Maione, Michela; O'Doherty, Simon; Reimann, Stefan
2017-09-01
Hydrofluorocarbons (HFCs) are used in a range of industrial applications and have largely replaced previously used gases (CFCs and HCFCs). HFCs are not ozone-depleting but have large global warming potentials and are, therefore, reported to the United Nations Framework Convention on Climate Change (UNFCCC). Here, we use four independent inverse models to estimate European emissions of the two HFCs contributing the most to global warming (HFC-134a and HFC-125) and of SF6 for the year 2011. Using an ensemble of inverse models offers the possibility to better understand systematic uncertainties in inversions. All systems relied on the same measurement time series from Jungfraujoch (Switzerland), Mace Head (Ireland), and Monte Cimone (Italy) and the same a priori estimates of the emissions, but differed in terms of the Lagrangian transport model (FLEXPART, NAME), inversion method (Bayesian, extended Kalman filter), treatment of baseline mole fractions, spatial gridding, and a priori uncertainties. The model systems were compared with respect to the ability to reproduce the measurement time series, the spatial distribution of the posterior emissions, uncertainty reductions, and total emissions estimated for selected countries. All systems were able to reproduce the measurement time series very well, with prior correlations between 0.5 and 0.9 and posterior correlations being higher by 0.05 to 0.1. For HFC-125, all models estimated higher emissions from Spain + Portugal than reported to UNFCCC (median higher by 390 %) though with a large scatter between individual estimates. Estimates for Germany (+140 %) and Ireland (+850 %) were also considerably higher than UNFCCC, whereas the estimates for France and the UK were consistent with the national reports. In contrast to HFC-125, HFC-134a emissions from Spain + Portugal were broadly consistent with UNFCCC, and emissions from Germany were only 30 % higher. The data suggest that the UK over-reports its HFC-134a emissions to
International Nuclear Information System (INIS)
Wongwises, Somchai; Kamboon, Amnouy; Orachon, Banchob
2006-01-01
This paper presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in automotive air conditioners. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). The measured data are obtained from an automotive air conditioning test facility utilizing HFC-134a as the refrigerant. The air conditioner, with a capacity of 3.5 kW driven by a Diesel engine, is charged and tested with four different ratios of hydrocarbon mixtures. The experiments are conducted at the same surrounding conditions. The temperature and pressure of the refrigerant at every major position in the refrigerant loop, the temperature, flow rate and humidity of air, torque and engine speed are recorded and analyzed. The parameters investigated are the refrigeration capacity, the compressor power and the coefficient of performance (COP). The results show that propane/butane/isobutane: 50%/40%/10% is the most appropriate alternative refrigerant to replace HFC-134a, having the best performance of all the hydrocarbon mixtures investigated
Directory of Open Access Journals (Sweden)
D. Brunner
2017-09-01
Full Text Available Hydrofluorocarbons (HFCs are used in a range of industrial applications and have largely replaced previously used gases (CFCs and HCFCs. HFCs are not ozone-depleting but have large global warming potentials and are, therefore, reported to the United Nations Framework Convention on Climate Change (UNFCCC. Here, we use four independent inverse models to estimate European emissions of the two HFCs contributing the most to global warming (HFC-134a and HFC-125 and of SF6 for the year 2011. Using an ensemble of inverse models offers the possibility to better understand systematic uncertainties in inversions. All systems relied on the same measurement time series from Jungfraujoch (Switzerland, Mace Head (Ireland, and Monte Cimone (Italy and the same a priori estimates of the emissions, but differed in terms of the Lagrangian transport model (FLEXPART, NAME, inversion method (Bayesian, extended Kalman filter, treatment of baseline mole fractions, spatial gridding, and a priori uncertainties. The model systems were compared with respect to the ability to reproduce the measurement time series, the spatial distribution of the posterior emissions, uncertainty reductions, and total emissions estimated for selected countries. All systems were able to reproduce the measurement time series very well, with prior correlations between 0.5 and 0.9 and posterior correlations being higher by 0.05 to 0.1. For HFC-125, all models estimated higher emissions from Spain + Portugal than reported to UNFCCC (median higher by 390 % though with a large scatter between individual estimates. Estimates for Germany (+140 % and Ireland (+850 % were also considerably higher than UNFCCC, whereas the estimates for France and the UK were consistent with the national reports. In contrast to HFC-125, HFC-134a emissions from Spain + Portugal were broadly consistent with UNFCCC, and emissions from Germany were only 30 % higher. The data suggest that the UK over
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
Aspen Systems and a team of nineteen agencies and industry participants conducted a series of tests to determine the performance of HFC-134a, HCFC-22, and CFC-502 for supermarket application. This effort constitutes the first phase of a larger project aimed at carrying out both laboratory and demonstration tests of the most viable HFC refrigerants and the refrigerants they replace. The results of the Phase I effort are presented in the present report. The second phase of the project has also been completed. It centered on testing all viable HFC replacement refrigerants for CFC-502. These were HFC-507, HFC-404A, and HFC-407A. The latter results are published in the Phase II report for this project. As part of Phase I, a refrigeration rack utilizing a horizontal open drive screw compressor was constructed in our laboratory. This refrigeration rack is a duplicate of one we have installed in a supermarket in Clifton Park, NY.
Viscosity Measurements and Correlations for 1,1,1,2-tetrafluoroethane (HFC-134a) up to 140 MPa
DEFF Research Database (Denmark)
Comuñas, M.J.P.; Baylaucq, A.; Cisneros, Sergio
2003-01-01
In spite of being one of the most studied refrigerants, large discrepancies in the experimental determination of the dynamic viscosity of 1, 1, 1,2-tetrafluoroethane (HFC-134a) prevail. Additionally, there is a need for supplementary high-pressure measurements that can help to derive sound general...... correlations for the viscosity of this compound. Hence, in this work new dynamic viscosity measurements for HFC-134a using a falling-body viscometer in the temperature range of 293.15-373.15 K and pressures up to 140 MPa are presented. This work high-pressure data in combination with already published data...
Energy Technology Data Exchange (ETDEWEB)
El-Sharkawy, Ibrahim I.; Saha, Bidyut B.; Koyama, Shigeru [Interdisciplinary Graduate School of Engineering Sciences, Kyushu University, Kasuga-koen 6-1, Kasuga-shi, Fukuoka 816-8580 (Japan); Srinivasan, Kandadai [School of Engineering and Logistics, Charles Darwin University, Darwin NT 0909 (Australia)
2007-03-15
The purpose of this paper is to provide empirical correlations for isosteric heats of adsorption on carbon based adsorbents for two refrigerants namely ethanol and HFC 134a. A non-dimensional correlation which partitions the contributions of the concentration and temperature dependence is proposed. The correlation is tested out against data obtained from experimental isotherms of ethanol adsorption on activated carbon fibers [ACF (A-20) and ACF (A-15)] and HFC 134a on two specimens of activated carbon powders and one specimen of carbon granules. It is expected that the suggested correlation will be useful for designers of adsorption chillers where indenting heat inventories fulcrums on the magnitude of isosteric heat of adsorption. (author)
Directory of Open Access Journals (Sweden)
Mani Kolandavel
2008-01-01
Full Text Available This paper presents an experimental study on the replacement of CFC12 and HFC134a by the new R290/R600a refrigerant mixture as drop-in replacement refrigerant with and without the effect of magnetic field. Without any modification to the system components drop-in experimental tests were performed on a vapour compression refrigeration system with a reciprocating compressor, which was originally designed to operate with CFC12.The test results with no magnets showed that the refrigerant R290/R600a had 19.9-50.1% higher refrigerating capacity than R12 and 28.6-87.2% than R134a. The mixture R290/R600a consumed 6.8- -17.4% more energy than R12. The coefficient of performance of R290/R600a mixture increases from 3.9-25.1% than R12 at lower evaporating temperatures and 11.8-17.6% at higher evaporating temperatures. The effect of magnetic field force reduced the compressor energy consumption by 1.5-2.5% than with no magnets. The coefficient of performance of the system was higher in the range 1.5-2.4% with the effect of magnetic field force. The R290/600a (68/32 by wt.% mixture can be considered as an excellent alternative refrigerant for CFC12 and HFC134a systems.
Ernstgård, Lena; Lind, Birger; Andersen, Melvin E; Johanson, Gunnar
2010-01-01
Blood-air and tissue-blood coefficients (lambda) are essential to characterize the uptake and disposition of volatile substances, e.g. by physiologically based pharmacokinetic (PBPK) modelling. Highly volatile chemicals, including many hydrofluorocarbons (HFC) have low solubility in liquid media. These characteristics pose challenges for determining lambda values. A modified head-space vial equilibrium method was used to determine lambda values for five widely used HFCs. The method is based on automated head-space gas chromatography and injection of equal amount of chemical in two head-space vials with identical air phase volumes but different volumes of the liquid phase. The liquids used were water (physiological saline), fresh human blood, and olive oil. The average lambda values (n = 8) were as follows: 1,1-difluoroethane (HFC152a) - 1.08 (blood-air), 1.11 (water-air) and 5.6 (oil-air); 1,1,1-trifluoroethane (HFC143a) - 0.15, 0.15 and 1.90; 1,1,1,2-tetrafluoroethane (HFC134a) - 0.36, 0.35 and 3.5; 1,1,1,2,2-pentafluoroethane (HFC125) - 0.083, 0.074 and 1.71; and 1,1,1,3,3-pentafluoropropane (HFC245fa) - 0.62, 0.58 and 12.1. The lambda values appeared to be concentration-independent in the investigated range (2-200 ppm). In spite of the low lambda values, the method errors were modest, with coefficients of variation of 9, 11 and 10% for water, blood and oil, respectively.
Barletta, B.; Nissenson, P.; Meinardi, S.; Dabdub, D.; Sherwood Rowland, F.; Vancuren, R. A.; Pederson, J.; Diskin, G. S.; Blake, D. R.
2011-03-01
This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS) study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB), which includes much of Los Angeles (LA) County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg) and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg) in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO) enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr-1 for HFC-152a and 2.12 ± 0.28 Gg yr-1 for HFC-134a) and then extrapolated to the United States (32 ± 4 Gg yr-1 for HFC-152a and 43 ± 6 Gg yr-1 for HFC-134a) using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.
Emmen, H.H.; Hoogendijk, E.M.G.; Klöpping-Ketelaars, W.A.A.; Muijser, H.; Duistermaat, E.; Ravensberg, J.C.; Alexander, D.J.; Borkhataria, D.; Rusch, G.M.; Schmit, B.
2000-01-01
HFC 134a (1,1,1,2-tetrafluoroethane) and HFC 227 (1,1,1,2,3,3,3-heptafluoropropane) are used to replace chlorofluorocarbons (CFCs) in refrigerant and aerosol applications, including medical use in metered-dose inhalers. Production and consumption of CFCs are being phased out under the Montreal
Choked flow mechanism of HFC-134a flowing through short-tube orifices
Energy Technology Data Exchange (ETDEWEB)
Nilpueng, Kitti; Wongwises, Somchai [Fluid Mechanics, Thermal Engineering and Multiphase Flow Research Lab (FUTURE), Department of Mechanical Engineering, King Mongkut' s University of Technology Thonburi, Bangmod, Bangkok (Thailand)
2011-02-15
This paper is a continuation of the author's previous work. New experimental data on the occurrence of choked flow phenomenon and mass flow rate of HFC-134a inside short-tube orifices under choked flow condition are presented. Short-tube orifices diameters ranging from 0.406 mm to 0.686 mm with lengths ranging from 1 mm to 3 mm which can be applied to a miniature vapour-compression refrigeration system are examined. The experimental results indicated that the occurrence of choked flow phenomena inside short-tube orifices is different from that obtained from short-tube orifice diameters of greater than 1 mm, which are typically used in air-conditioner. The beginning of choked flow is dependent on the downstream pressure, degree of subcooling, and length-to-diameter ratio. Under choked flow condition, the mass flow rate is greatly varied with the short-tube orifice dimension, but it is slightly affected by the operating conditions. A correlation of mass flow rate through short-tube orifices is proposed in terms of the dimensionless parameters. The predicted results show good agreement with experimental data with a mean deviation of 4.69%. (author) transfer coefficient was also proposed. (author)
Directory of Open Access Journals (Sweden)
B. Barletta
2011-03-01
Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.
Investigation into the conditions under which HFC134a may become flammable.
CSIR Research Space (South Africa)
Kramers, AP
2002-01-01
Full Text Available or approaching 180°C would be associated with an onset of catastrophic conditions such as plant room fires and total mechanical failure of equipment. It is suggested in that the guidelines listed in Section 5.2, pertaining to abnormal plant conditions... /lubricant mixtures can become explosive. The work must therefore consider both normal and abnormal operating conditions to which HFC134a may be exposed to empower machine operators, mine maintenance personnel and contractors to take preventative...
Emissions of CO2, CO, NOx, HC, PM, HFC-134a, N2O and CH4 from the global light duty vehicle fleet
Directory of Open Access Journals (Sweden)
Timothy J. Wallington
2008-04-01
Full Text Available Vehicles emit carbon dioxide (CO2, carbon monoxide (CO, nitrogen oxides (NOx, hydrocarbons (HC, particulate matter (PM, hydrofluorocarbon 134a (HFC-134a, methane (CH4, and nitrous oxide (N2O. An understanding of these emissions is needed in discussions of climate change and local air pollution issues. To facilitate such discussions an overview of past, present, and likely future emissions from light duty vehicles is presented. Emission control technologies have reduced the emissions of CO, VOCs, PM, HFC-134a, CH4, and N2O from modern vehicles to very low levels.
Critical heat flux experimental facility using Freon R-134a fluid
Energy Technology Data Exchange (ETDEWEB)
Hong, Sung Deok; Chung, C. H.; Kim, B. D. [Korea Atomic Energy Research Institute, Taejeon (Korea)
2000-02-01
A CHF experimental loop using Freon R-134a as a working fluid has been designed and built to facilitate modeling of high pressure/temperature water CHF experiments. This loop was designed to operate at 4 MPa, 100 deg C with the maximum flow rate of 2.5 kg/s. The detailed technical specification and operating procedure of the loop are described together with comments on the performance and limitations of the loop. A series of CHF experiment was carried out in a vertical round tube and the fluid-to-fluid modeling techniques are applied for it's validity for the high temperature/pressure reactor conditions. The experimental range covered all the application ranges of CHF correlations developed for both PWR and PHWR. 28 refs., 9 figs., 5 tabs. (Author)
US emissions of HFC-134a derived for 2008-2012 from an extensive flask-air sampling network
Hu, Lei; Montzka, Stephen A.; Miller, John B.; Andrews, Aryln E.; Lehman, Scott J.; Miller, Benjamin R.; Thoning, Kirk; Sweeney, Colm; Chen, Huilin; Godwin, David S.; Masarie, Kenneth; Bruhwiler, Lori; Fischer, Marc L.; Biraud, Sebastien C.; Torn, Margaret S.; Mountain, Marikate; Nehrkorn, Thomas; Eluszkiewicz, Janusz; Miller, Scot; Draxler, Roland R.; Stein, Ariel F.; Hall, Bradley D.; Elkins, James W.; Tans, Pieter P.
2015-01-01
U.S. national and regional emissions of HFC-134a are derived for 2008-2012 based on atmospheric observations from ground and aircraft sites across the U.S. and a newly developed regional inverse model. Synthetic data experiments were first conducted to optimize the model assimilation design and to
Zhan, Tao; Potts, Winston; Collins, John F.; Austin, Jeff
2014-12-01
Many vehicle owners in the United States recharge their vehicles' air conditioning systems with small containers of hydrofluorocarbon-134a (HFC-134a, CH2FCF3), at a frequency estimated to be once every year on average. Such nonprofessional service produces immediate emissions of this potent greenhouse gas during service and from the residual heel in partially used containers. The nonprofessional operations are also associated with increased delayed refrigerant emissions that occur because owners are less likely to repair leaks than professional technicians. In California, an estimated 1.3 million nonprofessional service operations performed each year generate 0.27 ± 0.07 million metric ton CO2 equivalent (MMTCO2e) of immediate emissions and 0.54 ± 0.08 MMTCO2e of delayed emissions, using a Global Warming Potential of 1300 for HFC-134a. The immediate emissions can be largely mitigated by a regulation that requires self-sealing valves and improved labeling instructions on the containers, a deposit-return-recycling program for the containers, and a consumer education program. If 95% of the used containers were to be returned by consumers for recycling of the container heel, the annual immediate emissions would be reduced by 0.26 ± 0.07 MMTCO2e. In the United States, an estimated 24 million nonprofessional service operations are performed each year, generating 5.1 ± 1.4 MMTCO2e of immediate emissions and 10.4 ± 1.5 MMTCO2e of delayed emissions. Mitigation measures equivalent to the California regulation would reduce nationwide immediate emissions by 4.9 ± 1.4 MMTCO2e, if 95% of the used cans were returned for recycling. These business-as-usual emissions and mitigation potentials are projected to stay approximately constant until around 2022, and remain at significant levels into the 2030s.
Energy Technology Data Exchange (ETDEWEB)
Sapali, S N [Govt. College of Engineering, Department of Mechanical Engineering, Shivaji Nagar, Pune, Maharashtra 411 005 (India); Patil, Pradeep A [AISSMS College of Engineering, Pune University, Mechanical Engineering Department, Kennedy Road, Near R.T.O., Pune, Maharashtra 411 001 (India)
2010-11-15
In recent small and medium capacity refrigeration systems, the condenser tubes are provided with micro-fins from inside. The vapour refrigerant at the compressor outlet and the condenser inlet is in superheat state. As it advances in the condenser it is in two phases and at the outlet it is in sub cooled liquid. The heat transfer coefficient (HTC) during condensation of HFC-134a and R-404A in a smooth (8.56 mm ID) and micro-fin tubes (8.96 mm ID) are experimentally investigated. Different from previous studies, the present experiments are performed for various condensing temperatures, with superheating and sub cooling and using hermetically sealed compressor. The test runs are done at average saturated condensing temperatures ranging from 35 C to 60 C. The mass fluxes are between 90 and 800 kg m{sup -2} s{sup -1}. The experimental results indicate that the average HTC increases with mass flux but decreases with increasing condensing temperature for both smooth and micro-fin tubes. The average condensation HTCs of HFC-134a and R-404A for the micro-fin tubes were 1.5-2.5 and 1.3-2 times larger than that in smooth tube respectively. The HTCs for R-404A are less than that of HFC-134a. New correlations based on the data gathered during the experimentation for predicting condensation HTCs are proposed for wide range of operating conditions. (author)
International Nuclear Information System (INIS)
Aprea, Ciro; Greco, Adriana; Maiorino, Angelo
2016-01-01
Highlights: • An experimental comparison between R134A and HFO1234YF is presented. • A domestic refrigerator made to work with R134A is analysed. • The annual energy consumptions of the device are reported. • The energy saving achievable after the drop-in is evaluated. - Abstract: The latest international regulations on the reduction of greenhouse gases are strongly redesigning the scenario of use of refrigerants, gradually eliminating the possibility of employing the HFCs. Among all sectors of refrigeration, one of the most affected by these restrictions is the domestic refrigeration. Although for it have been suggested some solutions, such as the construction of household refrigerator operating with the hydrocarbons, there remains the need to find a substitute for HFC134a. In particular, the substitution may involve both existing machines and already in operation, which cannot be loaded with hydrocarbons, and new devices. With the aim of finding a simple implementation solution, in the present work, it is reported an experimental investigation carried out on a domestic refrigerator designed and built to operate with HFC134a and for which a drop-in with HFO1234yf has been realised. The experimentation has been addressed so as to highlight the behaviour of the system as a result of the drop-in, with a particular interest in the energy performance variation. A slight energy saving has been recorded with HFO1234yf, and an improving of the cooling capacity has been noticed.
DEFF Research Database (Denmark)
Monsalvo, Matias Alfonso; Baylaucq, A.; Reghem, P.
2005-01-01
.15-373.15 K. The measurements have been carried out with a failing body viscometer for four molar fractions x(1) =(0.28, 0.44, 0.63 and 0.88). The density values of this system were interpolated from previous results obtained at the laboratory. All of the available viscosity data, including pure HFC-134a...
HFO1234ze(E) And HFC134a Flow Boiling Inside a 4mm Horizontal Smooth Tube
Longo, Giovanni A.; Mancin, Simone; Righetti, Giulia; Zilio, Claudio
2016-01-01
Nowadays, the substitution of HFC134a with low GWP refrigerants is one of the most important challenge for refrigeration and air conditioning. The possible substitutes include natural refrigerants, such as HC600 (Butane) and HC600a (Isobutane), and also synthetic refrigerants, such as HFO1234yf and HFO1234ze(E). The HC refrigerants exhibit very low GWP, 3 and 4 HC600a and HC600 respectively, good thermodynamic and transport properties, and pressure and volumetric performance very similar to H...
Water plasma generation under atmospheric pressure for HFC destruction
International Nuclear Information System (INIS)
Watanabe, Takayuki; Tsuru, Taira
2008-01-01
The purpose of this paper is to investigate the decomposition process of hydrofluoroethylene (HFC-134a) by water plasmas. The water plasma was generated by DC arc discharge with a cathode of hafnium embedded into a copper rod and a nozzle-type copper anode. The advantage of the water plasma torch is the generation of 100%-water plasma by DC discharge. The distinctive steam generation leads to the portable light-weight plasma generation system that does not require the gas supply unit, as well as the high energy efficiency owing to the nonnecessity of the additional water-cooling. HFC-134a was injected into the water plasma jet to decompose it in the reaction tube. Neutralization vessel was combined to the reaction tube to absorb F 2 and HF generated from the HFC-134a decomposition. The decomposition was performed with changing the feed rate of HFC-134a up to 185 mmol/min. The decomposition efficiency of 99.9% can be obtained up to 0.43 mmol/kJ of the ratio of HFC-134a feed rate to the arc power, hence the maximum feed rate was estimated to be 160 g/h at 1 kW of the arc power
Performance Analysis of a Centrifugal Compressor for HFC-134a with aviation of Diffuser Vane Angle
International Nuclear Information System (INIS)
Park, Han Young; Chung, Jin Taek; Shin, You Hwan; Lee, Yoon Pyo; Kim, Kwang Ho; Cho, Yong Hun; Kim, Jong Seong
2007-01-01
Numerical simulation on the two-stage centrifugal compressor with Low Solidity Vaned Diffuser (LSVD) for HFC-134a turbo-chiller was performed using a commercial code. The comparative study with experimental results from other compressor was also investigated to testify the simulation schemes. The numerical analysis was separately simulated for each stage of the compressor and the effect of impeller-diffuser flow interaction was considered. Setting angle of the diffuser vane changed in the range of 15 .deg. and the effects on its variation were discussed in detail including the flow analysis in the passage of the compressor. The vane setting angle obtained from the preliminary design was slightly adjusted to the optimal value by the performance enhancement in terms of pressure recovery and flow characteristics
Mohtar, M. N.; Nasution, H.; Aziz, A. A.
2015-12-01
The use of hydrocarbon mixture as a working fluid in a refrigerator system is rarely explored. Almost all domestic refrigerators use hydroflourocarbon R134a (HFC-R134a) as refrigerants. In this study, hydrocarbon gas (HC-R134a) is used as the alternative refrigerant to replace HFC-R134a. It has a composition of R290 (56%), R600a (54.39%) and additive (0.1%wt) blended for the trials. The experiments were conducted with 105 g and 52.5 g refrigerant mass charge, subjected to internal heat load of 0, 1, 2, 3 and 4 kg respectively. The study investigates the coefficient of performance of the refrigerator (COPR) and energy consumption. The results show that the use of HC-R134a as the replaceable refrigerant can save energy ranging from 2.04% to 7.09%, as compared to the conventional HFC-R134a refrigerant. Naturally, the COPR improvement and temperature distribution using HC-R134a are much better than HFC-R134a
Power Optimization of Organic Rankine-cycle System with Low-Temperature Heat Source Using HFC-134a
Energy Technology Data Exchange (ETDEWEB)
Baik, Young Jin; Kim, Min Sung; Chang, Ki Chang; Lee, Young Soo; Ra, Ho Sang [Korea Institute of Energy Research, Daejeon (Korea, Republic of)
2011-01-15
In this study, an organic Rankine-cycle system using HFC-134a, which is a power cycle corresponding to a low temperature heat source, such as that for geothermal power generation, was investigated from the view point of power optimization. In contrast to conventional approaches, the heat transfer and pressure drop characteristics of the working fluid within the heat exchangers were taken into account by using a discretized heat exchanger model. The inlet flow rates and temperatures of both the heat source and the heat sink were fixed. The total heat transfer area was fixed, whereas the heat-exchanger areas of the evaporator and the condenser were allocated to maximize the power output. The power was optimized on the basis of three design parameters. The optimal combination of parameters that can maximize power output was determined on the basis of the results of the study. The results also indicate that the evaporation process has to be optimized to increase the power output.
CFC and HFC recycling equipments: Test performances
International Nuclear Information System (INIS)
Picini, P.; Caropreso, G.; Cicoli, G.; Posarelli, M.
1996-12-01
Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid
Operation of Resistive Plate Chamber Detectors with a New Environmentally Friendly Freon
Lewis, Helen Elizabeth
2014-01-01
RPC particle gas detectors at CERN provide a vital element to the physics experiments carried out on the LHC. While their current operation and working gas mixtures are successful, environ- mental and economic factors force a revision of the mixture, specifically the eventual replacement of the current Freon gas R134-a with a newer, less environmentally harmful formulation, namely R1234-yf. The methods and results presented here outline the detector response to the introduction of the new Freon and its behavior under various mixtures. The electronegativity and hence impact on RPC parameters was investigated. It was found that the new Freon gas is indeed electroneg- ative, and suppresses the RPC signal. The mixture was modified to include Argon to increase ionization, and the final results of the operation of the RPC were satisfactory. Further work to refine the mixture for future implementation is necessary.
Energy Technology Data Exchange (ETDEWEB)
Zuercher, O.; Favrat, D.; Thome, J. R.; Kattan, N.; Nidegger, E. [Ecole polytechnique federale, Lab. d` energetique industrielle, Lausanne (Switzerland)
1996-11-15
The substitution of CFC refrigerants in refrigeration systems, heat pumps and organic Rankine cycles for heat recovery, requires good methods for predicting heat transfer of substitute fluids. The measurements in the LENI test facility (concentric tubes with water flowing in a counter-current flow) with HFC 407C, HFC 134a, HCFC 123, HFC 404a and HFC/HCFC 402A provide a new data bank for new refrigerants, and allow a coherent comparison with old refrigerants CFC 11, CFC 12, CFC/HCFC 502 and with existing correlations. The existing correlations were found to be inadequate. Because of this work, an improved flow pattern map and flow boiling model were developed, which resulted in a substantial progress in the accurate predict of heat transfer in plain, horizontal tubes for refrigerants without oil. The Kattan et al. correlation was programmed to calculate and compare predicted heat transfer coefficients to the new HFC 407C test data. The flow pattern map proposed by Kattan et al. was also programmed and compared to flow regimes observed for HFC 407C. It predicted the HFC 407C flow pattern data quite accurately. The original objective of the HFC 407C measurements was the validation of the Kattan et al. correlation applied to a zeotropic refrigerant blend. Local flow boiling heat transfer coefficients were measured for HFC 407C evaporating inside a microfin and a plain tube. In addition, microfin heat transfer augmentation relative to a plain tube was investigated. The presence of oil in the evaporator had a complex effect on heat transfer coefficients. Local flow boiling heat transfer coefficients were measured for refrigerant HFC 407C ester oil mixtures (Mobil EAL Arctic 68). A new thermodynamic approach for modeling mixtures of zeotropic refrigerant blends and lubricating oils was also developed. (author) figs., tabs., 14 refs.
Vollmer, M. K.; Miller, B. R.; Rigby, M. L.; Reimann, S.; Muhle, J.; Agage, Soge, Snu Members, Kopri Members
2010-12-01
We report on the atmospheric measurements and global emissions of the hydrofluorocarbons (HFCs) HFC-365mfc (CH3CH2CF2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). These measurements are from in-situ observations at stations of AGAGE (Advanced Global Atmospheric Gases Experiment) and SOGE (System for Observations of Halogenated Greenhouse Gases in Europe), and from the Korean station Gosan. We also report on flask sample measurements from the Antarctic stations King Sejong and Troll, and extend our records back to the 1970s using archived air samples of both hemispheres. All data are used in a global 12-box 2-dimensional atmospheric transport model to derive global abundances and emission estimates. All four HFCs have strongly increased in the atmosphere in recent years with growth rates at nearly 10 %, resulting in dry air mole fractions at the end of 2009 of 0.49 ppt for HFC-365mfc, 1.00 ppt for HFC-245fa, and 0.51 ppt for HFC-227ea. HFC-236fa, for which we report the first atmospheric measurements, is less abundant and has grown to 0.069 ppt at the end of 2009. Our model results show rapidly growing emissions of HFC-365mfc and HFC-245fa after 2002 but surprisingly these have now started to decline to globally 2.7 kt/yr (HFC-365mfc) and 6.1 kt/yr (HFC-245fa). On the other hand HFC-227ea and HFC-236fa show uninterrupted growth in their emissions of 2.5 kt/yr and 0.2 kt/yr at the end of 2009.
Vollmer, Martin K.; Miller, Benjamin R.; Rigby, Matthew; Reimann, Stefan; Mühle, Jens; Krummel, Paul B.; O'Doherty, Simon; Kim, Jooil; Rhee, Tae Siek; Weiss, Ray F.; Fraser, Paul J.; Simmonds, Peter G.; Salameh, Peter K.; Harth, Christina M.; Wang, Ray H. J.; Steele, L. Paul; Young, Dickon; Lunder, Chris R.; Hermansen, Ove; Ivy, Diane; Arnold, Tim; Schmidbauer, Norbert; Kim, Kyung-Ryul; Greally, Brian R.; Hill, Matthias; Leist, Michael; Wenger, Angelina; Prinn, Ronald G.
2011-04-01
We report on ground-based atmospheric measurements and emission estimates of the four anthropogenic hydrofluorocarbons (HFCs) HFC-365mfc (CH3CF2CH2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). In situ measurements are from the global monitoring sites of the Advanced Global Atmospheric Gases Experiment (AGAGE), the System for Observations of Halogenated Greenhouse Gases in Europe (SOGE), and Gosan (South Korea). We include the first halocarbon flask sample measurements from the Antarctic research stations King Sejong and Troll. We also present measurements of archived air samples from both hemispheres back to the 1970s. We use a two-dimensional atmospheric transport model to simulate global atmospheric abundances and to estimate global emissions. HFC-365mfc and HFC-245fa first appeared in the atmosphere only ˜1 decade ago; they have grown rapidly to globally averaged dry air mole fractions of 0.53 ppt (in parts per trillion, 10-12) and 1.1 ppt, respectively, by the end of 2010. In contrast, HFC-227ea first appeared in the global atmosphere in the 1980s and has since grown to ˜0.58 ppt. We report the first measurements of HFC-236fa in the atmosphere. This long-lived compound was present in the atmosphere at only 0.074 ppt in 2010. All four substances exhibit yearly growth rates of >8% yr-1 at the end of 2010. We find rapidly increasing emissions for the foam-blowing compounds HFC-365mfc and HFC-245fa starting in ˜2002. After peaking in 2006 (HFC-365mfc: 3.2 kt yr-1, HFC-245fa: 6.5 kt yr-1), emissions began to decline. Our results for these two compounds suggest that recent estimates from long-term projections (to the late 21st century) have strongly overestimated emissions for the early years of the projections (˜2005-2010). Global HFC-227ea and HFC-236fa emissions have grown to average values of 2.4 kt yr-1
Two-phase flow characteristics of HFC and HCFC fluid
International Nuclear Information System (INIS)
Ueno, T.; Matsuda, K.; Kusakabe, T.
1998-01-01
Some two-phase flow characteristics of HFC and HCFC fluid have been investigated experimentally. Fluids used in this experiment are HCFC22 (hereinafter called 'R22'), HCFC123 (hereinafter called 'R123') and Mixture of HFC fluid (hereinafter called 'R407C'). The fluid R407C are mixture of HFC32, HFC134a and HFC125, and their concentrations are 23wt%, 52wt% and 25wt%, respectively. This paper presents main flow parameters such as void fraction, interfacial velocities, bubble diameter distribution and pressure drop multiplier, which can characterize flow behavior. The void fractions and interfacial velocities were measured at some local positions in the single pipe using the bi-optical probe(hereinafter called 'BOP'). The procedure to calculate the void fraction from the void signals obtained by BOP were adopted the so-called slice method. The effects of slice levels on the void fraction were discussed taking into account bubble diameter. The new correlation of slice level as the function of void fraction has been proposed. The area-averaged void fractions obtained from BOP's void signals using new correlation were compared with void fractions obtained from pressure drops. The area-averaged interfacial velocities were also compared with the superficial gas velocities. It was concluded that the accuracy of BOP measurements are 5% for void fraction and less than 8.5% for interfacial velocity
Tiscione, Nicholas B; Yeatman, Dustin Tate; Shan, Xiaoqin; Kahl, Joseph H
2013-10-01
Volatiles are frequently abused as inhalants. The methods used for identification are generally nonspecific if analyzed concurrently with ethanol or require an additional analytical procedure that employs mass spectrometry. A previously published technique utilizing a capillary flow technology splitter to simultaneously quantitate and confirm ethyl alcohol by flame ionization and mass spectrometric detection after headspace sampling and gas chromatographic separation was evaluated for the detection of inhalants. Methanol, isopropanol, acetone, acetaldehyde, toluene, methyl ethyl ketone, isoamyl alcohol, isobutyl alcohol, n-butyl alcohol, 1,1-difluoroethane, 1,1,1-trifluoroethane, 1,1,1,2-tetrafluoroethane (Norflurane, HFC-134a), chloroethane, trichlorofluoromethane (Freon®-11), dichlorodifluoromethane (Freon®-12), dichlorofluoromethane (Freon®-21), chlorodifluoromethane (Freon®-22) and 1,2-dichlorotetrafluoroethane (Freon®-114) were validated for qualitative identification by this method. The validation for qualitative identification included evaluation of matrix effects, sensitivity, carryover, specificity, repeatability and ruggedness/robustness.
International Nuclear Information System (INIS)
García-Valladares, O.; Santoyo, E.
2014-01-01
In a previous work, one-dimensional numerical modelling of fluid-flow inside short tube orifices was performed, and successfully validated against a wide range of mass flow rate measurements reported for the refrigerant HFC-134a. Governing equations of continuity, momentum, energy and entropy were solved for describing the fluid flow under a wide variety of thermodynamic transitions (e.g., subcooled liquid region, metastable liquid region, metastable two-phase region and equilibrium two-phase region), including sudden contraction and enlargement. In this new study, a comprehensive comparison analysis between numerical simulation data and experimental measurements obtained for HFC-407C and HFC-410A refrigerants (N o = 241) to extend the applicability of the same mathematical model was carried out. Using a widespread statistical analysis, based on weighted linear regressions with an outlier detection/rejection module at 95% of confidence level, the prediction performance of the mathematical model was again assessed. Linear regressions between predicted mass flow rate data and experimental measurements were computed, and used them as a statistical comparison criterion. A statistical comparison between predicted simulation results and mass flow rate experimental data are reported. Average deviation errors of ±11.1% (for the refrigerant HFC-407C) and ±7.3% (for refrigerant HFC-410A) were found between numerical model and experimental data. These results demonstrate a new and robust application of the model to predict reliably the mass flow rate through short tube orifices under metastable conditions, which enable this tool to be reliably used for the design of short tube orifices. - Highlights: •A modelling for evaluating short tube orifice was developed for refrigerant mixtures. •The numerical model applied considered metastable regions and choke flow. •The model was validated against experimental data for HFC-407C and HFC-410A. •Statistical analysis based
Sakai, Kentaro; Maruyama-Maebashi, Kyoko; Takatsu, Akihiro; Fukui, Kenji; Nagai, Tomonori; Aoyagi, Miwako; Ochiai, Eriko; Iwadate, Kimiharu
2011-03-20
Spray cleaner is a cleaning product containing compressed 1,1-difluoroethane (HFC-152a) to blow dust off electric devices and other sensitive equipment; however, it is also inhaled to induce euphoria. This report describes three cases of death involving HFC-152a inhalation with spray cleaner under different circumstances. In case 1, death was during inhalation for euphoria with which led to having frostbite. In case 2, death may have been associated with suicidal intention. Case 3 was also considered an accidental autoerotic death. In all three cases, HFC-152a was detected at 99.2-136.2mg/l in blood samples, 94.5-191.9 mg/l in urine samples and 3.6-18.4 mg in the gastric contents according to gas chromatography with flame ionization detection. To prevent death associated with HFC-152a inhalation from spray cleaner, the danger of the sudden death should be announced to people, given the ready availability of commercial products containing HFC-152a. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.
Vapor Explosions with Subcooled Freon
International Nuclear Information System (INIS)
Henry, R.E.; Fauske, Hans K.; McUmber, L.M.
1976-01-01
Explosive vapor formation accompanied by destructive shock waves, can be produced when two liquids, at much different temperatures, are brought into intimate contact. A proposed analytical model states that the interface temperature upon contact between the two liquid systems, gust be greater than or equal to the spontaneous nucleation temperature of that liquid-liquid system and that the thermal boundary layer must be sufficiently developed to support a critical size cavity. For time scales greater than 10-12 sec, the interface temperature upon contact of two semi-infinite masses, with constant thermal properties, can be related to the initial liquid temperatures. The spontaneous nucleation behavior at the interface can either be heterogeneous or homogeneous in nature. In either case, the critical size cavities, which initiate the vaporization process, are produced by local density fluctuations within the cold liquid. For homogeneous conditions, the two liquids present a well-wetted system and the vapor embryos are produced entirely within the cold liquid. For heterogeneous conditions, which result from poor, or imperfect wetting, at the liquid-liquid interface, the critical sized cavities are created at the interface at somewhat lower temperatures. A sequence of experiments, using Freon-22 and water, Freon-22 and mineral oil, and Freon-12 and mineral oil have been performed to test this spontaneous nucleation premise. For Freon-22 at its normal boiling point, the interface temperature of the water must be at least 77 deg. C before the interface temperature equals or exceeds the minimum homogeneous nucleation value of 54 deg. C and 84 deg. C before the interface temperature equals 60 deg. C where the homogeneous nucleation rate becomes truly explosive. The Freon-water test demonstrated explosive interactions for water temperatures considerably lower than this value and this was attributed to the heterogeneous nucleation characteristics of that particular system
Energy Technology Data Exchange (ETDEWEB)
Tian, Song, E-mail: tiansong22@126.com [State Key Laboratory of Solidification Processing, Northwestern Polytechnical University, Xi’an 710072 (China); School of Materials Science and Engineering, Chongqing Jiaotong University, Chongqing 400074 (China); Zhang, Yulei; Ren, Jincui; Qiang, Xinfa; Zhang, Shouyang [State Key Laboratory of Solidification Processing, Northwestern Polytechnical University, Xi’an 710072 (China); Li, Hejun, E-mail: lihejun@nwpu.edu.cn [State Key Laboratory of Solidification Processing, Northwestern Polytechnical University, Xi’an 710072 (China)
2017-04-30
Highlights: • HfC naobelts accompanied by HfC nanowires were synthesized by a catalytic CVD method. • HfC nanobelts as a novel structure of HfC ceramic are reported for the first time. • HfC nanobelts have 100–200 μm in lengths and reach up to 10 μm in widths. • The synthesized product is promising field nanoemitters. - Abstract: As a key refractory carbide, hafnium carbide (HfC) is commonly used as structural materials while the field emission (FE) application of HfC in the field of vacuum microelectronics is almost the only one for functional material purposes. Based on its outstanding physical and chemical characteristics, HfC is identified as a potential candidate with satisfactory mechanical properties and long-term and/or high-temperature FE stability for future applications in high-performance field emitters. However, the development of HfC in various FE applications is hindered because it is not facile to fabricate large-scale low-dimensional HfC field nanoemitters. Herein, High-aspect-ratio HfC nanobelts accompanied by HfC nanowires were synthesized on a large scale by a traditional and simple catalytic chemical vapor deposition (CVD) method. Classical vapor–liquid–solid (VLS) theory was employed to explain the growth of the HfC nanowires and nanobelts along axial direction. The thin HfO{sub 2} shell and thin C layer surrounding the nanostructures might give rise to the diameter fluctuation of HfC nanowires and the width increase of HfC nanobelts in lateral direction. Field emission results show that the high-aspect-ratio HfC nanobelts accompanied by the nanowires are promising field nanoemitters, which exhibit excellent field emission properties with a fairly low turn-on field of ∼1.5 V μm{sup −1} and a low current fluctuation less than ∼10%. This suggests that HfC ceramics with high-aspect-ratio nanostructures are ideal cathode material for various field emission applications.
ANALISIS PERBANDINGAN EVAPORATOR KULKAS (LEMARI ES DENGAN MENGUNAKAN REFRIGERANT R-22 DAN R-134A
Directory of Open Access Journals (Sweden)
Imam Faozan
2017-03-01
Full Text Available Tulisan ini bertujuan untuk mengetahui komponen mesin refrigerasi khususnya pembahasan evaporator. Dalam penelitian ini digunakan lemari pendingin (kulkas sederhana untuk pengawetan dan pendinginan bahan makanan dalam rumah tangga. Untuk refrigerant yang digunakan adalah Refrigerant Freon R – 22 dan Freon R - 134a sebagai perbandingan dan untuk mengetahui performance evaporator ( COP pada mesin refrigerasi untuk rumah tangga. Lemari pendingin yang dianalisa berukuran tinggi = 1 m, panjang = 0,55 m dan lebar 0,5 m. Temperatur evaporasi = -5°C dan temperature kondensasi = 40°C.
Ll, Jin; Sato, Haruki; Watanabe, Koichi
On the basis of critically-evaluated thermodynamic property data among those recently published, a new Peng-Robinson equation of state for the HFC refrigerants,R-32,R-125 and R-134a,has be end eveloped so as to represent the VLE properties in the vapor-liquid coexisting phase at temperatures 223K-323K. In accord with a challenge to correlate the binary and/or ternary interatction parameters as functions of temperature, we have also applied the present modified Peng-Robinson equation of state to the promising alternative HFC refrigerant mixtures, i.e., R-32/125,R-32/134a and R-32/125/134a systems. The developed equation of state improves significantly its effectiveness for practical engineering property calculations at refrigerantion and air-conditioning industries in comparison with conventional Peng-Robinson equation.
High pressure freon decontamination of remote equipment
International Nuclear Information System (INIS)
Wilson, C.E.
1987-01-01
A series of decontamination tests using high pressure FREON 113 was conducted in the 200 Area of the Hanford site. The intent of these tests was to evaluate the effectiveness of FREON 113 in decontamination of manipulator components, tools, and equipment items contaminated with mixed fission products. The test results indicated that high pressure FREON 113 is very effective in removing fissile material from a variety of objects and can reduce both the quantity and the volume of the radioactive waste material presently being buried
Energy Technology Data Exchange (ETDEWEB)
De Rossi, Filippo; Mastrullo, Rita; Mazzei, Pietro [Naples Univ. (Italy)
1993-05-01
A software package for both the computation of thermodynamic properties and the analysis of the usual vapour compression plant schemes is a useful tool for air conditioning and refrigeration researchers and manufacturers. At present, it could make an important contribution to the search for CFC substitutes; in fact, comparisons between two or more working fluids could be accomplished more easily. A program created by the authors is presented by means of some demonstrative diagrams referring to a comparison between the ''ozone killer'' R12 and its substitute R134a. An R134a exergy-enthalpy chart is also provided. (Author)
Volume reduction and material recirculation by freon decontamination
International Nuclear Information System (INIS)
Berners, O.; Buhmann, D.; Yamashita, Y.; Yoshiaki, M.
1989-01-01
This paper discusses the use of freon in a large variety of decontamination in the nuclear and non-nuclear fields. As far as the contamination is loose or smerable, surfaces of nearly all materials can be decontaminated. Freon is electrically non-conductive, chemically neutral and has a low surface tension. So it is capable of creeping under the contaminant and loosening or dissolving it. Used freon can be collected, cleaned and recirculated. Its cleaning can be done easily by evaporation at its lower vapor point of about 48 degrees C (104 degrees F). Good decontamination results could be achieved, expensive materials, tools and equipment could be recirculated. Big volumes of materials could get separated from their contaminants, which is the real radioactive waste. Freon decontamination is an effective, overall economical and approved technology to volume reduction and material recirculation
Future emissions and atmospheric fate of HFC-1234yf from mobile air conditioners in Europe.
Henne, Stephan; Shallcross, Dudley E; Reimann, Stefan; Xiao, Ping; Brunner, Dominik; O'Doherty, Simon; Buchmann, Brigitte
2012-02-07
HFC-1234yf (2,3,3,3-tetrafluoropropene) is under discussion for replacing HFC-134a (1,1,1,2-tetrafluoroethane) as a cooling agent in mobile air conditioners (MACs) in the European vehicle fleet. Some HFC-1234yf will be released into the atmosphere, where it is almost completely transformed to the persistent trifluoroacetic acid (TFA). Future emissions of HFC-1234yf after a complete conversion of the European vehicle fleet were assessed. Taking current day leakage rates and predicted vehicle numbers for the year 2020 into account, European total HFC-1234yf emissions from MACs were predicted to range between 11.0 and 19.2 Gg yr(-1). Resulting TFA deposition rates and rainwater concentrations over Europe were assessed with two Lagrangian chemistry transport models. Mean European summer-time TFA mixing ratios of about 0.15 ppt (high emission scenario) will surpass previously measured levels in background air in Germany and Switzerland by more than a factor of 10. Mean deposition rates (wet + dry) of TFA were estimated to be 0.65-0.76 kg km(-2) yr(-1), with a maxium of ∼2.0 kg km(-2) yr(-1) occurring in Northern Italy. About 30-40% of the European HFC-1234yf emissions were deposited as TFA within Europe, while the remaining fraction was exported toward the Atlantic Ocean, Central Asia, Northern, and Tropical Africa. Largest annual mean TFA concentrations in rainwater were simulated over the Mediterranean and Northern Africa, reaching up to 2500 ng L(-1), while maxima over the continent of about 2000 ng L(-1) occurred in the Czech Republic and Southern Germany. These highest annual mean concentrations are at least 60 times lower than previously determined to be a safe level for the most sensitive aquatic life-forms. Rainwater concentrations during individual rain events would still be 1 order of magnitude lower than the no effect level. To verify these results future occasional sampling of TFA in the atmospheric environment should be considered. If future HFC-1234yf
Venezuelan contribution to the ozone layer preservation
Energy Technology Data Exchange (ETDEWEB)
Pereira, M.H.; Coltters, R.; Damian, A. [Universidad La Urbina, Caracas (Venezuela). Escuela de Ingenieria Mecanica
1995-12-31
There are two ways to solve the problem of the ozone layer destruction in the upper atmosphere by the harmful chlorine which comes from CFC refrigerants and from aerosols. The first one is to replace the old equipment by new ones which work with non-contaminant refrigerants and the second solution is to establish a conversion program according to the Montreal Protocol and the Vienna Convention. According to this, some Venezuelan Companies are beginning to replace the car`s air conditioning equipment, and others like CVG-SIDOR are making an accelerated program for its central air conditioning system. Another company, C.A. Metro de Caracas, has made a progressive program for the replacement of Freon R-11 and R-12 for HFC 123 and HFC-134a respectively. The results indicate that the most economical solution is to replace these refrigerants instead of replacing the equipment completely.
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
The paper made a research survey of a technology to decompose the recovered CFC (specified freon) in which energy efficiency is high and no hazardous materials such as dioxin are generated. As to the technology to decompose specified freon, the high frequency plasma method, the cement kiln method and the combustion method are at the stage of the demonstration test and close to the commercialization. The catalyst method has finished the basic test and is at the stage of a pilot plant. Besides, there are the supercritical water decomposition method, the ultraviolet decomposition method, etc., but they are at the stage of the fundamental research. Mechanisms of the dioxin generation and the suppression of dioxin generation in case of incinerating waste mixed with halide have been made clear. In the fundamental test, conditions were obtained under which the freon decomposition rate of more than 99.99% is attained by the combustion of a mixture of industrial waste and freon using the combustion method, and measures for reduction in hazardous materials such as dioxin were expected to be taken. In the catalyst method, the result obtained was the decomposition rate of more than 99.99% and the catalyst life of more than 1000 years, and its practicality was confirmed. 43 refs., 97 figs., 29 tabs.
Directory of Open Access Journals (Sweden)
R. G. Prinn
2010-08-01
Full Text Available HFC-23 (also known as CHF3, fluoroform or trifluoromethane is a potent greenhouse gas (GHG, with a global warming potential (GWP of 14 800 for a 100-year time horizon. It is an unavoidable by-product of HCFC-22 (CHClF2, chlorodifluoromethane production. HCFC-22, an ozone depleting substance (ODS, is used extensively in commercial refrigeration and air conditioning, in the extruded polystyrene (XPS foam industries (dispersive applications and also as a feedstock in fluoropolymer manufacture (a non-dispersive use. Aside from small markets in specialty uses, HFC-23 has historically been considered a waste gas that was, and often still is, simply vented to the atmosphere. Efforts have been made in the past two decades to reduce HFC-23 emissions, including destruction (incineration in facilities in developing countries under the United Nations Framework Convention on Climate Change's (UNFCCC Clean Development Mechanism (CDM, and by process optimization and/or voluntary incineration by most producers in developed countries. We present observations of lower-tropospheric mole fractions of HFC-23 measured by "Medusa" GC/MSD instruments from ambient air sampled in situ at the Advanced Global Atmospheric Gases Experiment (AGAGE network of five remote sites (2007–2009 and in Cape Grim air archive (CGAA samples (1978–2009 from Tasmania, Australia. These observations are used with the AGAGE 2-D atmospheric 12-box model and an inverse method to produce model mole fractions and a "top-down" HFC-23 emission history. The model 2009 annual mean global lower-tropospheric background abundance is 22.6 (±0.2 pmol mol−1. The derived HFC-23 emissions show a "plateau" during 1997–2003, followed by a rapid ~50% increase to a peak of 15.0 (+1.3/−1.2 Gg/yr in 2006. Following this peak, emissions of HFC-23 declined rapidly to 8.6 (+0.9/−1.0 Gg/yr in 2009, the lowest annual emission of the past 15 years. We derive a 1990–2008 "bottom-up" HFC-23 emission history
Gill, Jatinder; Singh, Jagdev
2017-11-01
In this work, the experimental examination was carried out using a mixture of R134a and LPG refrigerant (consisting of R134a and LPG in a proportion of 28:72 by weight) as a replacement for R134a in a vapor compression refrigeration system. Exergy and energy tests were carried out at different evaporator and condenser temperatures with controlled environmental conditions. The results showed that the exergy destruction in the compressor, condenser, evaporator, and a capillary tube of the R134a / LPG refrigeration system was found lower by approximately 11.13-3.41%, 2.24-3.43%, 12.02-13.47% and 1.54-5.61% respectively. The compressor exhibits the highest level of destruction, accompanied by a condenser, an evaporator and a capillary tube in refrigeration systems. The refrigeration capacity, COP and power consumption of the compressor of the R134a /LPG refrigeration system were detected higher and lower compared to the R134a refrigeration system by about 7.04-11.41%, 15.1-17.82%, and 3.83-8.08% respectively. Also, the miscibility of R134a and LPG blend with mineral oil discovered good. The R134a and LPG refrigerant mixture proposed in this study perform superior to R134a from component-wise exergy and energy analyses under similar experimental conditions.
Gill, Jatinder; Singh, Jagdev
2018-05-01
In this work, the experimental examination was carried out using a mixture of R134a and LPG refrigerant (consisting of R134a and LPG in a proportion of 28:72 by weight) as a replacement for R134a in a vapor compression refrigeration system. Exergy and energy tests were carried out at different evaporator and condenser temperatures with controlled environmental conditions. The results showed that the exergy destruction in the compressor, condenser, evaporator, and a capillary tube of the R134a / LPG refrigeration system was found lower by approximately 11.13-3.41%, 2.24-3.43%, 12.02-13.47% and 1.54-5.61% respectively. The compressor exhibits the highest level of destruction, accompanied by a condenser, an evaporator and a capillary tube in refrigeration systems. The refrigeration capacity, COP and power consumption of the compressor of the R134a /LPG refrigeration system were detected higher and lower compared to the R134a refrigeration system by about 7.04-11.41%, 15.1-17.82%, and 3.83-8.08% respectively. Also, the miscibility of R134a and LPG blend with mineral oil discovered good. The R134a and LPG refrigerant mixture proposed in this study perform superior to R134a from component-wise exergy and energy analyses under similar experimental conditions.
Gas-Chromatographic Determination Of Water In Freon PCA
Melton, Donald M.
1994-01-01
Gas-chromatographic apparatus measures small concentrations of water in specimens of Freon PCA. Testing by use of apparatus faster and provides greater protection against accidental contamination of specimens by water in testing environment. Automated for unattended operation. Also used to measure water contents of materials, other than Freon PCA. Innovation extended to development of purgeable sampling accessory for gas chromatographs.
Performance analysis of the electric vehicle air conditioner by replacing hydrocarbon refrigerant
Santoso, Budi; Tjahjana, D. D. D. P.
2017-01-01
The thermal comfort in passenger cabins needs an automotive air-conditioning system. The electric vehicle air conditioner system is driven by an electric compressor which includes a compressor and an electric motor. Almost air-conditioning system uses CFC-12, CFC-22 and HFC-134a as refrigerant. However, CFC-12 and CFC-22 will damage the ozone layer. The extreme huge global warming potentials (GWP) values of CFC-12, CFC-22, and HFC-134a represent the serious greenhouse effect of Earth. This article shows new experimental measurements and analysis by using a mixture of HC-134 to replace HFC-134a. The result is a refrigerating effect, the coefficient of performance and energy factor increase along with cooling capacity, both for HFC-134a and HC-134. The refrigerating effect of HC-134 is almost twice higher than HFC-134a. The coefficient of performance value of HC-134 is also 36.42% greater than HFC-134a. Then, the energy factor value of HC-134 is 3.78% greater than HFC-134a.
Development of a Centrifugal Technique for the Microbial Bioburden Analysis of Freon (CFC-11)
Benardini, James N.; Koukol, Robert C.; Kazarians, Gayane A.; Morales, Fabian
2013-01-01
NASA Procedural Requirement 8020.12C entitled "Planetary Protection Provisions for Robotic Extraterrestrial Missions" states that the source-specific encapsulated microbial density for encapsulated organisms (div(0)) in nonmetallic materials ranges from 1-30 spores/cubic cm. The standard laboratory procedure, NASA Standard Procedures for the Microbial Examination of Space Hardware, NHB 5340.1B, does not provide any direction into the methodologies to understand the bioburden within such a fluid as CFC-11 (Freon). This general specification value for the Freon would be applicable to the Freon charged within the Mars Science Laboratory fs (MSL fs) Heat Rejection System. Due to the large volume required to fill this system, MSL could not afford to conservatively allocate 55.8% of the total spore budget of the entire laboratory system (rover, descent stage, cruise stage, and aeroshell) of 5.00 X 10(exp 5) spores at launch. A novel filtration approach was developed to analyze the Freon employing a 50 kDa molecular weight cutoff (MCO) filter, followed by 0.22-micron pore-size filter to establish a calculated microbial bioburden.
Cooling performance of R510A in domestic water purifiers
International Nuclear Information System (INIS)
Park, Ki Jung; Lee, Yo Han; Jung, Dong Soo
2010-01-01
Cooling performance of R510A is examined both numerically and experimentally in an effort to replace HFC134a in the refrigeration system of domestic water purifiers. Although the use of HFC134a is currently dominant, it is being phased out in Europe and most developed countries due to its high potential contribution to global warming. To solve this problem, cycle simulation and experimental measurements are conducted with a new refrigerant mixture of 88%RE170/12%R600a using actual domestic water purifiers. This mixture has been recently numbered and listed as R510A by ASHRAE. Test results show that, due to the small internal volume of the refrigeration system of the domestic water purifiers, system performance with R510A is greatly influenced by the amount of charge. With the optimum charge amount of 20 to 21 g, approximately 50% that of HFC134a, the energy consumption of R510A is 22.3% lower than that of HFC134a. The compressor discharge temperature of R510A is 3.7 .deg. C lower than that of HFC134a at the optimum charge. Overall, R510A, a new, long term, and environmentally safe refrigerant, is a good alternative for HFC134a. Furthermore, it requires only minor changes in the refrigeration system of the domestic water purifiers
Evaluation of high pressure Freon decontamination. I. Preliminary tests
International Nuclear Information System (INIS)
Rankin, W.N.
1983-01-01
High-pressure Freon blasting techniques are being evaluated for applications involving the removal of non-adherent radioactive particulate contamination at SRP. Very little waste is generated by this technique because the used Freon can be easily distilled and reused. One of the principle advantages of this technique is that decontaminated electrical equipment can be returned to service immediately without drying, unlike high-pressure water blasting techniques. Preliminary scoutin tests evaluating high-pressure Freon blasting for decontamination at SRP were carried out at Quadrex Co., Oak Ridge, TN, October 12 and 13. DWPF-type contamination (raw sludge plus volatiles) and separations area-type contamination (diluted boiling point (47.6 0 C) allow it to rapidly separate from higher boiling contaminants via distillation with filtration to remove particulate material, and distillation with condensation, the solvent may be recovered for indefinite reuse while reducing the radioactive waste to a minimum. 3 references, 5 figures, 6 tables
DEFF Research Database (Denmark)
Monsalvo, Matias Alfonso; Baylaucq, A.; Cisneros, Sergio
2006-01-01
fractions x(HFC) = 0.3427 and 0.5940 (a total of 100 experimental values). Since lubricants and refrigerants are in two different thermodynamic states at atmospheric pressure and ambient temperature, an especially designed falling-body viscometer has been used to perform the measurements. The data obtained...... with a physical and theoretical background, such as the hard-sphere scheme, the free-volume model, and the friction theory....
On scaling laws for modelling the steam/water flow in a 'Dodewaard' fuel-assembly using Freon-12
International Nuclear Information System (INIS)
Graaf, R. van de; Mudde, R.F.; Hagen, T.H.J.J. van der.
1991-09-01
To stimulate the steam/water flow behaviour in a fuel assembly as present in the boiling water reactor at Dodewaard, Freon-12 is used as a modelling fluid. Scaling criteria are elaborated using dimensional analysis as a fluid-to-fluid modelling technique. When scaling is emphasized on void-fraction distribution and flow-regime transitions it is found that an approximately half-scale geometry for the Freon-model should be used. Together with the low latent heat of vaporization of Freon-12 this reduces the total required heat input significantly to be only 2% of the required heat input in a 'Dodewaard' fuel-assembly. Finally, working pressure (and saturation temperature) can also be brought to a convenient level. (author). 16 refs., 11 figs., 1 tab
Investigation of two-phase thermosyphon performance filled with modern HFC refrigerants
Gorecki, Grzegorz
2018-02-01
Two-phase closed thermosyphons (TPCTs) are widely utilized as heat exchanger elements in waste heat recovery systems and as passive heating/cooling devices. They are popular because of their high thermal conductivity, simple construction and reliability. Previous researches indicate that refrigerants are performing better than typical TPCT working fluids like deionized water or alcohols in the low temperature range. In the present study three HFC (Hydrofluorocarbons) refrigerants were tested: R134a, R404A and R407C. The total length of the investigated TPCT is 550 mm with equal length (245 mm) condenser and evaporator sections. Its outer diameter is 22 mm with 1 mm wall thickness. The evaporator section was heated by hot water with varying inlet temperature by 5 K step in the range of 288 K - 323 K. The condenser was cooled by cold water with inlet temperature kept at a constant value of 283 K. It was found that using R134a and R404A as working fluids heat transfer rates are the highest. For both refrigerants 10% is optimal filling ratio. They can be utilized interchangeably because the differences between their throughputs are within uncertainty bands. R407C performance was 50% lower. Other disadvantages of using this refrigerant are relatively high working pressures and higher optimal filling ratio (30%).
THERMODYNAMIC PROPERTIES OF SELECTED HFC REFRIGERANTS
Hydrofluorocarbon (HFC) refrigerants are possible alternatives to replace ozone-depleting chlorofluorocarbon and hydrochlorofluorocarbon (HCFC) refrigerants. The flammability of a proposed new refrigerant is a major consideration in assessing its utility for a particular applicat...
Reactions of the radical cations of aliphatic aldehydes in freon matrices
International Nuclear Information System (INIS)
Belevskij, V.N.; Belopushkin, S.I.; Feldman, V.I.
1985-01-01
ESR spectra of γ-irradiated solutions of acetic and propionic aldehydes in freon-11 and freon-113 affected by aldehyde concentration, temperature, and the action of light were studied. It is shown that the radical cations are converted into neutral radicals, and the cations CHsub(3)CHsub(2)CHOsup(+). are converted to RCO and CHsub(3)CHCHO due to ion-molecular reactions of proton transfer of hydrogen atom transfer. (author)
The large contribution of projected HFC emissions to future climate forcing.
Velders, Guus J M; Fahey, David W; Daniel, John S; McFarland, Mack; Andersen, Stephen O
2009-07-07
The consumption and emissions of hydrofluorocarbons (HFCs) are projected to increase substantially in the coming decades in response to regulation of ozone depleting gases under the Montreal Protocol. The projected increases result primarily from sustained growth in demand for refrigeration, air-conditioning (AC) and insulating foam products in developing countries assuming no new regulation of HFC consumption or emissions. New HFC scenarios are presented based on current hydrochlorofluorocarbon (HCFC) consumption in leading applications, patterns of replacements of HCFCs by HFCs in developed countries, and gross domestic product (GDP) growth. Global HFC emissions significantly exceed previous estimates after 2025 with developing country emissions as much as 800% greater than in developed countries in 2050. Global HFC emissions in 2050 are equivalent to 9-19% (CO(2)-eq. basis) of projected global CO(2) emissions in business-as-usual scenarios and contribute a radiative forcing equivalent to that from 6-13 years of CO(2) emissions near 2050. This percentage increases to 28-45% compared with projected CO(2) emissions in a 450-ppm CO(2) stabilization scenario. In a hypothetical scenario based on a global cap followed by 4% annual reductions in consumption, HFC radiative forcing is shown to peak and begin to decline before 2050.
Experimental investigation of HFC407C/HC290/HC600a mixture in a window air conditioner
International Nuclear Information System (INIS)
Jabaraj, D.B.; Avinash, P.; Lal, D. Mohan; Renganarayan, S.
2006-01-01
HCFC22, one of the widely used refrigerants in window air conditioners must be phased out soon as per the Montreal protocol. Presently, HFC407C is considered as a potential drop in substitute for HCFC22, but retrofitting HCFC22 systems with HFC407C with polyol ester oil (POE) is a major issue as HFC407C is immiscible with mineral oil. The miscibility issue of HFC407C with mineral oil was overcome with the addition of a HC blend to it. The above technoeconomic feasibility issues to retrofit the existing HCFC22 systems with an ozone friendly refrigerant and retain the energy efficiency of the system are challenges in the air conditioning sector. In this present work, an experimental analysis has been conducted in a window air conditioner retrofitted with eco-friendly refrigerant mixtures of HFC407C/HC290/HC600a without changing the mineral oil. Its performance, as well as energy consumption, was compared with the conventional one. It is observed that the mixtures demand lengthening of the condenser in order to maintain the discharge pressure within acceptable limits. This also resulted in better heat transfer at the condenser. Therefore, in this study, the condenser tube length was increased by 19% to suit the mixtures as compared to HCFC22. Compared to HCFC22, the refrigeration capacity of the new mixture was 9.54-12.76% higher than that of HCFC22, while the actual COP was found to be 11.91-13.24% higher than that of HCFC22. The overall performance has proved that the HFC407C/HC blend refrigerant mixture could be an eco-friendly substitute to phase out HCFC22
Ustinov, D. A.; Sukhikh, A. A.; Sidenkov, D. V.; Ustinov, V. A.
2017-10-01
The heat supply by means of heat pumps is considered now as a rational method of local heating which can lead to economy of primary fuel. At use of low-potential heat, for example, the heat of a ground (5 … 18 °C) or ground waters (8 … 10°C) only small depressing of temperature of these sources (on 3 … 5°C) is possible that demands application of heat exchangers with intensified heatmass transfer surfaces. In thermal laboratory of TOT department the 200 W experimental installation has been developed for research of process of boiling of freon R134a. The principle of action of the installation consists in realisation of reverse thermodynamic cycle and consecutive natural measurement of characteristics of elements of surfaces of heat exchangers of real installations at boiling points of freon from-10°C to +10°C and condensing temperatures from 15°C to 50 °C. The evaporator casing has optical windows for control of process of boiling of freon on ribbed on technology of distorting cut tubes. Temperature measurement in characteristic points of a cycle is provided by copper-constantan thermocouples which by means of ADT are connected to the computer that allows treat results of measurements in a real time mode. The structure of a two-phase flow investigated by means of the optical procedure based on laser technique.
Burnout and intensification of heat transfer in a four-red bundle in freon-12 and water flows
International Nuclear Information System (INIS)
Perepelitsa, N.I.; Pomet'ko, R.S.; Sapankevich, A.P.
1979-01-01
Results of experimental investigation of burnout and intensification of heat transfer in a four-rod bundle in freon-12 and water flows are presented. Experiments are carried out at mass rates of 1000-2500 kg/(m 2 xc), pressures of 6.86-12.74 MPa, coolant temperatures at the channel entry of 240-300 deg C for water and pressures of 1.06-2.46 MPa, temperatures of 20-65 deg C for freon. Pressure at the channel exit, coolant expense and temperature at the channel entry were kept constant during experiments. Burnout was attained by smooth increase of electric power and was fixed by indexes of thermal pairs placed in tubes. The comparison of experimental results for freon-12 and water showed that regularities of burnout arising and dependence of critical heat flux (critical power) on regime parameters are qualitatively similar. The experiments showed that dynamics of burnout development for bundles with standard lattices and with lattice-turbulators is essentially different. In the first case burnout starting was accompanied by sharp change of heat transfer surface temperature. In the second case under similar conditions surface temperature increased smoothly in strict correspondance with conducted power. Data evaluation coefficient of freon-12 burnout is specified to water
Analysis and test of a breadboard cryogenic hydrogen/Freon heat exchanger
Desjardins, L. F.; Hooper, J.
1973-01-01
System studies required to verify a tube-in-tube cryogenic heat exchanger as optimum for the space shuttle mission are described. Design of the optimum configuration, which could be fabricated from commercially available hardware, is discussed. Finally, testing of the proposed configuration with supercritical hydrogen and Freon 21 is discussed and results are compared with thermal and dynamic analysis.
Hydrofluorocarbon (HFC) Scenarios, Climate Effects and the Montreal Protocol
Velders, G. J. M.; Fahey, D. W.; Daniel, J. S.
2016-12-01
The Montreal Protocol has reduced the use of ozone-depleting substances by more than 95% from its peak levels in the 1980s. As a direct result the use of hydrofluorocarbons (HFCs) as substitute compounds has increased significantly. National regulations to limit HFC use have been adopted recently in the European Union, Japan and USA, and four proposals have been submitted to amend the Montreal Protocol to substantially reduce growth in HFC use. The Parties of the Montreal Protocol have discussed these proposals during their meetings in 2016. The effects of the national regulations and Montreal Protocol amendment proposals on climate forcings and surface temperatures will be presented. Global scenarios of HFC emissions reach 4.0-5.3 GtCO2-eq yr-1 in 2050, which corresponds to a projected growth from 2015 to 2050 which is 9% to 29% of that for CO2 over the same time period. In 2050, in percent of global HFC emissions, China ( 30%), India and the rest of Asia ( 25%), Middle East and northern Africa ( 10%), and USA ( 10%) are the principal source regions; and refrigeration and stationary air conditioning are the major use sectors. Calculated baseline emissions are reduced by 90% in 2050 by implementing the North America Montreal Protocol amendment proposal. This corresponds to a reduction in surface temperature attributed to HFCs from 0.1 oC to 0.04 oC in 2050 and from 0.3-0.4 oC to 0.02 oC in 2100.
Flow film boiling heat transfer in water and Freon-113
International Nuclear Information System (INIS)
Liu, Qiusheng; Shiotsu, Masahiro; Sakurai, Akira
2002-01-01
Experimental apparatus and method for film boiling heat transfer measurement on a horizontal cylinder in forced flow of water and Freon-113 under pressurized and subcooled conditions were developed. The experiments of film boiling heat transfer from single horizontal cylinders with diameters ranging from 0.7 to 5 mm in saturated and subcooled water and Freon-113 flowing upward perpendicular to the cylinders were carried out for the flow velocities ranging from 0 to 1 m/s under system pressures ranging from 100 to 500 kPa. Liquid subcoolings ranged from 0 to 50 K, and the cylinder surface superheats were raised up to 800 K for water and 400 K for Freon-113. The film boiling heat transfer coefficients obtained were depended on surface superheats, flow velocities, liquid subcoolings, system pressures and cylinder diameters. The effects of these parameters were systematically investigated under wider ranges of experimental conditions. It was found that the heat transfer coefficients are higher for higher flow velocities, subcoolings, system pressures, and for smaller cylinder diameters. The observation results of film boiling phenomena were obtained by a high-speed video camera. A new correlation for subcooled flow film boiling heat transfer was derived by modifying authors' correlation for saturated flow film boiling heat transfer with authors' experimental data under wide subcooled conditions. (author)
Directory of Open Access Journals (Sweden)
Vali Shaik Sharmas
2018-01-01
Full Text Available The present work focuses on analytical computation of thermodynamic performance of actual vapour compression refrigeration system by using six pure refrigerants. The refrigerants are namely R22, R32, R134a, R152a, R290 and R1270 respectively. A MATLAB code is developed to compute the thermodynamic performance parameters of actual vapour compression system such as refrigeration effect, compressor work, COP, power per ton of refrigeration, compressor discharge temperature and volumetric refrigeration capacity at condensing and evaporating temperatures of 54.4oC and 7.2oC respectively. Analytical results exhibited that COP of both R32 and R134a are 15.95% and 11.71% higher among the six investigated refrigerants. However R32 and R134a cannot be replaced directly into R22 system. This is due to their higher compressor discharge temperature and poor volumetric capacity respectively. The discharge temperature of both R1270 and R290 are lower than R22 by 20-26oC. Volumetric refrigeration capacity of R1270 (3197 kJ/m3 is very close to that of volumetric capacity of R22 (3251 kJ/m3. Both R1270 and R290 shows good miscibility with R22 mineral oil. Overall R1270 would be a suitable ecofriendly refrigerant to replace R22 from the stand point of ODP, GWP, volumetric capacity, discharge temperature and miscibility with mineral oil although its COP is lower.
International Nuclear Information System (INIS)
Macbeth, R.V.; Wood, R.W.
1980-06-01
The use of a 'Freon' to model high-pressure boiling water has been employed successfully in a number of applications. A prerequisite in modelling is that a well tried and proven basis for the modelling exists. This is not entirely the situation with subcooled boiling however, since past work had tended to concentrate on bulk boiling conditions. Since many of the questions that arise in the design of subcooled boiling systems are concerned with two-phase flow structure, it was decided to place emphasis on attempting to match photographs of subcooled two-phase conditions in high-pressure water (at 55.2 and 82.7 bar) with those of Freon-12 at the corresponding pressures (8.13 and 12.75 bar). A special test-section was constructed giving visual access to a vapour forming region and to an unheated region into which vapour bubbles were drawn by the flow of subcooled liquid. The photographs obtained show that close similarity of two-phase flow structure exists in water and in Freon at corresponding conditions as determined by a previously established modelling procedure. (U.K.)
Charef, Adil; Feddaoui, M'barek; Najim, Monssif; Meftah, Hicham
2018-04-01
A computational study of the liquid film condensation from vapour-gas mixtures of HFC refrigerants inside a vertical tube is performed. The external wall of the tube is subjected to constant temperature. The model uses an implicit finite difference method to solve the governing equations for the liquid film and gas flow together including the boundary and interfacial matching conditions. Parametric computations were realised to examine the effects of inlet Reynolds number, tube length, and inlet temperature of the gas mixtures on the condensation mechanism. A comparative study between the results obtained for studied R152 a and R134 a with presence of non-condensable gas is made. The predicted results indicate that the condensation of R152 a-air corresponds to a higher accumulated condensation m c d and local heat transfer coefficient h T when compared to R134 a-air in the same conditions. Increasing the inlet Reynolds number or the tube length improve the condensation. Additionally, lower non-condensable gas in R152 a - a i r substantially enhances the heat and mass exchanges.
EXPERIMENTAL PERFORMANCE OF R134a AND R152a USING MICROCHANNEL CONDENSER
Bhatkar, V. W.
2018-01-01
An experimental performance study on vapour compression refrigeration system with R134a and drop in substitute R152a with aluminium microchannel condenser was carried out for condensation temperature of 48°C while evaporation temperature varied from -10 to 15°C. Refrigerant charge of R152a was reduced by 40% over R134a with the microchannel condenser. Performance parameters like work input to the compressor, coefficient of performance, refrigerating capacity, condenser capacity and the produc...
International Nuclear Information System (INIS)
Longo, Giovanni A.; Mancin, Simone; Righetti, Giulia; Zilio, Claudio
2016-01-01
Highlights: • This paper investigates HFC404A vaporisation inside a BPHE. • HC290 and HC1270 exhibit heat transfer coefficients similar to HFC404A. • HC290 and HC1270 exhibit frictional pressure drops higher than HFC404A. • The experimental measurements are complemented with an IR thermography analysis. - Abstract: This paper presents the heat transfer coefficients and the pressure drops measured during HFC404A vaporisation inside a commercial BPHE and the comparison of this data with previous measurements carried out during HC290 (Propane) and HC1270 (Propylene) vaporisation inside the same BPHE and similar operating condition in order to assess the capability of HydroCarbon refrigerants as long-term low GWP substitutes for HFC404A in commercial and industrial refrigeration. Propane and Propylene exhibit boiling heat transfer coefficient very similar and frictional pressure drops higher than to those of HFC404A, therefore, taking into account also their good thermodynamic properties, they seems to be very promising as long-term low GWP substitutes for HFC404A. The HFC404A boiling heat transfer coefficients were also compared with a new model for refrigerant boiling inside BPHE (Longo et al., 2015): the mean absolute percentage deviation between calculated and experimental data is 6.0%. The heat transfer measurements were also complemented with an IR thermography analysis for a better understanding of refrigerant vaporisation heat transfer regime inside a BPHE.
A molecular orbital study on the oxidative decomposition of HFC-32
International Nuclear Information System (INIS)
Mochizuki, Yuji
1999-03-01
A series of ab initio molecular orbital calculations, in which Hartree-Fock, second-order Moeller-Plesset perturbation, density functional (B3LYP and BHandHLYP) levels of theory were used, was performed on the elementary reactions related to the oxidative decomposition of HFC-32 (CH 2 F 2 ) by hydroxyl (OH) radicals in a supercritical water condition (so-called SCWO). The whole process is written as CH 2 F 2 + 4OH → CO 2 + 2H 2 O + 2HF and consists of (1) H abstraction by OH to form H 2 O, (2) OH coupling to C-center, and (3) HF leaving to form C=O bond. Molecular geometries were optimized at each level of theory. The HF leaving was found to be the rate-determining step, but its barrier height was lowered by the reactive solvation with an extra H 2 O. Calculations implied that the SCWO of HFC-32 can proceed efficiently. (author)
Freon Rig design for performing to heat transfer experiments for nuclear reactors fuel bundles
International Nuclear Information System (INIS)
Flores, L.F.V.
1981-01-01
The main features of a Freon Rig design for performing to heat transfer experiments for PWR and BWR fuel bundles, are presented. The project is based on a Freon Rig pressurized at 30 bar with a flow rate up to 80 m 3 /h. The maximum power fed to test sections is of about 420 KW D.C. The rig was designed to use scaling techniques wich would enable a fluid of low latente heat to be used in place of water, thereby reducing the cost of testes. (Author) [pt
Velders, G. J. M.
2015-12-01
Hydrofluorocarbons (HFCs) are used as substitutes for ozone-depleting substances that are being phased out globally under Montreal Protocol regulations. New global scenarios of HFC emissions reach 4.0-5.3 GtCO2-eq yr-1 in 2050, which corresponds to a projected growth from 2015 to 2050 which is 9% to 29% of that for CO2 over the same time period. New baseline scenarios are formulated for 10 HFC compounds, 11 geographic regions, and 13 use categories. These projections are the first to comprehensively assess production and consumption of individual HFCs in multiple use sectors and geographic regions with emission estimates constrained by atmospheric observations. In 2050, in percent of global HFC emissions, China (~30%), India and the rest of Asia (~25%), Middle East and northern Africa (~10%), and USA (~10%) are the principal source regions; and refrigeration and stationary air conditioning are the major use sectors. National regulations to limit HFC use have been adopted recently in the European Union, Japan and USA, and four proposals have been submitted in 2015 to amend the Montreal Protocol to substantially reduce growth in HFC use. Calculated baseline emissions are reduced by 90% in 2050 by implementing the North America Montreal Protocol amendment proposal. Global adoption of technologies required to meet national regulations would be sufficient to reduce 2050 baseline HFC consumption by more than 50% of that achieved with the North America proposal for most developed and developing countries. The new HFC scenarios and effects of national regulations and Montreal Protocol amendment proposals will be presented.
HFC perspectives in air-conditioning and refrigeration; Perspectives HFC en A/C et refrigeration
Energy Technology Data Exchange (ETDEWEB)
Fauvarque, P [ELF Atochem, Centre d` Application de Lavallois, 92 (France)
1998-12-31
This paper is a series of transparencies dealing with the development of substitutes for the replacement of the R-22 refrigerant in air-conditioning systems (R-134a, R-407C, R-410A), and in industrial refrigeration systems of agriculture and food industry (R-134a and R-404A). (J.S.)
HFC perspectives in air-conditioning and refrigeration; Perspectives HFC en A/C et refrigeration
Energy Technology Data Exchange (ETDEWEB)
Fauvarque, P. [ELF Atochem, Centre d`Application de Lavallois, 92 (France)
1997-12-31
This paper is a series of transparencies dealing with the development of substitutes for the replacement of the R-22 refrigerant in air-conditioning systems (R-134a, R-407C, R-410A), and in industrial refrigeration systems of agriculture and food industry (R-134a and R-404A). (J.S.)
Wang, Z.; Fang, X.; Zhang, J.
2015-12-01
After the phase-out of hydrochlorofluorocarbons (HCFCs) as ozone-depleting substances pursuant to the requirements of the Montreal Protocol, hydrofluorocarbons (HFCs) are worldwide used as substitutes although the bulk of them are potent greenhouse gases (GHGs). Therefore, the alternation may bring side effect on global climate change. The trade-off of its environmental impacts between the ozone depletion and climate change regimes necessitates a quantification of the past and future consumption and emissions of both the original HCFCs and their alternative HFCs. Now a dilemma arise in China's RAC industry that HCFC-22, which has an ozone-depleting potential (ODP) of 0.055, has been replaced by HFC-410A, which is a blended potent GHG from respective 50% HFC-32 and HFC-125 with a global warming potential (GWP) of 1923.5. Here, we present our results of estimates of consumption and emissions of HCFC-22 and HFC-410A from 1994 to 2050. Historic emissions of HCFC-22 contributed to global total HCFCs by 4.0% (3.0%-5.6%) ODP-weighted. Projection under a baseline scenario shows future accumulative emissions of HFC-410A make up 5.9%-11.0% of global GWP-weighted HFCs emissions, and its annual contribution to national overall CO2 emissions can be 5.5% in 2050. This makes HCFC-22 and HFC-410A emissions of significant importance in ozone depletion and climate change regimes. Two mitigation scenarios were set to assess the mitigation performance under the North America Proposal and an accelerated schedule. In practice of international environmental agreement, "alternative to alternative" should be developed to avoid regrettable alternations.
International Nuclear Information System (INIS)
Guo, Y.; Bullock, D.E.; Pioro, I.L.; Martin, J.
2006-01-01
An experimental program has been completed to study the behaviour of sheath wall temperatures in the Bruce Power Station Low Void Reactivity Fuel (shortened hereafter to Bruce LVRF) bundles under post-dryout (PDO) heat-transfer conditions. The experiment was conducted with an electrically heated simulator of a string of nine Bruce LVRF bundles, installed in the MR-3 Freon heat transfer loop at the Chalk River Laboratories (CRL), Atomic Energy of Canada Limited (AECL). The loop used Freon R-134a as a coolant to simulate typical flow conditions in CANDU R nuclear power stations. The simulator had an axially uniform heat flux profile. Two radial heat flux profiles were tested: a fresh Bruce LVRF profile and a fresh natural uranium (NU) profile. For a given set of flow conditions, the channel power was set above the critical power to achieve dryout, while heater-element wall temperatures were recorded at various overpower levels using sliding thermocouples. The maximum experimental overpower achieved was 64%. For the conditions tested, the results showed that initial dryout occurred at an inner-ring element at low flows and an outer-ring element facing internal subchannels at high flows. Dry-patches (regions of dryout) spread with increasing channel power; maximum wall temperatures were observed at the downstream end of the simulator, and immediately upstream of the mid-bundle spacer plane. In general, maximum wall temperatures were observed at the outer-ring elements facing the internal subchannels. The maximum water-equivalent temperature obtained in the test, at an overpower level of 64%, was significantly below the acceptable maximum temperature, indicating that the integrity of the Bruce LVRF will be maintained at PDO conditions. Therefore, the Bruce LVRF exhibits good PDO heat transfer performance. (authors)
Greally, B. R.; Manning, A. J.; Reimann, S.; McCulloch, A.; Huang, J.; Dunse, B. L.; Simmonds, P. G.; Prinn, R. G.; Fraser, P. J.; Cunnold, D. M.; O'Doherty, S.; Porter, L. W.; Stemmler, K.; Vollmer, M. K.; Lunder, C. R.; Schmidbauer, N.; Hermansen, O.; Arduini, J.; Salameh, P. K.; Krummel, P. B.; Wang, R. H. J.; Folini, D.; Weiss, R. F.; Maione, M.; Nickless, G.; Stordal, F.; Derwent, R. G.
2007-03-01
Ground-based in situ measurements of 1,1-difluoroethane (HFC-152a, CH3CHF2) which is regulated under the Kyoto Protocol are reported under the auspices of the AGAGE (Advanced Global Atmospheric Gases Experiment) and SOGE (System of Observation of halogenated Greenhouse gases in Europe) programs. Observations of HFC-152a at five locations (four European and one Australian) over a 10 year period were recorded. The annual average growth rate of HFC-152a in the midlatitude Northern Hemisphere has risen from 0.11 ppt/yr to 0.6 ppt/yr from 1994 to 2004. The Southern Hemisphere annual average growth rate has risen from 0.09 ppt/yr to 0.4 ppt/yr from 1998 to 2004. The 2004 average mixing ratio for HFC-152a was 5.0 ppt and 1.8 ppt in the Northern and Southern hemispheres, respectively. The annual cycle observed for this species in both hemispheres is approximately consistent with measured annual cycles at the same locations in other gases which are destroyed by OH. Yearly global emissions of HFC-152a from 1994 to 2004 are derived using the global mean HFC-152a observations and a 12-box 2-D model. The global emission of HFC-152a has risen from 7 Kt/yr to 28 Kt/yr from 1995 to 2004. On the basis of observations of above-baseline elevations in the HFC-152a record and a consumption model, regional emission estimates for Europe and Australia are calculated, indicating accelerating emissions from Europe since 2000. The overall European emission in 2004 ranges from 1.5 to 4.0 Kt/year, 5-15% of global emissions for 1,1-difluoroethane, while the Australian contribution is negligible at 5-10 tonnes/year, <0.05% of global emissions.
Energy Technology Data Exchange (ETDEWEB)
Hernandez, J.I.; Best, R.; Estrada, C.A. [UNAM, Morelos (Mexico). Centro de Investigacion en Energia; Dorantes, R.J. [UAM Azcapotzalco, Reynosa Tamaulipas (Mexico). Dpto. de Energia
2004-09-01
A complete theoretical analysis on the thermodynamic behaviour of a HYbrid Compressor and Ejector Refrigeration System - HYCERS - is carried out. An ejector under optimum performance is employed. Two working fluids were selected: refrigerant 142b (HCFC 142b) which has shown very good characteristics in air conditioning applications of ejector systems and refrigerant 134a (HFC134a) which is widely used in refrigeration applications and readily available in most countries. The variation of the generator and condenser temperatures as well as the intercooler pressure were considered for an evaporator temperature of 10{sup o}C and a unitary cooling capacity of 1 kW. The ideal efficiency, the enthalpy-based coefficient of performance, the exergy efficiency and the supplied energy ratio are obtained. With this information, at a moderate condenser and generator temperature of 30 and 85{sup o}C, respectively, the HYCERS working with R134a had the best operation with a highest coefficient of performance of 0.48 and an exergy efficiency of 0.25. On the other hand, if a higher condenser temperature is imposed, the HYCERS with 142b had its best performance at a higher generator temperature. In selecting a working fluid the ejector subsystem behaviour is determinant in system performance. If a working fluid is badly selected, despite having high entrainment ratios, the system will not function properly. Therefore, the methodology here defined becomes an effective tool for selecting adequate working fluids and optimum system design conditions. Also, the employment of a unitary cooling load allows system scaling at any capacity as it increases linearly. (author)
Velders, Guus J. M.; Fahey, David W.; Daniel, John S.; Andersen, Stephen O.; McFarland, Mack
2015-12-01
Hydrofluorocarbons (HFCs) are manufactured for use as substitutes for ozone-depleting substances that are being phased out globally under Montreal Protocol regulations. While HFCs do not deplete ozone, many are potent greenhouse gases that contribute to climate change. Here, new global scenarios show that baseline emissions of HFCs could reach 4.0-5.3 GtCO2-eq yr-1 in 2050. The new baseline (or business-as-usual) scenarios are formulated for 10 HFC compounds, 11 geographic regions, and 13 use categories. The scenarios rely on detailed data reported by countries to the United Nations; projections of gross domestic product and population; and recent observations of HFC atmospheric abundances. In the baseline scenarios, by 2050 China (31%), India and the rest of Asia (23%), the Middle East and northern Africa (11%), and the USA (10%) are the principal source regions for global HFC emissions; and refrigeration (40-58%) and stationary air conditioning (21-40%) are the major use sectors. The corresponding radiative forcing could reach 0.22-0.25 W m-2 in 2050, which would be 12-24% of the increase from business-as-usual CO2 emissions from 2015 to 2050. National regulations to limit HFC use have already been adopted in the European Union, Japan and USA, and proposals have been submitted to amend the Montreal Protocol to substantially reduce growth in HFC use. Calculated baseline emissions are reduced by 90% in 2050 by implementing the North America Montreal Protocol amendment proposal. Global adoption of technologies required to meet national regulations would be sufficient to reduce 2050 baseline HFC consumption by more than 50% of that achieved with the North America proposal for most developed and developing countries.
Energy Technology Data Exchange (ETDEWEB)
Yagyu, Sumio; Maekawa, Koich; Sugawara, Koich; Hayashida, Masaru; Fujishima, Ichiro; Fukuyama, Yuji; Morikawa, Tomoyuki; Yamato, Tadao; Obata, Norio [Advanced Technology Lab., Kubota Corp., Amagasaki, Hyogo (Japan)
1999-07-01
This paper describes recent results at Kubota to develop a gas engine driven freon-free heat supply system. Utilizing a gas mixture which consists of CO and H{sub 2} supplied from a broad area energy utilization network, the system produces four heat sources (263 K, 280 K, 318 K, and 353 K) for air-conditioning, hot water supply, and refrigeration in a single system. It also conforms to fuel systems that utilize methane and hydrogen. This multi-functional heat supply system is composed of an efficient gas engine (methanol gas engine) and a freon-free heat pump (heat-assisted Stirling heat pump). The heat-assisted Stirling heat pump is mainly driven by engine shaft power and is partially assisted by thermal power provided by engine exhaust heat. By proportioning the two energy sources to match the characteristics of the driving engine, the heat pump is supplied with the maximum share of the original energy fueling the engine. Developing the system will establish freon-free thermal utilization system technology that satisfies both wide heat demands and various fuel systems. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Cavestri, R.C. [Imagination Resources, Inc., Dublin, OH (United States)
1994-11-01
Included in this report is a compiled partial list of presently used processing materials in the air-conditioning and refrigeration industry and the manufacturers, intended uses, and applications of each. Also listed are the processing materials that have received final acceptance for this contracted study. An analytical methodology discussion is presented, including the final decision and the limitations of said methodology, as well as how to establish a level of confidence in observed immiscible material components in two 32 ISO VG polyolesters: (1) Mobil EAL Arctic 32; and (2) ICI Emkarate RL32H; both with HFC 134a refrigerant solutions.
Energy Technology Data Exchange (ETDEWEB)
Wang, Yalei, E-mail: yaleipm@csu.edu.cn [State Key Laboratory of Powder Metallurgy, Central South University, Changsha, 410083 (China); School of Metallurgy and Environment, Central South University, Changsha, 410083 (China); Li, Zehao [State Key Laboratory of Powder Metallurgy, Central South University, Changsha, 410083 (China); Xiong, Xiang, E-mail: xiongx@csu.edu.cn [State Key Laboratory of Powder Metallurgy, Central South University, Changsha, 410083 (China); Li, Xiaobin [School of Metallurgy and Environment, Central South University, Changsha, 410083 (China); Chen, Zhaoke; Sun, Wei [State Key Laboratory of Powder Metallurgy, Central South University, Changsha, 410083 (China)
2016-12-30
Highlights: • HfC coatings were deposited on C/C composites by LPCVD using HfCl4-CH4-H2-Ar system. • Action mechanism of H2 on structure and growth behavior of HfC coating was studied. • Increased H2 concentration leads to transformation in growth mechanism of coating. - Abstract: Hafnium carbide coatings were deposited on carbon/carbon composites by low pressure chemical vapor deposition using HfCl{sub 4}-CH{sub 4}-H{sub 2}-Ar system. The microstructure, mechanical and ablation resistance performance of HfC coatings deposited with various H{sub 2} concentrations were investigated. The effect of hydrogen gas on the deposition of HfC coating was also discussed. Results show that all of the deposited coatings are composed of single cubic HfC phase, the hydrogen gas acted as a crucial role in determining the preferred orientation, microstructure and growth behavior of HfC coatings. During the deposition process, the gas phase supersaturation of the reaction species can be controlled by adjusting the hydrogen gas concentration. When deposited with low hydrogen gas concentration, the coating growth was dominated by the nucleation of HfC, which results in the particle-stacked structure of HfC coating. Otherwise, the coating growth was dominated by the crystal growth at high hydrogen gas concentration, which leads to the column-arranged structure of HfC coating. Under the ablation environment, the coating C2 exhibits better configurational stability and ablation resistance. The coating structure has a significant influence on the mechanical and ablation resistance properties of HfC coating.
Directory of Open Access Journals (Sweden)
I MADE RASTA
2015-06-01
Full Text Available CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 consisting supervision rules on producing, consuming, and treading ozone damaging materials. The government of Indonesia had ratified the convention through President Decree Number 23 Year 1999. The ozone layer reservation program implementation in Indonesia is facilitated by KLH. Governor of Bali issued Decree Number 523/04-B/HK/2010 on membership restructuring of ozone layer reservation and ozone damaging materials control team work in province of Bali. This research was done in 27 car AC service companies or workshop, which received grant of 3R engine in Denpasar, Bali. The research was dominantly focused on monitoring and evaluation, that is how car AC service company or workshop manage CFC/ R-12 and HFC/R-134a refrigerant at service time using 3R engine that refrigerant does not escape to atmostphere. Cooling machine work procedure test (COP was conducted in laboratory. Research result showed that car AC service company or workshop could manage CFC/ R-12 and HFC /R-l 34a eefctively ( 88,3%. The cooling engine work procedure using CFC /R-12 as the result of 3R engine recovery and recycel resulted in 2,435 while pure CFC/R-12 resulted in 2,54. There were differences in cooling engine work procedure to the use of pure CFC/R-12 refrigerant with that resulted by 3R engine with avarage difference 0,089 or 3,53%.
2010-07-01
... removed from, motor vehicle air-conditioning systems. 1. Scope The purpose of this SAE Standard is to... 700 Standard or allow for recycling of the recovered refrigerant to SAE J2788 specifications by using... (R-134a) Recovery/Recycling Equipment and Recovery/Recycling/Recharging for Mobile Air-Conditioning...
Energy Technology Data Exchange (ETDEWEB)
Kattan, N.; Favrat, D.; Thome, J. R.; Nidegger, E.; Zuercher, O. [Ecole Polytechnique Federale, Lab. d` Energetique Industrielle (LENI), Lausanne (Switzerland)
1995-07-15
The substitution of old refrigerants in refrigeration systems, heat pumps and organic Rankine cycles for heat recovery, request a good knowledge of heat transfer properties of substitute fluids. The test measurements in LENI test facility (concentric tubes with water flowing in a counter-current flow) with new refrigerants like HFC134a, HCFC123, R-402A, have established a new data bank with new refrigerants, a comparison with old refrigerants like CFC11, CFC12 CFC/HCFC502 and with existent correlations. Correlations were programmed to calculate and compare heat transfer coefficient during the tests. To develop a new correlation based on flow regimes, a high speed Sony video tape camera is used to observe and identify flow patterns. Important images are captured, digitalized, stored for later analysis and sent to a color plotter. Several flow pattern maps were programmed and compared to flow regimes observed on the test rig. Local flow boiling heat transfer coefficients were measured for HFC134a and HCFC123 evaporating inside a microfin tube. In addition, microheat transfer augmentation relative to plain tube test data was investigated. The presence of oil in the evaporator has an effect on heat transfer coefficient. Local flow boiling heat transfer coefficients were measured for refrigerant HFC134a-oil ester (Mobil EAL Arctic 68). A new thermodynamic approach for modeling mixtures of refrigerants and lubricating oils is developed. A very high accuracy, straight vibrating tube type of density flowmeter is used to measure oil concentrations of flowing HFC134a-oil mixtures. (author) figs., tabs., refs.
2010-07-01
... Refrigerant Recycling Equipment Intended for Use With Both CFC-12 and HFC-134a E Appendix E to Subpart B of... Appendix E to Subpart B of Part 82—The Standard for Automotive Refrigerant Recycling Equipment Intended for... Intended for Use With Both CFC-12 and HFC-134a Foreword The purpose of this standard is to establish...
Energy Technology Data Exchange (ETDEWEB)
Watanabe, K; Sato, H [Keio University, Tokyo (Japan). Faculty of Science and Technology
1997-02-01
This paper describes thermodynamic properties of HFC refrigerant mixtures for Lorentz-cycled new generation air-conditioning equipment. Equipment has been completed for simultaneous measurement of density and vapor-liquid equilibrium property, accurate measurement of latent heat of vaporization, and accurate measurement of specific heat at constant pressure in liquid phase. Final adjustment and preliminary measurements are currently conducted. Through analytical investigation using actually measured data of thermodynamic properties of HFC refrigerant mixtures, five state equations were obtained, i.e., modified Peng-Robinson state equation which can reproduce the vapor-liquid equilibrium property of refrigerant mixtures, modified Patel-Teja state equation, Helmholtz function type state equation which is applicable in the whole fluid region of refrigerant mixtures, and so on. An evaluation test equipment has been fabricated as a trial for Lorentz-cycled air-conditioning equipments using HFC refrigerant mixtures, and demonstration test is conducted to confirm the validity. 9 refs., 5 figs.
International Nuclear Information System (INIS)
Stevens, G.F.; Wood, R.W.
1966-01-01
Previous experiments on the Winfrith Freon Rig have produced scaling factors which relate these Freon experiments to the corresponding experiments in water with an accuracy of about 10%. It has also been found that the Freon rig is accurate, economical and easy to use. The scaling factors so obtained have now been tested against data for 19-rod clusters which had previously been tested at Columbia University. This report presents the results of the rod cluster tests in which comparison is made between Freon-12 and water for three test-sections which differ in the means of spacing the individual rods. All the test-sections were heated uniformly with respect to length, but had a radial flux depression of nominally 0.70/1.0. The results provide strong evidence that the scaling factor method using Freon-12 at 155 lb/in 2 (abs) is a useful technique for predicting the behaviour at burn-out of complicated test-sections cooled by boiling water at 1000 lb/in 2 with only one-eighteenth of the power required for the water experiment. In particular, the Freon tests reproduce closely the relative burn-out powers previously measured in water. It has also been found that repeated rebuilding of a nominally unchanged cluster from the same components can produce burn-out powers differing by ± 6%. This new result illustrates the power and value of the Freon technique. (author)
Simmonds, Peter G.; Rigby, Matthew; McCulloch, Archie; Vollmer, Martin K.; Henne, Stephan; Mühle, Jens; O'Doherty, Simon; Manning, Alistair J.; Krummel, Paul B.; Fraser, Paul J.; Young, Dickon; Weiss, Ray F.; Salameh, Peter K.; Harth, Christina M.; Reimann, Stefan; Trudinger, Cathy M.; Steele, L. Paul; Wang, Ray H. J.; Ivy, Diane J.; Prinn, Ronald G.; Mitrevski, Blagoj; Etheridge, David M.
2018-03-01
High frequency measurements of trifluoromethane (HFC-23, CHF3), a potent hydrofluorocarbon greenhouse gas, largely emitted to the atmosphere as a by-product of the production of the hydrochlorofluorocarbon HCFC-22 (CHClF2), at five core stations of the Advanced Global Atmospheric Gases Experiment (AGAGE) network, combined with measurements on firn air, old Northern Hemisphere air samples and Cape Grim Air Archive (CGAA) air samples, are used to explore the current and historic changes in the atmospheric abundance of HFC-23. These measurements are used in combination with the AGAGE 2-D atmospheric 12-box model and a Bayesian inversion methodology to determine model atmospheric mole fractions and the history of global HFC-23 emissions. The global modelled annual mole fraction of HFC-23 in the background atmosphere was 28.9 ± 0.6 pmol mol-1 at the end of 2016, representing a 28 % increase from 22.6 ± 0.4 pmol mol-1 in 2009. Over the same time frame, the modelled mole fraction of HCFC-22 increased by 19 % from 199 ± 2 to 237 ± 2 pmol mol-1. However, unlike HFC-23, the annual average HCFC-22 growth rate slowed from 2009 to 2016 at an annual average rate of -0.5 pmol mol-1 yr-2. This slowing atmospheric growth is consistent with HCFC-22 moving from dispersive (high fractional emissions) to feedstock (low fractional emissions) uses, with HFC-23 emissions remaining as a consequence of incomplete mitigation from all HCFC-22 production.Our results demonstrate that, following a minimum in HFC-23 global emissions in 2009 of 9.6 ± 0.6, emissions increased to a maximum in 2014 of 14.5 ± 0.6 Gg yr-1 and then declined to 12.7 ± 0.6 Gg yr-1 (157 Mt CO2 eq. yr-1) in 2016. The 2009 emissions minimum is consistent with estimates based on national reports and is likely a response to the implementation of the Clean Development Mechanism (CDM) to mitigate HFC-23 emissions by incineration in developing (non-Annex 1) countries under the Kyoto Protocol. Our derived cumulative
Radiation polymerization of tetrafluoroethylene in freon-22
International Nuclear Information System (INIS)
Schnautz, N.G.; Thompson, J.C.
1979-02-01
The radiation-induced solution-polymerization of tetrafluoroethylene in Freon-22 has been investigated over a temperature range of - 62 degrees celcius to 0 degrees celcius. The rate of polymerization for the in-source process was found to be directly propertional to monomer concentration and an activation energy of only 7,66 kj/mole was calculated. The number-average molecular mass of the product PTFE ranged from 2X10 4 to 6X10 4 and was relatively independent of the usual reaction parameters. The rate of postpolymerization was also found to be directly proportional to monomer concentration. The postpolyerization process did not result in any enchancement of the initial PTFE molecular mass [af
New use of ammonia in heat pumps; Nouvelle utilisation de l`ammoniac en pompe a chaleur
Energy Technology Data Exchange (ETDEWEB)
Hivet, B.; Ducruet, C. [Electricite de France, 77 - Moret sur Loing (France). Direction des Etudes et Recherches
1996-12-31
According to simple thermodynamic criteria and to pollution regulations, ammonia and HFC 134a are the only refrigerating fluids that can be used in heat pumps. Ammonia is particularly performing at high condensation temperatures. However, its use has become possible thanks to the use of industrial refrigerating compressors with a maximum operation pressure of 40 bars. Test results confirm the interesting thermal performances of this fluid. A comparison with the HFC 134a refrigerant indicates that ammonia leads to equal or better coefficients of performance for higher volume powers. Two applications taken in the agriculture and food industries are presented. (J.S.)
Simmonds, P. G.; Rigby, M.; Manning, A. J.; Lunt, M. F.; O'Doherty, S.; McCulloch, A.; Fraser, P. J.; Henne, S.; Vollmer, M. K.; Mühle, J.; Weiss, R. F.; Salameh, P. K.; Young, D.; Reimann, S.; Wenger, A.; Arnold, T.; Harth, C. M.; Krummel, P. B.; Steele, L. P.; Dunse, B. L.; Miller, B. R.; Lunder, C. R.; Hermansen, O.; Schmidbauer, N.; Saito, T.; Yokouchi, Y.; Park, S.; Li, S.; Yao, B.; Zhou, L. X.; Arduini, J.; Maione, M.; Wang, R. H. J.; Ivy, D.; Prinn, R. G.
2016-01-01
High frequency, in situ observations from 11 globally distributed sites for the period 1994-2014 and archived air measurements dating from 1978 onward have been used to determine the global growth rate of 1,1-difluoroethane (HFC-152a, CH3CHF2). These observations have been combined with a range of atmospheric transport models to derive global emission estimates in a top-down approach. HFC-152a is a greenhouse gas with a short atmospheric lifetime of about 1.5 years. Since it does not contain chlorine or bromine, HFC-152a makes no direct contribution to the destruction of stratospheric ozone and is therefore used as a substitute for the ozone depleting chlorofluorocarbons (CFCs) and hydrochlorofluorocarbons (HCFCs). The concentration of HFC-152a has grown substantially since the first direct measurements in 1994, reaching a maximum annual global growth rate of 0.84 ± 0.05 ppt yr-1 in 2006, implying a substantial increase in emissions up to 2006. However, since 2007, the annual rate of growth has slowed to 0.38 ± 0.04 ppt yr-1 in 2010 with a further decline to an annual average rate of growth in 2013-2014 of -0.06 ± 0.05 ppt yr-1. The annual average Northern Hemisphere (NH) mole fraction in 1994 was 1.2 ppt rising to an annual average mole fraction of 10.1 ppt in 2014. Average annual mole fractions in the Southern Hemisphere (SH) in 1998 and 2014 were 0.84 and 4.5 ppt, respectively. We estimate global emissions of HFC-152a have risen from 7.3 ± 5.6 Gg yr-1 in 1994 to a maximum of 54.4 ± 17.1 Gg yr-1 in 2011, declining to 52.5 ± 20.1 Gg yr-1 in 2014 or 7.2 ± 2.8 Tg-CO2 eq yr-1. Analysis of mole fraction enhancements above regional background atmospheric levels suggests substantial emissions from North America, Asia, and Europe. Global HFC emissions (so called "bottom up" emissions) reported by the United Nations Framework Convention on Climate Change (UNFCCC) are based on cumulative national emission data reported to the UNFCCC, which in turn are based on
Directory of Open Access Journals (Sweden)
P. G. Simmonds
2018-03-01
Full Text Available High frequency measurements of trifluoromethane (HFC-23, CHF3, a potent hydrofluorocarbon greenhouse gas, largely emitted to the atmosphere as a by-product of the production of the hydrochlorofluorocarbon HCFC-22 (CHClF2, at five core stations of the Advanced Global Atmospheric Gases Experiment (AGAGE network, combined with measurements on firn air, old Northern Hemisphere air samples and Cape Grim Air Archive (CGAA air samples, are used to explore the current and historic changes in the atmospheric abundance of HFC-23. These measurements are used in combination with the AGAGE 2-D atmospheric 12-box model and a Bayesian inversion methodology to determine model atmospheric mole fractions and the history of global HFC-23 emissions. The global modelled annual mole fraction of HFC-23 in the background atmosphere was 28.9 ± 0.6 pmol mol−1 at the end of 2016, representing a 28 % increase from 22.6 ± 0.4 pmol mol−1 in 2009. Over the same time frame, the modelled mole fraction of HCFC-22 increased by 19 % from 199 ± 2 to 237 ± 2 pmol mol−1. However, unlike HFC-23, the annual average HCFC-22 growth rate slowed from 2009 to 2016 at an annual average rate of −0.5 pmol mol−1 yr−2. This slowing atmospheric growth is consistent with HCFC-22 moving from dispersive (high fractional emissions to feedstock (low fractional emissions uses, with HFC-23 emissions remaining as a consequence of incomplete mitigation from all HCFC-22 production.Our results demonstrate that, following a minimum in HFC-23 global emissions in 2009 of 9.6 ± 0.6, emissions increased to a maximum in 2014 of 14.5 ± 0.6 Gg yr−1 and then declined to 12.7 ± 0.6 Gg yr−1 (157 Mt CO2 eq. yr−1 in 2016. The 2009 emissions minimum is consistent with estimates based on national reports and is likely a response to the implementation of the Clean Development Mechanism (CDM to mitigate HFC-23 emissions by
HEAT TRANSFER EVALUATION OF HFC-236FA IN CONDENSATION AND EVAPORATION
The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...
Burnout experiments in freon 12 using different types of orifices to simulate the core grids
International Nuclear Information System (INIS)
Ladeira, L.; Katsaounis, A.; Orlowski, R.; Fulfs, H.; Hofmann, K.
1978-01-01
This paper will report on burnout experiments carried out in freon 12 mainly at steady state and further at mass flow or power transient conditions with annular test sections axially uniformly heating either the inside or both the inside and outside rod. The runs are performed without orifice and using three different types of orifices simulating the reactor spacer grid. An important influence of the flow restriction on burnout position and value is measured. Furthermore, the comparison between the burnout correlations W2, W3, B and W2 and GE and experimental results from the literature using simple test section geometries in water and freon 12 demonstrate, that the accuracy is more or less comparable for both fluids. (orig.) [de
Preparation of HfC single crystals by a floating zone technique
International Nuclear Information System (INIS)
Otani, S.; Tanaka, T.
1981-01-01
HfC single crystals have been prepared using a floating zone technique by controlling the compositions of the initial molten zone and the feed rod. The obtained crystal rods were 6 cm long and 0.9 cm in diameter. The various parts of the crystal rods have nearly constant compositions (C/Hf(ZR) = 0.956-0.977), and do not contain any free carbon. The impurities in the crystal, evaporation product, and starting material were examined by fluorescence X-ray spectroscopy. The refining effect due to evaporation was discussed. (orig.)
MODELING AND DESIGN STUDY USING HFC-236EA AS AN ALTERNATIVE REFRIGERANT IN A CENTRIFUGAL COMPRESSOR
The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...
Analysis of a combined Rankine-vapour-compression refrigeration cycle
International Nuclear Information System (INIS)
Aphornratana, Satha; Sriveerakul, Thanarath
2010-01-01
This paper describes a theoretical analysis of a heat-powered refrigeration cycle, a combined Rankine-vapour-compression refrigeration cycle. This refrigeration cycle combines an Organic Rankine Cycle and a vapour-compression cycle. The cycle can be powered by low grade thermal energy as low as 60 deg. C and can produce cooling temperature as low as -10 deg. C. In the analysis, two combined Rankine-vapour-compression refrigeration cycles were investigated: the system with R22 and the system with R134a. Calculated COP values between 0.1 and 0.6 of both the systems were found.
Directory of Open Access Journals (Sweden)
P. G. Simmonds
2016-01-01
Full Text Available High frequency, in situ observations from 11 globally distributed sites for the period 1994–2014 and archived air measurements dating from 1978 onward have been used to determine the global growth rate of 1,1-difluoroethane (HFC-152a, CH3CHF2. These observations have been combined with a range of atmospheric transport models to derive global emission estimates in a top-down approach. HFC-152a is a greenhouse gas with a short atmospheric lifetime of about 1.5 years. Since it does not contain chlorine or bromine, HFC-152a makes no direct contribution to the destruction of stratospheric ozone and is therefore used as a substitute for the ozone depleting chlorofluorocarbons (CFCs and hydrochlorofluorocarbons (HCFCs. The concentration of HFC-152a has grown substantially since the first direct measurements in 1994, reaching a maximum annual global growth rate of 0.84 ± 0.05 ppt yr−1 in 2006, implying a substantial increase in emissions up to 2006. However, since 2007, the annual rate of growth has slowed to 0.38 ± 0.04 ppt yr−1 in 2010 with a further decline to an annual average rate of growth in 2013–2014 of −0.06 ± 0.05 ppt yr−1. The annual average Northern Hemisphere (NH mole fraction in 1994 was 1.2 ppt rising to an annual average mole fraction of 10.1 ppt in 2014. Average annual mole fractions in the Southern Hemisphere (SH in 1998 and 2014 were 0.84 and 4.5 ppt, respectively. We estimate global emissions of HFC-152a have risen from 7.3 ± 5.6 Gg yr−1 in 1994 to a maximum of 54.4 ± 17.1 Gg yr−1 in 2011, declining to 52.5 ± 20.1 Gg yr−1 in 2014 or 7.2 ± 2.8 Tg-CO2 eq yr−1. Analysis of mole fraction enhancements above regional background atmospheric levels suggests substantial emissions from North America, Asia, and Europe. Global HFC emissions (so called “bottom up” emissions reported by the United Nations Framework Convention on Climate Change (UNFCCC
Energy Technology Data Exchange (ETDEWEB)
Kattan, N.; Favrat, D.; Thome, J. R.; Nidegger, E.; Zuercher, O. [Ecole Polytechnique Federale, Lab. d` Energetique Industrielle (LENI), Lausanne (Switzerland)
1995-07-15
The substitution of old refrigerants in refrigeration systems, heat pumps and organic Rankine cycles for heat recovery, request a good knowledge of heat transfer properties of substitute fluids. The test measurements in LENI test facility (concentric tubes with water flowing in a counter-current flow) with new refrigerants like HFC134a, HCFC123, R-404A, R-402A, have established a new data bank with new refrigerants, a comparison with old refrigerants like CFC11, CFC12 CFC/HCFC502 and with existent correlations. Correlations were programmed to calculate and compare heat transfer coefficient during the tests. To develop a new correlation based on flow regimes, a high speed Sony video tape camera is used to observe and identify flow patterns. Important images are captured, digitalized, stored for later analysis and sent to a color plotter. Several flow pattern maps were programmed and compared to flow regimes observed on the test rig. Local flow boiling heat transfer coefficients were measured for HFC134a and HCFC123 evaporating inside a microfin tube. In addition, microfin heat transfer augmentation relative to plain tube test data was investigated. The presence of oil in the evaporator has an effect on heat transfer coefficient. Local flow boiling heat transfer coefficients were measured for refrigerant HFC134a-oil ester (Mobil EAL Arctic 68). A new thermodynamic approach for modeling mixtures of refrigerants and lubricating oils is developed. A very high accuracy, straight vibrating tube type of density flowmeter is used to measure oil concentrations of flowing HFC134a-oil mixtures. (author) 28 figs., 25 refs.
Cardiotoxicity of Freon among refrigeration services workers: comparative cross-sectional study
2009-01-01
Background Freon includes a number of gaseous, colorless chlorofluorocarbons. Although freon is generally considered to be a fluorocarbon of relatively low toxicity; significantly detrimental effects may occur upon over exposure. The purpose of the present study is to investigate whether occupational exposure to fluorocarbons can induce arterial hypertension, myocardial ischemia, cardiac arrhythmias, elevated levels of plasma lipids and renal dysfunction. Methods This comparative cross-sectional study was conducted at the cardiology clinic of the Suez Canal Authority Hospital (Egypt). The study included 23 apparently healthy male workers at the refrigeration services workshop who were exposed to fluorocarbons (FC 12 and FC 22) and 23 likewise apparently healthy male workers (unexposed), the control group. All the participants were interviewed using a pre-composed questionnaire and were subjected to a clinical examination and relevant laboratory investigations. Results There were no significant statistical differences between the groups studied regarding symptoms suggesting arterial hypertension and renal affection, although a significantly higher percentage of the studied refrigeration services workers had symptoms of arrhythmias. None of the workers had symptoms suggesting coronary artery disease. Clinical examination revealed that the refrigeration services workers had a significantly higher mean pulse rate compared to the controls, though no significant statistical differences were found in arterial blood pressure measurements between the two study groups. Exercise stress testing of the workers studied revealed normal heart reaction to the increased need for oxygen, while sinus tachycardia was detected in all the participants. The results of Holter monitoring revealed significant differences within subject and group regarding the number of abnormal beats detected throughout the day of monitoring (p < 0.001). There were no significant differences detected in the
Reproductive and developmental toxicity of hydrofluorocarbons used as refrigerants.
Ema, Makoto; Naya, Masato; Yoshida, Kikuo; Nagaosa, Ryuichi
2010-04-01
The present paper summarizes data on the reproductive and developmental toxicity of hydrofluorocarbons (HFCs), including pentafluoroethane (HFC-125), 1,1,1,2-tetrafluoroethane (HFC-134a), 1,1,1-trifluoroethane (HFC-143a), 1,1-difluoroethane (HFC-152a), difluoromethane (HFC-32) and 1,1,1,3,3-pentafluoropropane (HFC-245fa), used as refrigerants, published in openly available scientific literature. No developmental toxicity of HFC-125 was found even at 50,000 ppm in rats or rabbits. Although HFC-134a exhibited no dominant lethal effect or reproductive toxicity in rats, it caused low body weight in pre- and postnatal offspring and slightly retarded skeletal ossification in fetuses at 50,000 ppm in rats. No maternal or developmental toxicity was noted after exposure to HFC-143a even at 40,000 ppm in rats or rabbits or HFC-152a even at 50,000 ppm in rats. HFC-32 is slightly maternally and developmentally toxic at 50,000 ppm in rats, but not in rabbits. HFC-245fa caused decreases in maternal body weight and food consumption at 10,000 and 50,000 ppm and fetal weight at 50 000ppm. No evidence of teratogenicity for these HFCs was noted in rats or rabbits. There is limited information about the reproductive toxicity of these HFCs. Animal studies remain necessary for risk assessments of chemicals because it is difficult to find alternative methods to determine the toxic effects of chemicals. It is required to reduce emissions of organic vapors containing HFCs to reduce the risk of exposure. Copyright 2009 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-03-01
An investigational study was made of the quantity of the specified freon remaining in the construction use heat insulating material, the rational method for the recovery/treatment, etc. As to the standardization of the method to analyze the remaining freon quantity, the tube furnace - GC method and the MS method were proposed, and the basic items that can be developed to JIS (Japanese Industrial Standard) were standardized. In the estimation of the remaining freon quantity, the actual state of the use of heat insulating materials was surveyed from the statistics on the start of construction work, survey of the heat insulating area in actual buildings and listening to heat insulation workers/cold store construction companies, etc. Further, the remaining quantity was analyzed of samples collected from various buildings nationwide and by years of completion. As a result, it was found out that, even in samples before 1995, HCFC is used in about 10% and that, in case of limiting to the specified freon (CFC), the freon remaining quantity was more than 1-4 wt% even after a lapse of 30 years. The paper arranged subjects on the freon recovery/treatment in each stage of the life cycle and the required conditions for technology/equipment. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
A hydrochlorofluorocarbon (HCFC) refrigerant, R-22, is currently being used almost exclusively as a refrigerant for conventional air-conditioning equipments. Since HCFCs are expected to be banned shortly, it is considered a crucial issue to support R and D of the air-conditioning system Lorentz-cycled with hydrofluorocarbon (HFC) refrigerants mixtures. In the present research project, therefore, it is aimed to reveal some of the essential thermodynamic properties of HFC refrigerant mixtures systematically. On the basis of a series of achievements for the last several years by the present research coordinator and his group regarding thermodynamic properties of single-component and blended HFC refrigerants, we have conducted following three major research programs rather systematically on which no challenges have ever been reported worldwide. Throughout a series of experimental as well as analytical researches performed so as to meet the objectives mentioned above, some novel knowledge and valuable outcomes could be obtained in the present study. (1) Precise measurements of vapor-liquid equilibrium properties with simultaneous determination of densities, latent heats of vaporization, and isobaric specific heat capacities in liquid phase. (2) Analytical studies to establish thermodynamic property modeling. (3) Feasibility study of evaluating the Lorentz-cycled performance. (NEDO)
Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems
National Research Council Canada - National Science Library
Gui, Fulin
1996-01-01
..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...
Aziz, A.; Izzudin; Mainil, A. K.
2017-09-01
The objective of this study is to compare the performance of refrigerator system using working fluid between R134a refrigerant and HCR134a as hydrocarbon refrigerant for substitution of R134a. The use of capillary tube (CT) 1.5 m with HCR134a showed that slightly better COP than among the others, due to the lower pressure of condenser, conversely thermostatic expansion valve (TEV) showed that better COP than among the others with R134a. COP of CT 1.25 m and CT 1.5 m using HCR134a increase about 42.89% and 18.09% compared to R134a, where the electric current of refrigerator system decrease about 11.63% and 10.98%. However, the COP of HCR134a with CT 2.7 m and TEV were obtained lower than R134a about 16.2% and 17.06% and the use of electric current is higher than R134a about 12.98% and 16.5%. The use of HCR134a provides a higher refrigeration effect than R134a about 66.71%-88.27% for various types of expansion devices. The results confirmed that HCR134a could be an alternative refrigerant for replacement of R134a refrigerant.
International Nuclear Information System (INIS)
Stevens, G.F.; Kirby, G.J.
1964-07-01
An earlier report presented the results of an experimental investigation into forced convection burn-out in Freon 12 (Arcton 12) at 155 lb/in 2 (abs) flowing vertically upwards in uniformly heated round tubes. This work was carried out as part of a programme devised to explore the possibility of developing model techniques for studies of two-phase flow and burn-out in high pressure water. The Freon 12 burn-out data was shown to exhibit qualitative similarity with data for water at 1000 Ib/in 2 , and to bring to light a number of details previously concealed by experimental scatter and inadequate coverage. The object of this paper is to present the results of a quantitative comparison of the Freon 12 data and the available water data, and to discuss the implications of this on the possibility of developing model techniques in the study of burn-out. (author)
International Nuclear Information System (INIS)
Shchapin, I.Yu.; Belevskij, V.N.
1996-01-01
Transformations of cation-radicals of 1,3- and 1,4-pentadienes, 2,3-dimethylbutadienes and cyclopentene, formed by X-ray irradiation at 77 K, are studied in the freon-11 and 113 matrices. It is shown that cation-radicals of 1,3-pentadienes in the CFCl 3 matrix at 77 K are regrouped in cyclopentene cation-radicals. There is no such a regrouping in the freon-113 matrix. The 1,4-pentadiene radicals have plane structure in the CFCl 3 matrix and are transformed into pentadienyl radicals in the freon-113 matrix. The cation radicals of dimethylbutadiene in the freon-113 matrix are transformed into end allyl radicals. The cation-radicals of cyclopentene in the freon-113 matrix are transformed at 110 K in cyclic allyl radicals. The radicals formation mechanism is in good agreement with the data, obtained during studies on liquid hydrocarbons, X-irradiated at 293 K in the presence of spin trap of 2.4.6-tri-tert-butylnitrosobenzene
Prinn, Ronald G.
2015-01-01
High frequency, in situ observations from 11 globally distributed sites for the period 1994–2014 and archived air measurements dating from 1978 onward have been used to determine the global growth rate of 1,1-difluoroethane (HFC-152a, CH[subscript 3]CHF[subscript 2]). These observations have been combined with a range of atmospheric transport models to derive global emission estimates in a top-down approach. HFC-152a is a greenhouse gas with a short atmospheric lifetime of about 1.5 years. Si...
An experimental evaluation of the greenhouse effect in the substitution of R134a with CO2
International Nuclear Information System (INIS)
Aprea, C.; Greco, A.; Maiorino, A.
2012-01-01
This paper addresses the problem of R314a substitution with a natural refrigerant fluid. Attention is devoted to the evaluation of the environmental impact, in terms of greenhouse effect. R134a and R744 (CO 2 ) are compared to one another. The hydrofluorocarbon R134a has a large direct warming impact (GWP), whereas the R744 contribution is negligible. The greenhouse effect is determined by the experimental evaluation of the TEWI index (Total Equivalent Warming Impact) that takes into account both direct and indirect contributions to global warming. This paper compares a commercial R134a refrigeration plant and a prototype R744 system working in a trans-critical cycle. The experimental results clearly show that the latter has a larger TEWI than the system operating with R134a. The indirect contribution to global warming provided by R744 is always greater than that of R134a. This contribution prevails in most cases. Only few operating conditions corresponding to a refrigerating plant working as a classical split system benefits, in terms of greenhouse effect, of the substitution of R134a with R744. -- Highlights: ► A comparison between a classical vapour compression plant and a trans-critical cycle. ► Evaluation of the greenhouse effect in R134a substitution with R744. ► Evaluation of direct and indirect contribution to global warming. ► Minimization of the global warming impact of a R744 transcritical cycle.
International Nuclear Information System (INIS)
Guida, R.; Capeans, M.; Mandelli, B.
2016-01-01
The large muon trigger systems based on Resistive Plate Chambers (RPC) at the LHC experiments are currently operated with R134a based mixture. Unfortunately R134a is considered a greenhouse gas with high impact on the enviroment and therefore will be subject to regulations aiming in strongly reducing the available quantity on the market. The immediat effects might be instability on the price and incertitude in the product availability. Alternative gases (HFO-1234yf and HFO-1234ze) have been already identified by industry for specific applications as replacement of R134a. Moreover, HFCs similar to the R134a but with lower global warming potential (GWP) are already available (HFC-245fa, HFC-32, HFC-152a). The present contribution describes the results obtained with RPCs operated with new enviromemtal friendly gases. A particular attention has been addressed to the possibility of maintening the current operation conditions (i.e. currently used applied voltage and front-end electronics) in order to be able to use a new mixture for RPC systems even where the common infrastructure (i.e. high voltage and detector components) cannot be replaced for operation at higher applied voltages.
HfC plasma coating of C/C composites
International Nuclear Information System (INIS)
Boncoeur, M.; Schnedecker, G.; Lulewicz, J.D.
1992-01-01
The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs
Photoionization and dissociative photoionization study of HFC-152a using synchrotron radiation
International Nuclear Information System (INIS)
Huang Chaoqun; Wei Lixia; Yang Bin; Yang Rui; Wang Sisheng; Shan Xiaobin; Qi Fei; Zhang Yunwu; Sheng Liusi; Hao Liqing; Zhou Shikang; Wang Zhenya
2006-01-01
Photoionization and dissociative photoionization of HFC-152a have been studied using synchrotron radiation and a reflection time-of-flight mass spectrometry (RTOF-MS). The ionization energy of parent molecule (11.94 ± 0.04 eV) and appearance potentials of various fragment ions have been determined by measuring their photoionization efficiency curves. Energies, symmetry point groups and ground electronic states of neutrals and cations of parent and its fragments have been calculated using GAUSSIAN-03 program with the G3 method. According to the theoretical and experimental results, some dissociation channels and their dissociation energies of CH 3 CHF 2 + have been analyzed. (authors)
HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION
The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...
(Vapour + liquid) equilibria of the {1,1-difluoroethane (HFC-152a) + n-butane (HC-600)} system
International Nuclear Information System (INIS)
Im, Jihoon; Lee, Gangwon; Lee, Yong-Jin; Kim, Hwayong
2007-01-01
Binary (vapour + liquid) equilibrium data were obtained for the {1,1-difluoroethane (HFC-152a) + n-butane (HC-600)} system at temperatures from 313.15 K to 363.15 K. These experiments were carried out with a circulating-type apparatus with on-line gas chromatography. The experimental data were correlated well by Peng-Robinson equation of state using the Wong-Sandler mixing rules. This system shows positive azeotropic phase behaviour
Disk-based compression of data from genome sequencing.
Grabowski, Szymon; Deorowicz, Sebastian; Roguski, Łukasz
2015-05-01
High-coverage sequencing data have significant, yet hard to exploit, redundancy. Most FASTQ compressors cannot efficiently compress the DNA stream of large datasets, since the redundancy between overlapping reads cannot be easily captured in the (relatively small) main memory. More interesting solutions for this problem are disk based, where the better of these two, from Cox et al. (2012), is based on the Burrows-Wheeler transform (BWT) and achieves 0.518 bits per base for a 134.0 Gbp human genome sequencing collection with almost 45-fold coverage. We propose overlapping reads compression with minimizers, a compression algorithm dedicated to sequencing reads (DNA only). Our method makes use of a conceptually simple and easily parallelizable idea of minimizers, to obtain 0.317 bits per base as the compression ratio, allowing to fit the 134.0 Gbp dataset into only 5.31 GB of space. http://sun.aei.polsl.pl/orcom under a free license. sebastian.deorowicz@polsl.pl Supplementary data are available at Bioinformatics online. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
A fundamental equation of state for 1,1-difluoroethane (HFC-152a)
Tillner-Roth, R.
1995-01-01
A fundamental equation ofstale for HFC-152a ( 1,1-dilluorocthane) is presented covering temperatures between the triple-point temperature ( 154.56 K) and 435 K for pressures up to 311 M Pa. The equation is based on reliable ( p, g, T) data in the range mentioned above. These are generally represented within ±0.1 % of density. Furthermore. experimental values of the vapor pressure, the saturated liquid density, and some isobaric heat capacities in the liquid were included during the correlation process. The new equation of state is compared with experimental data and also with the equation of state developed by Tamatsu et al. Differences between the two equations of state generally result from using different experimental input data. It is shown that the new equation of state allows an accurate calculation of various thermodynamic properties for most technical applications.
ESTUDO TERMODINÂMICO DA APLICAÇÃO DE HIDROCARBONETOS EM SISTEMA DE REFRIGERAÇÃO
Directory of Open Access Journals (Sweden)
Jucélio Gomes da Silva
2010-11-01
Full Text Available Os esforços de pesquisa e desenvolvimento na área de Refrigeração e Ar-Condicionado aplicados ao uso de fluidos refrigerantes naturais não esta associada somente à necessidade de preservação do meio-ambiente em si, mas também apresenta grande importância na necessidade latente do aumento da eficiência energética dos equipamentos. Neste sentido, o presente trabalho trata da avaliação termodinâmica da aplicação de fluidos refrigerantes hidrocarbonetos em um sistema de refrigeração residencial que utiliza o HFC134a como fluido de trabalho. Uma análise teórico-computacional foi desenvolvida para o R134a, propano (R290 e as misturas selecionadas (R290/R600a 60%/40%, R290/R600a/R134a 40%/30%/30% e R600a/R290-GLP 70%/30% no ciclo de refrigeração padrão ASHRAE, utilizando as propriedades termodinâmicas e termofísicas fornecidas pelo software REFPROP 6.0. Os resultados das simulações computacionais foram comparados entre os fluidos para indicação da melhor alternativa ao HFC134a. Neste sentido, pôde-se observar que os hidrocarbonetos reduzem os níveis de pressão no condensador e evaporador, além de menores trabalhos de compressão serem necessários no sistema devido às propriedades termofísicas privilegiadas destes fluidos. A utilização destes fluidos também proporciona uma menor temperatura de descarga do compressor, incrementando a vida útil deste componente de alto valor do sistema.
International Nuclear Information System (INIS)
Nickerson, J.R.
1982-05-01
A 6-m, 37-element, electrically heated bundle with full end plate simulation, cooled by Freon-12, has been tested for CHF (critical heat flux) and post-CHF conditions in the MR-3 Freon loop. The bundle was tested in a horizontal attitude and had a uniform axial heat flux distribution and radial heat flux depression. A total of 110 CHF points have been collected over the following range of water equivalent conditions: exit pressure 8.27 - 11.03 MPa, mass flux 1.38 - 8.14 Mg.m -2 .s -1 , inlet subcooling 0 - 500 kJ.kg -1 , outlet quality 10% - 37%. The data have been correlated on both a systems and local conditions basis over a limited mass flux range to within 2.8% rms. Significant CHF increases over smooth bundle results have been observed along with significant CHF improvement over a two end plate bundle simulation in the lower mass flux ranges. A satisfactory axial drypatch spreading correlation has been determined and extensive drypatch wall superheat mapping has been performed
Energy and exergy analyses of a bi-evaporator compression/ejection refrigeration cycle
International Nuclear Information System (INIS)
Geng, Lihong; Liu, Huadong; Wei, Xinli; Hou, Zhonglan; Wang, Zhenzhen
2016-01-01
Highlights: • A bi-evaporator compression/ejection refrigeration cycle was studied experimentally. • Experiments were operated at the same external conditions and cooling capacities. • COP improvement was 16.94–30.59% higher than that of the conventional system. • The exergy efficiency of the R134a cycle was improved by 7.57–28.29%. - Abstract: Aiming to reduce the throttling loss in the vapor compression refrigeration cycle, a bi-evaporator compression/ejection refrigeration cycle (BCERC) using an ejector as the expansion device was experimentally investigated with R134a refrigerant. The effects of the compressor frequency and the operating conditions on the coefficient of performance (COP) and the amount of exergy destruction of each component were studied. The results were compared with that of the conventional vapor compression refrigeration cycle under the same external operating conditions and cooling capacities. Results showed that the refrigeration cycle with an ejector as the expansion device exhibited lower irreversibility for each component and total system in comparison with the conventional vapor compression refrigeration cycle. The COP and the exergy efficiency of the BCERC were higher than that of the conventional system. The COP and exergy efficiency improvements became more significant as the condenser water temperature increased, the evaporator water temperature decreased and the compressor frequency increased. In the BCERC with a constant frequency compressor, the COP and the exergy efficiency could be improved by 16.94–30.59%, 7.57–28.29%, respectively. The COP and the exergy efficiency of the BCERC with a variable frequency compressor could increase by around 32.64% and 23.32%, respectively.
International Nuclear Information System (INIS)
Lasa, J.
1981-01-01
In developing the use of Freon-11 and Freon-12 as environmental tracers in aeronomy, oceanography and hydrology electron capture gas chromatography was used to measure the concentration changes. A detector in the coulometric mode was designed and operated as a solute switch. The detection limit was in the order of 0.2x10 -12 g for a modified head space method in handling aqueous samples. Theoretical analysis of the detector design and the effects of factors including pulsing period, flowrates of carrier gas and the radioactivity of the detector source were discussed and confirmed experimentally
Transmission design in a multimode HFC network
Cambron, G. Keith
1996-11-01
Contemporary hybrid fiber coaxial (HFC) networks are capable of supporting a wide range of services including traditional analog video, telephony, digital video, and data services. Each service has unique performance or service requirements. This contribution examines transmission design for one such network. Pacific Bell's advanced communications network (ACN). The design methodology begins with a set of end to end service quality objectives. Network impairments, such as noise, distortion and delay, are allocated across the network elements using a set of standard network models. These models are a representative set of the actual field designs and bound the network operating parameters. Network components, headend equipment, and customer premises equipment are specified analytically or characterized empirically in relationship to the chosen impairment set. The component parameters are then included in analytical models to estimate overall network performance. In addition to the forward path transmission considerations examined by traditional coaxial network designers, other dimensions including power consumption, traffic demand, and message latency are taken into account. Analytical models are used to estimate the effects of multiple modulation schemes within the unified network. The variability introduced by on demand services such as telephony and interactive digital services changes the base computational domain from deterministic models to stochastic ones. These models are then used to set operating parameters at measurable points throughout the network for proof of performance prior to turn up, and for ongoing performance monitoring. For closure, empirical results are compared with model projections as a way of verifying and improving the predictive models.
International Nuclear Information System (INIS)
Katsaounis, A.; Orlowski, R.; Fulfs, H.; Hofmann, K.; Ladeira, L.C.D.
1978-06-01
This paper will report on burnout experiments carried out in freon 12 mainly at steady state and further at mass flow or power transient conditions with annular test sections axially uniformly heating either the inside or both the inside and outside rod. The runs are performed without orifice and using three different types of orifices simulating the reactor spacer grid. An important influence of the flow restriction on burnout position and value is measured. Furthermore, the comparison between the burnout correlations W2, W3, BandW2 and GE and experimental results from the literature using simple test section geometries in water and freon 12 demonstrate, that the accuracy is more or less comparable for both fluids
Emission estimates of HCFCs and HFCs in California from the 2010 CalNex study
Barletta, Barbara; Carreras-Sospedra, Marc; Cohan, Alex; Nissenson, Paul; Dabdub, Donald; Meinardi, Simone; Atlas, Elliot; Lueb, Rich; Holloway, John S.; Ryerson, Thomas B.; Pederson, James; VanCuren, Richard A.; Blake, Donald R.
2013-02-01
The CalNex 2010 (California Research at the Nexus of Air Quality and Climate Change) study was designed to evaluate the chemical composition of air masses over key source regions in California. During May to June 2010, air samples were collected on board a National Oceanic and Atmospheric Administration (NOAA) WP-3D aircraft over the South Coast Air Basin of California (SoCAB) and the Central Valley (CV). This paper analyzes six effective greenhouse gases—chlorodifluoromethane (HCFC-22), 1,1-dichloro-1-fluoroethane (HCFC-141b), 1-chloro-1,1-difluoroethane (HCFC-142b), 2-chloro-1,1,1,2-tetrafluoroethane (HCFC-124), 1,1,1,2-tetrafluoroethane (HFC-134a), and 1,1-difluoroethane (HFC-152a)—providing the most comprehensive characterization of chlorofluorocarbon (CFC) replacement compound emissions in California. Concentrations of measured HCFCs and HFCs are enhanced greatly throughout the SoCAB and CV, with highest levels observed in the SoCAB: 310 ± 92 pptv for HCFC-22, 30.7 ± 18.6 pptv for HCFC-141b, 22.9 ± 2.0 pptv for HCFC-142b, 4.86 ± 2.56 pptv for HCFC-124, 109 ± 46.4 pptv for HFC-134a, and 91.2 ± 63.9 pptv for HFC-152a. Annual emission rates are estimated for all six compounds in the SoCAB using the measured halocarbon to carbon monoxide (CO) mixing ratios and CO emissions inventories. Emission rates of 3.05 ± 0.70 Gg for HCFC-22, 0.27 ± 0.07 Gg for HCFC-141b, 0.06 ± 0.01 Gg for HCFC-142b, 0.11 ± 0.03 Gg for HCFC-124, 1.89 ± 0.43 Gg for HFC-134a, and 1.94 ± 0.45 Gg for HFC-152b for the year 2010 are calculated for the SoCAB. These emissions are extrapolated from the SoCAB region to the state of California using population data. Results from this study provide a baseline emission rate that will help future studies determine if HCFC and HFC mitigation strategies are successful.
Burnout in the boiling of water and freon-113 on tubes with annular fins
International Nuclear Information System (INIS)
Rubin, I.R.; Pul'kin, I.N.; Roizen, L.I.
1986-01-01
This paper presents the results of numerical calculations of burnout heat flux associated with the boiling of Freon-113 and water on an annular fin of constant thickness which have been approximated by simple analytical relations. These are used to calculate the critical burnout parameters of tubes with an annular fin assembly. The calculated data may be used for the analysis of tubes with an annular fin assembly over a wide range of variation of the thermophysical properties of the material and geometrical parameters of the fin assembly
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-06-01
;Contents: Preface to Special Issue on Environmental Technologies; Total System for Recycling and Optimal Treatment of Waste Home Electric Appliances; Material Reduction Design Using Computer Aided Engineering; Rewritable Thermal Recording Sheet; Reusable Taping System; Estimating Method for Disassembly of Home Appliances; Thermal Design Technique to Reduce Furnace Running Cost to Half; Study of Air Conditioner Using HFC Refrigerant Blend; High-Efficiency Compact Rotary Compressor Using New Refrigerant HFC 134a for Automotive Air Conditioner; Simulation for Refrigerators Using HFC 134a; Zero-ODP (Ozone Depletion Potential) Rigid Insulation Foams for Refrigerators; Heat Energy of Industrial Waste Combustion Gas Utilization System; Exhaust Gas Denitrification System for Car Road Tunnels and Underground Parking Areas; Apparatus for Regenerating Diesel Particulate Filter Using Microwave; Analysis of Advanced Treatment System of Heavy Metals in Waste Water; Ventilating and Air-Conditioning System for Energy-Saving Houses; Garbage Disposer; and Anti-Microbial Resin and Applications to Products in Harmony with Living Environment.
The effect of diameter on vertical and horizontal flow boiling crisis in a tube cooled by Freon-12
International Nuclear Information System (INIS)
Merilo, M.; Ahmad, S.Y.
1979-03-01
The influence of test section orientation and diameter on flow boiling crisis occurring in tubes has been studied experimentally using Freon-12 as a coolant. At low mass flux the critical heat flux (CHF) was lower in horizontal flow than in vertical. As either the liquid or vapour velocity, or both, were increased the vertical and horizontal CHF results converged. Above a mass flux of 4 Mg.m -2 .s -1 the results were essentially identical. The effect of tube diameter on boiling crisis in general depends crucially on the parameters which are maintained constant when the comparison is made. (author)
The report gives results of an evaluation of the heat transfer performance of pure hydrofluorocarbon (HFC)-236ea for high performance enhanced tubes which had not been previously used in Navy shipboard chillers. Shell-side heat transfer coefficient data are presented for condensa...
Energy Technology Data Exchange (ETDEWEB)
Signe, J.Ch.
1999-04-16
The development of non-azeotrope mixing, as regular refrigerating fluids substitute, calls in question the experience for the design of refrigerating and cooling machinery. Studies to better understand these fluids behaviour are necessary. The aim of this thesis is the knowledge enlargement on the pure fluids and non azeotrope mixing condensation, outside of a tubes stack, and to simulate the heat transfers. The tubes stack is a condenser, type TEMA X often used in refrigerating machinery. The binary mixing HFC 134a-HFC23, allows a large sliding scale. (A.L.B.)
Energy Technology Data Exchange (ETDEWEB)
Torrella, E.; Larumbe, J.A. [Polytechnic University of Valencia, Dep. of Applied Thermodynamics, Camino de Vera 14, E-46022 Valencia (Spain); Cabello, R.; Sanchez, D.; Llopis, R. [Jaume I University, Dep. of Mechanical Engineering and Construction, Campus de Riu Sec s/n, E-12071 Castellon (Spain)
2010-09-15
The European Regulation no 2037/2000 has banned manufacturing HCFC refrigerants from January 1st 2010, although its use is allowed up to 2015 if the fluids come from a recycling process. This situation creates the need for developing new working fluids to replace the HCFC in the refrigeration plants now in operation. Among all the HCFCs the R22 is the most widely used in a wide range of applications, especially in air conditioning. This work presents an on-site experimental study of the R22 replacement by two possible substitutes, the HFC-417A and the HFC-422D, in a water chiller in which the energy performance was evaluated. This chiller is part of the centralized HVAC system of a lecture room building at the Jaume I University of Castellon, Spain. This communication compares and analyses main operation parameters of the chiller when operating with each refrigerant in real conditions. (author)
Gill, Jatinder; Singh, Jagdev
2018-07-01
In this work, an experimental investigation is carried out with R134a and LPG refrigerant mixture for depicting mass flow rate through straight and helical coil adiabatic capillary tubes in a vapor compression refrigeration system. Various experiments were conducted under steady-state conditions, by changing capillary tube length, inner diameter, coil diameter and degree of subcooling. The results showed that mass flow rate through helical coil capillary tube was found lower than straight capillary tube by about 5-16%. Dimensionless correlation and Artificial Neural Network (ANN) models were developed to predict mass flow rate. It was found that dimensionless correlation and ANN model predictions agreed well with experimental results and brought out an absolute fraction of variance of 0.961 and 0.988, root mean square error of 0.489 and 0.275 and mean absolute percentage error of 4.75% and 2.31% respectively. The results suggested that ANN model shows better statistical prediction than dimensionless correlation model.
Gallagher, Glenn; Zhan, Tao; Hsu, Ying-Kuang; Gupta, Pamela; Pederson, James; Croes, Bart; Blake, Donald R; Barletta, Barbara; Meinardi, Simone; Ashford, Paul; Vetter, Arnie; Saba, Sabine; Slim, Rayan; Palandre, Lionel; Clodic, Denis; Mathis, Pamela; Wagner, Mark; Forgie, Julia; Dwyer, Harry; Wolf, Katy
2014-01-21
To provide information for greenhouse gas reduction policies, the California Air Resources Board (CARB) inventories annual emissions of high-global-warming potential (GWP) fluorinated gases, the fastest growing sector of greenhouse gas (GHG) emissions globally. Baseline 2008 F-gas emissions estimates for selected chlorofluorocarbons (CFC-12), hydrochlorofluorocarbons (HCFC-22), and hydrofluorocarbons (HFC-134a) made with an inventory-based methodology were compared to emissions estimates made by ambient-based measurements. Significant discrepancies were found, with the inventory-based emissions methodology resulting in a systematic 42% under-estimation of CFC-12 emissions from older refrigeration equipment and older vehicles, and a systematic 114% overestimation of emissions for HFC-134a, a refrigerant substitute for phased-out CFCs. Initial, inventory-based estimates for all F-gas emissions had assumed that equipment is no longer in service once it reaches its average lifetime of use. Revised emission estimates using improved models for equipment age at end-of-life, inventories, and leak rates specific to California resulted in F-gas emissions estimates in closer agreement to ambient-based measurements. The discrepancies between inventory-based estimates and ambient-based measurements were reduced from -42% to -6% for CFC-12, and from +114% to +9% for HFC-134a.
A binary mixture operated heat pump
International Nuclear Information System (INIS)
Hihara, E.; Saito, T.
1991-01-01
This paper evaluates the performance of possible binary mixtures as working fluids in high- temperature heat pump applications. The binary mixtures, which are potential alternatives of fully halogenated hydrocarbons, include HCFC142b/HCFC22, HFC152a/HCFC22, HFC134a/HCFC22. The performance of the mixtures is estimated by a thermodynamic model and a practical model in which the heat transfer is considered in heat exchangers. One of the advantages of binary mixtures is a higher coefficient of performance, which is caused by the small temperature difference between the heat-sink/-source fluid and the refrigerant. The mixture HCFC142b/HCFC22 is promising from the stand point of thermodynamic performance
Emissions of halocarbons from mobile vehicle air conditioning system in Hong Kong.
Yan, H H; Guo, H; Ou, J M
2014-08-15
During the implementation of Montreal Protocol, emission inventories of halocarbons in different sectors at regional scale are fundamental to the formulation of relevant management strategy and inspection of the implementation efficiency. This study investigated the emission profile of halocarbons used in the mobile vehicle air conditioning system, the leading sector of refrigeration industry in terms of the refrigerant bank, market and emission, in the Hong Kong Special Administrative Region, using a bottom-up approach developed by 2006 IPCC Good Practice Guidance. The results showed that emissions of CFC-12 peaked at 53 tons ODP (Ozone Depletion Potential) in 1992 and then gradually diminished, whereas HFC-134a presented an increasing emission trend since 1990s and the emissions of HFC-134a reached 65,000 tons CO2-equivelant (CO2-eq) by the end of 2011. Uncertainty analysis revealed relatively high levels of uncertainties for special-purpose vehicles and government vehicles. Moreover, greenhouse gas (GHG) abatements under different scenarios indicated that potential emission reduction of HFC-134a ranged from 4.1 to 8.4 × 10(5)tons CO2-eq. The findings in this study advance our knowledge of halocarbon emissions from mobile vehicle air conditioning system in Hong Kong. Copyright © 2014 Elsevier B.V. All rights reserved.
Ambarita, H.; Sihombing, H. V.
2018-03-01
Vapor compression cycle is mainly employed as a refrigeration cycle in the Air-Conditioning (AC) unit. In order to save energy, the Coefficient of Performance (COP) of the need to be improved. One of the potential solutions is to modify the system into multi-stages vapor compression cycle. The suitable intermediate pressure between the high and low pressures is one of the design issues. The present work deals with the investigation of an optimum intermediate pressure of two-stages vapor compression refrigeration cycle. Typical vapor compression cycle that is used in AC unit is taken into consideration. The used refrigerants are R134a. The governing equations have been developed for the systems. An inhouse program has been developed to solve the problem. COP, mass flow rate of the refrigerant and compressor power as a function of intermediate pressure are plotted. It was shown that there exists an optimum intermediate pressure for maximum COP. For refrigerant R134a, the proposed correlations need to be revised.
International Nuclear Information System (INIS)
El-Morsi, Mohamed
2015-01-01
This study presents a comparison of energetic and exergetic performance of a vapour compression refrigeration system using pure HC (hydrocarbon) refrigerants. In this study, three different pure HCs propane (R290), butane (R600) and commercial LPG (liquefied petroleum gas) are used in the theoretical analysis. R134a is also used in the analysis as a reference refrigerant. The evaporator temperature ranges from −30 to 0 °C while the condenser ranges from 30 to 50 °C. MATLAB software is used for solving the thermodynamic equations, while the thermo-physical properties are calculated using REFPROP software. The results show that R600 has the highest COP c and exergetic efficiency, while LPG has the lowest. When compared to R134a, the COP c for R134a is higher than that for LPG by 10%. Also, the exergetic efficiency is higher by 5%. However, LPG has the advantage of being not expensive, available in large amounts and zero ozone depletion potential and low global warming potential. - Highlights: • The results show that R600 has the highest COP c & exergy efficiency, and the lowest irreversibility. • LPG has the lowest COP c & exergy efficiency, and the highest irreversibility. • Compared to R134a, LPG has a lower COP c and exergy efficiency by an average of 10% and 5%, respectively
Leedham Elvidge, Emma; Bönisch, Harald; Brenninkmeijer, Carl A. M.; Engel, Andreas; Fraser, Paul J.; Gallacher, Eileen; Langenfelds, Ray; Mühle, Jens; Oram, David E.; Ray, Eric A.; Ridley, Anna R.; Röckmann, Thomas; Sturges, William T.; Weiss, Ray F.; Laube, Johannes C.
2018-03-01
In a changing climate, potential stratospheric circulation changes require long-term monitoring. Stratospheric trace gas measurements are often used as a proxy for stratospheric circulation changes via the mean age of air values derived from them. In this study, we investigated five potential age of air tracers - the perfluorocarbons CF4, C2F6 and C3F8 and the hydrofluorocarbons CHF3 (HFC-23) and HFC-125 - and compare them to the traditional tracer SF6 and a (relatively) shorter-lived species, HFC-227ea. A detailed uncertainty analysis was performed on mean ages derived from these new tracers to allow us to confidently compare their efficacy as age tracers to the existing tracer, SF6. Our results showed that uncertainties associated with the mean age derived from these new age tracers are similar to those derived from SF6, suggesting that these alternative compounds are suitable in this respect for use as age tracers. Independent verification of the suitability of these age tracers is provided by a comparison between samples analysed at the University of East Anglia and the Scripps Institution of Oceanography. All five tracers give younger mean ages than SF6, a discrepancy that increases with increasing mean age. Our findings qualitatively support recent work that suggests that the stratospheric lifetime of SF6 is significantly less than the previous estimate of 3200 years. The impact of these younger mean ages on three policy-relevant parameters - stratospheric lifetimes, fractional release factors (FRFs) and ozone depletion potentials - is investigated in combination with a recently improved methodology to calculate FRFs. Updates to previous estimations for these parameters are provided.
Effect of orientation on critical heat flux in a 3-rod bundle cooled by Freon-12
International Nuclear Information System (INIS)
Dimmick, G.R.
1979-06-01
Critical heat flux measurements have been made in a segmented 3-rod test section cooled by Freon-12. Three test section orientations were used: vertical, inclined at 11 deg to the vertical, and horizontal. It was found that at flows of less than 2.5 Mg.m -2 .s -1 the transverse gravity force on the inclined and horizontal orientations reduced the magnitude of the critical heat flux and also changed the location of initial dryout when compared to the vertical data. To account for the effect of orientation during correlation of the data, the Reynolds number was modified to include a transverse gravity term. The minimum standard deviation for the data from the three orientations combined was 3.4 percent and less than 3.7 percent for the three orientations separately. (author)
Energy Technology Data Exchange (ETDEWEB)
Sun, K.H.; Jung, H.C. [Kyung Hee University, Seoul (Korea, Republic of); Kim, K.S. [Daebul University (Korea, Republic of)
1997-03-01
The goal of this paper is to measure and compare the performance of solar heat pump for school classroom heating. To accomplish the goal, solar heat pump with aluminum roll bond type evaporator and indoor heat exchanger(condenser) was built and fully instrumented with thermocouples and pressure transducers etc. The test results showed that the COP and capacity of R-134a(CF{sub 3}CH{sub 2}F) were higher than those of R-12(CF{sub 2}Cl{sub 2}). The solar heat pump system for room heating was designed to show the best efficiency that the room temperature make 18{approx}20{sup o} C and 23{approx}25{sup o} C in Seoul during November, December, and January. (author) 12 refs., 4 figs., 2 tabs.
International Nuclear Information System (INIS)
Shayeghi, H.; Hashemi, Y.
2014-01-01
Highlights: • Capability of wind farms is contributed in the problem of hybrid TNEM–RPM. • Inclusion of HFC as a novel and versatile device to implement hybrid TNEM–RPM. • INSGA-II optimization and FDM method is applied to specify the best solution. • Simulation study is conducted on the real power system of Iran. - Abstract: This paper addresses a mathematical model for solving transmission network expansion management (TNEM) associated with reactive power management (RPM) in the presence of double-fed induction generator (DFIG) variable speed wind turbine and hybrid flow controller (HFC). According to this plan, the reactive power capability of DFIG wind turbine is gained and the constraints of deliverable power are derived for each operation point. Strong control capability of the HFC with controlling bus voltage and line power flow offers a great potential for solving many of the problems facing electric utilities. For a precise steady-state analysis of HFC, the injection model is considered which it is an adaptive model in steady-state analysis. The main goals of the proposed management strategy are to minimize investment cost, real power loss cost in transmission lines and voltage deviation and maximize voltage stability index and social benefit at the same time. A three-stage scheme has been developed for solving hybrid TNEM–RPM problem. In the beginning of the plan, it is assumed that all the reactive demands are acquired from local sources and an optimal transmission plan is specified. After transmission lines are constructed, in the second step, reactive power sources will be allocated to weak buses. In order to assess reliability of the system, EENS criterion is used. Due to multi-objective nature of the proposed management method, an improved non-dominated sorting genetic algorithm-II (INSGA-II) style is applied for an optimization procedure. Also, a decision making method based on fuzzy decision making (FDM) is used for finding the best
Dimension reduction for compressible viscous fluids
Czech Academy of Sciences Publication Activity Database
Bella, P.; Feireisl, Eduard; Novotný, A.
2014-01-01
Roč. 134, č. 1 (2014), s. 111-121 ISSN 0167-8019 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible Navier-Stokes system * dimension reduction * thin rod Subject RIV: BA - General Mathematics Impact factor: 1.047, year: 2014 http://link.springer.com/article/10.1007%2Fs10440-014-9872-5
Directory of Open Access Journals (Sweden)
Mishra Shubham
2016-12-01
Full Text Available Performance assessment of ejector-expansion vapor compression refrigeration system with eco-friendly R134a alternative refrigerants (R152a, R1234yf, R600a, R600, R290, R161, R32, and propylene is presented for air-conditioning application. Ejector has been modeled by considering experimental data based correlations of component efficiencies to take care of all irreversibilities. Ejector area ratio has been optimized based on maximum coefficient of performance (COP for typical air-conditioner operating temperatures. Selected refrigerants have been compared based on area ratio, pressure lift ratio, entrainment ratio, COP, COP improvement and volumetric cooling capacity. Effects of normal boiling point and critical point on the performances have been studied as well. Using ejector as an expansion device, maximum improvement in COP is noted in R1234yf (10.1%, which reduces the COP deviation with R134a (4.5% less in basic cycle and 2.5% less in ejector cycle. Hence, R1234yf seems to be best alternative for ejector expansion system due to its mild flammability and comparable volumetric capacity and cooling COP. refrigerant R161 is superior to R134a in terms of both COP and volumetric cooling capacity, although may be restricted for low capacity application due to its flammability.
Mishra, Shubham; Sarkar, Jahar
2016-12-01
Performance assessment of ejector-expansion vapor compression refrigeration system with eco-friendly R134a alternative refrigerants (R152a, R1234yf, R600a, R600, R290, R161, R32, and propylene) is presented for air-conditioning application. Ejector has been modeled by considering experimental data based correlations of component efficiencies to take care of all irreversibilities. Ejector area ratio has been optimized based on maximum coefficient of performance (COP) for typical air-conditioner operating temperatures. Selected refrigerants have been compared based on area ratio, pressure lift ratio, entrainment ratio, COP, COP improvement and volumetric cooling capacity. Effects of normal boiling point and critical point on the performances have been studied as well. Using ejector as an expansion device, maximum improvement in COP is noted in R1234yf (10.1%), which reduces the COP deviation with R134a (4.5% less in basic cycle and 2.5% less in ejector cycle). Hence, R1234yf seems to be best alternative for ejector expansion system due to its mild flammability and comparable volumetric capacity and cooling COP. refrigerant R161 is superior to R134a in terms of both COP and volumetric cooling capacity, although may be restricted for low capacity application due to its flammability.
Arnold, Tim; Manning, Alistair J.; Li, Shanlan; Kim, Jooil; Park, Sunyoung; Fraser, Paul J.; Mitrevski, Blagoj; Steele, L. Paul; Krummel, Paul B.; Mühle, Jens; Weiss, Ray F.
2016-04-01
The fluorinated species carbon tetrafluoride (CF4; PFC-14), nitrogen trifluoride (NF3) and trifluoromethane (CHF3; HFC-23) are potent greenhouse gases with 100-year global warming potentials of 6,630, 16,100 and 12,400, respectively. Unlike the majority of CFC-replacement compounds that are emitted from fugitive and mobile emission sources, these gases are largely emitted from large single point sources - semiconductor manufacturing facilities (all three), aluminium smelting plants (CF4) and chlorodifluoromethane factories (HFC-23). In this work we show the potential for atmospheric measurements to understand regional sources of these gases and to highlight emission 'hotspots'. We target our analysis on measurements from two Advanced Global Atmospheric Gases Experiment (AGAGE) long term monitoring sites that are particularly sensitive to regional emissions of these gases: Gosan on Jeju Island in the Republic of Korea and Cape Grim on Tasmania in Australia. These sites measure CF4, NF3 and HFC-23 alongside a suite of greenhouse and stratospheric ozone depleting gases every two hours using automated in situ gas-chromatography mass-spectrometry instrumentation. We couple each measurement to an analysis of air history using the regional atmospheric transport model NAME (Numerical Atmospheric dispersion Modelling Environment) driven by 3D meteorology from the Met Office's Unified Model, and use a Bayesian inverse method (InTEM - Inversion Technique for Emission Modelling) to calculate yearly emission changes over a decade (2005-2015) at high spatial resolution. At present these gases make a small contribution to global radiative forcing, however, given that their impact could rise significantly and that point sources of such gases can be mitigated, atmospheric monitoring could be an important tool for aiding emissions reduction policy.
2010-07-01
... does not recycle, any single, specific automotive refrigerant other than CFC-12 or HFC-134a, including... or equivalent new product specifications before reuse in a mobile air-conditioning system.” The... capable of ensuring removal of refrigerant from the system being serviced by reducing the system pressure...
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-01-01
HFC-23 is produced as a by-product during HCFC-22 manufacturing (produced at by-production rate of about 2%, whereas the reaction control has limitation in reducing the production). This is one of the substances subjected to the greenhouse effect gas reduction in the climate change framework treaty. This paper describes the achievements in 1998 on developing the HFC-23 destruction technology. High-temperature pyrolysis decomposes the substance into HF and CO2, which are given absorption treatment by water and alkali to make them harmless, and are recovered finally as calcium fluoride. An equipment having the treatment capability of 195 kg/h was constructed. Design was made on a facility capable of treating fluorine containing waste water at 3 t/h at maximum. Utilities consumed in a factory (industrial water, acids for neutralization, and alkali) are used effectively to identify the effect of reducing the treatment cost. Discussions were given from the safety aspect on facilities to prevent leakage of fluorine containing waste water being a harmful substance. Fabrication was executed on a full-size treatment testing equipment that can utilize the utilities in the factory effectively, and trial equipment operation was performed to arrange the system prepared toward the future tests and researches. (NEDO)
Investigation of R-134a as a modeling fluid for supercritical water
International Nuclear Information System (INIS)
Jouvin, J.C.; Pioro, I.
2014-01-01
The objective of this paper is to investigate the feasibility of using Refrigerant-134a (R-134a) as a potential modeling fluid by comparing the thermophysical properties with those of water. Operating conditions of SuperCritical Water-cooled Reactors (SCWRs) are scaled into those of R-134a, in order to provide proper SCWR-equivalent conditions. The thermophysical properties for R-134a are obtained from NIST REFPROP software. The results indicate that the thermophysical properties of R-134a undergo significant changes within the critical and pseudocritical regions similar to that of supercritical water. An investigation into the pseudocritical region of R-134a was also conducted. (author)
The R-134a energy efficiency problem
International Nuclear Information System (INIS)
Behrens, N.; Dekleva, T.W.; Hartley, J.G.; Murphy, F.T.; Powell, R.L.
1990-01-01
This paper examines the controversy over the relative energy efficiencies of R-134a and R-12, from a theoretical thermodynamic perspective. In this regard, the authors have used an in-house process flowsheeting program which allows to simulate the complete thermodynamic cycle, and investigate the effects of superheat and subcooling. Special attention is given to the suitable basis for comparing the energy efficiencies of different refrigerants calculated from thermodynamic data. Modelling experiments demonstrate the relative extent to which R-12 and R-134a respond differently to superheat and subcooling. With appropriate superheat and subcooling taken into consideration, such as applied in standard practice in the home appliance industry, R-134a can provide COP values essentially equivalent to that of R-12
Energy Technology Data Exchange (ETDEWEB)
Kenny, Kevin [Sprint, Reston, VA (United States); Bradley, Dwayne [Burns & McDonnell, Kansas City, MO (United States)
2015-09-01
Sprint is one of the telecommunications industry leaders in the deployment of hydrogen fuel cell (HFC) systems to provide backup power for their mission critical wireless network facilities. With several hundred fuel cells commissioned in California, states in the gulf coast region, and along the upper eastern seaboard. A strong incentive for advancing the integration of fuel cells into the Sprint network came through the award of a Department of Energy (DOE) grant focused on Market Transformation activities for project (EE0000486). This grant was funded by the 2009 American Recovery and Reinvestment Act (ARRA). The funding provided by DOE ($7.295M) was allocated to support the installation of 260 new HFC systems, equipped with an on-site refillable Medium Pressure Hydrogen Storage Solution (MPHSS), as well as for the conversion of 21 low pressure hydrogen systems to the MPHSS, in hopes of reducing barriers to market acceptance.
International Nuclear Information System (INIS)
Tanimoto, K.; Ishii, M.
1998-01-01
Transient characteristics of two-phase natural circulation within a Freon-113 loop with a large condenser have been examined mainly focused on the flashing phenomenon. General behavior was described and parametric studies were performed. The items observed were the period and duration of flashing, peak flow rate, amount of flow carryover per flashing, lowest-peak liquid level within the condenser, and the peak void distribution in the riser section. The parameters considered were the heater power input, valve friction at the heater inlet (simulating the loopwise friction), condenser cooling, degree of subcooling at the heater inlet, and the heat loss to the surroundings. As a whole, the heater power input, valve friction, and the rate of condenser cooling played important roles in flashing while the other effects being marginal. In general, the flow appeared to be more unstable with the larger condensing surface which causes the condensation-induced flashing. (orig.)
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Settlement. 134.25 Section 134.25 Foreign... Considering Applications § 134.25 Settlement. The applicant and the Department of State may agree on a proposed settlement of the award before final action on the application, either in connection with a...
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Investigation. 13.4 Section 13.4 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.4 Investigation. (a) If an Investigating Official concludes that a subpoena pursuant to the Authority conferred by...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.213 Section 134.213... OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.213 Discovery. (a) Motion. A party may obtain discovery only upon motion, and for good cause shown. (b) Forms. The forms of discovery...
Fujita, Megumi; Himi, Satoshi; Iwata, Motokazu
2010-03-01
SX-3228, 6-benzyl-3-(5-methoxy-1,3,4-oxadiazol-2-yl)-5,6,7,8-tetrahydro-1,6-naphthyridin-2(1H)-one, is a newly-synthesized benzodiazepine receptor agonist intended to be developed as a tablet preparation. This compound, however, becomes chemically unstable due to decreased crystallinity when it undergoes mechanical treatments such as grinding and compression. A wet-granule tableting method, where wet granules are compressed before being dried, was therefore investigated as it has the advantage of producing tablets of sufficient hardness at quite low compression pressures. The results of the stability testing showed that the drug substance was chemically considerably more stable in wet-granule compression tablets compared to conventional tablets. Furthermore, the drug substance was found to be relatively chemically stable in wet-granule compression tablets even when high compression pressure was used and the effect of this pressure was small. After investigating the reason for this excellent stability, it became evident that near-isotropic pressure was exerted on the crystals of the drug substance because almost all the empty spaces in the tablets were occupied with water during the wet-granule compression process. Decreases in crystallinity of the drug substance were thus small, making the drug substance chemically stable in the wet-granule compression tablets. We believe that this novel approach could be useful for many other compounds that are destabilized by mechanical treatments.
AN EXPERIMENTAL STUDY ON A VAPOR COMPRESSION REFRIGERATION CYCLE BY ADDING INTERNAL HEAT EXCHANGER
Directory of Open Access Journals (Sweden)
Muhammad Asmail Eleiwi
2013-05-01
Full Text Available Thispaper presents practical study to improve the indication COP of a vaporcompression refrigeration cycle in instrumented automobile air conditioner bydesigning internal heat exchanger and installing it in the vapor compressionrefrigeration cycle. Two cases of vapor compression refrigeration cycle were takenin this paper: the first case is thatthe vapor compression refrigeration cycle without internal heat exchanger andin the second case the vapor compressionrefrigeration cycle with heat exchanger ; in these two cases, the temperatureat each point of a vapor compressionrefrigeration cycle, the low and the high pressure ,the indoor temperature andthe outdoor temperature were measured at each time at compressor speed 1450 rpmand 2900 rpm for each blower speed 1, blower speed 2 and blower speed 3.Therefrigerant fluid was used in the vapor compression refrigeration cycle withoutIHE and with IHE is R134a..
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.217 Settlement. At any... have settled the case, and may file with such motion a copy of the settlement agreement. If the Judge...
Abundance and sources of atmospheric halocarbons in the Eastern Mediterranean
Schoenenberger, Fabian; Henne, Stephan; Hill, Matthias; Vollmer, Martin K.; Kouvarakis, Giorgos; Mihalopoulos, Nikolaos; O'Doherty, Simon; Maione, Michela; Emmenegger, Lukas; Peter, Thomas; Reimann, Stefan
2018-03-01
A wide range of anthropogenic halocarbons is released to the atmosphere, contributing to stratospheric ozone depletion and global warming. Using measurements of atmospheric abundances for the estimation of halocarbon emissions on the global and regional scale has become an important top-down tool for emission validation in the recent past, but many populated and developing areas of the world are only poorly covered by the existing atmospheric halocarbon measurement network. Here we present 6 months of continuous halocarbon observations from Finokalia on the island of Crete in the Eastern Mediterranean. The gases measured are the hydrofluorocarbons (HFCs), HFC-134a (CH2FCF3), HFC-125 (CHF2CF3), HFC-152a (CH3CHF2) and HFC-143a (CH3CF3) and the hydrochlorofluorocarbons (HCFCs), HCFC-22 (CHClF2) and HCFC-142b (CH3CClF2). The Eastern Mediterranean is home to 250 million inhabitants, consisting of a number of developed and developing countries, for which different emission regulations exist under the Kyoto and Montreal protocols. Regional emissions of halocarbons were estimated with Lagrangian atmospheric transport simulations and a Bayesian inverse modeling system, using measurements at Finokalia in conjunction with those from Advanced Global Atmospheric Gases Experiment (AGAGE) sites at Mace Head (Ireland), Jungfraujoch (Switzerland) and Monte Cimone (Italy). Measured peak mole fractions at Finokalia showed generally smaller amplitudes for HFCs than at the European AGAGE sites except for periodic peaks of HFC-152a, indicating strong upwind sources. Higher peak mole fractions were observed for HCFCs, suggesting continued emissions from nearby developing regions such as Egypt and the Middle East. For 2013, the Eastern Mediterranean inverse emission estimates for the four analyzed HFCs and the two HCFCs were 13.9 (11.3-19.3) and 9.5 (6.8-15.1) Tg CO2eq yr-1, respectively. These emissions contributed 16.8 % (13.6-23.3 %) and 53.2 % (38.1-84.2 %) to the total inversion
Directory of Open Access Journals (Sweden)
Balev Dessislav Kostadinov
2017-03-01
Full Text Available Ground spices are a source of hazards for dry-fermented meat products. Since dry-cured sausages are not subjected to heat treatment, there is a high risk of microbial cross-contamination and physical impurities. The aim of this study was to determine effects of the replacement of 3 g/kg of ground black pepper (Piper nigrum L., and cumin (Cuminum cyminum with their aliquots of new freon extracts, and compare them with the effect of 0.2 g/kg antioxidant addition (taxifolin extract from Siberian larch (Larix sibirica Ledeb, rosemary (Rosmarinus officinalis L. extract, and butylated hydroxytoluene on sensory properties, color stability, proximate composition, free amino nitrogen and pH of Bulgarian-type dry-cured „Sudjuk“ sausages. The replacement of natural ground spices with aliquots of their extracts improved sensory properties and stabilized the color characteristics of the final product during 30 days of storage at 0–4°C. The addition of 0.2 g/kg rosemary extract was as effective as the addition of freon extracts on the overall assessment to the 14th day of the experiment. It was determined that the addition of antioxidants or spice extracts had no significant effect on proximate composition, pH, and free amino nitrogen accumulation of the “Sudjuk”. The addition of 0.2 g/kg, taxifolin or rosemary extracts and butylated hydroxytoluene was not so efficient in improving the sensory properties and color stabilization in comparison to the new freon spice extracts. The examined spice extracts can be successfully used to improve the quality of “Sudjuk” sausages.
Czech Academy of Sciences Publication Activity Database
Penel, P.; Straškraba, Ivan
2010-01-01
Roč. 134, č. 3 (2010), s. 278-294 ISSN 0007-4497 R&D Projects: GA ČR GA201/08/0012 Institutional research plan: CEZ:AV0Z10190503 Keywords : compressible fluid * Navier-Stokes equations * asymptotic behavior Subject RIV: BA - General Mathematics Impact factor: 0.722, year: 2010 http://www.sciencedirect.com/science/article/pii/S0007449709000153
International Nuclear Information System (INIS)
Stevens, G.F.; Wood, R.W.; Pryzbylski, J.
1968-09-01
Burnout results are given for an annular test section 12ft long and having an inner heated rod 0.625 in diameter, and an outer unheated tube of 0.825in bore. In one case the rod was uniformly heated and in the other case the rod was given a symmetrical chopped cosine heat flux profile. The Freon data is shown to compare well with equivalent water data using an established scaling technique; this applied both to burnout power and to burnout position. The comparison is made at pressures of 1000 psia and 750 psia water equivalent and the same scaling factors are shown to work at both pressures. (author)
13 CFR 134.402 - Appeal petition.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Appeal petition. 134.402 Section 134.402 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.402 Appeal petition. In addition to the requirements of § 134.203, an appeal petition must state...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.310 Section 134.310 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE... Designations § 134.310 Discovery. Discovery will not be permitted in appeals from size determinations or NAICS...
19 CFR 134.34 - Certain repacked articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain repacked articles. 134.34 Section 134.34... TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.34 Certain repacked articles. (a) Exception for repacked articles. An exception under § 134.32(d) may be authorized in the...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reports. 13.4 Section 13.4 Housing... PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 13.4 Reports. HUD shall compile and submit... report on its experience in implementing S. 1195 Official Mail Use in the Location and Recovery of...
13 CFR 134.203 - The petition.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false The petition. 134.203 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.203 The petition. (a) A petition must contain the following: (1) The basis of OHA's jurisdiction; (2) A copy of the SBA...
19 CFR 134.53 - Examination packages.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 134.53 Section 134.53... TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.53 Examination packages. (a) Site of marking—(1) Customs custody. Articles (or containers) in examination packages may be marked by...
Hydrochlorofluorocarbon and hydrofluorocarbon emissions in East Asia determined by inverse modeling
Directory of Open Access Journals (Sweden)
A. Stohl
2010-04-01
Full Text Available The emissions of three hydrochlorofluorocarbons, HCFC-22 (CHClF2, HCFC-141b (CH3CCl2F and HCFC-142b (CH3CClF2 and three hydrofluorocarbons, HFC-23 (CHF3, HFC-134a (CH2FCF3 and HFC-152a (CH3CHF2 from four East Asian countries and the Taiwan region for the year 2008 are determined by inverse modeling. The inverse modeling is based on in-situ measurements of these halocarbons at the Japanese stations Cape Ochi-ishi and Hateruma, the Chinese station Shangdianzi and the South Korean station Gosan. For every station and every 3 h, 20-day backward calculations were made with the Lagrangian particle dispersion model FLEXPART. The model output, the measurement data, bottom-up emission information and corresponding uncertainties were fed into an inversion algorithm to determine the regional emission fluxes. The model captures the observed variation of halocarbon mixing ratios very well for the two Japanese stations but has difficulties explaining the large observed variability at Shangdianzi, which is partly caused by small-scale transport from Beijing that is not adequately captured by the model. Based on HFC-23 measurements, the inversion algorithm could successfully identify the locations of factories known to produce HCFC-22 and emit HFC-23 as an unintentional byproduct. This lends substantial credibility to the inversion method. We report national emissions for China, North Korea, South Korea and Japan, as well as emissions for the Taiwan region. Halocarbon emissions in China are much larger than the emissions in the other countries together and contribute a substantial fraction to the global emissions. Our estimates of Chinese emissions for the year 2008 are 65.3±6.6 kt/yr for HCFC-22 (17% of global emissions extrapolated from Montzka et al., 2009, 12.1±1.6 kt/yr for HCFC-141b (22%, 7.3±0.7 kt/yr for HCFC-142b (17%, 6.2±0.7 kt/yr for HFC
Davis, Ryan; Bienvenue, David; Swierczek, Sabina I; Gilner, Danuta M; Rajagopal, Lakshman; Bennett, Brian; Holz, Richard C
2006-03-01
Glutamate-134 (E134) is proposed to act as the general acid/base during the hydrolysis reaction catalyzed by the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase (DapE) from Haemophilus influenzae. To date, no direct evidence has been reported for the role of E134 during catalytic turnover by DapE. In order to elucidate the catalytic role of E134, altered DapE enzymes were prepared in which E134 was substituted with an alanine and an aspartate residue. The Michaelis constant (K (m)) does not change upon substitution with aspartate but the rate of the reaction changes drastically in the following order: glutamate (100% activity), aspartate (0.09%), and alanine (0%). Examination of the pH dependence of the kinetic constants k (cat) and K (m) for E134D-DapE revealed ionizations at pH 6.4, 7.4, and approximately 9.7. Isothermal titration calorimetry experiments revealed a significant weakening in metal K (d) values of E134D-DapE. D134 and A134 perturb the second divalent metal binding site significantly more than the first, but both altered enzymes can still bind two divalent metal ions. Structural perturbations of the dinuclear active site of DapE were also examined for two E134-substituted forms, namely E134D-DapE and E134A-DapE, by UV-vis and electron paramagnetic resonance (EPR) spectroscopy. UV-vis spectroscopy of Co(II)-substituted E134D-DapE and E134A-DapE did not reveal any significant changes in the electronic absorption spectra, suggesting that both Co(II) ions in E134D-DapE and E134A-DapE reside in distorted trigonal bipyramidal coordination geometries. EPR spectra of [Co_(E134D-DapE)] and [Co_(E1341A-DapE] are similar to those observed for [CoCo(DapE)] and somewhat similar to the spectrum of [Co(H(2)O)(6)](2+) which typically exhibit E/D values of approximately 0.1. Computer simulation returned an axial g-tensor with g ((x,y))=2.24 and E/D=0.07; g ( z ) was only poorly determined, but was estimated as 2.5-2.6. Upon the addition of a second Co
Abundance and sources of atmospheric halocarbons in the Eastern Mediterranean
Directory of Open Access Journals (Sweden)
F. Schoenenberger
2018-03-01
Full Text Available A wide range of anthropogenic halocarbons is released to the atmosphere, contributing to stratospheric ozone depletion and global warming. Using measurements of atmospheric abundances for the estimation of halocarbon emissions on the global and regional scale has become an important top-down tool for emission validation in the recent past, but many populated and developing areas of the world are only poorly covered by the existing atmospheric halocarbon measurement network. Here we present 6 months of continuous halocarbon observations from Finokalia on the island of Crete in the Eastern Mediterranean. The gases measured are the hydrofluorocarbons (HFCs, HFC-134a (CH2FCF3, HFC-125 (CHF2CF3, HFC-152a (CH3CHF2 and HFC-143a (CH3CF3 and the hydrochlorofluorocarbons (HCFCs, HCFC-22 (CHClF2 and HCFC-142b (CH3CClF2. The Eastern Mediterranean is home to 250 million inhabitants, consisting of a number of developed and developing countries, for which different emission regulations exist under the Kyoto and Montreal protocols. Regional emissions of halocarbons were estimated with Lagrangian atmospheric transport simulations and a Bayesian inverse modeling system, using measurements at Finokalia in conjunction with those from Advanced Global Atmospheric Gases Experiment (AGAGE sites at Mace Head (Ireland, Jungfraujoch (Switzerland and Monte Cimone (Italy. Measured peak mole fractions at Finokalia showed generally smaller amplitudes for HFCs than at the European AGAGE sites except for periodic peaks of HFC-152a, indicating strong upwind sources. Higher peak mole fractions were observed for HCFCs, suggesting continued emissions from nearby developing regions such as Egypt and the Middle East. For 2013, the Eastern Mediterranean inverse emission estimates for the four analyzed HFCs and the two HCFCs were 13.9 (11.3–19.3 and 9.5 (6.8–15.1 Tg CO2eq yr−1, respectively. These emissions contributed 16.8 % (13.6–23.3 % and 53.2 % (38.1–84.2
miR-134: A Human Cancer Suppressor?
Directory of Open Access Journals (Sweden)
Jing-Yu Pan
2017-03-01
Full Text Available MicroRNAs (miRNAs are small noncoding RNAs approximately 20–25 nt in length, which play crucial roles through directly binding to corresponding 3′ UTR of targeted mRNAs. It has been reported that miRNAs are involved in numerous of diseases, including cancers. Recently, miR-134 has been identified to dysregulate in handles of human cancers, such as lung cancer, glioma, breast cancer, colorectal cancer, and so on. Increasing evidence indicates that miR-134 is essential for human carcinoma and participates in tumor cell proliferation, apoptosis, invasion and metastasis, drug resistance, as well as cancer diagnosis, treatment, and prognosis. Nevertheless, its roles in human cancer are still ambiguous, and its mechanisms are sophisticated as well, referring to a variety of targets and signal pathways, such as STAT5B, KRAS, MAPK/ERK signal pathway, Notch pathway, etc. Herein, we review the crucial roles of miR-134 in scores of human cancers via analyzing latest investigations, which might provide evidence for cancer diagnose, treatment, prognosis, or further investigations.
Nicolette-Baker, Alexis; Garr, Elizabeth; Sathe, Abhijit; O'Shaughnessey, Steve
2014-01-01
With growing global warning concerns on the current breed of HFC refrigerants, a search for more environmentally-friendly fluids has already begun. Potential alternatives to replace R134a should have significantly lower global warming potential (GWP), operate at similar system pressures, and maintain all other advantages of R134a (non-flammability, dielectric properties, etc.). This study investigates four possible alternatives that have been identified by AHRI in its Low-GWP Alternative Refr...
Emissions of halocarbons from mobile vehicle air conditioning system in Hong Kong
Energy Technology Data Exchange (ETDEWEB)
Yan, H.H.; Guo, H., E-mail: ceguohai@polyu.edu.hk; Ou, J.M.
2014-08-15
Highlights: • Halocarbon emissions from MVACS were characterized using bottom up approach. • Quantification of emission inventory was revealed using AUV Tools. • Potential emission reduction was estimated under 3 possible mitigation scenarios. • The results are useful for the policy makers to formulate and implement future phase-out schedule. - Abstract: During the implementation of Montreal Protocol, emission inventories of halocarbons in different sectors at regional scale are fundamental to the formulation of relevant management strategy and inspection of the implementation efficiency. This study investigated the emission profile of halocarbons used in the mobile vehicle air conditioning system, the leading sector of refrigeration industry in terms of the refrigerant bank, market and emission, in the Hong Kong Special Administrative Region, using a bottom-up approach developed by 2006 IPCC Good Practice Guidance. The results showed that emissions of CFC-12 peaked at 53 tons ODP (Ozone Depletion Potential) in 1992 and then gradually diminished, whereas HFC-134a presented an increasing emission trend since 1990s and the emissions of HFC-134a reached 65,000 tons CO{sub 2}-equivelant (CO{sub 2}-eq) by the end of 2011. Uncertainty analysis revealed relatively high levels of uncertainties for special-purpose vehicles and government vehicles. Moreover, greenhouse gas (GHG) abatements under different scenarios indicated that potential emission reduction of HFC-134a ranged from 4.1 to 8.4 × 10{sup 5} tons CO{sub 2}-eq. The findings in this study advance our knowledge of halocarbon emissions from mobile vehicle air conditioning system in Hong Kong.
Emissions of halocarbons from mobile vehicle air conditioning system in Hong Kong
International Nuclear Information System (INIS)
Yan, H.H.; Guo, H.; Ou, J.M.
2014-01-01
Highlights: • Halocarbon emissions from MVACS were characterized using bottom up approach. • Quantification of emission inventory was revealed using AUV Tools. • Potential emission reduction was estimated under 3 possible mitigation scenarios. • The results are useful for the policy makers to formulate and implement future phase-out schedule. - Abstract: During the implementation of Montreal Protocol, emission inventories of halocarbons in different sectors at regional scale are fundamental to the formulation of relevant management strategy and inspection of the implementation efficiency. This study investigated the emission profile of halocarbons used in the mobile vehicle air conditioning system, the leading sector of refrigeration industry in terms of the refrigerant bank, market and emission, in the Hong Kong Special Administrative Region, using a bottom-up approach developed by 2006 IPCC Good Practice Guidance. The results showed that emissions of CFC-12 peaked at 53 tons ODP (Ozone Depletion Potential) in 1992 and then gradually diminished, whereas HFC-134a presented an increasing emission trend since 1990s and the emissions of HFC-134a reached 65,000 tons CO 2 -equivelant (CO 2 -eq) by the end of 2011. Uncertainty analysis revealed relatively high levels of uncertainties for special-purpose vehicles and government vehicles. Moreover, greenhouse gas (GHG) abatements under different scenarios indicated that potential emission reduction of HFC-134a ranged from 4.1 to 8.4 × 10 5 tons CO 2 -eq. The findings in this study advance our knowledge of halocarbon emissions from mobile vehicle air conditioning system in Hong Kong
Behaviour of 134Cs in the aquatic ecosystems
International Nuclear Information System (INIS)
Xu Yinliang; Chen Chuanqun
1992-07-01
The diminution of 134 Cs in the aquatic phases and the absorption of 134 Cs by aquatic lives observe the exponential expression. i.e. Y Ae be . The relationships between the enrichment factor of 134 Cs(K) and the time(t) in the aquatic lives can be represented by a linear equation, K A + Bt. The value of K in the Alternanthera philoxeroides was about 560. That can be used for monitoring and purifying the water phase contaminated by 134 Cs. Fish can absorb 134 Cs from water phase and store it in liver and kidney. The specific activity of 134 Cs in fish flesh was low but the percentage of radioactivity was high that was about 30% of total radioactivity in the fish. River mud can strongly absorb 134 Cs and reduce the absorption by aquatic lives. It is a good adsorbent and purifying agent with low cost for treatment of 134 Cs. The K + can prevent aquatic lives from absorbing Cs + because of antagonistic function
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT
Behavior of cesium-134 in the tea tree
International Nuclear Information System (INIS)
Xu Yinliang; Chen Kaixuan; Chen Chuangqun
1996-01-01
The radioactivity changes of 134 Cs in the aged and the young leaves followed an exponential regression function after spraying 134 Cs in the tea trees. Contamination by spraying 134 Cs greatly harmed tea tree and by irrigating or mixing 134 Cs with soil resulted in a potential endangerment. The concentrating ability of tea leaves for 134 CS was very low and K value was 0.02. After the fresh tea leaves were processed to dry tea, the content of 134 Cs decreased by about 13.3%. When the tea leaves were soaked in hot water, the extraction ratio was around 83.6%
13 CFR 134.409 - Decision on appeal.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision on appeal. 134.409 Section 134.409 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.409 Decision on appeal. (a) A decision of the Administrative Law Judge under this subpart is the...
International Nuclear Information System (INIS)
Zheng Danxing; Meng Xuelin
2012-01-01
Highlights: ► Two novel fundamental concepts of the absorption refrigeration cycle were proposed. ► The interaction mechanism of compressor pressure increasing with other key-parameters was investigated. ► A set of optimal operating condition of hybrid refrigeration cycle was found. ► A simulation and investigation for R134a-DMF hybrid refrigeration cycle was performed. - Abstract: The absorption–compression hybrid refrigeration cycle has been considered as an effective approach to reduce the mechanical work consumption by using low-grade heat, such as solar energy. This work aims at studying the thermodynamic mechanism of the hybrid refrigeration cycle. Two fundamental concepts have been proposed, which are the ultimate refrigerating temperature (or the ultimate temperature lift) and the behavior turning. On the basis of that, the interaction mechanism of compressor pressure increasing with other key-parameters and the impact of compressor pressure increasing on the cycle performance have been investigated. The key-parameters include the concentration difference, the circulation ratio of working fluid, etc. The work points out that the hybrid refrigeration cycle performance varies with the change of compressor outlet pressure and depends on which one achieves dominance in the hybrid refrigeration cycle, the absorption sub-system or the compression sub-system. The behavior turning point during parameters changing corresponds to a maximum value of the heat powered coefficient of performance. In this case, the hybrid refrigeration cycle performance is optimal because the low-grade heat utilization is the most effective. In addition, to validate the theoretical analysis, a solar hybrid refrigeration cycle with R134a–DMF as working pair was simulated. The Peng–Robinson equation of state was adopted to calculate thermophysical properties when the reliability assessment of the prediction models on the available literature data of R134a–DMF system had been
Energy Technology Data Exchange (ETDEWEB)
Giuliani, G.; Marchesi Donati, F.; Polonara, F. [Ancona Univ. (Italy). Dip. di Energetica; Hewitt, N.J. [University of Ulster at Coleraine, Northern Ireland (United Kingdom). NICERT
1999-09-01
The ability of zeotropic mixtures with a remarkable temperature glide to operate in liquid-recirculation systems is investigated and the results of an experimental comparison between the performances of the pure fluid R134a and the zeotropic mixture R32/134a (25/75% by mass) are presented. R134a performs slightly better in the liquid-recirculation mode than in the traditional dry-expansion mode; on the other hand, liquid-recirculation configuration has a detrimental effect on the zeotropic mixture's performance. The reason for this detrimental effect is the mixture component separation which occurs at the liquid/vapor separator. The effect of this separation is investigated using gas chromatograph analysis.
19 CFR 134.14 - Articles usually combined.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles usually combined. 134.14 Section 134.14... TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.14 Articles usually combined. (a) Articles combined before delivery to purchaser. When an imported article is of a kind which is usually...
Monta, William J.
1992-01-01
A pitot-rake survey of the simulated exhaust of a half-span scramjet nozzle model was conducted in the Langley 20-Inch Mach 6 Tunnel to provide an additional data set for computational fluid dynamics (CFD) code comparisons. A wind-tunnel model was tested with a 26-tube pitot rake that could be manually positioned along the mid-semispan plane of the model. The model configuration had an external expansion surface of 20 degrees and an internal cowl expansion of 12 degrees; tests were also performed with a flow fence. Tests were conducted at a free-stream Reynolds number of approximately 6.5 x 10(exp 6) per foot and a model angle of attack of -0.75 degrees. The two exhaust gas mediums that were tested were air and a Freon 12-argon mixture. Each medium was tested at two jet total pressures at approximately 28 and 14 psia. This document presents the flow-field survey results in graphical as well as tabular form, and several observations concerning the results are discussed. The surveys reveal the major expected flow-field characteristics for each test configuration. For a 50-percent freon 12 and 50-percent argon mixture by volume (Fr-Ar), the exhaust jet pressures were slightly higher than those for air. The addition of a flow fence slightly raised the pitot pressure for the Fr-Ar mixture, but it produced little change for air. For the Fr-Ar exhaust, the plume was larger and the region between the shock wave and plume was smaller.
13 CFR 134.715 - Can a Judge reconsider his decision?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can a Judge reconsider his decision? 134.715 Section 134.715 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF....715 Can a Judge reconsider his decision? (a) The Judge may reconsider an appeal decision within 20...
12 CFR 13.4 - Recommendations to customers.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Recommendations to customers. 13.4 Section 13.4... PRACTICES § 13.4 Recommendations to customers. In recommending to a customer the purchase, sale or exchange... reasonable grounds for believing that the recommendation is suitable for the customer upon the basis of the...
Simmonds, P. G.; O'Doherty, S.; Huang, J.; Prinn, R.; Derwent, R. G.; Ryall, D.; Nickless, G.; Cunnold, D.
1998-01-01
The first in-situ measurements by automated gas chromatograph-mass spectrometer are reported for 1,1,1,2-tetrafluoroethane (HFC-134a), 1,1-dichloro-1-fluoroethane, (HCFC-141b), and 1-chloro-1,1-difluoroethane, (HCFC-142b). These compounds are steadily replacing the chlorofluorocarbons (CFCs) as refrigerants, foam-blowing agents, and solvents. The concentrations of all three compounds are shown to be rapidly increasing in the atmosphere, with 134a increasing at a rate of 2.05±0.02 ppt yr-1 over the 30 months of observations. Similarly, 141b and 142b increased at rates of 2.49±0.03 and 1.24±0.02 ppt yr-1, respectively, over the same period. The concentrations recorded at the atmospheric research station at Mace Head, Ireland, on January 1, 1996, the midpoint of the time series, were 3.67 ppt (134a), 7.38 ppt (141b), and 8.78 ppt (142b). From these observations we optimally estimate the HCFC and HFC emissions using a 12-box global model and OH concentrations derived from global 1,1,1-trichloroethane (CCl3CH3) measurements. Comparing two methods of estimating emissions with independent industry estimates shows satisfactory agreement for 134a and 141b, while for 142b, industry estimates are less than half those required to explain our observations.
The NCSU [North Carolina State Univ.] freon PWR [pressurized water reactor] loop
International Nuclear Information System (INIS)
Caves, J.R.; Doster, J.M.; Miller, G.D.; Wehring, B.W.; Turinsky, P.J.
1989-01-01
The nuclear engineering department at North Carolina State University has designed and constructed an operating scale model of a pressurized water reactor (PWR) nuclear steam supply system (NSSS). This facility will be used for education, training, and research. The loop uses electric heaters to simulate the reactor core and Freon as the primary and secondary coolant. Viewing ports at various locations in the loop allow the students to visualize flow regimes in normal and off-normal operating conditions. The objective of the design effort was to scale the thermal-hydraulic characteristics of a two-loop Westinghouse NSSS. Provisions have been made for the simulation of various abnormal occurrences. The model is instrumented in much the same manner as the actual NSSS. Current research projects using the loop include the development of adaptive expert systems to monitor the performance of the facility, diagnose mechanical faults, and to make recommendations to operators for mitigation of accidents. This involves having thermal-hydraulics and core-physics simulators running faster than real time on a mini-supercomputer, with operating parameters updated by communication with the data acquisition and control computer. Further opportunities for research will be investigated as they arise
Energy Technology Data Exchange (ETDEWEB)
Lottin, O.; Guillemet, P. [Ecole Polytechnique de l' Universite de Nantes (France). Laboratoire de Thermocinetique; Lebreton, J-M. [Electricite de France, Moret sur Loing (France)
2003-11-01
The consequences of the oil rejected by the compressor of a vapour-compression refrigeration system on the operation of the evaporator and condenser are analysed. The modelled prototype uses the mixture of HFC R410A and a synthetic polyolester (POE) oil. The rise of the amount of lubricant circulating in the system leads to a progressive change in the behaviour of the mixture of refrigerant and oil that, for the higher oil mass fraction, evolves like a zeotropic mixture. One also observes that the presence of lubricant is generally associated with a fall of the performances of the heat exchangers, except however in the evaporator where an optimum is observed when the quantity of oil is equal to 0.1% of the total mass of the mixture. Some conclusions are drawn about the choice of correlations for the calculation of the refrigerant side heat transfer coefficient in a plate evaporator. (author)
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
An integrated assessment of emissions of some important refrigerant ozone depleting substances (ODSs) (CFC-11, CFC-12, HCFC-141b and HFC-134a) and their contributed ozone depletion potentials (ODPs) and global warming potentials (GWPs) have been made in the megacity Lahore (Pakistan) for the periodfrom ...
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
At the end of 1995, a total abolition of the production of the specified freons (CFC) was achieved. In future, it will be important to proceed with the appropriate recovery/destruction of the CFC, etc. which has been used so far, not only for the protection of ozone layer, but for the prevention of global warming. For the international study of facilities (technology) for destruction CFC, etc., the Technical Assessment Committee (TAC) was installed for destruction technology of ozone layer depletion substances (ODS) under the United Nations Environment Programme (UNEP), and the destruction efficiency (DE) of ODS was set up. In Japan, more than 30 facilities are already handling the destruction of CFC on a commercial basis. The number is expected to increase by the promotion of protection of ozone layer and prevention of global warming. This survey indicated quantitatively and qualitatively based on the TAC DE what the facilities for destruction of CFC should be which were considered of domestic laws in Japan, and was made a guide for existing facilities and ones to be newly installed. (NEDO)
Kalugina, Yulia N.; Roy, Pierre-Nicholas
2017-12-01
We present a five-dimensional potential energy surface (PES) for the HF@C60 system computed at the DF-LMP2/cc-pVTZ level of theory. We also calculated a five-dimensional dipole moment surface (DMS) based on DFT(PBE0)/cc-pVTZ calculations. The HF and C60 molecules are considered rigid with bond length rHF = 0.9255 Å (gas phase ground rovibrational state geometry). The C60 geometry is of Ih symmetry. The ab initio points were fitted to obtain a PES in terms of bipolar spherical harmonics. The minimum of the PES corresponds to a geometry where the center of mass of HF is located 0.11 Å away from the center of the cage with an interaction energy of -6.929 kcal/mol. The DMS was also represented in terms of bipolar spherical harmonics. The PES was used to calculate the rotation-translation bound states of HF@C60, and good agreement was found relative to the available experimental data [A. Krachmalnicoff et al., Nat. Chem. 8, 953 (2016)] except for the splitting of the first rotational excitation levels. We propose an empirical adjustment to the PES in order to account for the experimentally observed symmetry breaking. The form of that effective PES is additive. We also propose an effective Hamiltonian with an adjusted rotational constant in order to quantitatively reproduce the experimental results including the splitting of the first rotational state. We use our models to compute the molecular volume polarizability of HF confined by C60 and obtain good agreement with experiment.
29 CFR 2570.134 - Consequences of default.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Consequences of default. 2570.134 Section 2570.134 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(7) § 2570.134 Consequences of default. For 502(c)(7) civil penalty proceedings...
49 CFR 195.134 - CPM leak detection.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.134 Section 195.134... PIPELINE Design Requirements § 195.134 CPM leak detection. This section applies to each hazardous liquid... computational pipeline monitoring (CPM) leak detection system and each replaced component of an existing CPM...
Uptake and disposition of 1,1-difluoroethane (HFC-152a) in humans.
Ernstgård, Lena; Sjögren, Bengt; Dekant, Wolfgang; Schmidt, Tobias; Johanson, Gunnar
2012-02-25
The aim of this study was to determine the toxicokinetics of inhaled 1,1-difluoroethane (HFC-152a) in humans. Healthy volunteers were exposed to 0, 200 or 1000 ppm 1,1-difluoroethane for 2h at light exercise in an exposure chamber. Capillary blood, urine and exhaled air were sampled up to 22 h post-exposure and analyzed for 1,1-difluoroethane. Fluoride and other potential metabolites were analyzed in urine. Symptoms of irritation and central nervous system effects were rated and inflammatory markers were analyzed in blood. Within a few minutes of exposure to 200 and 1000 ppm, 1,1-difluoroethane increased rapidly in blood and reached average levels of 7.4 and 34.3 μM, respectively. The post-exposure decreases in blood were fast and parallel to those in exhaled air. The observed time courses in blood and breath agreed well with those obtained with the PBPK model. The PBPK simulations indicate a net uptake during exposure to 1000 ppm of 6.6 mmol (6.7%) which corresponds to the amount exhaled post-exposure. About 20 μmol excess fluoride (0.013% of inhaled 1,1-difluoroethane on a molar basis) was excreted in urine after exposure to 1000 ppm, compared to control. No fluorine-containing metabolites were detected in urine. Symptom ratings and changes in inflammatory markers revealed no exposure-related effects. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Recycling of tailings from Korea Molybdenum Corporation as admixture for high-fluidity concrete.
Jung, Moon Young; Choi, Yun Wang; Jeong, Jae Gwon
2011-01-01
The main objective of this study is to develop an eco-friendly and a large recycling technique of flotation Tailings from korea (TK) from metal mines as construction materials such as admixtures for high-fluidity concrete (HFC). TK used in this study was obtained from the Korea Molybdenum Corporation in operation. TK was used as the alternative material to adjust flowability and viscosity of HFC in the form of powder agent which enables adjustment of concrete compressive strength. In this study, we have performed concrete rheological tests and concrete flowability tests to obtain the quality characteristics of TK for using as the admixture in producing HFC. The results indicated that the adequate mix ratio of cement to TK should be 8:2 (vol%). It is more effective to use the TK as admixture to control flowability, viscosity and strength of HFC than the normal concrete. It was found that TK could be recycled construction materials in bulk such as admixture for HFC, in terms of the economic and eco-friendly aspects.
Directory of Open Access Journals (Sweden)
Pavlenko Aleksandr
2017-01-01
Full Text Available Results of experimental studies of heat-and-mass transfer and hydrodynamic processes at distillation on a regular packing are presented. The mixture of freons R114–R21 at the pressure of 0.3 MPa was used as a working mixture. The mixture was separated on the Mellapak 350Y structured packing with the diameter of 0.9 m under the conditions of complete reflux (L/V = 1 at different packing heights. A specially designed liquid distributor with a possibility to change the density and pattern of drip points was used to irrigate the packing. The experimental data on the efficiency of mixture separation (height of transfer unit HTU and distribution of the local flow rate density over the column cross-section were compared. It is shown that an increase in the height of the structured packing from 2.1 m to 4.0 m leads to a significant decrease in the efficiency of mixture separation in the distillation column.
13 CFR 134.709 - When will a Judge dismiss an appeal?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When will a Judge dismiss an appeal? 134.709 Section 134.709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
The 134Cs uptake by sunflower (Helianthus anuus, Less) cultivated on soil contaminated with 134Cs
International Nuclear Information System (INIS)
Poppy Intan Tjahaja; Putu Sukmabuana
2008-01-01
One of the methods for remediation of contaminated environment is phytoremediation techniques, i.e. the environmental remediation using plants. In this research the bioavailability of sunflower plant (Helianthus anuus, Less) in radiocaesium uptake from soil was studied for being considered as a phytoremediator later. Sunflower plants were cultivated on soil contaminated with 134 Cs with the concentrations of 29,3 kBq/kg ; 117,2 kBq/kg ; 557 kBq/kg for 45 days. As control the sunflowers were also cultivated on non contaminated soil. Observation was carried out every 5 days by sampling 3 plants and soils. The plant and soil samples were dried using infra red lamp for 24 hours, and then counted using gamma spectrometer. The counting results i.e. 134 Cs concentration on soil and plant parts were then analyzed to obtain transfer factor (TF) values. The highest TF values was reached on 26 th day, i.e. 0,87; 1,89 ; 2,82 for initial soil 134 Cs concentrations of 29,3 Bq/g ; 117,2 Bq/g ; 557 Bq/g, respectively. The TF values obtained expressed the capability of plants to accumulate 134 Cs from soils. The observation to the plants growth showed that the plants grew normally on the 134 Cs contaminated soil until the concentration of 557 Bq/g. The sunflower can be considered to be phytoremediator of andosol soil contaminated with Cs radionuclides. (author)
Oxidation behavior of TiC, ZrC, and HfC dispersed in oxide matrices
International Nuclear Information System (INIS)
Arun, R.; Subramanian, M.; Mehrotra, G.M.
1990-01-01
The oxidation behavior of hot pressed TiC-Al 2 O 3 , TiC-ZrO 2 , ZrC-ZrO 2 , and HfC-HfO 2 composites has been investigated at 1273 K. The oxidation of TiC, ZrC, and HfC in hot-pressed composites containing ZrO 2 and HfO 2 has been found to be extremely rapid. The kinetics of oxidation of TiC and a 90 wt% TiC-Al 2 O 3 composite appear to be faster compared to that of pure TiC. X-ray diffraction results for hot-pressed ZrC-HfO 2 and HfC-HfO 2 composites indicate partial stabilization of tetragonal ZrO 2 and HfO 2 phases in these composites
Ha, Ji-Eun; Yang, Seung-Ju; Gong, Young-Dae
2018-02-12
An efficient solid-phase synthetic route for the construction of 1,3,4-oxadiazole and 1,3,4-thiadiazole libraries based on branching diversity-oriented synthesis (DOS) has been developed in this study. The core skeleton resins, 1,3,4-oxadiazole and 1,3,4-thiadiazole, were obtained through desulfurative and dehydrative cyclizations of thiosemicarbazide resin, respectively. Various functional groups have been introduced to the core skeleton resins, such as aryl, amine, amide, urea, thiourea, and an amino acid. Most of the libraries were purified by simple trituration without extraction or column chromatography after cleavage of the products from the solid-supported resin. As a result, we obtained high yields of pure 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives (total numbers = 128). Finally, we confirmed the drug-like properties of our library by calculation of physicochemical properties, displays of the skeletal diversities of the library in 3D-space, and occupation of a broad range of areas by their functional groups.
Heat-pump cool storage in a clathrate of freon
Tomlinson, J. J.
Presented are the analytical description and assessment of a unique heat pump/storage system in which the conventional evaporator of the vapor compression cycle is replaced by a highly efficient direct contract crystallizer. The thermal storage technique requires the formation of a refrigerant gas hydrate (a clathrate) and exploits an enthalpy of reaction comparable to the heat of fusion of ice. Additional system operational benefits include cool storage at the favorable temperatures of 4 to 7 C (40 to 45 F), and highly efficient heat transfer ates afforded by he direct contact mechanism. In addition, the experimental approach underway at ORNL to study such a system is discussed.
Adsorbate shape selectivity: Separation of the HF/134a azeotrope over carbogenic molecular sieve
Energy Technology Data Exchange (ETDEWEB)
Hong, A.; Mariwala, R.K.; Kane, M.S.; Foley, H.C. [Univ. of Delaware, Nework, DE (United States)
1995-03-01
Experimental evidence is provided for adsorptive shape selectivity in the separation of the azeotrope between HF and 1,1,1,2-tetrafluoroethane (134a) over pyrolyzed poly(furfuryl alcohol)-derived carbogenic molecular sieve (PPFA-CMS). The separation can be accomplished over coconut charcoal or Carbosieve G on the basis of the differences in the extent of equilibrium adsorption of HF and 134a. On these adsorbents 134a is more strongly bound than HF, thus it elutes much more slowly from the bed. The heat of adsorption for 134a in the vicinity of 200 C on Carbosieve G is {approximately}8.8 kcal/mol. In contrast, when the same azeotropic mixture is separated over PPFA-CMS prepared at 500 C, 134a is not adsorbed. As a result 134a elutes from the bed first, followed by HF. The reversal is brought about by the narrower pore size and pore size distribution of the PPFA-CMS versus that for Carbosieve G. Thus the separation over PPFA-CMS is an example of adsorbate shape selectivity and represents a limiting case of kinetic separation.
Measurement limits to 134Cs concentration in soil
International Nuclear Information System (INIS)
Ahn, J.K.; Kim, J.S.; Lee, H.M.; Kim, H.; Kim, T.H.; Park, J.N.; Kang, Y.S.; Lee, H.S.; Kim, S.J.; Park, J.Y.; Ryu, S.Y.; Kim, H.-Ch.; Kang, W.G.; Kim, S.K.
2011-01-01
We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the 134 Cs. In order to lower the minimum detectable amount (MDA) of activity for the 134 Cs, we have used the ammonium molybdophosphate (AMP) precipitation method to get rid of the 40 K existing in natural radioactivity, which reduces the MDA activity about 10 times smaller than those without the AMP precipitation method. The MDA results for the 134 Cs were found to be in the range between 0.015 and 0.044 Bq/kg-dry weight. In order to diminish the background, we also have measured a part of the soil samples in Yangyang, a small town in the east coast of Korea. However, it turns out that in order to detect the 134 Cs in the samples the MDA should be reduced to the level of mBq/kg-dry weight. - Highlights: → We study the caesium concentrations in soils in mountain areas near Gori NPT in Korea. → We use the AMP precipitation method to lower the minimum detectable amount (MDA) of activity for the 134 Cs. → The results of the MDA for the 134 Cs turn out to be in the range between 0.015 and 0.044. → In order to detect the 134 Cs in the samples, the MDA should be reduced to the level of mBq/kg-dry weight.
Directory of Open Access Journals (Sweden)
Ye Chang
2018-01-01
Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.
13 CFR 134.404 - Decision by Administrative Law Judge.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision by Administrative Law Judge. 134.404 Section 134.404 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... 8(a) Program § 134.404 Decision by Administrative Law Judge. Appeal proceedings brought under this...
29 CFR 1915.134 - Abrasive wheels.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Abrasive wheels. 1915.134 Section 1915.134 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... wheels shall fit freely on the spindle and shall not be forced on. The spindle nut shall be tightened...
Burnout experiments with 6 x 6, 8 x 8 and 7 x 7 rod bundle test sections using freon as model fluid
International Nuclear Information System (INIS)
Fulfs, H.; Katsaounis, A.; Minden, C.v.
1976-01-01
This paper reports on burnout experiments at staedy state condition using Freon12 as model fluid. The experiments were carried out with three test sections with 6 x 6, 8 x 8 and 7 x 7 rod bundles. The axial flux distribution of the rods is either constant or reactor like. The transformed measured points using STEVENS and BOURE scaling factors to equivalent water conditions respectively, were compared to the burnout correlation W3 using the reactor layout program DYNAMIT. The DYNAMIT code is a thermohydraulic lay-out reactor program without consideration of mixing flow between the subchannels. (orig.) [de
Heat transfer performance during condensation of R-134a inside helicoidal tubes
International Nuclear Information System (INIS)
Al-Hajeri, M.H.; Koluib, A.M.; Mosaad, M.; Al-Kulaib, S.
2007-01-01
This paper reports an experimental investigation of condensation heat transfer and pressure drop of an ozone friendly refrigerant, R-134a, inside a helical tube for climatic conditioning of hot regions. This study concerns the condensation of R-134a flowing through annular helical tubes with different operating refrigerant saturated temperatures. The average pressure drop is measured and compared with data from relevant literature. The measurements of R-134a were performed on mass flow flux ranges from 50 to 680 kg/m 2 s. The study provides experimental data that could be used for the design and development of more efficient condensers for refrigeration and air conditioning (A/C) systems working with the same refrigerant
Effect of Pelletized Coconut Fibre on the Compressive Strength of Foamed Concrete
Directory of Open Access Journals (Sweden)
Mohd Jaini Zainorizuan
2016-01-01
Full Text Available Foamed concrete is a controlled low density ranging from 400kg/m3 to 1800kg/m3, and hence suitable for the construction of buildings and infrastructures. The uniqueness of foamed concrete is does not use aggregates in order to retain low density. Foamed concrete contains only cement, sand, water and foam agent. Therefore, the consumption of cement is higher in producing a good quality and strength of foamed concrete. Without the present of aggregates, the compressive strength of foamed concrete can only achieve as high as 15MPa. Therefore, this study aims to introduce the pelletized coconut fibre aggregate to reduce the consumption of cement but able to enhance the compressive strength. In the experimental study, forty-five (45 cube samples of foamed concrete with density 1600kg/m3 were prepared with different volume fractions of pelletized coconut fibre aggregate. All cube samples were tested using the compression test to obtain compressive strength. The results showed that the compressive strength of foamed concrete containing 5%, 10%, 15% and 20% of pelletized coconut fibre aggregate are 9.6MPa, 11.4MPa, 14.6MPa and 13.4MPa respectively. It is in fact higher than the controlled foamed concrete that only achieves 9MPa. It is found that the pelletized coconut fibre aggregate indicates a good potential to enhance the compressive strength of foamed concrete.
Directory of Open Access Journals (Sweden)
S. Kutsuna
2017-06-01
Full Text Available Gas-to-water equilibrium coefficients, KeqS (in M atm−1, of difluoromethane (CH2F2, a hydrofluorocarbon refrigerant (HFC-32, in aqueous salt solutions relevant to seawater were determined over a temperature (T range from 276 to 313 K and a salinity (S range up to 51 ‰ by means of an inert-gas stripping method. From the van't Hoff equation, the KeqS value in water, which corresponds to the Henry's law constant (KH, at 298 K was determined to be 0.065 M atm−1. The salinity dependence of KeqS (the salting-out effect, ln(KH∕KeqS, did not obey the Sechenov equation but was proportional to S0. 5. Overall, the KeqS(T value was expressed by ln(KeqS(T = −49.71 + (77.70 − 0.134 × S0. 5 × (100∕T + 19.14 × ln(T∕100. By using this equation in a lower-tropospheric semi-hemisphere (30–90 °S of the Advanced Global Atmospheric Gases Experiment (AGAGE 12-box model, we estimated that 1 to 4 % of the atmospheric burden of CH2F2 resided in the ocean mixed layer and that this percentage was at least 4 % in the winter; dissolution of CH2F2 in the ocean may partially influence estimates of CH2F2 emissions from long-term observational data of atmospheric CH2F2 concentrations.
Environmental Assessment for Construction of a 20-Slip Boat Dock Structure MacDill AFB, Florida
2008-01-01
practice CAA Clean Air Act CCA chromated copper arsenate CEQ Council on Environmental Quality CES Civil Engineering Squadron CEV Environmental...newspaper advertisement in the April 10, 2007 edition of the Tampa Tribune announcing the availability of the Draft EA for public review at the John F...chlorine, freon, paints, thinners, oils, lubricants, compressed gases, pesticides, herbicides, nitrates, and chromates . A detailed tracking and accounting
Experimental Study of Flow Boiling Heat Transfer in a Horizontal Microfin Tube
Yu, Jian; Koyama, Shigeru; Momoki, Satoru
1995-01-01
An experimental study on flow boiling heat transfer in a horizontal microfin tube is conducted with pure refrigerants HFC134a, HCFC123 and HCFC22 using a water-heated double-tube type test section. The test microfin tube is a copper tube having the following dimensions: 8.37mm mean inside diameter, 0.168mm fin height, 60fin number and 18 degree of helix angle. The local heat transfer coefficients for both counter and parallel flows are measured in a range of heat flux of 1 to 93W/m^2, mass ve...
Hybrid compression/absorption type heat utilization system (eco-energy city project)
Energy Technology Data Exchange (ETDEWEB)
Karimata, T.; Susami, S.; Ogawa, Y. [Research and Development Dept., EBARA Corp., Kanagawa pref. (Japan)
1999-07-01
This research is intended to develop a 'hybrid compression/absorption type heat utilization system' by combining an absorption process with a compression process in one circulation cycle. This system can produce chilling heat for ice thermal storage by utilizing low-temperature waste heat (lower than 100 C) which is impossible to treat with a conventional absorption chiller. It means that this system will be able to solve the problem of a timing mismatch between waste heat and heat demand. The working fluid used in this proposed system should be suitable for producing ice, be safe, and not damage the ozone layer. In this project, new working fluids were searched as substitutes for the existing H{sub 2}O/LiBr or NH{sub 3}/H{sub 2}O. The interim results of this project in 1997, a testing unit using NH{sub 3}/H{sub 2}O was built for demonstration of the system and evaluation of its characteristics, and R134a/E181 was found to be one of the good working fluid for this system. The COP (ratio of energy of ice produced to electric power provided) of this system using R134a/E181 is expected to achieve 5.5 by computer simulation. The testing unit with this working fluid was built recently and prepared for the tests to confirm the result of the simulation. (orig.)
Direct and indirect contamination of tree crops with Cs-134
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Arapis, G.; Haidouti, C.
1996-01-01
A long term glasshouse pot experiment was established in 1994 to study the transfer factors of Cs-134 from soil to olive and orange trees for which no relevant data are available. A calcareous-heavy textured and an acid-light textured soil were used in this experiment. Results from two year's experimentation are considered in this study. The ability of the studied plant species for Cs-134 root uptake seems to be significantly influenced by soil type. The contamination of both tree species grown on calcareous and heavy soil was very low and did not change much with the time. On the contrary, trees grown on acid and light soil showed much higher Cs-134 concentration (up to 34 times for orange and 23 for olive trees) which significantly increased with the time. Both olive and orange trees showed a similar behaviour in the studied soils. Effort was also made to study the long term consequences of the direct contamination in a field experiment where an olive tree was contaminated by dry deposition with Cs-134. Six months after contamination 5 % of the Cs-134 deposited on the leaves was measured in the first olive production. However, very small quantities (= 0.5 %) of the olive Cs-134 was detected in the unprocessed olive oil. The following year 15 % of the Cs-134 remained in the leaves while extremely low quantities of Cs-134 were detected in either olives or olive oil. (author)
Gafni, Rachel I; Guthrie, Lori C; Kelly, Marilyn H; Brillante, Beth A; Christie, C Michele; Reynolds, James C; Yovetich, Nancy A; James, Robert; Collins, Michael T
2015-11-01
Synthetic human PTH 1-34 (hPTH 1-34) replacement therapy in hypoparathyroidism maintains eucalcemia and converts quiescent bone to high-turnover bone. However, the skeletal and metabolic effects of drug discontinuation have not been reported. Nine subjects with hypoparathyroidism received subcutaneous injections of hPTH 1-34 two to three times daily for 19.8 to 61.3 months and then transitioned back to calcium and calcitriol. Biochemistries and bone mineral density (BMD) by dual-energy X-ray absorptiometry (DXA) were assessed at baseline, while on treatment, and at follow-up 3 to 12 months after drug discontinuation. Two subjects developed hypocalcemia when hPTH 1-34 was abruptly discontinued. Thus, to avoid hypocalcemia, subjects were slowly weaned from hPTH 1-34 over several weeks. When hPTH 1-34 was stopped, subjects were requiring two to three times pretreatment doses of calcitriol and calcium to maintain blood calcium levels. Doses were gradually reduced over many weeks until calcium levels were stable on doses similar to baseline. Bone-specific alkaline phosphatase (BSAP), N-telopeptide (NTX), and osteocalcin (OC) increased significantly with hPTH 1-34; at follow-up, BSAP and NTX had returned to baseline while OC was still slightly elevated. During treatment, BMD was unchanged at the hip and lateral spine but declined at the anterior-posterior (AP) spine, radius, and total body. During weaning, BMD increased, with the hip and lateral spine exceeding pre-hPTH 1-34 values and the whole body returning to baseline. AP spine was increased non-significantly compared to baseline at follow-up. hPTH 1-34 must be gradually weaned in hypoparathyroid patients with high doses of oral medications given to avoid hypocalcemia. The transient increased requirements accompanied by increased BMD after long-term hPTH 1-34 therapy suggest a reversal of the expanded remodeling space favoring bone formation as the skeleton returns to a low-turnover state, reminiscent of the hungry
Implementation of R134a Thermophysical Properties for MARS Application
Energy Technology Data Exchange (ETDEWEB)
Son, Gyu Min; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)
2016-05-15
MARS requires 3 files for analysis: executable MARS file, input, and thermodynamic property file (tpf) for target fluids like light water or heavy water. Most experiments and scenarios were interested in behavior of water so original tpfs were sufficient enough for analysis. As MARS application became wider, needs for other fluid properties rose since MARS do not have extra function to interpret foreign materials that does not have tpf. One way of solving this problem is to generate external tpf file and if successfully implemented, this methodology could widen the application of MARS to other fields of engineering. Thus, this study aims for tpf generation of R134a. The reasons for its selection is because R134a is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. Generation methods of tpf were discussed. Conventional tpfh2o utilized Gibbs function to calculate the properties. However, since that method could not be applied to other fluids, fitting equation with temperature and pressure variables were applied from R134a property database. Direct implementation of theses equations simplified the structure of main program.
The absorption and distribution of Cesium-134 in rice-soil system
International Nuclear Information System (INIS)
Xu Yinliang; Chen Chuanqun; Chen Bin; Sun Zhiming
1991-01-01
Dynamics of absorption of 134 Cs by rice shows that absorption rate is the fastest at boot stage; absorption capacities of 134 Cs in soils are different with the different physical-chemical properties of soils; absorption amounts vary with the time of irrigating 134 Cs; the closer the irrigation time to mature stage is, the more the absorption amount of 134 Cs in rice will be; the more the irrigating times are, and the higher the radioactivity of 134 Cs in irrigating water is, the more the absorption amount in rice will be. After brown rice is polished, contamination of 134 Cs can be decreased by 22.6-45.6%. The order of specific activity in rice is: bran > root > straw > husk > polished rice. Percentage activity of straw, brown rice, root and husk is 51.4%, 28.4%, 11.8% and 8.4% respectively. The migration of 134 Cs is very slow in soil and 95.1% of 134 Cs is concentrated in surface soil (0-2.5 cm). The distribution ratio of 134 Cs in the rice and soil is 6.1%:93.9%. Potassium ion can inhibit the absorption of 134 Cs by rice. There is an exponential function between the concentration of potassium ion and specific activity of 134 Cs in rice
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
The trend survey was conducted of global warming protection measures by participation in international conferences, scientific society meetings and lecture meetings, and by literature surveys. We participated in the international conference on ozonosphere protection measures. In the 9th meeting of the nations which concluded the Montreal Protocol, the strengthening of restrictions on methyl bromide was decided on. In the UNEP solvent technology selection conference and the OORG conference of the World Bank, reports were made on substituting solvents in Japan, activities supporting developing countries, and the developmental trend of urethane use foaming agent. In the international conference on ozonosphere protection measures, introduced were the present status of Japan`s ODA for developing countries and examples of success of the substitution in the solvent field. The paper included nine reports on CFC destruction technology related literature made public in the past one year. The paper also introduced a comparative study of de-HCFC substituting technology at U.S. Oak Ridge National Laboratory, U.S. EPA`s prediction of emission of fluorine 3 gas, the predicted value of HFC emission and trial calculation of contributing rate in all greenhouse gases by IIR, Green Peace and Elf Atochem, and NOAA`s measured data on SF6 in the atmosphere. 49 refs., 46 figs., 26 tabs.
13 CFR 134.209 - Requirement of signature.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirement of signature. 134.209 Section 134.209 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... of signature. Every written submission to OHA, other than evidence, must be signed by the party...
13 CFR 134.702 - Who may appeal?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who may appeal? 134.702 Section 134.702 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...
DNABIT Compress - Genome compression algorithm.
Rajarajeswari, Pothuraju; Apparao, Allam
2011-01-22
Data compression is concerned with how information is organized in data. Efficient storage means removal of redundancy from the data being stored in the DNA molecule. Data compression algorithms remove redundancy and are used to understand biologically important molecules. We present a compression algorithm, "DNABIT Compress" for DNA sequences based on a novel algorithm of assigning binary bits for smaller segments of DNA bases to compress both repetitive and non repetitive DNA sequence. Our proposed algorithm achieves the best compression ratio for DNA sequences for larger genome. Significantly better compression results show that "DNABIT Compress" algorithm is the best among the remaining compression algorithms. While achieving the best compression ratios for DNA sequences (Genomes),our new DNABIT Compress algorithm significantly improves the running time of all previous DNA compression programs. Assigning binary bits (Unique BIT CODE) for (Exact Repeats, Reverse Repeats) fragments of DNA sequence is also a unique concept introduced in this algorithm for the first time in DNA compression. This proposed new algorithm could achieve the best compression ratio as much as 1.58 bits/bases where the existing best methods could not achieve a ratio less than 1.72 bits/bases.
International Nuclear Information System (INIS)
Kairouani, L.; Nehdi, E.
2006-01-01
The objectives of this paper are to develop a novel combined refrigeration system, and to discuss the thermodynamic analysis of the cycle and the feasibility of its practical development. The aim of this work was to study the possibility of using geothermal energy to supply vapour absorption system cascaded with conventional compression system. Three working fluids (R717, R22, and R134a) are selected for the conventional compression system and the ammonia-water pair for the absorption system. The geothermal temperature source in the range 343-349 K supplies a generator operating at 335 K. Results show that the COP of a combined system is significantly higher than that of a single stage refrigeration system. It is found that the COP can be improved by 37-54%, compared with the conventional cycle, under the same operating conditions, that is an evaporation temperature at 263 K and a condensation temperature of 308 K. For industrial refrigeration, the proposed system constitutes an alternative solution for reducing energy consumption and greenhouse gas emissions
42 CFR 84.134 - Respirator containers; minimum requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.134... Respirators § 84.134 Respirator containers; minimum requirements. Supplied-air respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...
2010-01-01
... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false [Reserved] 3.134-3.135 Section 3.134-3.135 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...
134Cs emission probabilities determination by gamma spectrometry
de Almeida, M. C. M.; Poledna, R.; Delgado, J. U.; Silva, R. L.; Araujo, M. T. F.; da Silva, C. J.
2018-03-01
The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of 134Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. 134Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration. The gamma emission probabilities (Pγ) were determined mainly for some energies of the 134Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1).
22 CFR 134.30 - Payment of award.
2010-04-01
... will pay the amount awarded to the applicant within 60 days, unless judicial review of the award or of... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Payment of award. 134.30 Section 134.30 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS EQUAL ACCESS TO JUSTICE ACT; IMPLEMENTATION Procedures for...
40 CFR 86.134-96 - Running loss test.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Running loss test. 86.134-96 Section... Heavy-Duty Vehicles; Test Procedures § 86.134-96 Running loss test. (a) Overview. Gasoline- and methanol-fueled vehicles are to be tested for running loss emissions during simulated high-temperature urban...
International research into chlorofluorocarbon (CFC) alternatives
Energy Technology Data Exchange (ETDEWEB)
Marseille, T.J.; Shankle, D.L.; Thurman, A.G.
1992-05-01
Selected researchers from 21 countries were queried through questionnaires about their current and planned research activities. The results of the survey show that the majority of research being conducted by the respondents is devoted to investigating the hydrogenated fluorocarbon HFC-134a as a replacement for CFC-12 in refrigeration applications. The main issue with this alternative is identifying compatible lubricants that do not reduce its effectiveness.
An examination of the influence of spacers on burnout in an annulus cooled by the upflow of Freon-12
International Nuclear Information System (INIS)
Ilic, V.
1975-04-01
To evaluate the spacer influence on burnout, tests were carried out in Freon-12 at 1.04 MPa (abs.) test section inlet pressure with an internally heated annulus 2743 mm long by 14.4 mm heater diameter, the outer tube (shroud) having a bore of 22.1 mm. The inner rod (heater) was located centrally to the shroud by spacers and their configuration was changed for each test. Comparison of the results with those obtained with a test section having no spacers indicated that spacers can increase burnout power up to 75 per cent, decrease it, or show no effect at all, depending on the combination of the inlet temperature and mass velocity. If the spacers were streamlined, removed from the upstream portion of the heater or relocated farther upstream from the downstream end of the heater, there was a considerably reduced effect on the test section performance. (author)
41 CFR 105-53.134 - Office of Administration.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office of Administration. 105-53.134 Section 105-53.134 Public Contracts and Property Management Federal Property Management... Associate Administrator for Administration, participates in the executive leadership of the agency...
EXPERIMENTAL INVESTIGATION OF R-134a AND R-600a ...
African Journals Online (AJOL)
Preet khandelwal
performance of blends of two existing refrigerant, R-134a and R-600a, blended together at ratios of 11%/89%, ... blending ratios, estimated GWPs ≤ 150 using Ali's model. .... series are less flammable among other HCs and its .... Figure 2: Variation of Evaporator Temperature with Time at an Ambient Temperature of 37oC.
Thermoeconomic optimization of subcooled and superheated vapor compression refrigeration cycle
International Nuclear Information System (INIS)
Selbas, Resat; Kizilkan, Onder; Sencan, Arzu
2006-01-01
An exergy-based thermoeconomic optimization application is applied to a subcooled and superheated vapor compression refrigeration system. The advantage of using the exergy method of thermoeconomic optimization is that various elements of the system-i.e., condenser, evaporator, subcooling and superheating heat exchangers-can be optimized on their own. The application consists of determining the optimum heat exchanger areas with the corresponding optimum subcooling and superheating temperatures. A cost function is specified for the optimum conditions. All calculations are made for three refrigerants: R22, R134a, and R407c. Thermodynamic properties of refrigerants are formulated using the Artificial Neural Network methodology
DNABIT Compress – Genome compression algorithm
Rajarajeswari, Pothuraju; Apparao, Allam
2011-01-01
Data compression is concerned with how information is organized in data. Efficient storage means removal of redundancy from the data being stored in the DNA molecule. Data compression algorithms remove redundancy and are used to understand biologically important molecules. We present a compression algorithm, “DNABIT Compress” for DNA sequences based on a novel algorithm of assigning binary bits for smaller segments of DNA bases to compress both repetitive and non repetitive DNA sequence. Our proposed algorithm achieves the best compression ratio for DNA sequences for larger genome. Significantly better compression results show that “DNABIT Compress” algorithm is the best among the remaining compression algorithms. While achieving the best compression ratios for DNA sequences (Genomes),our new DNABIT Compress algorithm significantly improves the running time of all previous DNA compression programs. Assigning binary bits (Unique BIT CODE) for (Exact Repeats, Reverse Repeats) fragments of DNA sequence is also a unique concept introduced in this algorithm for the first time in DNA compression. This proposed new algorithm could achieve the best compression ratio as much as 1.58 bits/bases where the existing best methods could not achieve a ratio less than 1.72 bits/bases. PMID:21383923
Experimental study on void fraction of two-phase flow inside a micro-fin tube
Koyama, Shigeru; Chen, Yongchang; Kitano, Ryuji; Kuwahara, Ken
2001-01-01
In this paper the void fraction and flow pattern of the two-phase flow in a micro-fin tube were investigated experimentally for a pure refrigerant HFC134a. The experiment was carried out at a pressure range of 0.6 and 1.2MPa with mass velocities of 90 and 180kg/m^2 s, in which the vapor quality varied from 0 to 1. The void fraction was measured by means of simultaneously closing valves of both sides of the test tube at adiabatic condition. Experimental results for the micro-fin tube were comp...
19 CFR 134.43 - Methods of marking specific articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Methods of marking specific articles. 134.43...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.43 Methods of marking specific articles. (a) Marking previously required by certain provisions of the...
International Nuclear Information System (INIS)
Fatouh, M.; El Kafafy, M.
2006-01-01
The possibility of using hydrocarbon mixtures as working fluids to replace R134a in domestic refrigerators has been evaluated through a simulation analysis in the present work. The performance characteristics of domestic refrigerators were predicted over a wide range of evaporation temperatures (-35 to -10 o C) and condensation temperatures (40-60 deg. C) for various working fluids such as R134a, propane, commercial butane and propane/iso-butane/n-butane mixtures with various propane mass fractions. The performance characteristics of the considered domestic refrigerator were identified by the coefficient of performance (COP), volumetric cooling capacity, cooling capacity, condenser capacity, input power to compressor, discharge temperature, pressure ratio and refrigerant mass flow rate. The results showed that pure propane could not be used as a drop in replacement for R134a in domestic refrigerators because of its high operating pressures and low COP. Commercial butane yields many desirable characteristics but requires a compressor change. The coefficient of performance of the domestic refrigerator using a ternary hydrocarbon mixture with propane mass fractions from 0.5 to 0.7 is higher than that of R134a. Comparison among the considered working fluids confirmed that the average refrigerant mass flow rate of the propoane/commercial butane mixture is 50% lower than that of R134a. Also, the results indicated that R134a and the propoane/commercial butane mixture with 60% propane mass concentration have approximately the same values of saturation pressure, compressor discharge temperature, condenser heat load, input power, cooling capacity and volumetric cooling capacity. However, the pressure ratio of the hydrocarbon mixture with 60% propane is lower than that of R134a by about 11.1%. Finally, the reported results confirmed that the propane/iso-butane/n-butane mixture with 60% propane is the best drop in replacement for R134a in domestic refrigerators under normal
MicroRNA-134 regulates poliovirus replication by IRES targeting
Bakre, Abhijeet A.; Shim, Byoung-Shik; Tripp, Ralph A.
2017-01-01
Global poliovirus eradication efforts include high vaccination coverage with live oral polio vaccine (OPV), surveillance for acute flaccid paralysis, and OPV “mop-up” campaigns. An important objective involves host-directed strategies to reduce PV replication to diminish viral shedding in OPV recipients. In this study, we show that microRNA-134-5p (miR-134) can regulate Sabin-1 replication but not Sabin-2 or Sabin-3 via direct interaction with the PV 5′UTR. Hypochromicity data showed miR-134 ...
134Cs in heather seed plants grown with and without mycorrhiza
International Nuclear Information System (INIS)
Strandberg, M.; Johansson, M.
1988-01-01
Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of 134 Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of 134 Cs to the shoots than heather without mycorrhiza. As an average the concentration of 134 Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of 134 Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of 134 Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)
19 CFR 134.54 - Articles released from Customs custody.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles released from Customs custody. 134.54...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.54 Articles... value of the articles not properly marked or redelivered. (b) Failure to petition for relief. A written...
The impact of chest compression rates on quality of chest compressions - a manikin study.
Field, Richard A; Soar, Jasmeet; Davies, Robin P; Akhtar, Naheed; Perkins, Gavin D
2012-03-01
Chest compressions are often performed at a variable rate during cardiopulmonary resuscitation (CPR). The effect of compression rate on other chest compression quality variables (compression depth, duty-cycle, leaning, performance decay over time) is unknown. This randomised controlled cross-over manikin study examined the effect of different compression rates on the other chest compression quality variables. Twenty healthcare professionals performed 2 min of continuous compressions on an instrumented manikin at rates of 80, 100, 120, 140 and 160 min(-1) in a random order. An electronic metronome was used to guide compression rate. Compression data were analysed by repeated measures ANOVA and are presented as mean (SD). Non-parametric data was analysed by Friedman test. At faster compression rates there were significant improvements in the number of compressions delivered (160(2) at 80 min(-1) vs. 312(13) compressions at 160 min(-1), P<0.001); and compression duty-cycle (43(6)% at 80 min(-1) vs. 50(7)% at 160 min(-1), P<0.001). This was at the cost of a significant reduction in compression depth (39.5(10)mm at 80 min(-1) vs. 34.5(11)mm at 160 min(-1), P<0.001); and earlier decay in compression quality (median decay point 120 s at 80 min(-1) vs. 40s at 160 min(-1), P<0.001). Additionally not all participants achieved the target rate (100% at 80 min(-1) vs. 70% at 160 min(-1)). Rates above 120 min(-1) had the greatest impact on reducing chest compression quality. For Guidelines 2005 trained rescuers, a chest compression rate of 100-120 min(-1) for 2 min is feasible whilst maintaining adequate chest compression quality in terms of depth, duty-cycle, leaning, and decay in compression performance. Further studies are needed to assess the impact of the Guidelines 2010 recommendation for deeper and faster chest compressions. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
{sup 134}Cs emission probabilities determination by gamma spectrometry
Energy Technology Data Exchange (ETDEWEB)
Almeida, M.C.M. de, E-mail: candida@cnen.gov.br [Comissão Nacional de Energia Nuclear (DINOR/CNEN), Riode Janeiro, RJ (Brazil); Poledna, R.; Delgado, J.U.; Silva, R.L.; Araujo, M.T.; Silva, C.J. da [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)
2017-07-01
The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of {sup 134}Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. {sup 134}Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration.The gamma emission probabilities (Pγ) were determined mainly for some energies of the {sup 134}Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1). (author)
R134a Flow Boiling Analysis with Modified Thermodynamic Property File of MARS Code
Energy Technology Data Exchange (ETDEWEB)
Son, Gyumin; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)
2016-10-15
Previous study showed application of RELAP5 code to solar energy facility with molten salt (60% NaNO3 and 40% KNO3) as working fluid. Based on external experimental correlations, thermodynamic properties of molten salt were evaluated as a function of pressure and temperature and those equations were used to generate tpf. To validate external tpf, experimental values were compared with RELAP5 analysis. In nuclear field, utilization of other fluid is also important since many thermal-hydraulic experiments used various fluids such as FC-72, R123, and R134a. Theses refrigerants have been used to simulate the high pressure environment of nuclear power plants due to their low boiling point, and density ratio between vapor and liquid. Thus, this study aims for tpf generation of R134a and verification by analyzing real case. R134a is selected as a fluid to be implemented and analyzed because it is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. R134a property file were generated with fitted equation using temperature and pressure as variables, originated from external data source. For validation, flow boiling experiment case were made into simplified input. Analysis with tpfr134a showed that application of Gnielinksi correlation could enhance single phase flow accuracy. Large error of HTC from two phase analysis requires parameter study. Future work aims for more specified experimental case comparison and correlation enhancement for two phase analysis.
13 CFR 134.405 - Jurisdiction.
2010-01-01
... Jurisdiction. (a) The Administrative Law Judge selected to preside over an appeal shall decline to accept... disadvantage, economic disadvantage, ownership or control; (2) The appeal is untimely filed under § 134.202 or... before a court of competent jurisdiction over such matters. (b) Once the Administrative Law Judge accepts...
40 CFR 81.134 - Austin-Waco Intrastate Air Quality Control Region.
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Austin-Waco Intrastate Air Quality Control Region. 81.134 Section 81.134 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.134 Austin-Waco Intrastate Air Quality Control Region. The Austin-Waco...
A Novel Application of Thermoelectric Modules in an HVAC System Under Cold Climate Operation
Okuma, Toru; Radermacher, Reinhard; Hwang, Yunho
2012-06-01
A vapor compression cycle (VCC) with integrated thermoelectric (TE) modules to boost the heating capacity of the system in an energy-efficient way, especially for cold climate operation, is suggested in this paper. While a baseline heat pump (HP) cycle absorbs heat from a source through an evaporator, the proposed system utilizes TE modules as an intermediate (or third) stage of an otherwise two-stage vapor compression system with a vapor injection compressor. This increases the overall system efficiency and augments the system capacity through the high coefficient of performance (COP) of the TE for small temperature lift conditions. To demonstrate the concept, a prototype refrigerant-to-solid (TE) heat exchanger, consisting of TE modules and microchannel flat tubes, was designed and fabricated so that the whole system could realize an additional 1 kW of heating capacity compared with the baseline system. The TE heat exchanger was integrated into a residential HP unit that uses R-410A as a refrigerant, and the system was tested in a laboratory under the severe condition of -17.8°C, in order to investigate the capacity improvement and the overall COP. Finally, an application of this technique in an automotive heating, ventilating, and air-conditioning system with HFC134a working fluid has been studied for the purpose of providing supplemental heating for electric vehicles and hybrid electric vehicles by establishing a detailed simulation model of a HP system with the TE heat exchanger. Both the laboratory test and the calculation study show that a VCC with integrated TE modules has both reasonable efficiency and increased heating capacity.
24 CFR 17.134 - Procedures for salary offset: when deductions may begin.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Procedures for salary offset: when deductions may begin. 17.134 Section 17.134 Housing and Urban Development Office of the Secretary, Department... Government Salary Offset Provisions § 17.134 Procedures for salary offset: when deductions may begin. (a...
Radiogenotoxicological effect of signal nuclide 134Cs on somatic and germ cells
Institute of Scientific and Technical Information of China (English)
ZhuShou-Peng; XiaFen; 等
1997-01-01
Chromosome at aberation rates in bone marrow cells and micronucleus formation in bone marrow polychromatic erythrocytes both rise with increase in radioactivities of 134Cs,and can be fitted to power functions of radioactivities of 134Cs.In spermatogonia 134Cs mainly induced chromatid breakage,and abnormalities in sperm can also be experessed as power functions of radioactivities of 134 Cs.
Predicting heat transfer in long, R-134a filled thermosyphons
Grooten, M.H.M.; Geld, van der C.W.M.
2008-01-01
When traditional air-to-air cooling is too voluminous, heat exchangers with long thermosyphons offer a good alternative. Experiments with a single thermosyphon with a large length-to-diameter ratio (188) and filled with R-134a are presented and analyzed. Saturation temperatures, filling ratios, and
The impact of chest compression rates on quality of chest compressions : a manikin study
Field, Richard A.; Soar, Jasmeet; Davies, Robin P.; Akhtar, Naheed; Perkins, Gavin D.
2012-01-01
Purpose\\ud Chest compressions are often performed at a variable rate during cardiopulmonary resuscitation (CPR). The effect of compression rate on other chest compression quality variables (compression depth, duty-cycle, leaning, performance decay over time) is unknown. This randomised controlled cross-over manikin study examined the effect of different compression rates on the other chest compression quality variables.\\ud Methods\\ud Twenty healthcare professionals performed two minutes of co...
International Nuclear Information System (INIS)
Liu Zengsheng; Chen Xiangmin; Sun Yiyan; Fang Ming; Wang Ping; Guan Yong; Sun Miao
2010-01-01
Objective: To explore the correlation of the operation effects of the miorovascular decompression (MVD) and the findings on magnetic resonance tomographie angiography (MRTA) in patients of neurovascular compression of the cranial nerves. Methods: Two hundred and twenty three patients treated with the microvascular decompression were analyzed retrospectively. They were grouped and graded according to the vessel compression on the cranial nerves. The compression were grouped as none, moderate and severe, and the operation effects were graded as I (complete relief), II (partial relief) and III ( no relief). The operation effects grades were correlated according to the compression groups by Kruskal-Wallis test and the operation effects between each two of the groups were compared using Nemenyi test. P 2 =16.84 and P<0.05. The mean rank of the non-compression, the moderate and the severe group was 134.21,102.37 and 110.4, respectively. The difference of the mean ranks between the non-compression group and the moderate group was 31.84, and between the non-compression and the severe group was 24.17, respectively, where P<0.05 both. Conclusions: There was close relationship between the findings on magnetic resonance tomographic angiography and the operation effects of the MVD. The operation effects of patients with moderate and severe vessel compression were much better than the non-compression group. MRTA is helpful for MVD surgical indication and its prognosis. (authors)
[Lens luxation in dogs: a retrospective study of 134 dogs (2000-2011)].
Betschart; Hässig; Spiess
2014-03-01
This retrospective study evaluated cases of lens luxation in dogs that were documented at the University of Zurich Veterinary Teaching Hospital between 2000 and 2011. A total 134 dogs were included in the study. This population of dogs with lens luxation represents 0.41 % of all dogs presented to the Zurich Veterinary Teaching Hospital (32'523) and 3.02 % of all dogs presented to the ophthalmology service during the same time period. The 134 dogs represented over 40 different breeds, including mixed breeds. 63 of the dogs were male, 71 were female. The 134 dogs were divided in primary lens luxation (86 of the 134 dogs, 64 %) and secondary lens luxation (48 dogs, 36 %). The most frequent causes for secondary lens luxation were glaucoma (58 %), cataract (19 %) and trauma (17 %). This study shows the predisposition for primary lens luxations in terrier breeds, Chinese Crested dogs, Pinscher and Spitz. In contrast, Siberian Huskies, Basset Hounds, Bearded Collies, Cairn Terriers, mixed breed dogs, Bolonka Zwetna, Boston Terriers, Borzoi, Doberman, Eurasian, Leonberg, Luzerner Niederlaufhund and Weimaraner suffered significantly more often from secondary lens luxation. There was no sex predilection for primary or secondary lens luxation. Dogs with primary lens luxation were on average 7.39 ± 3.02 years old, which is significantly younger than the dogs with secondary lens luxation (9.12 ± 3.38 years). Dogs with primary lens luxation showed a significantly higher rate of a bilateral development than those with secondary lens luxation (85.5 % of the dogs with primary lens luxation and only 14.5 % of the dogs with secondary lens luxation showed it in both their eyes).
MicroRNA hsa-miR-134 is a circulating biomarker for mesial temporal lobe epilepsy.
Directory of Open Access Journals (Sweden)
Simoni H Avansini
Full Text Available Epilepsy is misdiagnosed in up to 25% of patients, leading to serious and long-lasting consequences. Recently, circulating microRNAs have emerged as potential biomarkers in a number of clinical scenarios. The purpose of this study was to identify and to validate circulating microRNAs that could be used as biomarkers in the diagnosis of epilepsy. Quantitative real-time PCR was used to measure plasma levels of three candidate microRNAs in two phases of study: an initial discovery phase with 14 patients with mesial temporal lobe epilepsy (MTLE, 13 with focal cortical dysplasia (FCD and 16 controls; and a validation cohort constituted of an independent cohort of 65 patients with MTLE and 83 controls. We found hsa-miR-134 downregulated in patients with MTLE (p = 0.018 but not in patients with FCD, when compared to controls. Furthermore, hsa-miR-134 expression could be used to discriminate MTLE patients with an area under the curve (AUC of 0.75. To further assess the robustness of hsa-miR-134 as a biomarker for MTLE, we studied an independent cohort of 65 patients with MTLE, 27 of whom MTLE patients were responsive to pharmacotherapy, and 38 patients were pharmacoresistant and 83 controls. We confirmed that hsa-miR-134 was significantly downregulated in the plasma of patients with MTLE when compared with controls (p < 0.001. In addition, hsa-miR-134 identified patients with MTLE regardless of their response to pharmacotherapy or the presence of MRI signs of hippocampal sclerosis. We revealed that decreased expression of hsa-miR-134 could be a potential non-invasive biomarker to support the diagnosis of patients with MTLE.
Energy Technology Data Exchange (ETDEWEB)
Bensafi, A; Borg, S [CETIAT, Centre Technique des Industries Aerauliques et Thermiques, 69 - Villeurbanne (France)
1998-12-31
A software for the dimensioning and simulation of flanged heat exchangers is presented. This software divides the exchanger into pipe sections in which local values of physical properties of fluids and thermal exchange coefficients are used, and for which individual thermal-hydraulic performances are determined. CYRANO can be used for condensers, evaporators and monophase exchanges, with refrigerants like water, R22, R134a and R32/R125/R134a mixtures. The software can be used also in the case of specified complex circuits, equipped with smooth or grooved pipes and with smooth continuous, corrugated or slatted flanges with non-homogeneous air temperature and velocity distributions. The validation of CYRANO was performed on 7 exchangers with and without humidity condensation on the flanges. Comparisons with test results show that the average of errors in exchanged powers is of about 5%, and of about 30% in the case of internal pressure drops. Some simulations of exchangers with HFC mixtures are also presented. (J.S.) 34 refs.
Energy Technology Data Exchange (ETDEWEB)
Bensafi, A.; Borg, S. [CETIAT, Centre Technique des Industries Aerauliques et Thermiques, 69 - Villeurbanne (France)
1997-12-31
A software for the dimensioning and simulation of flanged heat exchangers is presented. This software divides the exchanger into pipe sections in which local values of physical properties of fluids and thermal exchange coefficients are used, and for which individual thermal-hydraulic performances are determined. CYRANO can be used for condensers, evaporators and monophase exchanges, with refrigerants like water, R22, R134a and R32/R125/R134a mixtures. The software can be used also in the case of specified complex circuits, equipped with smooth or grooved pipes and with smooth continuous, corrugated or slatted flanges with non-homogeneous air temperature and velocity distributions. The validation of CYRANO was performed on 7 exchangers with and without humidity condensation on the flanges. Comparisons with test results show that the average of errors in exchanged powers is of about 5%, and of about 30% in the case of internal pressure drops. Some simulations of exchangers with HFC mixtures are also presented. (J.S.) 34 refs.
2010-01-01
... Administrative Law Judge. The AA/OHA will assign all other cases before OHA to either an Administrative Law Judge... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.218 Judges. (a) Assignment. The AA...
32 CFR 13.4 - Duties and responsibilities of the defense.
2010-07-01
... COMMISSIONS RESPONSIBILITIES OF THE CHIEF DEFENSE COUNSEL, DETAILED DEFENSE COUNSEL, AND CIVILIAN DEFENSE COUNSEL § 13.4 Duties and responsibilities of the defense. (a) Regular duties. The Defense shall perform... 32 National Defense 1 2010-07-01 2010-07-01 false Duties and responsibilities of the defense. 13.4...
Thermofluidic compression effects to achieve combustion in a low-compression scramjet engine
Moura, A. F.; Wheatley, V.; Jahn, I.
2017-12-01
The compression provided by a scramjet inlet is an important parameter in its design. It must be low enough to limit thermal and structural loads and stagnation pressure losses, but high enough to provide the conditions favourable for combustion. Inlets are typically designed to achieve sufficient compression without accounting for the fluidic, and subsequently thermal, compression provided by the fuel injection, which can enable robust combustion in a low-compression engine. This is investigated using Reynolds-averaged Navier-Stokes numerical simulations of a simplified scramjet engine designed to have insufficient compression to auto-ignite fuel in the absence of thermofluidic compression. The engine was designed with a wide rectangular combustor and a single centrally located injector, in order to reduce three-dimensional effects of the walls on the fuel plume. By varying the injected mass flow rate of hydrogen fuel (equivalence ratios of 0.22, 0.17, and 0.13), it is demonstrated that higher equivalence ratios lead to earlier ignition and more rapid combustion, even though mean conditions in the combustor change by no more than 5% for pressure and 3% for temperature with higher equivalence ratio. By supplementing the lower equivalence ratio with helium to achieve a higher mass flow rate, it is confirmed that these benefits are primarily due to the local compression provided by the extra injected mass. Investigation of the conditions around the fuel plume indicated two connected mechanisms. The higher mass flow rate for higher equivalence ratios generated a stronger injector bow shock that compresses the free-stream gas, increasing OH radical production and promoting ignition. This was observed both in the higher equivalence ratio case and in the case with helium. This earlier ignition led to increased temperature and pressure downstream and, consequently, stronger combustion. The heat release from combustion provided thermal compression in the combustor, further
Plant uptake of 134Cs in relation to soil properties and time
International Nuclear Information System (INIS)
Massas, I.; Skarlou, V.; Haidouti, C.
2002-01-01
134 Cs uptake by sunflower and soybean plants grown on seven different soils and its relation to soil properties were studied in a greenhouse pot experiment. Soil in each pot was contaminated by dripping the 134 Cs in layers, and sunflower and soybean plants were grown for three and two successive periods, respectively. 134 Cs plant uptake was expressed as the transfer factor (TF) (Bq kg -1 plant/Bq kg -1 soil) and as the daily plant uptake (flux) (Bq pot -1 day -1 ) taking into account biomass production and growth time. For the studied soils and for both plants, no consistent trend of TFs with time was observed. The use of fluxes, in general, provided less variable results than TFs and stronger functional relationships. A negative power functional relationship between exchangeable potassium plus ammonium cations expressed as a percentage of cation exchange capacity of each soil and 134 Cs fluxes was found for the sunflower plants. A similar but weaker relationship was observed for soybean plants. The significant correlation between sunflower and soybean TFs and fluxes, as well as the almost identical highest/lowest 134 Cs flux ratios, in the studied soils, indicated a similar effect of soil characteristics on 134 Cs uptake by both plants. In all the studied soils, sunflower 134 Cs TFs and fluxes were significantly higher than the respective soybean values, while no significant difference was observed in potassium content and daily potassium plant uptake (flux) of the two plants
A simple method for the deconvolution of 134 Cs/137 Cs peaks in gamma-ray scintillation spectrometry
International Nuclear Information System (INIS)
Darko, E.O.; Osae, E.K.; Schandorf, C.
1998-01-01
A simple method for the deconvolution of 134 Cs / 137 Cs peaks in a given mixture of 134 Cs and 137 Cs using Nal(TI) gamma-ray scintillation spectrometry is described. In this method the 795 keV energy of 134 Cs is used as a reference peak to calculate the activity of the 137 Cs directly from the measured peaks. Certified reference materials were measured using the method and compared with a high resolution gamma-ray spectrometry measurements. The results showed good agreement with the certified values. The method is very simple and does not need any complicated mathematics and computer programme to de- convolute the overlapping 604.7 keV and 661.6 keV peaks of 134 Cs and 137 Cs respectively. (author). 14 refs.; 1 tab., 2 figs
13 CFR 134.713 - When is the record closed?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When is the record closed? 134.713 Section 134.713 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...
A Compressive Superresolution Display
Heide, Felix; Gregson, James; Wetzstein, Gordon; Raskar, Ramesh; Heidrich, Wolfgang
2014-01-01
In this paper, we introduce a new compressive display architecture for superresolution image presentation that exploits co-design of the optical device configuration and compressive computation. Our display allows for superresolution, HDR, or glasses-free 3D presentation.
A Compressive Superresolution Display
Heide, Felix
2014-06-22
In this paper, we introduce a new compressive display architecture for superresolution image presentation that exploits co-design of the optical device configuration and compressive computation. Our display allows for superresolution, HDR, or glasses-free 3D presentation.
R-134a (1,1,1,2-Tetrafluoroethane) Inhalation Induced Reactive Airways Dysfunction Syndrome.
Doshi, Viral; Kham, Nang; Kulkarni, Shreedhar; Kapitan, Kent; Henkle, Joseph; White, Peter
2016-01-01
R-134a (1,1,1,2-tetrafluoroethane) is widely used as a refrigerant and as an aerosol propellant. Inhalation of R-134a can lead to asphyxia, transient confusion, and cardiac arrhythmias. We report a case of reactive airways dysfunction syndrome secondary to R-134a inhalation. A 60-year-old nonsmoking man without a history of lung disease was exposed to an air conditioner refrigerant spill while performing repairs beneath a school bus. Afterward, he experienced worsening shortness of breath with minimal exertion, a productive cough, and wheezing. He was also hypoxic. He was admitted to the hospital for further evaluation. Spirometry showed airflow obstruction with an FEV1 1.97 L (45% predicted). His respiratory status improved with bronchodilators and oral steroids. A repeat spirometry 2 weeks later showed improvement with an FEV1 2.5 L (60% predicted). Six months after the incident, his symptoms had improved, but he was still having shortness of breath on exertion and occasional cough.
Activity standardization of 134Cs and 137Cs
International Nuclear Information System (INIS)
Sochorová, Jana; Auerbach, Pavel
2014-01-01
The paper presents the results from a primary standardization of 137 Cs using two independent methods – efficiency tracing using PC-NaI coincidence and the TDCR method. The nuclides 60 Co and 134 Cs were used as the tracers. Primary standardization of the 134 Cs is also discussed. The efficiency extrapolation was carried out by measuring samples of varying mass and using the wet extrapolation method. The results obtained are in good agreement; the differences did not exceed 0.5%. The advantages, pitfalls and also possibilities for improvement of the procedures are discussed
42 CFR 410.134 - Provider qualifications.
2010-10-01
... after December 22, 2000: (a) Holds a bachelor's or higher degree granted by a regionally accredited college or university in the United States (or an equivalent foreign degree) with completion of the... PROGRAM SUPPLEMENTARY MEDICAL INSURANCE (SMI) BENEFITS Medical Nutrition Therapy § 410.134 Provider...
{sup 134}Cs in heather seed plants grown with and without mycorrhiza
Energy Technology Data Exchange (ETDEWEB)
Strandberg, M. [Risoe National Laboratory, DK-4000 Roskilde (Denmark); Johansson, M. [Department of Mycology, Botanical Institute, University of Copenhagen, Oester Farimagsgade 2D, DK-1353 Copenhagen K. (Denmark)
1988-08-01
Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of {sup 134}Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of {sup 134}Cs to the shoots than heather without mycorrhiza. As an average the concentration of {sup 134}Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of {sup 134}Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of {sup 134}Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)
Release and attenuation of fluorocarbons in landfills
DEFF Research Database (Denmark)
Kjeldsen, Peter; Scheutz, Charlotte
2003-01-01
Several halocarbons with very high global warming and ozone depleting potentials have been used as blowing agent for insulation foam in refrigerators and freezers. Many appliances are shredded after the end of their useful life. Release experiments carried out in the laboratory on insulation foam...... blown with CFC-11, HCFC-141b, HFC- 134a, and HFC-245fa revealed that most of the blowing agent is not released to the atmosphere during a six-week period following the shredding process. The fraction which is released in the six-week period is highly dependent on how fine the foam is shredded....... The residual blowing agent remaining after the six-week period may be very slowly released if the integrity of the foam particles with respect to diffusional properties is kept after disposal of the foam waste in landfills. Laboratory experiments simulating attenuation processes in the landfilled waste...
Preservation of renal blood flow by the antioxidant EUK-134 in LPS-treated pigs.
Magder, Sheldon; Parthenis, Dimitrios G; Ghouleh, Imad Al
2015-03-25
Sepsis is associated with an increase in reactive oxygen species (ROS), however, the precise role of ROS in the septic process remains unknown. We hypothesized that treatment with EUK-134 (manganese-3-methoxy N,N'-bis(salicyclidene)ethylene-diamine chloride), a compound with superoxide dismutase and catalase activity, attenuates the vascular manifestations of sepsis in vivo. Pigs were instrumented to measure cardiac output and blood flow in renal, superior mesenteric and femoral arteries, and portal vein. Animals were treated with saline (control), lipopolysaccharide (LPS; 10 µg·kg-1·h-1), EUK-134, or EUK-134 plus LPS. Results show that an LPS-induced increase in pulmonary artery pressure (PAP) as well as a trend towards lower blood pressure (BP) were both attenuated by EUK-134. Renal blood flow decreased with LPS whereas superior mesenteric, portal and femoral flows did not change. Importantly, EUK-134 decreased the LPS-induced fall in renal blood flow and this was associated with a corresponding decrease in LPS-induced protein nitrotyrosinylation in the kidney. PO2, pH, base excess and systemic vascular resistance fell with LPS and were unaltered by EUK-134. EUK-134 also had no effect on LPS-associated increase in CO. Interestingly, EUK-134 alone resulted in higher CO, BP, PAP, mean circulatory filling pressure, and portal flow than controls. Taken together, these data support a protective role for EUK-134 in the renal circulation in sepsis.
Mining and global environmental challenges
Energy Technology Data Exchange (ETDEWEB)
Greeff, J C; Bailey-McEwan, M [Chamber of Mines of South Africa, Johannesburg (South Africa)
1992-04-01
At least half of South Africa's gold production is presently dependent on CFC11 an CFC12 as refrigerants in water chilling machines used in cooling the underground workings. The South African Government will ratify the revised Montreal Protocol on substances that deplete the ozone layer which will mean CFCs will have to be phased out probably by 1997. HFC134 or HFC22 are possible replacements for CFC but present costs of converting machines are high. The article goes on to discuss the contribution of CFCs and CO{sub 2} to global warming and model simulations and predictions of climate change. Likely effects of growing concern about global warming on the coal mining industry are the possible limitations on the use of coal and the increased need for clean coal technology. 12 refs., 5 figs., 3 tabs.
A novel Carnot-based cycle for ocean thermal energy conversion
International Nuclear Information System (INIS)
Semmari, Hamza; Stitou, Driss; Mauran, Sylvain
2012-01-01
A thermodynamic engine cycle can be implemented by exploiting the temperature difference existing between the warm surface seawater and cold deep seawater. It employs a working fluid that evaporates by warm seawater, produces work in an expander device, such as a gas turbine and finally condenses by cold deep seawater. A new Carnot-based cycle for OTEC applications, called CAPILI cycle is presented. In this new engine cycle, work is produced by the movement of an inert liquid through a hydraulic turbine. This inert liquid characterized by a very low saturation pressure and immiscibility with the working fluid, acts as a liquid piston that moves alternately between two insulated cylinders. The insulated cylinders are connected alternately to an evaporator and a condenser, each of them operates at different pressure and temperature levels. A performance study which consists in a steady state energy balance is realised first to select the most suitable working fluid for this specific application. It was found that the best fluid is the HFC refrigerant R134a. A dynamic modelling based on the concept of equivalent Gibbs system is carried out to appreciate the dynamic behaviour and the performances of this new thermal conversion process. -- Highlights: ► A novel Carnot-based cycle operating with a liquid piston is investigated for OTEC application. ► The most suitable working fluid giving the best performances is found to be the HFC R134a. ► The performances of this new thermal process are evaluated using a dynamic modelling. ► A thermal efficiency of 1.9% can be obtained by exploiting seawater temperature difference of 20 °C. ► A net cycle efficiency of 1.2% is achieved considering a net to gross power production ratio of 61%.
DNABIT Compress – Genome compression algorithm
Rajarajeswari, Pothuraju; Apparao, Allam
2011-01-01
Data compression is concerned with how information is organized in data. Efficient storage means removal of redundancy from the data being stored in the DNA molecule. Data compression algorithms remove redundancy and are used to understand biologically important molecules. We present a compression algorithm, “DNABIT Compress” for DNA sequences based on a novel algorithm of assigning binary bits for smaller segments of DNA bases to compress both repetitive and non repetitive DNA sequence. Our ...
International Nuclear Information System (INIS)
Stevens, G.F.; Elliott, D.F.; Wood, R.W.
1965-05-01
Some correlations of forced convection burn-out data are based on the approximate linearity of the relationship between burn-out heat flux and the channel-averaged quality at the burn-out point. These correlations perform satisfactorily on data obtained from uniformly heated configurations. Therefore the further inference is sometimes made that the burn-out heat flux is uniquely related to the quality, and that the burn-out in non-uniformly heated configurations can be calculated from measurements made with uniform heating. This report presents burn-out data for Freon 12 flowing vertically upwards through both uniformly and non-uniformly heated round tubes. This data shows that the quality at burn-out does depend on the heat flux profile, and that the inference mentioned above is not justified. (author)
Directory of Open Access Journals (Sweden)
Fanggang Bi
Full Text Available We examined whether intermittent administration of parathyroid hormone [1-34] (PTH[1-34]; 60 μg/kg/day can prevent the negative effects of titanium (Ti particles on implant fixation and periprosthetic osteolysis in a rat model. Eighteen adult male rats (12 weeks old, bones still growing received intramedullary Ti implants in their bilateral femurs; 6 rats from the blank group received vehicle injections, and 12 rats from the control group and PTH treatment group received Ti particle injections at the time of operation and intra-articular injections 2 and 4 weeks postoperatively. Six of the rats that received Ti particles from the PTH group also received PTH[1-34] treatment. Six weeks postoperatively, all specimens were collected for assessment by X-ray, micro-CT, biomechanical, scanning electron microscopy (SEM, and dynamic histomorphometry. A lower BMD, BV/TV, Tb.N, maximal fixation strength, and mineral apposition rate were observed in the control group compared to the blank group, demonstrating that a periprosthetic osteolysis model had been successfully established. Administration of PTH[1-34] significantly increased the bone mineral density of the distal femur, BV/TV, Tb.N, Tb.Th, Tb.Sp, Con.D, SMI, and maximal fixation strength in the PTH group compared to that in the control group. SEM revealed higher bone-implant contact, thicker lamellar bone, and larger trabecular bone area in the PTH group than in the control group. A higher mineral apposition rate was observed in the PTH group compared to both the blank and control groups. These findings imply that intermittent administration of PTH[1-34] prevents periprosthetic osteolysis by promoting bone formation. The effects of PTH[1-34] were evaluated at a suprapharmacological dosage to the human equivalent in rats; therefore, additional studies are required to demonstrate its therapeutic potential in periprosthetic osteolysis.
Czech Academy of Sciences Publication Activity Database
Klomfar, Jaroslav; Součková, Monika; Pátek, Jaroslav
2013-01-01
Roč. 58, č. 8 (2013), s. 2316-2325 ISSN 0021-9568 R&D Projects: GA ČR GA101/09/0010 Institutional support: RVO:61388998 Keywords : surface tension * density * HFC-365mfc * HFE-347mcc Subject RIV: BJ - Thermodynamics Impact factor: 2.045, year: 2013
13 CFR 134.407 - Evidence beyond the record and discovery.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence beyond the record and discovery. 134.407 Section 134.407 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF..., the Administrative Law Judge may not admit evidence beyond the written administrative record nor...
The accumulation of 134Cs in heart and skeletal muscle of healthy and dystrophic hamsters
International Nuclear Information System (INIS)
Szentkuti, L.; Breitrueck, H.; Giese, W.
1976-01-01
he accumulation of cesium-134 in heart and skeletal muscle of healthy and dystrophic hamsters was compared. It was lower in dystrophic hamsters than in normal ones after only a single dose of cesium-134. The 134 Cs-concentrations of heart and 'red' skeletal muscle were different between normal and dystrophic hamsters. When the isotope had equilibrated in the animals differences in 134 Cs-accumulation in muscle tissue between normal and dystrophic hamsters were even more obvious. The faster elimination of cesium-134 from the body as affected by muscular dystrophy was due to a reduction of 134 Cs-accumulation in muscle tissue. The reduced ability of damaged muscles to accumulate Cs-ions offers the possibility to use Cs-isotopes in diagnosis of skeletal muscle dystrophy. (author)
19 CFR 122.134 - When airline does not have in-bond liquor storeroom.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline does not have in-bond liquor storeroom. 122.134 Section 122.134 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.134 When airline does not have in-bond liquor storeroom. (a...
Evaluation of a new image compression technique
International Nuclear Information System (INIS)
Algra, P.R.; Kroon, H.M.; Noordveld, R.B.; DeValk, J.P.J.; Seeley, G.W.; Westerink, P.H.
1988-01-01
The authors present the evaluation of a new image compression technique, subband coding using vector quantization, on 44 CT examinations of the upper abdomen. Three independent radiologists reviewed the original images and compressed versions. The compression ratios used were 16:1 and 20:1. Receiver operating characteristic analysis showed no difference in the diagnostic contents between originals and their compressed versions. Subjective visibility of anatomic structures was equal. Except for a few 20:1 compressed images, the observers could not distinguish compressed versions from original images. They conclude that subband coding using vector quantization is a valuable method for data compression in CT scans of the abdomen
Microscopic structure of liquid 1-1-1-2-tetrafluoroethane (R134a) from Monte Carlo simulation.
Do, Hainam; Wheatley, Richard J; Hirst, Jonathan D
2010-10-28
1-1-1-2-tetrafluoroethane (R134a) is one of the most commonly used refrigerants. Its thermophysical properties are important for evaluating the performance of refrigeration cycles. These can be obtained via computer simulation, with an insight into the microscopic structure of the liquid, which is not accessible to experiment. In this paper, vapour-liquid equilibrium properties of R134a and its liquid microscopic structure are investigated using coupled-decoupled configurational-bias Monte Carlo simulation in the Gibbs ensemble, with a recent potential [J. Phys. Chem. B 2009, 113, 178]. We find that the simulations agree well with the experimental data, except at the vicinity of the critical region. Liquid R134a packs like liquid argon, with a coordination number in the first solvation shell of 12 at 260 K. The nearest neighbours prefer to be localized in three different spaces around the central molecule, in such a manner that the dipole moments are in a parallel alignment. Analysis of the pair interaction energy shows clear association of R134a molecules, but no evidence for C-HF type hydrogen bonding is found. The above findings should be of relevance to a broad range of fluoroalkanes.
27 CFR 17.134 - Determination of unfitness for beverage purposes.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Determination of unfitness for beverage purposes. 17.134 Section 17.134 Alcohol, Tobacco Products and Firearms ALCOHOL AND... an alcoholic concentration of 15% and tasted. Sale or use for beverage purposes is indicative of...
International Nuclear Information System (INIS)
Green, W.J.; Stevens, J.R.
1981-08-01
Experiments have been performed using vertical heated tubes, cooled internally by Freon-12, to determine critical heat fluxes (CHFs) for both a uniformly heated section and an exit region with a separately controlled power supply. Heated lengths of the main separately were 2870 mm (8.48 and 16.76 mm tube bores) and 3700 mm (for 21.34 mm tube bore); heated length of the exit section was 230 mm. Coolant pressures, exit qualities and mass fluxes were in the range 0.9 to 1.3 MPa, 0.19 to 0.86, and 380 to 2800 kg m -2 s -1 , respectively. The data have been compared with published empirical correlations specifically formulated to predict CHFs in Freon-cooled, vertical tubes; relevant published CHF data have also been compared with these correlations. These comparisons show that, even over the ranges of conditions for which the correlations were developed, predicted values are only accurate to within +-20 per cent. Moreover, as mass fluxes increase above 3500 kg m -2 s -1 , the modified Groeneveld correlation becomes increasingly inadequate, and the Bertoletti and modified Bertoletti correlations under-predict CHF values by increasing amounts. At mass fluxes below 750 kg m -2 s -1 the Bertoletti correlations exhibit increasing inaccuracy with a decrease in mass flux. For non-uniform heating, the correlations are at variance with the experimental data
Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134.
Kaneko, Mika K; Yamada, Shinji; Itai, Shunsuke; Chang, Yao-Wen; Nakamura, Takuro; Yanaka, Miyuki; Kato, Yukinari
2018-07-01
The epidermal growth factor receptor (EGFR) is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb), which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7%) to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA), flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375-394 amino acids of EGFR) neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377- RGDSFTHTPP -386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.
10 CFR 60.134 - Design of seals for shafts and boreholes.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Design of seals for shafts and boreholes. 60.134 Section....134 Design of seals for shafts and boreholes. (a) General design criterion. Seals for shafts and... closure. (b) Selection of materials and placement methods. Materials and placement methods for seals shall...
13 CFR 134.708 - What is the standard of review?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is the standard of review? 134.708 Section 134.708 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea
International Nuclear Information System (INIS)
Zhu Cong; Guo Jiangfeng
2008-01-01
Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)
Energy Technology Data Exchange (ETDEWEB)
Shrestha, Som [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sharma, Vishaldeep [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Abdelaziz, Omar [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2014-02-18
This report investigates the tested performance of lower - GWP candidate refrigerant, 94.07 wt% R - 32 + 5.93 wt % R - 134 a mixture (hereafter referred to as R - 32/134a), as an alternative to baseline refrigerant R - 410 A using a 36,000 Btu/hr compressor calorimeter located at the Heat Exchanger Advanced Testing Facility at Oak Ridge National Laboratory . These tests were conducted during May and August 2013. R - 410A is a near - azeotropic blend of R - 32 and R - 125 with 0.5/0.5 mass fraction and has a GWP 100 of 2100. R - 32 and R - 134a are pure refrigerants and have GWP 100 of 716 and 1370 1, respectively. Based on the GWP 100 values of pure refrigerants and their mass fraction in the blend, GWP 100 of R - 32/134a, which is under development by National Refrigerant, is 755. This report compares various performance parameters, such as cooling capacity, compressor power, refrigerant mass flow rate, EER, isentropic efficiency and discharge temperature of the alternative refrigerant to that of R - 410 A.
33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...
Energy Technology Data Exchange (ETDEWEB)
Higashi, Y.
1999-09-01
The plane of vapor-liquid criticality for ternary refrigerant mixtures of difluoromethane (R-32) + pentafluoroethane (R-125) + 1,1,1,2-tetrafluoroethane (R-134a) was determined from data on the vapor-liquid coexistence curve near the mixture critical points. The composition (mass percentage) of the mixtures studied were 23% R-32 + 25% R-125 + 52% R-134a (R-407C). 25% R-32 + 15% R-125 + 60% R-134a (R-407E), and 20% R-32 + 40% R-125 + 40% R-134a (R-407A). The critical temperature of each mixture was determined by observation of the disappearance of the meniscus. The critical density of each mixture was determined on the basis of meniscus disappearance level and the intensity of the critical opalescence. The uncertainties of the temperature, density, and composition measurements are estimated as {+-}10mK, {+-}5kg{center_dot}m{sup {minus}3}, and {+-}0.05%, respectively. In addition, predictive methods for the critical parameters of R-32/125/134a mixtures are discussed.
Comparative data compression techniques and multi-compression results
International Nuclear Information System (INIS)
Hasan, M R; Ibrahimy, M I; Motakabber, S M A; Ferdaus, M M; Khan, M N H
2013-01-01
Data compression is very necessary in business data processing, because of the cost savings that it offers and the large volume of data manipulated in many business applications. It is a method or system for transmitting a digital image (i.e., an array of pixels) from a digital data source to a digital data receiver. More the size of the data be smaller, it provides better transmission speed and saves time. In this communication, we always want to transmit data efficiently and noise freely. This paper will provide some compression techniques for lossless text type data compression and comparative result of multiple and single compression, that will help to find out better compression output and to develop compression algorithms
A statistical–mechanical view on source coding: physical compression and data compression
International Nuclear Information System (INIS)
Merhav, Neri
2011-01-01
We draw a certain analogy between the classical information-theoretic problem of lossy data compression (source coding) of memoryless information sources and the statistical–mechanical behavior of a certain model of a chain of connected particles (e.g. a polymer) that is subjected to a contracting force. The free energy difference pertaining to such a contraction turns out to be proportional to the rate-distortion function in the analogous data compression model, and the contracting force is proportional to the derivative of this function. Beyond the fact that this analogy may be interesting in its own right, it may provide a physical perspective on the behavior of optimum schemes for lossy data compression (and perhaps also an information-theoretic perspective on certain physical system models). Moreover, it triggers the derivation of lossy compression performance for systems with memory, using analysis tools and insights from statistical mechanics
International Nuclear Information System (INIS)
Rahmani, R.
1983-01-01
The nucleate boiling heat-transfer coefficient and the maximum heat flux were studied experimentally as functions of velocity, quality and heater diameter for single-phase flow, and two-phase flow of Freon-113 (trichlorotrifluorethane). Results show: (1) peak heat flux: over 300 measured peak heat flux data from two 0.875-in. and four 0.625-in.-diameter heaters indicated that: (a) for pool boiling, single-phase and two-phase forced convection boiling the only parameter (among hysteresis, rate of power increase, aging, presence and proximity of unheated rods) that has a statistically significant effect on the peak heat flux is the velocity. (b) In the velocity range (0 0 position or the point of impact of the incident fluid) and the top (180 0 position) of the test element, respectively
Sulfur Bridged Multidentate Ligands Based on (Bipyridyl-(Bi-1,3,4-Thiadiazolyl Conjugates
Directory of Open Access Journals (Sweden)
M. Teresa Clasadonte
2003-03-01
Full Text Available The synthesis of a series of mixed (bipyridyl/(bi1,3,4-thiadiazolyl ligands, derived from the condensation of 2-mercapto-5-methylthio-1,3,4-thiadiazole or 5-mercapto-5'-methylthio-2,2'-bi-1,3,4-thiadiazole with 2,6-bis(chloromethylpyridine or 6,6’-bis(chloromethyl-2,2’-bipyridine (compounds L1–L4, and of 2,5-dimercapto-1,3,4-thiadiazole or 5,5'-dimercapto-2,2'-di-1,3,4-thiadiazole with picolyl chloride hydrochloride or 6-chloromethyl-6'-methyl-2,2'-bipyridine (compounds L5–L8 in the presence of triethylamine is described. All new compounds have been characterized by FAB (+ spectrometry and NMR spectroscopy. 13C-NMR spectra are crucial to firmly establish the thiol structure of the title ligands.
Indirect phase transition of TiC, ZrC, and HfC crystal structures
Energy Technology Data Exchange (ETDEWEB)
Abavare, Eric K.K.; Dodoo, Samuel N.A. [Department of Physics, Kwame Nkrumah University of Science and Technology, Kumasi (Ghana); Uchida, Kazuyuki; Oshiyama, Atsushi [Department of Applied Physics, The University of Tokyo, Hongo, Tokyo (Japan); Nkurumah-Buandoh, George K.; Yaya, Abu [Department of Physics, University of Ghana, Legon (Ghana)
2016-06-15
We have performed first-principles calculations to analyze the electronic structures, static, and dynamical structural stabilities of the pressure-induced phase transformation of refractory compounds (transition-metal carbides) from NaCl-type (B1) to CsCl-type (B2) via zinc-blende phase using the plane-wave pseudopotential approach in the framework of the generalized gradient approximation (GGA) for the exchange and correlation functional. The ground-state properties, equilibrium lattice constant, bulk moduli, and band structures are determined for the stoichiometry of the compounds and compared with known experimental and theoretical values. We find that the phase-transition pressure for the indirect phase transition from B1→B2 via zinc-blende structure is about 17-fold for TiC, 12-fold for both ZrC and HfC, respectively, when compared with the direct phase transition. Calculated phonon instability exists for the CsCl-B2 phase, which can prevent the structures from forming and contrary to the zinc-blende and the NaCl-B1 phases. The band dispersion and electronic density of states for B1 and B2 crystal phases were explored and found to indicate metallic character in contrast with the zinc-blende phase, which has a pseudogap opening in the bandgap region suggesting a semiconducting property and also a frequency gap in the phonon spectrum. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134
Directory of Open Access Journals (Sweden)
Mika K. Kaneko
2018-07-01
Full Text Available The epidermal growth factor receptor (EGFR is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb, which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7% to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA, flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375–394 amino acids of EGFR neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377-RGDSFTHTPP−386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.
Transfer factors of 134Cs for olive and orange trees grown on different soils
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.; Papanicolaou, E.
1999-01-01
Transfer factors (TF) of 134 Cs to olive and citrus trees grown on two different soils, were determined for a 3-year greenhouse experiment. Two-year-old trees were transplanted with their entire rootball into large pots containing the contaminated soil (110 kg pot -1 ). The soil was transferred to each pot in layers on the top of which 134 Cs as CsCl was dripped (18.5 MBq pot -1 ). For both evergreen trees, soil type significantly influenced radiocaesium transfer. 134 Cs concentration was lower for the calcareous-heavy soil than for the acid-light soil. Transfer factors of orange trees were higher than those of olive trees in the acid-light soil. Although a significant amount of 134 Cs was measured in olives grown on the acid-light soil, no 134 Cs was detected in the unprocessed olive oil when an oil fraction (5% f.w.) was extracted. On the contrary the edible part of the oranges showed the highest 134 Cs concentration of all plant parts. The relationship between 134 Cs uptake and potassium content in the different plant compartments was also studied when selected trees were cut down. The potassium concentration in the plants was not significantly different between the trees growing in the two types of soil in spite of the big differences in the 134 Cs uptake in the two soils. TF values and potassium content in the different plant compartments of each tree were highly correlated. For both crops transfer factors as well as potassium content were the highest in the developing plant parts (new leaves and branches, flowers). The transfer factors of 134 Cs for the studied trees are in the same order of magnitude as the values of annual crops grown under similar conditions. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)
Johnson, Jennifer L; He, Jing; Ramadass, Mahalakshmi; Pestonjamasp, Kersi; Kiosses, William B; Zhang, Jinzhong; Catz, Sergio D
2016-02-12
The small GTPase Rab11 and its effectors control trafficking of recycling endosomes, receptor replenishment and the up-regulation of adhesion and adaptor molecules at the plasma membrane. Despite recent advances in the understanding of Rab11-regulated mechanisms, the final steps mediating docking and fusion of Rab11-positive vesicles at the plasma membrane are not fully understood. Munc13-4 is a docking factor proposed to regulate fusion through interactions with SNAREs. In hematopoietic cells, including neutrophils, Munc13-4 regulates exocytosis in a Rab27a-dependent manner, but its possible regulation of other GTPases has not been explored in detail. Here, we show that Munc13-4 binds to Rab11 and regulates the trafficking of Rab11-containing vesicles. Using a novel Time-resolved Fluorescence Resonance Energy Transfer (TR-FRET) assay, we demonstrate that Munc13-4 binds to Rab11a but not to dominant negative Rab11a. Immunoprecipitation analysis confirmed the specificity of the interaction between Munc13-4 and Rab11, and super-resolution microscopy studies support the interaction of endogenous Munc13-4 with Rab11 at the single molecule level in neutrophils. Vesicular dynamic analysis shows the common spatio-temporal distribution of Munc13-4 and Rab11, while expression of a calcium binding-deficient mutant of Munc13-4 significantly affected Rab11 trafficking. Munc13-4-deficient neutrophils showed normal endocytosis, but the trafficking, up-regulation, and retention of Rab11-positive vesicles at the plasma membrane was significantly impaired. This correlated with deficient NADPH oxidase activation at the plasma membrane in response to Rab11 interference. Our data demonstrate that Munc13-4 is a Rab11-binding partner that regulates the final steps of Rab11-positive vesicle docking at the plasma membrane. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Chung, Tae Nyoung; Bae, Jinkun; Kim, Eui Chung; Cho, Yun Kyung; You, Je Sung; Choi, Sung Wook; Kim, Ok Jun
2013-07-01
Recent studies have shown that there may be an interaction between duty cycle and other factors related to the quality of chest compression. Duty cycle represents the fraction of compression phase. We aimed to investigate the effect of shorter compression phase on average chest compression depth during metronome-guided cardiopulmonary resuscitation. Senior medical students performed 12 sets of chest compressions following the guiding sounds, with three down-stroke patterns (normal, fast and very fast) and four rates (80, 100, 120 and 140 compressions/min) in random sequence. Repeated-measures analysis of variance was used to compare the average chest compression depth and duty cycle among the trials. The average chest compression depth increased and the duty cycle decreased in a linear fashion as the down-stroke pattern shifted from normal to very fast (pmetronome-guided cardiopulmonary resuscitation.
Münster, Tobias; Stosch, Christoph; Hindrichs, Nina; Franklin, Jeremy; Matthes, Jan
2016-01-01
The external chest compression is a very important skill required to maintain a minimum of circulation during cardiac arrest until further medical procedures can be taken. Peyton's 4-Steps-Approach is one method of skill training, the four steps being: Demonstration, Deconstruction, Comprehension and Execution. Based on CPR skill training, this method is widely, allegedly predominantly used, although there are insufficient studies on Peyton's 4-Steps-Approach for skill training in CPR in comparison with other methods of skill training. In our study, we compared the medium- term effects on learning external chest compression with a CPR training device in three different groups: PEY (Peyton's 4-Steps-Approach), PMOD (Peyton's 4-Steps-Approach without Step 3) and STDM, the standard model, according to the widely spread method "see one, do one" (this is equal to Peyton's step 1 and 3). This prospective and randomised pilot study took place during the summer semester of 2009 at the SkillsLab and Simulation Centre of the University of Cologne (Kölner interprofessionelles Skills Lab und Simulationszentrum - KISS). The subjects were medical students (2(nd) and 3(rd) semester). They volunteered for the study and were randomised in three parallel groups, each receiving one of the teaching methods mentioned above. One week and 5/6 months after the intervention, an objective, structured single assessment was taken. Compression rate, compression depth, correct compressions, and the sum of correct checklist items were recorded. Additionally, we compared cumulative percentages between the groups based on the correct implementation of the resuscitation guidelines during that time. The examined sample consisted of 134 subjects (68% female; age 22±4; PEY: n=62; PMOD: n=31; STDM: n=41). There was no difference between the groups concerning age, gender, pre-existing experience in CPR or time of last CPR course. The only significant difference between the groups was the mean
Directory of Open Access Journals (Sweden)
Xiangwei Li
2014-12-01
Full Text Available Compressive Sensing Imaging (CSI is a new framework for image acquisition, which enables the simultaneous acquisition and compression of a scene. Since the characteristics of Compressive Sensing (CS acquisition are very different from traditional image acquisition, the general image compression solution may not work well. In this paper, we propose an efficient lossy compression solution for CS acquisition of images by considering the distinctive features of the CSI. First, we design an adaptive compressive sensing acquisition method for images according to the sampling rate, which could achieve better CS reconstruction quality for the acquired image. Second, we develop a universal quantization for the obtained CS measurements from CS acquisition without knowing any a priori information about the captured image. Finally, we apply these two methods in the CSI system for efficient lossy compression of CS acquisition. Simulation results demonstrate that the proposed solution improves the rate-distortion performance by 0.4~2 dB comparing with current state-of-the-art, while maintaining a low computational complexity.
Radiologic image compression -- A review
International Nuclear Information System (INIS)
Wong, S.; Huang, H.K.; Zaremba, L.; Gooden, D.
1995-01-01
The objective of radiologic image compression is to reduce the data volume of and to achieve a lot bit rate in the digital representation of radiologic images without perceived loss of image quality. However, the demand for transmission bandwidth and storage space in the digital radiology environment, especially picture archiving and communication systems (PACS) and teleradiology, and the proliferating use of various imaging modalities, such as magnetic resonance imaging, computed tomography, ultrasonography, nuclear medicine, computed radiography, and digital subtraction angiography, continue to outstrip the capabilities of existing technologies. The availability of lossy coding techniques for clinical diagnoses further implicates many complex legal and regulatory issues. This paper reviews the recent progress of lossless and lossy radiologic image compression and presents the legal challenges of using lossy compression of medical records. To do so, the authors first describe the fundamental concepts of radiologic imaging and digitization. Then, the authors examine current compression technology in the field of medical imaging and discuss important regulatory policies and legal questions facing the use of compression in this field. The authors conclude with a summary of future challenges and research directions. 170 refs
[Overexpressed miRNA-134b inhibits proliferation and invasion of CD133+ U87 glioma stem cells].
Liu, Yifeng; Zhang, Baochao; Wen, Changming; Wen, Gongling; Zhou, Guoping; Zhang, Jingwei; He, Haifa; Wang, Ning; Li, Wei
2017-05-01
Objective To investigate the role of microRNA-134b (miR-134b) in the tumorigenesis of glioma stem cells (GSCs) and the possible molecular mechanism. Methods Real-time quantitative PCR (qRT-PCR) was used to evalate the expression of miR-134b in CD133 + and CD133 - U87 GSCs. A lentiviral vector overexpressing miR-134b in U87 GSCs was constructed, and the effect of miR-134b overexpression on matrix metalloproteinase-2 (MMP-2), MMP-9 and MMP-12 expressions at both mRNA and protein levels were detected by qRT-PCR and Western blotting, respectively. Transwell TM assay was performed to determine the effect of miR-134b overexpression on GSCs invasion ability. Tumor xenograft models in nude mice were established to evaluate the effect of miR-134b overexpression on tumorgenesis in vivo. Results The qRT-PCR showed that, compared with CD133 - cells, miR-134b was significantly down-regulated in CD133 + cells. Cell line over-expressing miR-134b was successfully established, and miR-134b was up-regulated significantly compared with empty vector control. Overexpression of miR-134b remarkably inhibited the invasion of U87 GSCs and the expression of MMP-12. However, overexpression of miR-134b did not affect MMP-2 and MMP-9 expressions. miR-134b also suppressed U87 GSCs xenograft growth in vivo. Tumor volume in tumor xenograft model group was significantly lower than that in control group, and tumor weight decreased by 42% in the former group. Conclusion Overexpression of miR-134b inhibits the growth and invasion of CD133 + GSCs.
Selecting a general-purpose data compression algorithm
Mathews, Gary Jason
1995-01-01
The National Space Science Data Center's Common Data Formate (CDF) is capable of storing many types of data such as scalar data items, vectors, and multidimensional arrays of bytes, integers, or floating point values. However, regardless of the dimensionality and data type, the data break down into a sequence of bytes that can be fed into a data compression function to reduce the amount of data without losing data integrity and thus remaining fully reconstructible. Because of the diversity of data types and high performance speed requirements, a general-purpose, fast, simple data compression algorithm is required to incorporate data compression into CDF. The questions to ask are how to evaluate and compare compression algorithms, and what compression algorithm meets all requirements. The object of this paper is to address these questions and determine the most appropriate compression algorithm to use within the CDF data management package that would be applicable to other software packages with similar data compression needs.
Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134
International Nuclear Information System (INIS)
Ballestra, S.; Gastaud, J.; Lopez, J.J.; Parsi, P.; Vas, D.
1993-08-01
The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for 40 K, 60 Co, 137 Cs, and 2 39+240 Pu (Reference date: 1 January 1992). Information values for 90 Sr, 106 Ru, 125 Sb, 134 Cs, 154 Eu, 155 Eu, 210 Pb, 210 Po, 226 Ra, 228 Ra, 228 Th, 230 Th, 232 Th, 234 U, 235 U, 238 U, 238 Pu and 241 Am are also reported. All the following values are expressed in Bq kg -1 (dry weight). (author)
Directory of Open Access Journals (Sweden)
Athanasios Lykidis
Full Text Available BACKGROUND: Cupriavidus necator JMP134 is a Gram-negative beta-proteobacterium able to grow on a variety of aromatic and chloroaromatic compounds as its sole carbon and energy source. METHODOLOGY/PRINCIPAL FINDINGS: Its genome consists of four replicons (two chromosomes and two plasmids containing a total of 6631 protein coding genes. Comparative analysis identified 1910 core genes common to the four genomes compared (C. necator JMP134, C. necator H16, C. metallidurans CH34, R. solanacearum GMI1000. Although secondary chromosomes found in the Cupriavidus, Ralstonia, and Burkholderia lineages are all derived from plasmids, analyses of the plasmid partition proteins located on those chromosomes indicate that different plasmids gave rise to the secondary chromosomes in each lineage. The C. necator JMP134 genome contains 300 genes putatively involved in the catabolism of aromatic compounds and encodes most of the central ring-cleavage pathways. This strain also shows additional metabolic capabilities towards alicyclic compounds and the potential for catabolism of almost all proteinogenic amino acids. This remarkable catabolic potential seems to be sustained by a high degree of genetic redundancy, most probably enabling this catabolically versatile bacterium with different levels of metabolic responses and alternative regulation necessary to cope with a challenging environment. From the comparison of Cupriavidus genomes, it is possible to state that a broad metabolic capability is a general trait for Cupriavidus genus, however certain specialization towards a nutritional niche (xenobiotics degradation, chemolithoautotrophy or symbiotic nitrogen fixation seems to be shaped mostly by the acquisition of "specialized" plasmids. CONCLUSIONS/SIGNIFICANCE: The availability of the complete genome sequence for C. necator JMP134 provides the groundwork for further elucidation of the mechanisms and regulation of chloroaromatic compound biodegradation.
Compression device for feeding a waste material to a reactor
Williams, Paul M.; Faller, Kenneth M.; Bauer, Edward J.
2001-08-21
A compression device for feeding a waste material to a reactor includes a waste material feed assembly having a hopper, a supply tube and a compression tube. Each of the supply and compression tubes includes feed-inlet and feed-outlet ends. A feed-discharge valve assembly is located between the feed-outlet end of the compression tube and the reactor. A feed auger-screw extends axially in the supply tube between the feed-inlet and feed-outlet ends thereof. A compression auger-screw extends axially in the compression tube between the feed-inlet and feed-outlet ends thereof. The compression tube is sloped downwardly towards the reactor to drain fluid from the waste material to the reactor and is oriented at generally right angle to the supply tube such that the feed-outlet end of the supply tube is adjacent to the feed-inlet end of the compression tube. A programmable logic controller is provided for controlling the rotational speed of the feed and compression auger-screws for selectively varying the compression of the waste material and for overcoming jamming conditions within either the supply tube or the compression tube.
30 CFR 75.1730 - Compressed air; general; compressed air systems.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Compressed air; general; compressed air systems... Compressed air; general; compressed air systems. (a) All pressure vessels shall be constructed, installed... Safety and Health district office. (b) Compressors and compressed-air receivers shall be equipped with...
13 CFR 134.712 - What are the limitations on new evidence?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the limitations on new evidence? 134.712 Section 134.712 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
13 CFR 134.706 - What are the service and filing requirements?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the service and filing requirements? 134.706 Section 134.706 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
MicroRNA-134 as a potential plasma biomarker for the diagnosis of acute pulmonary embolism
Directory of Open Access Journals (Sweden)
Liu Yi
2011-09-01
Full Text Available Abstract Background Acute pulmonary embolism (APE remains a diagnostic challenge due to a variable clinical presentation and the lack of a reliable screening tool. MicroRNAs (miRNAs regulate gene expression in a wide range of pathophysiologic processes. Circulating miRNAs are emerging biomarkers in heart failure, type 2 diabetes and other disease states; however, using plasma miRNAs as biomarkers for the diagnosis of APE is still unknown. Methods Thirty-two APE patients, 32 healthy controls, and 22 non-APE patients (reported dyspnea, chest pain, or cough were enrolled in this study. The TaqMan miRNA microarray was used to identify dysregulated miRNAs in the plasma of APE patients. The TaqMan-based miRNA quantitative real-time reverse transcription polymerase chain reactions were used to validate the dysregulated miRNAs. The receiver-operator characteristic (ROC curve analysis was conducted to evaluate the diagnostic accuracy of the miRNA identified as the candidate biomarker. Results Plasma miRNA-134 (miR-134 level was significantly higher in the APE patients than in the healthy controls or non-APE patients. The ROC curve showed that plasma miR-134 was a specific diagnostic predictor of APE with an area under the curve of 0.833 (95% confidence interval, 0.737 to 0.929; P Conclusions Our findings indicated that plasma miR-134 could be an important biomarker for the diagnosis of APE. Because of this finding, large-scale investigations are urgently needed to pave the way from basic research to clinical utilization.
A New Approach for Fingerprint Image Compression
Energy Technology Data Exchange (ETDEWEB)
Mazieres, Bertrand
1997-12-01
The FBI has been collecting fingerprint cards since 1924 and now has over 200 million of them. Digitized with 8 bits of grayscale resolution at 500 dots per inch, it means 2000 terabytes of information. Also, without any compression, transmitting a 10 Mb card over a 9600 baud connection will need 3 hours. Hence we need a compression and a compression as close to lossless as possible: all fingerprint details must be kept. A lossless compression usually do not give a better compression ratio than 2:1, which is not sufficient. Compressing these images with the JPEG standard leads to artefacts which appear even at low compression rates. Therefore the FBI has chosen in 1993 a scheme of compression based on a wavelet transform, followed by a scalar quantization and an entropy coding : the so-called WSQ. This scheme allows to achieve compression ratios of 20:1 without any perceptible loss of quality. The publication of the FBI specifies a decoder, which means that many parameters can be changed in the encoding process: the type of analysis/reconstruction filters, the way the bit allocation is made, the number of Huffman tables used for the entropy coding. The first encoder used 9/7 filters for the wavelet transform and did the bit allocation using a high-rate bit assumption. Since the transform is made into 64 subbands, quite a lot of bands receive only a few bits even at an archival quality compression rate of 0.75 bit/pixel. Thus, after a brief overview of the standard, we will discuss a new approach for the bit-allocation that seems to make more sense where theory is concerned. Then we will talk about some implementation aspects, particularly for the new entropy coder and the features that allow other applications than fingerprint image compression. Finally, we will compare the performances of the new encoder to those of the first encoder.
13 CFR 134.703 - When must a person file an appeal from an WOSB or EDWOSB protest determination?
2010-01-01
... APPEALS Rules of Practice for Appeals From Women-Owned Small Business Concern (WOSB) and Economically... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must a person file an appeal from an WOSB or EDWOSB protest determination? 134.703 Section 134.703 Business Credit and Assistance...
Energy Technology Data Exchange (ETDEWEB)
Besley, John C. [School of Journalism and Mass Communications, University of South Carolina, Columbia, SC 29205 (United States); Baxter-Clemmons, Shannon [South Carolina Hydrogen Fuel Cell Alliance, P.O. Box 12302, Columbia, SC 29201 (United States)
2010-08-15
The current study uses quantitative survey results to explore what a near census of hydrogen and fuel cell (HFC) workers in South Carolina (n = 70) say about their HFC experiences and the degree to which these workers can be expected to act as opinion leaders for the field. In general, these workers say they are positive about the environmental, national security, and economic potential of HFC technologies. They further see HFC technologies as having small and manageable levels of risk. A number of these workers exhibit characteristics associated with both issue-specific and general opinion leadership. Issue-specific leadership and positive views about HFC technology were associated with higher levels of self-reported technology-related interpersonal discussion. The study concludes that the existence of workers with positive HFC experiences and a demonstrated interest in telling others about their experiences may represent an opportunity for those charged with promoting HFC development and adoption. Future efforts should explore how HFC workers could be effectively integrated into such efforts as a means of reaching difficult to reach audiences. (author)
Directory of Open Access Journals (Sweden)
Jiahang Sun
2017-09-01
Full Text Available Background: MiR-134 is enriched in dendrites of hippocampal neurons and plays crucial roles in the progress of epilepsy. The present study aims to investigate the effects of antagomirs targeting miroRNA-134 (Ant-134 on limk1 expression and the binding of miR-134 and limk1 in experimental seizure. Methods: Status epilepticus (SE rat model was established by lithium chloride-pilocarpine injection and was treated with Ant-134 by intracerebroventricular injection. Low Mg2+-exposed primary neurons were used as an in vitro model of SE. The expression of miR-134 was determined using real-time PCR. Protein expressions of limk1 and cofilin were determined by Western blotting. Luciferase reporter assay was used to examine the binding between miR-134 and limk1 3’-untranslated region. Results: The expression of miR-134 was markedly enhanced in hippocampus of the SE rats and low Mg2+-exposed neurons. Ant-134 increased the expression of limk1 and reduced the expression of cofilin in the SE hippocampus and Low Mg2+-exposed neurons. In addition, luciferase reporter assay confirmed that miR-134 bound limk1 3’-UTR. MiR-134 overexpression inhibited limk1 mRNA and protein expressions in neurons. Conclusion: Blockage of miR-134 upregulates limk1 expression and downregulated cofilin expression in hippocampus of the SE rats. This mechanism may contribute to the neuroprotective effects of Ant-134.
Decomposition of SF6-R134a effluents by RF plasma
International Nuclear Information System (INIS)
Joshi, Avinash V.
2012-01-01
The efficiency of recovery achieved by open or closed loop extraction of RPC exhaust gases is in the range of 90-95% under optimum conditions. For a large detector setup operating on one volume change per day basis, a 5% loss amounts to discharging 50 kg of R134a and 0.5 kg of SF 6 into atmosphere every day. The emissions are equivalent to create nearly 50 000 m 3 of carbon dioxide daily. The gas emissions need to be completely converted to safer compounds. The gases such as R134a and SF 6 are stable compounds. In order to decompose these, the mixture is first activated by adding of 50% oxygen and 2% argon and under typical RF plasma conditions of 13.56 MHz, 1 Torr pressure and 0.2 W/cm 2 power density. The chemical reaction takes place on the surface of a silicon electrode. The product of the reaction is mainly SiF 4 (gas), which is further hydrolyzed to form HF solution and silicon hydroxide sludge. More than 90% of the effluent gas mixture can be effectively removed by this method.
Determination of Cs-134 and Cs-137 rain water samples
International Nuclear Information System (INIS)
Lima, M.F.; Mazzilli, B.
1988-01-01
In order to setting an environmental monitoring program at IPEN, was developed a fast and simple methodology for concentration of Cs-134 and Cs-137 in rain water. This procedure consists in the precipitation of cesium and others cathions of its family (NH 4 + , K + and Rb + ) by ammonium molybdophosphate. The measures of the desintegration rates of Cs-134 and Cs-137 was done by gamma spectrometry in a Ge(Li) detector. After setting up the ideal experimental conditions, the procedure was used to analyze four samples of rain water. (author) [pt
A review on compressed pattern matching
Directory of Open Access Journals (Sweden)
Surya Prakash Mishra
2016-09-01
Full Text Available Compressed pattern matching (CPM refers to the task of locating all the occurrences of a pattern (or set of patterns inside the body of compressed text. In this type of matching, pattern may or may not be compressed. CPM is very useful in handling large volume of data especially over the network. It has many applications in computational biology, where it is useful in finding similar trends in DNA sequences; intrusion detection over the networks, big data analytics etc. Various solutions have been provided by researchers where pattern is matched directly over the uncompressed text. Such solution requires lot of space and consumes lot of time when handling the big data. Various researchers have proposed the efficient solutions for compression but very few exist for pattern matching over the compressed text. Considering the future trend where data size is increasing exponentially day-by-day, CPM has become a desirable task. This paper presents a critical review on the recent techniques on the compressed pattern matching. The covered techniques includes: Word based Huffman codes, Word Based Tagged Codes; Wavelet Tree Based Indexing. We have presented a comparative analysis of all the techniques mentioned above and highlighted their advantages and disadvantages.
2010-01-01
... APPEALS Rules of Practice for Appeals From Women-Owned Small Business Concern (WOSB) and Economically... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who can file a response to an appeal petition and when must such a response be filed? 134.710 Section 134.710 Business Credit and...
International Nuclear Information System (INIS)
Tian, Song; Li, Hejun; Zhang, Yulei; Liu, Sen; Fu, Yangxi; Li, Yixian; Qiang, Xinfa
2013-01-01
Graphical abstract: Novel HfC microcrystal chains have been synthesized via a catalyst-assisted chemical vapor deposition process. SEM results show the chains have a periodically changing diameter and a nanoscale sharpening tip. Analysis of TEM/SAED/EELS/EDX data shows the single-crystal chains grow along a [0 0 1] direction and consist of a HfC core and a thin carbon-rich shell with embedded HfC nanocrystallites surrounding the core. This work achieves the controllable preparation of nanoscale HfC sharpening tips for application as a point electron emission source and facilitates the application of HfC ultrafast laser-triggered tips in attosecond science. Highlights: •HfC microcrystal chains were synthesized by a catalyst-assisted CVD. •The chains grow along a [0 0 1] direction and have a periodically changing diameter. •Single-crystal HfC core is sheathed by a thin carbon-rich shell. •A growth mechanism model is proposed to explain the growth of microcrystal chians. •This work achieves the controllable preparation of nanoscale HfC sharpening tips. -- Abstract: Novel hafnium carbide (HfC) microcrystal chains, with a periodically changing diameter and a nanoscale sharpening tip at the chain end, have been synthesized via a catalyst-assisted chemical vapor deposition (CVD) process. The as-synthesized chains with many octahedral microcrystals have diameters of between several hundreds of nm and 6 μm and lengths of ∼500 μm. TEM diffraction studies show that the chains are single-crystalline HfC and preferentially grow along a [0 0 1] crystal orientation. TEM/EELS/EDX analysis proves the chains are composed of a HfC core and a thin (several tens of nm to 100 nm) carbon-rich shell with the embedded HfC nanocrystallites (typically below 10 nm) surrounding the core. The growth mechanism model for the chains based on the vapor–liquid–solid process, the vapor–solid process, and the HfC crystal growth characteristics is discussed
A biological compression model and its applications.
Cao, Minh Duc; Dix, Trevor I; Allison, Lloyd
2011-01-01
A biological compression model, expert model, is presented which is superior to existing compression algorithms in both compression performance and speed. The model is able to compress whole eukaryotic genomes. Most importantly, the model provides a framework for knowledge discovery from biological data. It can be used for repeat element discovery, sequence alignment and phylogenetic analysis. We demonstrate that the model can handle statistically biased sequences and distantly related sequences where conventional knowledge discovery tools often fail.
Directory of Open Access Journals (Sweden)
Münster, Tobias
2016-08-01
Full Text Available Introduction: The external chest compression is a very important skill required to maintain a minimum of circulation during cardiac arrest until further medical procedures can be taken. Peyton’s 4-Steps-Approach is one method of skill training, the four steps being:Based on CPR skill training, this method is widely, allegedly predominantly used, although there are insufficient studies on Peyton’s 4-Steps-Approach for skill training in CPR in comparison with other methods of skill training. In our study, we compared the medium- term effects on learning external chest compression with a CPR training device in three different groups: PEY (Peyton’s 4-Steps-Approach, PMOD (Peyton’s 4-Steps-Approach without Step 3 and STDM, the standard model, according to the widely spread method “see one, do one” (this is equal to Peyton’s step 1 and 3.Material and Methods: This prospective and randomised pilot study took place during the summer semester of 2009 at the SkillsLab and Simulation Centre of the University of Cologne (Kölner interprofessionelles Skills Lab und Simulationszentrum - KISS. The subjects were medical students (2 and 3 semester. They volunteered for the study and were randomised in three parallel groups, each receiving one of the teaching methods mentioned above. One week and 5/6 months after the intervention, an objective, structured single assessment was taken. Compression rate, compression depth, correct compressions, and the sum of correct checklist items were recorded. Additionally, we compared cumulative percentages between the groups based on the correct implementation of the resuscitation guidelines during that time.Results: The examined sample consisted of 134 subjects (68% female; age 22±4; PEY: n=62; PMOD: n=31; STDM: n=41. There was no difference between the groups concerning age, gender, pre-existing experience in CPR or time of last CPR course. The only significant difference between the groups was the mean
Energy Technology Data Exchange (ETDEWEB)
Hoetzl, H. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz; Winkler, R. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz
1993-12-31
In winter months maxima of Cs-134/137 activity concentrations in air are observed at several locations in Europe. To clarify this phenomenon, from October 1991 to November 1992 we performed a program for aerosol collection on a short-term scale based on collecting intervals of 48-72 hours. The local meteorological parameters were determined simultaneously. Statistical analysis of these observations reveiled a highly significant positive correlation between Cs-137 activity concentration and the so-called `Stagnationsindex`. Based on this relationship the seasonal variations of Cs-134/137 concentrations in ground-level air can be explained by atmospheric inversion conditions frequently occurring during fall- and wintermonths. (orig.) [Deutsch] Zur Klaerung der an verschiedenen Orten Europas in den Wintermonaten beobachteten Maxima der Cs-134/137-Aktivitaetskonzentrationen in der bodennahen Luft wurde von Oktober 1991 bis November 1992 ein Messgrogramm mit relativ kurzen Zeitintervallen fuer die Aerosolsammlung (48-72 Stunden) durchgefuehrt. Gleichzeitig wurden lokale meteorologische Parameter miterfasst. Die statistische Auswertung der Messergebnisse lieferte eine hochsignifikante positive Korrelation zwischen der Aktivitaetskonzentration von Cs-137 und dem sog. Stagnationsindex. Auf Grund dieses Zusammenhangs lassen sich die saisonalen Schwankungen der Cs-134/137-Luftkonzentrationen mit dem haeufigen Auftreten von austauscharmen Wetterlagen in den Herbst- und Wintermonaten erklaeren. (orig.)
A hybrid data compression approach for online backup service
Wang, Hua; Zhou, Ke; Qin, MingKang
2009-08-01
With the popularity of Saas (Software as a service), backup service has becoming a hot topic of storage application. Due to the numerous backup users, how to reduce the massive data load is a key problem for system designer. Data compression provides a good solution. Traditional data compression application used to adopt a single method, which has limitations in some respects. For example data stream compression can only realize intra-file compression, de-duplication is used to eliminate inter-file redundant data, compression efficiency cannot meet the need of backup service software. This paper proposes a novel hybrid compression approach, which includes two levels: global compression and block compression. The former can eliminate redundant inter-file copies across different users, the latter adopts data stream compression technology to realize intra-file de-duplication. Several compressing algorithms were adopted to measure the compression ratio and CPU time. Adaptability using different algorithm in certain situation is also analyzed. The performance analysis shows that great improvement is made through the hybrid compression policy.
Halftoning processing on a JPEG-compressed image
Sibade, Cedric; Barizien, Stephane; Akil, Mohamed; Perroton, Laurent
2003-12-01
Digital image processing algorithms are usually designed for the raw format, that is on an uncompressed representation of the image. Therefore prior to transforming or processing a compressed format, decompression is applied; then, the result of the processing application is finally re-compressed for further transfer or storage. The change of data representation is resource-consuming in terms of computation, time and memory usage. In the wide format printing industry, this problem becomes an important issue: e.g. a 1 m2 input color image, scanned at 600 dpi exceeds 1.6 GB in its raw representation. However, some image processing algorithms can be performed in the compressed-domain, by applying an equivalent operation on the compressed format. This paper is presenting an innovative application of the halftoning processing operation by screening, to be applied on JPEG-compressed image. This compressed-domain transform is performed by computing the threshold operation of the screening algorithm in the DCT domain. This algorithm is illustrated by examples for different halftone masks. A pre-sharpening operation, applied on a JPEG-compressed low quality image is also described; it allows to de-noise and to enhance the contours of this image.
Stage dependent expression and tumor suppressive function of FAM134B (JK1) in colon cancer.
Islam, Farhadul; Gopalan, Vinod; Wahab, Riajul; Smith, Robert A; Qiao, Bin; Lam, Alfred King-Yin
2017-01-01
The aims of the present study are to investigate sub-cellular location, differential expression in different cancer stages and functional role of FAM134B in colon cancer development. FAM134B expression was studied and quantified at protein and mRNA levels in cell lines using immunocytochemistry, Western blot and real-time PCR. In vitro functional assays and an in vivo xenotransplantation mouse models were used to investigate the molecular role of FAM134B in cancer cell biology in response to FAM134B silencing with shRNA lentiviral particles. FAM134B protein was noted in both cytoplasm and nuclei of cancer cells. In cancer cells derived from stage IV colon cancer, FAM134B expression was remarkably reduced when compared to non-cancer colon cells and cancer cells derived from stage II colon cancer. FAM134B knockdown significantly (P colon cancer cells following lentiviral transfection. Furthermore, FAM134B suppression significantly increased (34-52%; P cancer suppressor gene in colon cancer. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Bhiogade Girish E.
2017-01-01
Full Text Available New combustion concepts have been recently developed with the purpose to tackle the problem of high emissions level of traditional direct injection Diesel engines. A good example is the premixed charge compression ignition combustion. A strategy in which early injection is used causing a burning process in which the fuel burns in the premixed condition. In compression ignition engines, soot (particulate matter and NOx emissions are an extremely unsolved issue. Premixed charge compression ignition is one of the most promising solutions that combine the advantages of both spark ignition and compression ignition combustion modes. It gives thermal efficiency close to the compression ignition engines and resolves the associated issues of high NOx and particulate matter, simultaneously. Premixing of air and fuel preparation is the challenging part to achieve premixed charge compression ignition combustion. In the present experimental study a diesel vaporizer is used to achieve premixed charge compression ignition combustion. A vaporized diesel fuel was mixed with the air to form premixed charge and inducted into the cylinder during the intake stroke. Low diesel volatility remains the main obstacle in preparing premixed air-fuel mixture. Exhaust gas re-circulation can be used to control the rate of heat release. The objective of this study is to reduce exhaust emission levels with maintaining thermal efficiency close to compression ignition engine.
SeqCompress: an algorithm for biological sequence compression.
Sardaraz, Muhammad; Tahir, Muhammad; Ikram, Ataul Aziz; Bajwa, Hassan
2014-10-01
The growth of Next Generation Sequencing technologies presents significant research challenges, specifically to design bioinformatics tools that handle massive amount of data efficiently. Biological sequence data storage cost has become a noticeable proportion of total cost in the generation and analysis. Particularly increase in DNA sequencing rate is significantly outstripping the rate of increase in disk storage capacity, which may go beyond the limit of storage capacity. It is essential to develop algorithms that handle large data sets via better memory management. This article presents a DNA sequence compression algorithm SeqCompress that copes with the space complexity of biological sequences. The algorithm is based on lossless data compression and uses statistical model as well as arithmetic coding to compress DNA sequences. The proposed algorithm is compared with recent specialized compression tools for biological sequences. Experimental results show that proposed algorithm has better compression gain as compared to other existing algorithms. Copyright © 2014 Elsevier Inc. All rights reserved.
High temperature strengthening mechanism of hafnium carbide in a tungsten-rhenium matrix
International Nuclear Information System (INIS)
Luo, A.; Shin, K.S.; Jacobson, D.L.
1991-01-01
The interrelationship between the testing temperature and HfC strength increment of an arc-melted W-3.6Re-0.4HfC was determined from 1950 K to 2980 K in a vacuum of better than 1.3x10 -5 Pa (10 -7 torr). The present research was focused on the characteristic temperature at which the rapid coarsening of HfC particles occurred and the effect of the second-phase particle size on the high temperature strength properties of this material. It was found that the HfC particle strengthening was effective in a W-Re matrix up to a characteristic temperature of 2450 K in the short-term tensile test. Carbon was found to be the rate-limiting solute in the HfC particle growth. The strength of HfC strengthened alloy at temperature above 0.5 T m is proportional to the square root of particle volume fraction. The yield strengths of W-3.6Re-0.26HfC calculated based on the particle statistical distribution had good agreement with the experimental values from 1950 K to 2980 K. Besides, an addition of 0.26 percent HfC in tungsten resulted in about 28 percent increase in the activation energy of plastic deformation at high temperatures
Foliar uptake of 134Cs and 85Sr in strawberry as function by leaf age
International Nuclear Information System (INIS)
Fortunati, P.; Brambilla, M.; Speroni, F.; Carini, F.
2004-01-01
In this paper a study of the foliar uptake and translocation of 134 Cs and 85 Sr in a herbaceous fruit plant is presented. In particular, absorption, translocation and loss of these radionuclides in strawberry plants have been studied in relation to the age of contaminated leaves. Strawberry plants were contaminated by distributing droplets of an aqueous solution containing 134 CsCl and 85 SrCl 2 on the surface of two leaves per plant. One half of the plants was contaminated through two young leaves, a second half through two old leaves. Sets of plants were collected 1 day, 7 days and 15 days after contamination. One half of them was rinsed with double distilled water before gamma analysis. Rinsing contaminated leaves removes on average 55% of the applied 134 Cs and 45% of 85 Sr. The activity removed decreases during the 15 days of the experimental study, both for 134 Cs and for 85 Sr, suggesting an increase in foliar absorption during this period. The activity removed does not differ between old and young leaves. 'External loss' is lower for young than old contaminated leaves. 'Internal loss' through translocation occurs mainly for 134 Cs. Translocation coefficients from contaminated leaves to fruits are two orders of magnitude higher for 134 Cs (4.0%), than for 85 Sr (0.05%). Leaf to fruit translocation coefficients for 134 Cs are higher from young leaves (5.8%), than from old leaves (2.3%)
2011-01-01
chlorine, freon, paints, thinners, oils, lubricants, compressed gases, pesticides, herbicides, nitrates, and chromates . A detailed tracking and...prolific beneficiaries of tl1e earmark system. In the three years since pub- lic disclosure of earmark LEGAL ADVERTISEMENT . PUBLIC NOTICE - UN~TED...ago: AI Gc legal fight to expand r Otic om GN (all bet ’fl?is offer i of your hem certified LEGAl. ADVERTISE ~ lENT ~ ,.._J) PUBLIC NOTICE
Radiological Image Compression
Lo, Shih-Chung Benedict
The movement toward digital images in radiology presents the problem of how to conveniently and economically store, retrieve, and transmit the volume of digital images. Basic research into image data compression is necessary in order to move from a film-based department to an efficient digital -based department. Digital data compression technology consists of two types of compression technique: error-free and irreversible. Error -free image compression is desired; however, present techniques can only achieve compression ratio of from 1.5:1 to 3:1, depending upon the image characteristics. Irreversible image compression can achieve a much higher compression ratio; however, the image reconstructed from the compressed data shows some difference from the original image. This dissertation studies both error-free and irreversible image compression techniques. In particular, some modified error-free techniques have been tested and the recommended strategies for various radiological images are discussed. A full-frame bit-allocation irreversible compression technique has been derived. A total of 76 images which include CT head and body, and radiographs digitized to 2048 x 2048, 1024 x 1024, and 512 x 512 have been used to test this algorithm. The normalized mean -square-error (NMSE) on the difference image, defined as the difference between the original and the reconstructed image from a given compression ratio, is used as a global measurement on the quality of the reconstructed image. The NMSE's of total of 380 reconstructed and 380 difference images are measured and the results tabulated. Three complex compression methods are also suggested to compress images with special characteristics. Finally, various parameters which would effect the quality of the reconstructed images are discussed. A proposed hardware compression module is given in the last chapter.
13 CFR 134.711 - Will the Judge permit discovery and oral hearings?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Will the Judge permit discovery and oral hearings? 134.711 Section 134.711 Business Credit and Assistance SMALL BUSINESS...
13 CFR 134.705 - What are the requirements for an appeal petition?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for an appeal petition? 134.705 Section 134.705 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...
Role of excited CF3CFHO radicals in the atmospheric chemistry of HFC-134a
DEFF Research Database (Denmark)
Wallington, T.J.; Hurley, M.D.; Fracheboud, J.M.
1996-01-01
with Oz, CF3CFHO + O-2 --> CF3C(O)F + HO2, and decomposition via C-C bond scission, CF3CFHO + M --> CS3 + HC(O)F + M. CF3CFHO radicals were produced by two different reactions: either via the self-reaction of CF3CFHO2 radicals or via the CF3CFHO2 + NO reaction. It was found that decomposition was much...
Neutron Inelastic Scattering on 134Xe at En = 5 - 8 MeV
Kidd, Mary; Tornow, Werner; Finch, Sean; Krishichayan, Fnu; Bhike, Megha
2017-09-01
Neutrinoless double-beta decay (0 νββ) studies are both the best way to determine the Majorana nature of the neutrino and determine its effective mass. The two main experiments searching for 0 νββ -decay of 136Xe (Q value = 2457.8 keV) are Kamland-Zen and EXO-200. Though both experiments have enriched 136Xe targets, these targets still contain significant quantities of 134Xe. Recently, a new nuclear level was discovered in 134Xe that decays to the ground state emitting a 2485.7 keV gamma ray. The γ-ray production cross section for this branch was found to be on the order of 10 mb for incident neutron energies of 2.5-4.5 MeV. Here, we have extended the investigation of this level to higher incident neutron energies, and further explore the potential neutron-induced backgrounds on both 134Xe and 136Xe for extended neutron energies. We will report our preliminary results for neutron inelastic scattering on 134Xe in applications to 0 νββ decay searches. NSF PHY-1614348, DE-FG02-97ER41033.
FRC translation into a compression coil
International Nuclear Information System (INIS)
Chrien, R.E.
1985-01-01
Several features of the problem of FRC translation into a compression coil are considered. First, the magnitude of the guide field is calculated and found to exceed that which would be applied to a flux conserver. Second, energy conservation is applied to FRC translation from a flux conserver into a compression coil. It is found that a significant temperature decrease is required for translation to be energetically possible. The temperature change depends on the external inductance in the compression circuit. An analogous case is that of a compression region composed of a compound magnet; in this case the temperature change depends on the ratio of inner and outer coil radii. Finally, the kinematics of intermediate translation states are calculated using an ''abrupt transition'' model. It is found, in this model, that the FRC must overcome a potential hill during translation, which requires a small initial velocity
Test of 134Cs, 85,89Sr leaching rate in a resemble vitrifiable cement waste form
International Nuclear Information System (INIS)
Lin Meiqiong; Wei Feng; Yin Qi; Fan Xianhua; Xu Shengli; Li Yongde
2003-01-01
A novel material--resemble vitrifiable cement for conditioning low and mediate level radioactive waste has been developed. Waste form has been characterized for their physical and chemical performance, phase composition. The cement formulation has been patented. In this experiment the cement is mixed with simulated wastes spiked with 134 Cs and 85,89 Sr by 5 min at least. The Ratio of the waste to the cement is 0.45-0.55. The mixture is packed into cylindrical molds which has the same dimension of diameter and height . The grouts are cured for a period of 28 d in a room temperature curing chamber at an atmospheric pressure. The cured waste form is then completely immersed into deionized water. According to standard GB7023-86, leaching rate of 134 Cs and 85,89 Sr are measured. The result shows that the leaching rate of the species 134 Cs and 85,89 Sr is to be on the order 10 -4 and 10 -5 on the 42 d immersion, respectively and is better than that of commercial cement
Adsorption of *sp134*Cs onto two different types of roof materials
International Nuclear Information System (INIS)
Quenild, C.; Tveten, U.
1983-01-01
The report relates to a subproject under a Nordic project called ''Large reactor accidents - consequences and mitigating actions''. Natural decontamination of two types of roof material, typical of Norwegian and Swedish buildings, was examined. The roofs were contaminated with *sp134*Cs. After two days with 7 mm precipitation, the remaining activity on the tar-paper roof was 97% and on the steel roof 29%. After 8 months the remaining activity was 61% on the tar-paper roof and 22% on the steel roof. In spring *sp134*Cs was spread upon an 8 cm thick layer of fresh snow on an additional tar-paper roof. After 3 montsh and 191 mm precipitation the remaining activity was 59%. All results are based upon *sp134*Cs in collected run-off water.(Auth.)
Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134
Energy Technology Data Exchange (ETDEWEB)
Ballestra, S; Gastaud, J; Lopez, J J; Parsi, P; Vas, D
1993-08-01
The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for {sup 40}K, {sup 60}Co, {sup 137}Cs, and 2{sup 39+240}Pu (Reference date: 1 January 1992). Information values for {sup 90}Sr, {sup 106}Ru, {sup 125}Sb, {sup 134}Cs, {sup 154}Eu, {sup 155}Eu, {sup 210}Pb, {sup 210}Po, {sup 226}Ra, {sup 228}Ra, {sup 228}Th, {sup 230}Th, {sup 232}Th, {sup 234}U, {sup 235}U, {sup 238}U, {sup 238}Pu and {sup 241}Am are also reported. All the following values are expressed in Bq kg{sup -1} (dry weight). (author)
International Nuclear Information System (INIS)
Lee, Hae Seung; Jeon, Dong Soon; Kim, Young Lyoul; Kim, Seon Chang
2010-01-01
Experimental investigations have been carried out to examine the evaporative heat transfer characteristics of R-134a with the channel-bending angle (CBA) in microchannel heat exchangers. In this study, we examined the effects of evaporation temperature and Reynolds number of R-134a on the evaporative heat transfer characteristics of R-134a in microchannel heat exchangers with CBAs of 120 .deg. , 150 .deg. , and 180 .deg. under counterflow conditions. Experimental results show that the evaporative heat transfer rate and evaporative heat transfer coefficient increased with an increase in the Reynolds number of R-134a. Further, the evaporative heat transfer rate corresponding to CBAs of 120 .deg. and 150 .deg. increased to values greater than the evaporative heat transfer rate corresponding to 180 .deg. by approximately 17.1% and 13.3%, respectively, for evaporating temperatures in the range 4.9-14.9 .deg. C. The evaporative heat transfer coefficient was affected by the channel angle with increasing evaporative heat transfer coefficient at small channel bending angle
Mathematical transforms and image compression: A review
Directory of Open Access Journals (Sweden)
Satish K. Singh
2010-07-01
Full Text Available It is well known that images, often used in a variety of computer and other scientific and engineering applications, are difficult to store and transmit due to their sizes. One possible solution to overcome this problem is to use an efficient digital image compression technique where an image is viewed as a matrix and then the operations are performed on the matrix. All the contemporary digital image compression systems use various mathematical transforms for compression. The compression performance is closely related to the performance by these mathematical transforms in terms of energy compaction and spatial frequency isolation by exploiting inter-pixel redundancies present in the image data. Through this paper, a comprehensive literature survey has been carried out and the pros and cons of various transform-based image compression models have also been discussed.
International Nuclear Information System (INIS)
Weber, J.
1993-01-01
Last December, after an all-out, nearly $500 million development effort, an Imperial Chemical Industries (ICI) plant in Louisiana was the first world-scale US facility to start pumping out HFC 134a, an alternative to CFC12, the chemical that accounts for more than 50% of CFC use. The saga of 134a is an object lesson in how a global crisis can compel governments and companies to transform technology far faster than either thought possible. With deadlines for phasing out CFCs closing in, ICI and its rivals, Du Pont and Elf, developed technology speedily by constructing factories even while their choice molecules were still being tested. ICI slashed the time it takes to commercialize a technology from the industry norm of more than a decade to only five years. If companies are forced to act on environmental issues, they do it
Experimental studies on the biokinetics of Cs-134 and Cd-109 in the blood cockle (Anadara granosa)
International Nuclear Information System (INIS)
Norfaizal Mohamed; Nita Salina Abu Bakar; Zal Uyun Wan Mahmood; Nur Hidaya Dmuliany Mohd Sidek; Zaharudin Ahmad
2010-01-01
Bioaccumulation and depuration study under controlled laboratory conditions of Cs and Cd in Anadara granosa collected at coastal Kapar, Selangor was carried out using respective radiotracer, Cs-134 and Cd-109. The radioactivity of Cs-134 and Cd-109 were determined using high resolution hyper germanium detector. Our results demonstrate that Cd-109 was accumulated efficiently by this species, except Cs-134. The steady state concentration factor (CF) for accumulation of Cs-134 and Cd-109 from seawater was estimated to be about 5.86 and 51.31, respectively. For the depuration stage, loss kinetics of Cs-134 and Cd-109 was best described by 2-compartment exponential model. Results shown that A. granosa exposed to Cs-134 have a total loss of 69% in compared to 19 % of Cd-109. Results gained in this experiment are a baseline data to evaluate future released of radioactive material from nuclear power programme facilities within this region. (author)
Blomberg, Hans; Gedeborg, Rolf; Berglund, Lars; Karlsten, Rolf; Johansson, Jakob
2011-10-01
Mechanical chest compression devices are being implemented as an aid in cardiopulmonary resuscitation (CPR), despite lack of evidence of improved outcome. This manikin study evaluates the CPR-performance of ambulance crews, who had a mechanical chest compression device implemented in their routine clinical practice 8 months previously. The objectives were to evaluate time to first defibrillation, no-flow time, and estimate the quality of compressions. The performance of 21 ambulance crews (ambulance nurse and emergency medical technician) with the authorization to perform advanced life support was studied in an experimental, randomized cross-over study in a manikin setup. Each crew performed two identical CPR scenarios, with and without the aid of the mechanical compression device LUCAS. A computerized manikin was used for data sampling. There were no substantial differences in time to first defibrillation or no-flow time until first defibrillation. However, the fraction of adequate compressions in relation to total compressions was remarkably low in LUCAS-CPR (58%) compared to manual CPR (88%) (95% confidence interval for the difference: 13-50%). Only 12 out of the 21 ambulance crews (57%) applied the mandatory stabilization strap on the LUCAS device. The use of a mechanical compression aid was not associated with substantial differences in time to first defibrillation or no-flow time in the early phase of CPR. However, constant but poor chest compressions due to failure in recognizing and correcting a malposition of the device may counteract a potential benefit of mechanical chest compressions. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
NRGC: a novel referential genome compression algorithm.
Saha, Subrata; Rajasekaran, Sanguthevar
2016-11-15
Next-generation sequencing techniques produce millions to billions of short reads. The procedure is not only very cost effective but also can be done in laboratory environment. The state-of-the-art sequence assemblers then construct the whole genomic sequence from these reads. Current cutting edge computing technology makes it possible to build genomic sequences from the billions of reads within a minimal cost and time. As a consequence, we see an explosion of biological sequences in recent times. In turn, the cost of storing the sequences in physical memory or transmitting them over the internet is becoming a major bottleneck for research and future medical applications. Data compression techniques are one of the most important remedies in this context. We are in need of suitable data compression algorithms that can exploit the inherent structure of biological sequences. Although standard data compression algorithms are prevalent, they are not suitable to compress biological sequencing data effectively. In this article, we propose a novel referential genome compression algorithm (NRGC) to effectively and efficiently compress the genomic sequences. We have done rigorous experiments to evaluate NRGC by taking a set of real human genomes. The simulation results show that our algorithm is indeed an effective genome compression algorithm that performs better than the best-known algorithms in most of the cases. Compression and decompression times are also very impressive. The implementations are freely available for non-commercial purposes. They can be downloaded from: http://www.engr.uconn.edu/~rajasek/NRGC.zip CONTACT: rajasek@engr.uconn.edu. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Rate of sediment intake by midge larvae (Chironomus plumosus: diptera) using a 134Cs tracer
International Nuclear Information System (INIS)
Gerking, S.D.; Berg, A.; Gerard, P.
1976-01-01
The food intake and assimilation of midge larvae (Chironomus plumosus) were determined by a 134 Cs technique which utilized the principle that the rate of excretion can be substituted for the rate of absorption when the larvae are in 134 Cs equilibrium with their environment. The larvae were introduced into contaminated sediments until they reached 134 Cs equilibrium. The time of reaching equilibrium and levels of radioactivity were the same at 10 and at 15 0 C (70 hr at a level of 1367 dpm/mg of larva) and were both significantly different from that at 20 0 C (40 hr at 1062 dpm/mg of larva). Cesium-134 elimination was followed on equilibrated larvae for as long as 330 hr. One egestion compartment (fast) and two excretion (medium and slow) compartments could be recognized at the three experimental temperatures. The loss rates from the second and third compartments at 10 0 C were slower and stretched out over longer time periods compared with those at 15 0 C, while the loss rate from the first compartment was much more comparable at the two temperatures. The first and second compartments merged at 20 0 C, while the slow compartment rose to almost three times that at 15 0 C. The food intake was nearly the same at the three temperatures (0.0986, 0.0893 and 0.0876 mg dry sediment/mg of larva/day). Thus, the larvae relied on an increase in assimilation to meet increased metabolic requirements at higher temperatures rather than depending upon a higher food intake. The gross growth efficiencies varied with temperature from 9.9 percent at 10 0 C to 15.1 percent at 15 0 C
WSNs Microseismic Signal Subsection Compression Algorithm Based on Compressed Sensing
Directory of Open Access Journals (Sweden)
Zhouzhou Liu
2015-01-01
Full Text Available For wireless network microseismic monitoring and the problems of low compression ratio and high energy consumption of communication, this paper proposes a segmentation compression algorithm according to the characteristics of the microseismic signals and the compression perception theory (CS used in the transmission process. The algorithm will be collected as a number of nonzero elements of data segmented basis, by reducing the number of combinations of nonzero elements within the segment to improve the accuracy of signal reconstruction, while taking advantage of the characteristics of compressive sensing theory to achieve a high compression ratio of the signal. Experimental results show that, in the quantum chaos immune clone refactoring (Q-CSDR algorithm for reconstruction algorithm, under the condition of signal sparse degree higher than 40, to be more than 0.4 of the compression ratio to compress the signal, the mean square error is less than 0.01, prolonging the network life by 2 times.
Idiopathic urolithiasis in Tunisian children: A report of 134 cases
Directory of Open Access Journals (Sweden)
A Alaya
2013-01-01
Full Text Available We evaluated the metabolic and the nutritional aspects of 134 urolithiasis children in order to outline the characteristics of idiopathic urolithiasis in children. This prospective study group of 134 children (56 females, 78 males with renal calculi was evaluated. The age range of the patients was six months to 16 years. A dietary survey was performed on every child. All patients were investigated with respect to stone localization and serum and urine risk factors. Statistical analysis of data was carried out using software SPSS 11.0 for Windows. Hypercalciuria was the most common risk factor detected in this group (28.3%. A decrease of water intake was noted in all age groups, especially in the rural area (549.6 mL/day vs. 1150.6 mL/day, and there was an increase in animal protein intake in 17 cases (mean: 1.9 g/kg. In addition, increased intake of starchy foods and food with high oxalate content (sorgum were detected in the ten to 16 years age group (51% of our study. Calcium oxalate monohydrate represents the principal component of idiopathic stone (58.2%, which is more frequent in children (68% than in infants (51.7% (P <0.02. The major etiology of idiopathic urolithiasis highlights the influence of dietary habit in stone formers in our country. The increased occurrence of calcium oxalate stones in school age children confirms the change in the etiology of urolithiasis according to age.
Compatibility of manufacturing process fluids with R-134a and polyolester lubricant. Final report
Energy Technology Data Exchange (ETDEWEB)
Cavestri, R.C.; Schooley, D.L. [Imagination Resources, Inc., Dublin, OH (United States)
1996-07-01
This report includes a broad list of processing fluids that are known to be used to manufacture air conditioning and refrigeration products. Sixty-four process fluids from this list were selected for compatibility studies with R-134a and ICI EMKARATE RL32H (32 ISO) polyolester lubricant. Solutions or suspensions of the process fluid residues in polyolester lubricant were heated for 14 days at 175{degrees}C (347{degrees}F) in evacuated sealed glass tubes containing only valve steel coupons. Miscibility tests were performed at 90 wt.% R-134a, 10 wt.% polyolester lubricant with process fluid residue contaminate and were scanned in 10{degrees}C (18{degrees}F) increments over a temperature range of ambient to -40{degrees}C (-40{degrees}F). Any sign of turbidity, haze formation or oil separation was considered the immiscibility point.
All-atom simulation study of protein PTH(1-34) by using the Wang-Landau sampling method
Energy Technology Data Exchange (ETDEWEB)
Kim, Seung-Yeon [Korea National University of Transportation, Chungju (Korea, Republic of); Kwak, Woo-Seop [Chosun University, Gwangju (Korea, Republic of)
2014-12-15
We perform simulations of the N-terminal 34-residue protein fragment PTH(1-34), consisting of 581 atoms, of the 84-residue human parathyroid hormone by using the all-atom ECEPP/3 force field and the Wang-Landau sampling method. Through a massive high-performance computation, the density of states and the partition function Z(T), as a continuous function of T, are obtained for PTH(1-34). From the continuous partition function Z(T), the partition function zeros of PTH(1-34) are evaluated for the first time. From both the specific heat and the partition function zeros, two characteristic transition temperatures are obtained for the all-atom protein PTH(1-34). The higher transition temperature T{sub 1} and the lower transition temperature T{sub 2} of PTH(1-34) can be interpreted as the collapse temperature T{sub θ} and the folding temperature T{sub f} , respectively.
40 CFR 61.134 - Standard: Naphthalene processing, final coolers, and final-cooler cooling towers.
2010-07-01
... coolers, and final-cooler cooling towers. 61.134 Section 61.134 Protection of Environment ENVIRONMENTAL... Standard: Naphthalene processing, final coolers, and final-cooler cooling towers. (a) No (“zero”) emissions are allowed from naphthalene processing, final coolers and final-cooler cooling towers at coke by...
Separation of 134Cs and 137Cs from 125I solution for medical applications
International Nuclear Information System (INIS)
Ram, Ramu; Dash, Ashutosh; Banerjee, Dayamoy
2015-01-01
While neutron irradiation of natural Xe gas followed by wet chemical dissolution of activation products constitutes a successful paradigm for the small scale production 125 I, the concomitant production of 134 Cs and 137 Cs emerged as the primary impediment which necessitates purification of 125 I solution. This paper describes an ion-exchange chromatographic technique using Resorcinol Formaldehyde (RF) resin to purify 125 I solution from 134 Cs and 137 Cs impurities. A thorough investigation of the adsorption parameters of RF resin was carried out to arrive at the experimental conditions resulting optimum retention of 134 Cs and 137 Cs impurities. Based on the experimental findings, an optimized separation procedure was developed in which the neutron irradiated dissolved products at pH ∝ 13 was passed through a chromatography column containing RF resin where in 134 Cs and 137 Cs impurities gets adsorbed leaving behind 125 I to appear in the effluent. The overall recovery of 125 I was >90% with acceptable purity amenable for clinical applications.
'Wash-out' of Cs-134 and Cs-137 from river sediment; 'Ispiranja' Cs-134 i Cs-137 iz recnog sedimenta
Energy Technology Data Exchange (ETDEWEB)
Skrbic, Z; Conkic, Lj; Bikit, I; Veskovic, M; Slivka, J; Marinkov, L [Institut za Fiziku, Novi Sad Univ. (Yugoslavia)
1988-07-01
Natural elimination and 'wash out' period of the Cs-134 and Cs-137 from the river sediment has been investigated. Obtained results suggest the possibility to describe these processes by exponential low and determination of the corresponding half lives. (author)
Lossless medical image compression with a hybrid coder
Way, Jing-Dar; Cheng, Po-Yuen
1998-10-01
The volume of medical image data is expected to increase dramatically in the next decade due to the large use of radiological image for medical diagnosis. The economics of distributing the medical image dictate that data compression is essential. While there is lossy image compression, the medical image must be recorded and transmitted lossless before it reaches the users to avoid wrong diagnosis due to the image data lost. Therefore, a low complexity, high performance lossless compression schematic that can approach the theoretic bound and operate in near real-time is needed. In this paper, we propose a hybrid image coder to compress the digitized medical image without any data loss. The hybrid coder is constituted of two key components: an embedded wavelet coder and a lossless run-length coder. In this system, the medical image is compressed with the lossy wavelet coder first, and the residual image between the original and the compressed ones is further compressed with the run-length coder. Several optimization schemes have been used in these coders to increase the coding performance. It is shown that the proposed algorithm is with higher compression ratio than run-length entropy coders such as arithmetic, Huffman and Lempel-Ziv coders.
International Nuclear Information System (INIS)
Ge Yanqing; Hao Benqian; Duan Guiyun; Wang Jianwu
2011-01-01
A series of novel substituted 1,3,4-oxadiazole derivatives were synthesized by the reaction of 3-butyl-1-chloroimidazo[1,5-a]pyridine-7-carbohydrazide with propionyl chloride and substituted benzoic chloride in the presence of phosphorus oxychloride. The compounds were characterized using IR, 1 H NMR, 13 C NMR and HRMS. Absorption and fluorescence spectra were measured in dichloromethane; an intense absorption maxima was noted at ca. 290 nm and emission maxima was noted at ca. 470 nm. The absorption spectra of the 1,3,4-oxadiazole derivatives reveal that a phenyl and an ethyl group attached to the 1,3,4-oxadiazole ring markedly influenced the maximum absorption. The structures based on density function theory (DFT) calculation show planar configurations for the compounds. The calculated molecular orbital correlates well with their absorption. - Research highlights: → Novel imidazo[1,5-a]pyridine derivatives were synthesized. → The structures were determined by IR, 1 H NMR, 13 C NMR and HRMS spectra. → We investigated the absorption and fluorescence spectral characteristics of the compounds. → The side group in 1,3,4-oxadiazole ring can affect its photophysical properties markedly. → Quantum calculation correlates well with their absorption.
FRC translation into a compression coil
International Nuclear Information System (INIS)
Chrien, R.E.
1986-01-01
The equilibrium and translational kinematics of Field-Reversed Configurations (FRCs) in a cylindrical coil which does not conserve flux are problems that arise in connection with adiabatic compressional heating. In this paper, they consider several features of the problem of FRC translation into a compression coil. First, the magnitude of the guide field is calculated and found to exceed that which would be applied to a flux conserver. Second, energy conservation is applied to FRC translation from a flux conserver into a compression coil. It is found that a significant temperature decrease is required for translation to be energetically possible. The temperature change depends on the external inductance in the compression circuit. An analogous case is that of a compression region composed of a compound magnet; in this case the temperature change depends on the ratio of inner and outer coil radii. Finally, the kinematics of intermediate translation states are calculated using an abrupt transition model. It is found, in this model, that the FRC must overcome a potential hill during translation, which requires a small initial velocity
Dual compression is not an uncommon type of iliac vein compression syndrome.
Shi, Wan-Yin; Gu, Jian-Ping; Liu, Chang-Jian; Lou, Wen-Sheng; He, Xu
2017-09-01
Typical iliac vein compression syndrome (IVCS) is characterized by compression of left common iliac vein (LCIV) by the overlying right common iliac artery (RCIA). We described an underestimated type of IVCS with dual compression by right and left common iliac arteries (LCIA) simultaneously. Thirty-one patients with IVCS were retrospectively included. All patients received trans-catheter venography and computed tomography (CT) examinations for diagnosing and evaluating IVCS. Late venography and reconstructed CT were used for evaluating the anatomical relationship among LCIV, RCIA and LCIA. Imaging manifestations as well as demographic data were collected and evaluated by two experienced radiologists. Sole and dual compression were found in 32.3% (n = 10) and 67.7% (n = 21) of 31 patients respectively. No statistical differences existed between them in terms of age, gender, LCIV diameter at the maximum compression point, pressure gradient across stenosis, and the percentage of compression level. On CT and venography, sole compression was commonly presented with a longitudinal compression at the orifice of LCIV while dual compression was usually presented as two types: one had a lengthy stenosis along the upper side of LCIV and the other was manifested by a longitudinal compression near to the orifice of external iliac vein. The presence of dual compression seemed significantly correlated with the tortuous LCIA (p = 0.006). Left common iliac vein can be presented by dual compression. This type of compression has typical manifestations on late venography and CT.
Post-Dryout Heat Transfer to a Refrigerant Flowing in Horizontal Evaporator Tubes
Mori, Hideo; Yoshida, Suguru; Kakimoto, Yasushi; Ohishi, Katsumi; Fukuda, Kenichi
Studies of the post-dryout heat transfer were made based on the experimental data for HFC-134a flowing in horizontal smooth and spiral1y grooved (micro-fin) tubes and the characteristics of the post-dryout heat transfer were c1arified. The heat transfer coefficient at medium and high mass flow rates in the smooth tube was lower than the single-phase heat transfer coefficient of the superheated vapor flow, of which mass flow rate was given on the assumption that the flow was in a thermodynamic equilibrium. A prediction method of post-dryout heat transfer coefficient was developed to reproduce the measurement satisfactorily for the smooth tube. The post dryout heat transfer in the micro-fin tube can be regarded approximately as a superheated vapor single-phase heat transfer.
Uhl, J-F; Benigni, J-P; Cornu-Thenard, A; Fournier, J; Blin, E
2015-06-01
Using standing magnetic resonance imaging (MRI), we recently showed that medical compression, providing an interface pressure (IP) of 22 mmHg, significantly compressed the deep veins of the leg but not, paradoxically, superficial varicose veins. To provide an explanation for this compression paradox by studying the correlation between the IP exerted by medical compression and intramuscular pressure (IMP). In 10 legs of five healthy subjects, we studied the effects of different IPs on the IMP of the medial gastrocnemius muscle. The IP produced by a cuff manometer was verified by a Picopress® device. The IMP was measured with a 21G needle connected to a manometer. Pressure data were recorded in the prone and standing positions with cuff manometer pressures from 0 to 50 mmHg. In the prone position, an IP of less than 20 did not significantly change the IMP. On the contrary, a perfect linear correlation with the IMP (r = 0.99) was observed with an IP from 20 to 50 mmHg. We found the same correlation in the standing position. We found that an IP of 22 mmHg produced a significant IMP increase from 32 to 54 mmHg, in the standing position. At the same time, the subcutaneous pressure is only provided by the compression device, on healthy subjects. In other words, the subcutaneous pressure plus the IP is only a little higher than 22 mmHg-a pressure which is too low to reduce the caliber of the superficial veins. This is in accordance with our standing MRI 3D anatomical study which showed that, paradoxically, when applying low pressures (IP), the deep veins are compressed while the superficial veins are not. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.
A checkpoint compression study for high-performance computing systems
Energy Technology Data Exchange (ETDEWEB)
Ibtesham, Dewan [Univ. of New Mexico, Albuquerque, NM (United States). Dept. of Computer Science; Ferreira, Kurt B. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States). Scalable System Software Dept.; Arnold, Dorian [Univ. of New Mexico, Albuquerque, NM (United States). Dept. of Computer Science
2015-02-17
As high-performance computing systems continue to increase in size and complexity, higher failure rates and increased overheads for checkpoint/restart (CR) protocols have raised concerns about the practical viability of CR protocols for future systems. Previously, compression has proven to be a viable approach for reducing checkpoint data volumes and, thereby, reducing CR protocol overhead leading to improved application performance. In this article, we further explore compression-based CR optimization by exploring its baseline performance and scaling properties, evaluating whether improved compression algorithms might lead to even better application performance and comparing checkpoint compression against and alongside other software- and hardware-based optimizations. Our results highlights are: (1) compression is a very viable CR optimization; (2) generic, text-based compression algorithms appear to perform near optimally for checkpoint data compression and faster compression algorithms will not lead to better application performance; (3) compression-based optimizations fare well against and alongside other software-based optimizations; and (4) while hardware-based optimizations outperform software-based ones, they are not as cost effective.
Nagamata, Satoshi; Nagasaka, Miwako; Kawabata, Akiko; Kishimoto, Kenji; Hasegawa, Daiichiro; Kosaka, Yoshiyuki; Mori, Takeshi; Morioka, Ichiro; Nishimura, Noriyuki; Iijima, Kazumoto; Yamada, Hideto; Kawamoto, Shinichiro; Yakushijin, Kimikazu; Matsuoka, Hiroshi; Mori, Yasuko
2018-05-01
CD134 (OX40), which is a cellular receptor for human herpesvirus-6B (HHV-6B) and expresses on activated T cells, may play a key role for HHV-6B replication after allogeneic hematopoietic stem cell transplantation (allo-HSCT). Therefore, we examined the CD134 expression on T cells and HHV-6B replication after allo-HSCT, and analyzed the correlation between them. Twenty-three patients after allo-HSCT were enrolled. The percentages of CD134-positive cells within the CD4 + and CD8 + cell populations were measured by flow cytometry, and the viral copy number of HHV-6B was simultaneously quantified by real-time PCR. The correlation between CD134 and HHV-6B viral load was then statistically analyzed. HHV-6B reactivation occurred in 11 of 23 patients (47.8%). CD134 expression was seen on T cells and was coincident with the time of peak viral load. The percentage of CD134-positive cells decreased significantly when HHV-6B DNA disappeared (p = .005 in CD4 + T cells, p = .02 in CD8 + T cells). In the 4 patients who underwent umbilical cord blood transplantation (UCBT), the viral load varied with the percentage of CD134-positive cells. In the comparison between the HHV-6B reactivation group and non-reactivation group, maximum percentages of CD134-positive cells among CD4 + T cells in reactivation group were significantly higher than those in non-reactivation group (p = .04). This is the first study to show that a correlation of CD134 expression on T cells with HHV-6B replication after allo-HSCT, especially in UCBT. The results possibly indicate that CD134 on T cells plays a key role for HHV-6B replication after allo-HSCT. Copyright © 2018 Elsevier B.V. All rights reserved.
Energy consumption estimation for greenhouse gas separation processes by clathrate hydrate formation
International Nuclear Information System (INIS)
Tajima, Hideo; Yamasaki, Akihiro; Kiyono, Fumio
2004-01-01
The process energy consumption was estimated for gas separation processes by the formation of clathrate hydrates. The separation process is based on the equilibrium partition of the components between the gaseous phase and the hydrate phase. The separation and capturing processes of greenhouse gases were examined in this study. The target components were hydrofluorocarbon (HFC-134a) from air, sulfur hexafluoride (SF 6 ) from nitrogen, and CO 2 from flue gas. Since these greenhouse gases would form hydrates under much lower pressure and higher temperature conditions than the accompanying components, the effective capturing of the greenhouse gases could be achieved by using hydrate formation. A model separation process for each gaseous mixture was designed from the basis of thermodynamics, and the process energy consumption was estimated. The obtained results were then compared with those for conventional separation processes such as liquefaction separation processes. For the recovery of SF 6 , the hydrate process is preferable to liquefaction process in terms of energy consumption. On the other hand, the liquefaction process consumes less energy than the hydrate process for the recovery of HFC-134a. The capturing of CO 2 by the hydrate process from a flue gas will consume a considerable amount of energy; mainly due to the extremely high pressure conditions required for hydrate formation. The influences of the operation conditions on the heat of hydrate formation were elucidated by sensitivity analysis. The hydrate processes for separating these greenhouse gases were evaluated in terms of reduction of global warming potential (GWP)
Synthesis of novel 2,5-disubstituted-1,3,4-selenadiazoles from fatty acid hydrazides
Directory of Open Access Journals (Sweden)
Himani Varshney
2018-01-01
Full Text Available A series of novel unsaturated hydroxy and non-hydroxy fatty acid residue substituted 1,3,4-selenadiazoles were described here. These derivatives were synthesized from the reaction of fatty acid hydrazide 1(a–d with acetyl chloride in the presence of anhydrous sodium carbonate in tetrahydrofuran and water at 0 °C, to form N′-acetyl undec-10-enoic hydrazide 2a, N′-acetyl-(9Z-octadec-9-enoic hydrazide 2b, N′-acetyl-(9Z, 12R-12-hydroxy-9-enoic hydrazide 2c, and N′-acetyl-(9R, 12Z-9-hydroxy-12-enoic hydrazide 2d. Then these hydrazines (dicarbonyl compound on reaction with Woollin’s reagent (WR in toluene led to the corresponding 2-(dec-9′-enyl-5-methyl-1,3,4-selenadiazole 3a, 2-[(8′Z-heptadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3b, 2-[(8′Z, 11′R-11′-hydroxy-octadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3c, and 2-[(8′R, 11′Z-8′-hydroxy-octadec-11′-enyl]-5-methyl-1,3,4-selenadiazole 3d, respectively. These synthesized compounds were characterized on the basis of IR, 1H NMR, 13C NMR, mass spectra and elemental analysis results.
Neutron-induced Backgrounds in 134Xe for Large-Scale Neutrinoless Double-Beta Decay Experiments
Moriguchi, Nina; Kidd, Mary; Tornow, Werner
2016-09-01
136Xe is used in large neutrinoless double-beta (0 νββ) decay experiments, such as KamLAND- Zen and EXO 200. Though highly purified, 136Xe still contains a significant amount of 134Xe. Recently, a new nuclear energy level was found in 134Xe. If 134Xe decays from this proposed excited state, it will emit a 2485.7 keV gamma ray. Because this energy lies near the region of interest of 136Xe νββ decay experiments (Q value 2457.8 keV), it could make a significant contribution to the background. A purified gaseous sample of 134Xe will be irradiated with neutrons of an incident energy of 4.0 MeV at Triangle Universities Nuclear Laboratory and monitored with high-purity germanium detectors. The spectra obtained from these detectors will be analyzed for the presence of the 2581 keV gamma ray. We will report on the status of this experiment. Future plans include expanding this measurement to higher initial neutron energies. Tennesse Tech University CISE Grant program.
Energy Technology Data Exchange (ETDEWEB)
Lottin, O; Feidt, M; Benelmir, R [LEMTA-UHP Nancy-1, 54 - Vandoeuvre-les-Nancy (France)
1998-12-31
This paper is a series of transparencies presenting a comparative study of the thermal performances of different types of refrigerating machineries: di-thermal with vapor compression, tri-thermal with moto-compressor, with ejector, with free piston, adsorption-type, resorption-type, absorption-type, compression-absorption-type. A prototype of ammonia-water compression-absorption heat pump is presented and modeled. (J.S.)
Energy Technology Data Exchange (ETDEWEB)
Lottin, O.; Feidt, M.; Benelmir, R. [LEMTA-UHP Nancy-1, 54 - Vandoeuvre-les-Nancy (France)
1997-12-31
This paper is a series of transparencies presenting a comparative study of the thermal performances of different types of refrigerating machineries: di-thermal with vapor compression, tri-thermal with moto-compressor, with ejector, with free piston, adsorption-type, resorption-type, absorption-type, compression-absorption-type. A prototype of ammonia-water compression-absorption heat pump is presented and modeled. (J.S.)
Use of two-phase flow heat transfer method in spacecraft thermal system
Hye, A.
1985-01-01
In space applications, weight, volume and power are critical parameters. Presently liquid freon is used in the radiator planels of the Space Shuttle to dissipate heat. This requires a large amount of freon, large power for pumps, large volume and weight. Use of two-phase flow method to transfer heat can reduce them significantly. A modified commercial vapor compression refrigerator/freezer was sucessfully flown in STS-4 to study the effect of zero-gravity on the system. The duty cycle was about 5 percent higher in flight as compared to that on earth due to low flow velocity in condenser. The vapor Reynolds number at exit was about 4000 as compared to about 12,000. Efforts are underway to design a refrigerator/freezer using an oil-free compressor for Spacelab Mission 4 scheduled to fly in January 1986. A thermal system can be designed for spacecraft using the two-phase flow to transfer heat economically.
13 CFR 134.714 - When must the Judge issue his or her decision?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must the Judge issue his or her decision? 134.714 Section 134.714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...
Gurovich, V.; Virozub, A.; Rososhek, A.; Bland, S.; Spielman, R. B.; Krasik, Ya. E.
2018-05-01
A major experimental research area in material equation-of-state today involves the use of off-Hugoniot measurements rather than shock experiments that give only Hugoniot data. There is a wide range of applications using quasi-isentropic compression of matter including the direct measurement of the complete isentrope of materials in a single experiment and minimizing the heating of flyer plates for high-velocity shock measurements. We propose a novel approach to generating quasi-isentropic compression of matter. Using analytical modeling and hydrodynamic simulations, we show that a working fluid composed of compressed water, generated by an underwater electrical explosion of a planar wire array, might be used to efficiently drive the quasi-isentropic compression of a copper target to pressures ˜2 × 1011 Pa without any complex target designs.
43 CFR 13.4 - Terms of permit.
2010-10-01
... § 13.4 Terms of permit. Every permit shall describe the location of the vending facilities and shall be... Interior bureau or office for each location. The head of the Interior bureau or office may require... efficiency as may be prescribed by the head of the Interior bureau or office. Such standards shall conform...
A Posteriori Restoration of Block Transform-Compressed Data
Brown, R.; Boden, A. F.
1995-01-01
The Galileo spacecraft will use lossy data compression for the transmission of its science imagery over the low-bandwidth communication system. The technique chosen for image compression is a block transform technique based on the Integer Cosine Transform, a derivative of the JPEG image compression standard. Considered here are two known a posteriori enhancement techniques, which are adapted.
Exploring Hydrofluorocarbons as Groundwater Age Tracers (Invited)
Haase, K. B.; Busenberg, E.; Plummer, L. N.; Casile, G.; Sanford, W. E.
2013-12-01
Groundwater dating tracers are an essential tool for analyzing hydrologic conditions in groundwater systems. Commonly used tracers for dating post-1940's groundwater include sulfur hexafluoride (SF6), chlorofluorocarbons (CFCs), 3H-3He, and other isotopic tracers (85Kr, δ2H and δ18O isotopes, etc.). Each tracer carries a corresponding set of advantages and limitations imposed by field, analytical, and interpretive methods. Increasing the number available tracers is appealing, particularly if they possess inert chemical properties and unique temporal emission histories from other tracers. Atmospherically derived halogenated trace gases continue to hold untapped potential for new tracers, as they are generally inert and their emission histories are well documented. SF5CF3, and CFC-13 were previously shown to have application as dating tracers, though their low mixing ratios and low solubility require large amounts of water to be degassed for their quantification. Two related groups of compounds, hydrochlorofluorocarbons (HCFCs) and hydrofluorocarbons (HFCs) are hypothesized to be potential age tracers, having similar mixing ratios to the CFCs and relatively high solubility. However, these compounds yield gas chromatography electron capture detector (GC-ECD) responses that are 10-2 -10-5 less than CFC-12, making purge and trap or field stripping GC-ECD approaches impractical. Therefore, in order to use dissolved HCFCs and HFCs as age tracers, different approaches are needed. To solve this problem, we developed an analytical method that uses an atomic emission detector (GC-AED) in place of an ECD to detect fluorinated compounds. In contrast to the ECD, the AED is a universally sensitive, highly linear, elementally specific detector. The new GC-AED system is being used to measure chlorodifluoromethane (HCFC-22), 1,1,1,2-tetrafluoroethane (HFC-134a), and other fluorinated compounds in one liter water samples to study their potential as age dating tracers. HCFC-22 is a
DEFF Research Database (Denmark)
Desideri, Adriano; Ommen, Torben Schmidt; Wronski, Jorrit
2016-01-01
fluids at typical working conditions of ORC systems for low temperature waste heat recovery (WHR) applications. Based on these premises, a novel testrig has been recently designed and built at the Technical University of Denmark to simulate the evaporating condition occurring in a small capacity ORC...... power unit. In this contribution the preliminary experimental results obtained from the first experimental campaign carried out on the rig are reported. HFC-134a was selected as working fluid. The experiments were carried out at saturation temperature of 60, 70 and 80 °C and inlet and outlet qualities...
FPGAs Emulate Microprocessors-A Successful Case for HFC NPP Digital I and C Upgrade
International Nuclear Information System (INIS)
Hsu, Allen; Crow, Ivan; Reese, Carl; Kim, Jong; Yang, Steve
2014-01-01
Field Programmable Gate Arrays (FPGAs), as programmable logic devices (PLDs) have gained a great deal of interests for implementing safety I and C applications in nuclear power plants (NPPs) largely owing to the FPGAs'potential advantage over the currently more common microprocessor-based digital I and C applications. First of all, FPGAs have adequate capabilities for most digital I and C applications in NPPs. Secondly, FPGAs provide products with longer lifetime, improve testability, and reduce the drift which occurs in analog-based systems, from hardware perspective. Thirdly, FPGAs, from software perspective, can be made simpler, less reliant on complex software such as operating systems, which should make FPGAs easier to qualify for nuclear safety applications. Fourthly, FPGAs are less vulnerable to cyber attacks when FPGAs implement the I and C systems that do not contain high-level, general purpose software that may be easily subjected to malicious modifications. Finally, FPGAs can bring cost reduction in an I and C digital upgrade because FPGAs can provide simpler licensing process than microprocessor-based digital I and C, and FPGAs can be implemented more efficiently. This paper will present one successful case for YGN Unit I and C upgrade using FPGA-based components to replace the obsolete Intel 8085 Microprocessor-based controllers. In this case, FPGAs emulated the process of the existing microprocessors and interpreted the execution of CPU processing. More than 160 of the FPGA-based SBC-01 controllers replacing the Intel 8085 Microprocessor-based Printed Circuit Boards have been installed and running successfully for safety I and C applications over the last five years. In this upgrade, the new FPGA-based controller board SBC-01 emulated the functions of Intel 8085 microprocessor correctly. It is a successful and cost-effective upgrade.vIn this paper, lifecycle design and implementation process and rigorous V and V activities that were used in the
FPGAs Emulate Microprocessors-A Successful Case for HFC NPP Digital I and C Upgrade
Energy Technology Data Exchange (ETDEWEB)
Hsu, Allen; Crow, Ivan; Reese, Carl; Kim, Jong; Yang, Steve [Doosan HF Controls Corp, Carrollton (United States)
2014-08-15
Field Programmable Gate Arrays (FPGAs), as programmable logic devices (PLDs) have gained a great deal of interests for implementing safety I and C applications in nuclear power plants (NPPs) largely owing to the FPGAs'potential advantage over the currently more common microprocessor-based digital I and C applications. First of all, FPGAs have adequate capabilities for most digital I and C applications in NPPs. Secondly, FPGAs provide products with longer lifetime, improve testability, and reduce the drift which occurs in analog-based systems, from hardware perspective. Thirdly, FPGAs, from software perspective, can be made simpler, less reliant on complex software such as operating systems, which should make FPGAs easier to qualify for nuclear safety applications. Fourthly, FPGAs are less vulnerable to cyber attacks when FPGAs implement the I and C systems that do not contain high-level, general purpose software that may be easily subjected to malicious modifications. Finally, FPGAs can bring cost reduction in an I and C digital upgrade because FPGAs can provide simpler licensing process than microprocessor-based digital I and C, and FPGAs can be implemented more efficiently. This paper will present one successful case for YGN Unit I and C upgrade using FPGA-based components to replace the obsolete Intel 8085 Microprocessor-based controllers. In this case, FPGAs emulated the process of the existing microprocessors and interpreted the execution of CPU processing. More than 160 of the FPGA-based SBC-01 controllers replacing the Intel 8085 Microprocessor-based Printed Circuit Boards have been installed and running successfully for safety I and C applications over the last five years. In this upgrade, the new FPGA-based controller board SBC-01 emulated the functions of Intel 8085 microprocessor correctly. It is a successful and cost-effective upgrade.vIn this paper, lifecycle design and implementation process and rigorous V and V activities that were used in the
Modelling for Fuel Optimal Control of a Variable Compression Engine
Nilsson, Ylva
2007-01-01
Variable compression engines are a mean to meet the demand on lower fuel consumption. A high compression ratio results in high engine efficiency, but also increases the knock tendency. On conventional engines with fixed compression ratio, knock is avoided by retarding the ignition angle. The variable compression engine offers an extra dimension in knock control, since both ignition angle and compression ratio can be adjusted. The central question is thus for what combination of compression ra...
Nishitani, Kohei; Mietus, Zachary; Beck, Christopher A; Ito, Hiromu; Matsuda, Shuichi; Awad, Hani A; Ehrhart, Nicole; Schwarz, Edward M
2017-01-01
Small animal studies have demonstrated significant high-dose recombinant parathyroid hormone1-34 (rPTH1-34) effects on intercalary allograft healing. Towards a human adjuvant therapy to decrease non-unions, we evaluated rPTH1-34 safety and efficacy in a clinically relevant canine femoral allograft model. Adult female mongrel hounds (n = 20) received a 5cm mid-diaphyseal osteotomy reconstructed with a plated allograft, and were randomized to: 1) Placebo (n = 5; daily saline), 2) Continuous rPTH1-34 (n = 7; 5 μg/kg/day s.c. from day 1-55 post-op), or 3) Delayed rPTH1-34 (n = 8; 5 μg/kg/day s.c. from day 14-28 post-op). Safety was assessed by physical behavior and blood calcium monitoring. Cone beam CT (CB-CT) was performed on days 14, 28 and 56 post-op to assess 2D cortical healing, 3D bone volume, and Union Ratio. Biomechanical testing and dynamic histomorphometry were also performed. The high drug dose was poorly tolerated, as most dogs receiving rPTH1-34 had to be given intravenous saline, and one dog died from hypercalcemia. Continuous rPTH1-34 significantly increased 2D healing and callus volumes at 4-weeks versus Placebo, and sustained the significant increase in cortical union at 8-week (p<0.05). These rPTH1-34 effects were confirmed by histomorphometry, revealing significant increases in mineral apposition rates (MAR) on host bone and graft-host junctions (p<0.05). Delayed rPTH1-34 significantly increased callus volume and MAR at 8 weeks (p<0.05). Although no biomechanical differences were observed, as expected for early healing, the results demonstrated that 2D RUST scoring significantly correlated with torsional biomechanics (p<0.01). In conclusion, 8-weeks of intermittent high-dose rPTH1-34 treatment significantly increases callus formation and accelerates bony union of intercalary massive allografts in a clinically relevant canine model, but with serious side-effects from hypercalcemia.
Directory of Open Access Journals (Sweden)
Kohei Nishitani
Full Text Available Small animal studies have demonstrated significant high-dose recombinant parathyroid hormone1-34 (rPTH1-34 effects on intercalary allograft healing. Towards a human adjuvant therapy to decrease non-unions, we evaluated rPTH1-34 safety and efficacy in a clinically relevant canine femoral allograft model. Adult female mongrel hounds (n = 20 received a 5cm mid-diaphyseal osteotomy reconstructed with a plated allograft, and were randomized to: 1 Placebo (n = 5; daily saline, 2 Continuous rPTH1-34 (n = 7; 5 μg/kg/day s.c. from day 1-55 post-op, or 3 Delayed rPTH1-34 (n = 8; 5 μg/kg/day s.c. from day 14-28 post-op. Safety was assessed by physical behavior and blood calcium monitoring. Cone beam CT (CB-CT was performed on days 14, 28 and 56 post-op to assess 2D cortical healing, 3D bone volume, and Union Ratio. Biomechanical testing and dynamic histomorphometry were also performed. The high drug dose was poorly tolerated, as most dogs receiving rPTH1-34 had to be given intravenous saline, and one dog died from hypercalcemia. Continuous rPTH1-34 significantly increased 2D healing and callus volumes at 4-weeks versus Placebo, and sustained the significant increase in cortical union at 8-week (p<0.05. These rPTH1-34 effects were confirmed by histomorphometry, revealing significant increases in mineral apposition rates (MAR on host bone and graft-host junctions (p<0.05. Delayed rPTH1-34 significantly increased callus volume and MAR at 8 weeks (p<0.05. Although no biomechanical differences were observed, as expected for early healing, the results demonstrated that 2D RUST scoring significantly correlated with torsional biomechanics (p<0.01. In conclusion, 8-weeks of intermittent high-dose rPTH1-34 treatment significantly increases callus formation and accelerates bony union of intercalary massive allografts in a clinically relevant canine model, but with serious side-effects from hypercalcemia.
Single and two-phase flow pressure drop for CANFLEX bundle
Energy Technology Data Exchange (ETDEWEB)
Park, Joo Hwan; Jun, Ji Su; Suk, Ho Chun [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of); Dimmick, G R; Bullock, D E [Atomic Energy of Canada Limited, Ontario (Canada)
1999-12-31
Friction factor and two-phase flow frictional multiplier for a CANFLEX bundle are newly developed and presented in this paper. CANFLEX as a 43-element fuel bundle has been developed jointly by AECL/KAERI to provide greater operational flexibility for CANDU reactor operators and designers. Friction factor and two-phase flow frictional multiplier have been developed by using the experimental data of pressure drops obtained from two series of Freon-134a (R-134a) CHF tests with a string of simulated CANFLEX bundles in a single phase and a two-phase flow conditions. The friction factor for a CANFLEX bundle is found to be about 20% higher than that of Blasius for a smooth circular pipe. The pressure drop predicted by using the new correlations of friction factor and two-phase frictional multiplier are well agreed with the experimental pressure drop data of CANFLEX bundle within {+-} 5% error. 11 refs., 5 figs. (Author)
Single and two-phase flow pressure drop for CANFLEX bundle
Energy Technology Data Exchange (ETDEWEB)
Park, Joo Hwan; Jun, Ji Su; Suk, Ho Chun [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of); Dimmick, G. R.; Bullock, D. E. [Atomic Energy of Canada Limited, Ontario (Canada)
1998-12-31
Friction factor and two-phase flow frictional multiplier for a CANFLEX bundle are newly developed and presented in this paper. CANFLEX as a 43-element fuel bundle has been developed jointly by AECL/KAERI to provide greater operational flexibility for CANDU reactor operators and designers. Friction factor and two-phase flow frictional multiplier have been developed by using the experimental data of pressure drops obtained from two series of Freon-134a (R-134a) CHF tests with a string of simulated CANFLEX bundles in a single phase and a two-phase flow conditions. The friction factor for a CANFLEX bundle is found to be about 20% higher than that of Blasius for a smooth circular pipe. The pressure drop predicted by using the new correlations of friction factor and two-phase frictional multiplier are well agreed with the experimental pressure drop data of CANFLEX bundle within {+-} 5% error. 11 refs., 5 figs. (Author)
Dutta, Debodyuti; Mishra, Sabyashachi
2016-11-17
In the fight against bacterial infections and antibiotic resistance, the dapE-encoded N-succinyl-l,l-diaminopimelic acid desuccinylase (DapE) is a potentially safe target enzyme. The role of the Glu134, His67, and His349 residues in the binding and hydrolysis of N-succinyl-l,l-diaminopimelic acid (SDAP) is investigated by employing molecular dynamics simulation and hybrid quantum mechanical-molecular mechanical (MM) calculations of the E134D, H67A, and H349A mutants of DapE. The free energy of substrate binding obtained from the MM-Poisson-Boltzmann surface area approach correctly reproduced the experimentally observed ordering of substrate affinity, that is, E134D > wt > H67A > H349A. The mechanism of catalytic action by the E134D mutant is elucidated by structurally and energetically characterizing the intermediates and the transition states along the reaction pathway. The rate-determining step in the general acid-base hydrolysis reaction by the E134D mutant is found to be the nucleophilic attack step, which involves an activation energy barrier 10 kcal/mol greater than that in the wild-type (wt)-DapE. This explains the 3 orders of magnitude decrease in the experimentally determined k cat value for the E134D mutant compared to that of wt-DapE. In the H67A and H349A mutants, the Glu134 residue undergoes a conformational change and exhibits a strong coordination with the metal centers. This not only results in a weaker substrate binding in the two histidine mutants but also hinders the activation of the catalytic water molecule, which constitutes the first step of the substrate hydrolysis by DapE. This leads to an effective quenching of the catalytic activity in the H67A and H349A mutants.
Monsieurs, Koenraad G; De Regge, Melissa; Vansteelandt, Kristof; De Smet, Jeroen; Annaert, Emmanuel; Lemoyne, Sabine; Kalmar, Alain F; Calle, Paul A
2012-11-01
BACKGROUND AND GOAL OF STUDY: The relationship between chest compression rate and compression depth is unknown. In order to characterise this relationship, we performed an observational study in prehospital cardiac arrest patients. We hypothesised that faster compressions are associated with decreased depth. In patients undergoing prehospital cardiopulmonary resuscitation by health care professionals, chest compression rate and depth were recorded using an accelerometer (E-series monitor-defibrillator, Zoll, U.S.A.). Compression depth was compared for rates 120/min. A difference in compression depth ≥0.5 cm was considered clinically significant. Mixed models with repeated measurements of chest compression depth and rate (level 1) nested within patients (level 2) were used with compression rate as a continuous and as a categorical predictor of depth. Results are reported as means and standard error (SE). One hundred and thirty-three consecutive patients were analysed (213,409 compressions). Of all compressions 2% were 120/min, 36% were 5 cm. In 77 out of 133 (58%) patients a statistically significant lower depth was observed for rates >120/min compared to rates 80-120/min, in 40 out of 133 (30%) this difference was also clinically significant. The mixed models predicted that the deepest compression (4.5 cm) occurred at a rate of 86/min, with progressively lower compression depths at higher rates. Rates >145/min would result in a depth compression depth for rates 80-120/min was on average 4.5 cm (SE 0.06) compared to 4.1 cm (SE 0.06) for compressions >120/min (mean difference 0.4 cm, Pcompression rates and lower compression depths. Avoiding excessive compression rates may lead to more compressions of sufficient depth. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Itai, Shunsuke; Yamada, Shinji; Kaneko, Mika K; Chang, Yao-Wen; Harada, Hiroyuki; Kato, Yukinari
2017-12-01
Epidermal growth factor receptor (EGFR), a receptor tyrosine kinase, activates downstream signaling cascades in many tumors. In this study, we established novel anti-EGFR monoclonal antibodies (mAbs) and characterized their efficacy in flow cytometry, Western blot, and immunohistochemical analyses. We immunized mice with a combination of the extracellular domain of EGFR and EGFR-overexpressing LN229 glioblastoma cells (LN229/EGFR) and performed the first screening using enzyme-linked immunosorbent assay. Next, we selected mAbs using flow cytometry. Among 156 established clones, two mAbs, EMab-51 (IgG 1 , kappa) and EMab-134 (IgG 1 , kappa), reacted with EGFR in Western blot analysis; EMab-134 showed a much higher sensitivity compared with EMab-51. We compared the binding affinities of EMab-51 and EMab-134 using flow cytometry; the calculated K D values for EMab-51 and EMab-134 against SAS cells/HSC-2 cells were 9.2 × 10 -9 M/9.9 × 10 -9 M and 2.6 × 10 -9 M/8.3 × 10 -9 M, respectively, indicating that EMab-134 has a higher affinity to EGFR-expressing cells. Immunohistochemical analysis of EMab-51 and EMab-134 showed sensitive and specific reactions against oral cancer cells; EMab-134 demonstrated a much higher sensitivity (36/38 cases; 94.7%) to oral squamous cell carcinomas compared with EMab-51 (6/38 cases; 15.8%). This novel anti-EGFR mAb, EMab-134, could be advantageous for detecting EGFR in the pathological analysis of EGFR-expressing cancers.
Directory of Open Access Journals (Sweden)
Hua Wang
Full Text Available Osteoporosis is a common disorder characterized by compromised bone strength that predisposes patients to increased fracture risk. Parathyroid hormone related protein (PTHrP is one of the candidates for clinical osteoporosis treatment. In this study, GST Gene Fusion System was used to express recombinant human PTHrP (hPTHrP 1-34 and 1-84. To determine whether the recombinant hPTHrP1-34 and 1-84 can enhance renal calcium reabsorption and promote bone formation, we examined effects of recombinant hPTHrP1-34 and 1-84 on osteogenic lineage commitment in a primary bone marrow cell culture system and on osteoporosis treatment. Results revealed that both of recombinant hPTHrP1-34 and 1-84 increased colony formation and osteogenic cell differentiation and mineralization in vitro; however, the effect of recombinant hPTHrP1-84 is a little stronger than that of hPTHrP1-34. Next, ovariectomy was used to construct osteoporosis animal model (OVX to test activities of these two recombinants in vivo. HPTHrP1-84 administration elevated serum calcium by up-regulating the expression of renal calcium transporters, which resulted in stimulation of osteoblastic bone formation. These factors contributed to augmented bone mass in hPTHrP1-84 treated OVX mice but did not affect bone resorption. There was no obvious bone mass alteration in hPTHrP1-34 treated OVX mice, which may be, at least partly, associated with shorter half-life of hPTHrP1-34 compared to hPTHrP1-84 in vivo. This study implies that recombinant hPTHrP1-84 is more effective than hPTHrP1-34 to enhance renal calcium reabsorption and to stimulate bone formation in vivo.
Soil to plant transfer of 134Cs for olive and orange trees after four years' experimentation
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.
1998-01-01
The transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) were calculated within a long-term glass-house pot experiment which was started in 1994. The effect of the soil characteristics on 134 Cs uptake was also studied using two soils with different physical and chemical properties. Both evergreen trees exhibited a similar behavior in the two soils, showing that a higher or lower uptake is not crop specific. The capacity of the trees for 134 Cs absorption through the roots seems to be significantly influenced by the soil type. The transfer factors were very low in the calcareous heavy soil and much higher in the acid light soil (up to 10 times for olives and 40 for the edible part of oranges). The difference in the TFs is higher between the two soils than between the two tree species. 134 Cs concentration kept increasing in the orange trees up to the 4th year of growth, while it seems to reach an equilibrium, with no further increase, in the olive trees. Although the behavior of the two tree species is similar, the difference in the final processed product is extreme. A significant amount of 134 Cs was observed in olives grown in the light-acid soil whereas no transfer to the olive oil was detected. On the other hand, the edible part of the oranges showed the highest 134 Cs of nearly all the plant parts
On Compression of a Heavy Compressible Layer of an Elastoplastic or Elastoviscoplastic Medium
Kovtanyuk, L. V.; Panchenko, G. L.
2017-11-01
The problem of deformation of a horizontal plane layer of a compressible material is solved in the framework of the theory of small strains. The upper boundary of the layer is under the action of shear and compressing loads, and the no-slip condition is satisfied on the lower boundary of the layer. The loads increase in absolute value with time, then become constant, and then decrease to zero.Various plasticity conditions are consideredwith regard to the material compressibility, namely, the Coulomb-Mohr plasticity condition, the von Mises-Schleicher plasticity condition, and the same conditions with the viscous properties of the material taken into account. To solve the system of partial differential equations for the components of irreversible strains, a finite-difference scheme is developed for a spatial domain increasing with time. The laws of motion of elastoplastic boundaries are presented, the stresses, strains, rates of strain, and displacements are calculated, and the residual stresses and strains are found.
STS-134 Re-Rendezvous Design History
Stuit, Timothy D.
2011-01-01
In preparation to provide the capability for the Orion spacecraft to rendezvous with the International Space Station (ISS), a new suite of relative navigation sensors are in development and will be tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the instruments on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle Orbiter at the end of the mission. Unlike the initial rendezvous and docking, the re-rendezvous profile would replicate the newly designed Orion coelliptic approach trajectory, something never before attempted with the Shuttle Orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this re-rendezvous to make the flight test successful. And all of this work had to be integrated with the normal operations of the ISS and Shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and re-rendezvous trajectory design that will prove not only the design of the relative navigation sensors for the Orion vehicle, but also will serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.
Vacancy behavior in a compressed fcc Lennard-Jones crystal
International Nuclear Information System (INIS)
Beeler, J.R. Jr.
1981-12-01
This computer experiment study concerns the determination of the stable vacancy configuration in a compressed fcc Lennard-Jones crystal and the migration of this defect in a compressed crystal. Isotropic and uniaxial compression stress conditions were studied. The isotropic and uniaxial compression magnitudes employed were 0.94 less than or equal to eta less than or equal to 1.5, and 1.0 less than or equal to eta less than or equal to 1.5, respectively. The site-centered vacancy (SCV) was the stable vacancy configuration whenever cubic symmetry was present. This includes all of the isotropic compression cases and the particular uniaxial compression case (eta = √2) that give a bcc structure. In addition, the SCV was the stable configuration for uniaxial compression eta 1.20, the SV-OP is an extended defect and, therefore, a saddle point for SV-OP migration could not be determined. The mechanism for the transformation from the SCV to the SV-OP as the stable form at eta = 1.29 appears to be an alternating sign [101] and/or [011] shear process
International Nuclear Information System (INIS)
Kang, Lae-Hyong; Lee, Dae-Oen; Han, Jae-Hung
2011-01-01
We introduce a new compression test method for piezoelectric materials to investigate changes in piezoelectric properties under the compressive stress condition. Until now, compression tests of piezoelectric materials have been generally conducted using bulky piezoelectric ceramics and pressure block. The conventional method using the pressure block for thin piezoelectric patches, which are used in unimorph or bimorph actuators, is prone to unwanted bending and buckling. In addition, due to the constrained boundaries at both ends, the observed piezoelectric behavior contains boundary effects. In order to avoid these problems, the proposed method employs two guide plates with initial longitudinal tensile stress. By removing the tensile stress after bonding a piezoelectric material between the guide layers, longitudinal compressive stress is induced in the piezoelectric layer. Using the compression test specimens, two important properties, which govern the actuation performance of the piezoelectric material, the piezoelectric strain coefficients and the elastic modulus, are measured to evaluate the effects of applied electric fields and re-poling. The results show that the piezoelectric strain coefficient d 31 increases and the elastic modulus decreases when high voltage is applied to PZT5A, and the compression in the longitudinal direction decreases the piezoelectric strain coefficient d 31 but does not affect the elastic modulus. We also found that the re-poling of the piezoelectric material increases the elastic modulus, but the piezoelectric strain coefficient d 31 is not changed much (slightly increased) by re-poling
Amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole
International Nuclear Information System (INIS)
Saidov, D.K.; Rakhmonov, R.O.; Khodzhiboev, Yu.; Kukaniev, M.A.; Bandaev, S.
2015-01-01
Present article is devoted to amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole. The reaction of new modifications of derivatives of imidazo-[2.1-B]-1.3.4-thiadiazoles-2-bromine-6-p-bromophenyl and 2-alkyl alkylene sulfonyl-6-phenyl imidazo--[2.1-B]-1.3.4-thiadiazole on Mannich with secondary and heterocyclic amines was studied.
DEFF Research Database (Denmark)
Jepsen, Ditte Beck; Ryg, Jesper; Jørgensen, Niklas Rye
2018-01-01
Background: PaVOS is a randomized controlled trial (RCT) which aims to address the use of whole-body vibration exercise (WBV) in combination with parathyroid hormone 1-34 fragment teriparatide (PTH 1-34) treatment in patients with osteoporosis. PTH 1-34 is an effective but expensive anabolic...... fracture risk. Methods/design: PaVOS is a multicenter, assessor-blinded, superiority, two-armed randomized controlled trial (RCT). Postmenopausal women (n = 40, aged 50 years and older) starting taking PTH 1-34 from outpatient clinics will be randomized and assigned to a PTH 1-34 + WBV-exercise group...... (intervention group), or a PTH 1-34-alone group (control group). The intervention group will undergo WBV three sessions a week (12 min each, including 1:1 ratio of exercise: rest, 30 Hz, 1 mm amplitude) for a 12-month intervention period. Both the intervention and the control group will receive PTH 1...
Determination of Optimum Compression Ratio: A Tribological Aspect
Directory of Open Access Journals (Sweden)
L. Yüksek
2013-12-01
Full Text Available Internal combustion engines are the primary energy conversion machines both in industry and transportation. Modern technologies are being implemented to engines to fulfill today's low fuel consumption demand. Friction energy consumed by the rubbing parts of the engines are becoming an important parameter for higher fuel efficiency. Rate of friction loss is primarily affected by sliding speed and the load acting upon rubbing surfaces. Compression ratio is the main parameter that increases the peak cylinder pressure and hence normal load on components. Aim of this study is to investigate the effect of compression ratio on total friction loss of a diesel engine. A variable compression ratio diesel engine was operated at four different compression ratios which were "12.96", "15:59", "18:03", "20:17". Brake power and speed was kept constant at predefined value while measuring the in- cylinder pressure. Friction mean effective pressure ( FMEP data were obtained from the in cylinder pressure curves for each compression ratio. Ratio of friction power to indicated power of the engine was increased from 22.83% to 37.06% with varying compression ratio from 12.96 to 20:17. Considering the thermal efficiency , FMEP and maximum in- cylinder pressure optimum compression ratio interval of the test engine was determined as 18.8 ÷ 19.6.
10 CFR 63.134 - Monitoring and testing waste packages.
2010-01-01
....134 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A... geologic repository operations area, the environment of the waste packages selected for the waste package monitoring program must be representative of the environment in which the wastes are to be emplaced. (c) The...
Compression for radiological images
Wilson, Dennis L.
1992-07-01
The viewing of radiological images has peculiarities that must be taken into account in the design of a compression technique. The images may be manipulated on a workstation to change the contrast, to change the center of the brightness levels that are viewed, and even to invert the images. Because of the possible consequences of losing information in a medical application, bit preserving compression is used for the images used for diagnosis. However, for archiving the images may be compressed to 10 of their original size. A compression technique based on the Discrete Cosine Transform (DCT) takes the viewing factors into account by compressing the changes in the local brightness levels. The compression technique is a variation of the CCITT JPEG compression that suppresses the blocking of the DCT except in areas of very high contrast.
Numerical analysis of an air condenser working with the refrigerant fluid R407C
International Nuclear Information System (INIS)
Aprea, Ciro; Maiorino, Angelo
2007-01-01
As CFC (clorofluorocarbon) and HCFC (hydrochlorofluorocarbon) refrigerants which have been used as refrigerants in a vapour compression refrigeration system were know to provide a principal cause to ozone depletion and global warming, production and use of these refrigerants have been restricted. Therefore, new alternative refrigerants should be searched for, which fit to the requirements in an air conditioner or a heat pump, and refrigerant mixtures which are composed of HFC (hydrofluorocarbon) refrigerants having zero ODP (ozone depletion potential) are now being suggested as drop-in or mid-term replacement. However also these refrigerants, as the CFC and HCFC refrigerants, present a greenhouse effect. The zeotropic mixture designated as R407C (R32/R125/R134a 23/25/52% in mass) represents a substitute of the HCFC22 for high evaporation temperature applications as the air-conditioning. Aim of the paper is a numerical-experimental analysis for an air condenser working with the non azeotropic mixture R407C in steady-state conditions. A homogeneous model for the condensing refrigerant is considered to forecast the performances of the condenser; this model is capable of predicting the distributions of the refrigerant temperature, the velocity, the void fraction, the tube wall temperature and the air temperature along the test condenser. Obviously in the refrigerant de-superheating phase the numerical analysis becomes very simple. A comparison with the measurements on an air condenser mounted in an air channel linked to a vapour compression plant is discussed. The results show that the simplified model provides a reasonable estimation of the steady-state response and that this model is useful to design purposes
International Nuclear Information System (INIS)
Bengtsson, G.B.
1992-01-01
The recovery of superficially applied 134 Cs + and 85 Sr 2+ in apple branches protected from precipitation decreased with time. Translocation of 134 Cs to uncontaminated branches declined rapidly with the distance from the contaminated branches. Extensive translocation of 134 Cs from foliage to fruits occurred within the same branch: after 84 d, 50% of the recovered activity was found in fruits and most of it in the edible part (excluding peel). On the other hand, 85 Sr was less mobile and in virtually all fruit 85 Sr was in the peel. Rinsing leaves removed 30% of both radionuclides 1 d after contamination and decreasing fractions later on. Rinsing fruits removed up to 62% of the peel radionuclides. Further rinses and washes (plus detergent) of fruits showed that 134 Cs had the same distribution in the outer skin as 85 Sr and that the ratio of the two nuclides was close to the ratio in the contamination solution. This indicates that apple skin is a barrier not only to 85 Sr, but probably also to 134 Cs. Unaccounted for disappearance of radioactivity from fruits and leaves could have been a result to field losses of small superficial particles. (author)
Mammographic compression – A need for mechanical standardization
Energy Technology Data Exchange (ETDEWEB)
Branderhorst, Woutjan, E-mail: w.branderhorst@amc.nl [Academic Medical Center, Department of Biomedical Engineering & Physics, P.O. Box 22660, 1100 DD Amsterdam (Netherlands); Sigmascreening B.V., Meibergdreef 45, 1105 BA Amsterdam (Netherlands); Groot, Jerry E. de, E-mail: jerry.degroot@sigmascreening.com [Academic Medical Center, Department of Biomedical Engineering & Physics, P.O. Box 22660, 1100 DD Amsterdam (Netherlands); Highnam, Ralph, E-mail: ralph.highnam@volparasolutions.com [Volpara Solutions Limited, P.O. Box 24404, Manners St Central, Wellington 6142 (New Zealand); Chan, Ariane, E-mail: ariane.chan@volparasolutions.com [Volpara Solutions Limited, P.O. Box 24404, Manners St Central, Wellington 6142 (New Zealand); Böhm-Vélez, Marcela, E-mail: marcelabvelez@gmail.com [Weinstein Imaging Associates, 5850 Centre Avenue, Pittsburgh, PA 15206 (United States); Broeders, Mireille J.M., E-mail: mireille.broeders@radboudumc.nl [Radboud University Medical Center, Department for Health Evidence, P.O. Box 9101, 6500 HB Nijmegen (Netherlands); LRCB Dutch Reference Center for Screening, P.O. Box 6873, 6503 GJ Nijmegen (Netherlands); Heeten, Gerard J. den, E-mail: g.denheeten@lrcb.nl [Academic Medical Center, Department of Radiology, P.O. Box 22660, 1100 DD Amsterdam (Netherlands); LRCB Dutch Reference Center for Screening, P.O. Box 6873, 6503 GJ Nijmegen (Netherlands); Grimbergen, Cornelis A., E-mail: c.a.grimbergen@amc.uva.nl [Academic Medical Center, Department of Biomedical Engineering & Physics, P.O. Box 22660, 1100 DD Amsterdam (Netherlands); Sigmascreening B.V., Meibergdreef 45, 1105 BA Amsterdam (Netherlands)
2015-04-15
Highlights: •We studied mechanical breast compression practice in two different clinical sites. •We visualized the distributions of not only the applied force but also the pressure. •The applied pressure was highly variable, both within and between the data sets. •The average applied pressure and the variation were higher for smaller breasts. •A proposal for improved individualization, by standardizing pressure, is discussed. -- Abstract: Background: A lack of consistent guidelines regarding mammographic compression has led to wide variation in its technical execution. Breast compression is accomplished by means of a compression paddle, resulting in a certain contact area between the paddle and the breast. This procedure is associated with varying levels of discomfort or pain. On current mammography systems, the only mechanical parameter available in estimating the degree of compression is the physical entity of force (daN). Recently, researchers have suggested that pressure (kPa), resulting from a specific force divided by contact area on a breast, might be a more appropriate parameter for standardization. Software has now become available which enables device-independent cross-comparisons of key mammographic metrics, such as applied compression pressure (force divided by contact area), breast density and radiation dose, between patient populations. Purpose: To compare the current compression practice in mammography between different imaging sites in the Netherlands and the United States from a mechanical point of view, and to investigate whether the compression protocols in these countries can be improved by standardization of pressure (kPa) as an objective mechanical parameter. Materials and methods: We retrospectively studied the available parameters of a set of 37,518 mammographic compressions (9188 women) from the Dutch national breast cancer screening programme (NL data set) and of another set of 7171 compressions (1851 women) from a breast imaging
Call your health insurance or prescription plan: Find out if they pay for compression stockings. Ask if your durable medical equipment benefit pays for compression stockings. Get a prescription from your doctor. Find a medical equipment store where they can ...
Comparison of transfer factors of Sr-85 and Cs-134 for soils and crops of Greece
International Nuclear Information System (INIS)
Skarlou, V.; Papanicolaou, E. P.; Nobeli, C.
1994-01-01
The transfer of Sr-85 and Cs-134 from soil to plant (CR) was studied in two successive and similar in design glasshouse experiments. Six plant species (wheat, alfalfa, radish, string bean, cucumber, lettuce - only for Sr-85 - and endives - only for Cs-134), were grown in pots on eight Greek soils differing significantly in their physical and chemical properties. After the necessary measurements and analyses, big differences were detected in the transfer factors of both radionuclides with the soil types. The CRs of Sr-85 were higher than those of Cs-134 and for the tested crops and soils ranged between 0.3 and 36.5 for Sr-85 and between < 0.01 and 1.72 for Cs-134. The CRs of grains and seeds were much lower than those of leafy material for Sr-85 while the difference was not so high for Cs-134. The correlation between CRs and pH, negative in all cases, was significant or highly significant for all tested crops or plant parts (for Sr-85 r-bar = - 0.89, for Cs-134 r-bar = - 0.82). The values of CRs indicated a trend for negative correlation with other soil properties (cation exchange capacity-CEC, clay %). From exchangeable cations, exchangeable (Ca + Mg) as well as exchangeable bases, expressed as percentages of CEC, gave a significant or highly significant correlation with CRs of both radionuclides. (author)
Data compression of digital X-ray images from a clinical viewpoint
International Nuclear Information System (INIS)
Ando, Yutaka
1992-01-01
For the PACS (picture archiving and communication system), large storage capacity recording media and a fast data transfer network are necessary. When the PACS are working, these technology requirements become an large problem. So we need image data compression having a higher recording efficiency media and an improved transmission ratio. There are two kinds of data compression methods, one is reversible compression and other is the irreversible one. By these reversible compression methods, a compressed-expanded image is exactly equal to the original image. The ratio of data compression is about between 1/2 an d1/3. On the other hand, for irreversible data compression, the compressed-expanded image is a distorted image, and we can achieve a high compression ratio by using this method. In the medical field, the discrete cosine transform (DCT) method is popular because of the low distortion and fast performance. The ratio of data compression is actually from 1/10 to 1/20. It is important for us to decide the compression ratio according to the purposes and modality of the image. We must carefully select the ratio of the data compression because the suitable compression ratio alters in the usage of image for education, clinical diagnosis and reference. (author)
Chemically assisted laser ablation ICP mass spectrometry.
Hirata, Takafumi
2003-01-15
A new laser ablation technique combined with a chemical evaporation reaction has been developed for elemental ratio analysis of solid samples using an inductively coupled plasma mass spectrometer (ICPMS). Using a chemically assisted laser ablation (CIA) technique developed in this study, analytical repeatability of the elemental ratio measurement was successively improved. To evaluate the reliability of the CLA-ICPMS technique, Pb/U isotopic ratios were determined for zircon samples that have previously been analyzed by other techniques. Conventional laser ablation for Pb/U shows a serious elemental fractionation during ablation mainly due to the large difference in elemental volatility between Pb and U. In the case of Pb/U ratio measurement, a Freon R-134a gas (1,1,1,2-tetrafluoroethane) was introduced into the laser cell as a fluorination reactant. The Freon gas introduced into the laser cell reacts with the ablated sample U, and refractory U compounds are converted to a volatile U fluoride compound (UF6) under the high-temperature condition at the ablation site. This avoids the redeposition of U around the ablation pits. Although not all the U is reacted with Freon, formation of volatile UF compounds improves the transmission efficiency of U. Typical precision of the 206Pb/238U ratio measurement is 3-5% (2sigma) for NIST SRM 610 and Nancy 91500 zircon standard, and the U-Pb age data obtained here show good agreement within analytical uncertainties with the previously reported values. Since the observed Pb/U ratio for solid samples is relatively insensitive to laser power and ablation time, optimization of ablation conditions or acquisition parameters no longer needs to be performed on a sample-to-sample basis.
Meng, Fanjun; Li, Yan; Chi, Wenying; Li, Junfa
2016-07-01
Brain protection by narcotics such as morphine is clinically relevant due to the extensive use of narcotics in the perioperative period. Morphine preconditioning induces neuroprotection in neurons, but it remains uncertain whether microRNA-134 (miR-134) is involved in morphine preconditioning against oxygen-glucose deprivation-induced injuries in primary cortical neurons of mice. The present study examined this issue. After cortical neurons of mice were cultured in vitro for 6 days, the neurons were transfected by respective virus vector, such as lentiviral vector (LV)-miR-control-GFP, LV-pre-miR-134-GFP, LV-pre-miR-134-inhibitor-GFP for 24 hours; after being normally cultured for 3 days again, morphine preconditioning was performed by incubating the transfected primary neurons with morphine (3 μM) for 1 hour, and then neuronal cells were exposed to oxygen-glucose deprivation (OGD) for 1 hour and oxygen-glucose recovery for 12 hours. The neuronal cells survival rate and the amount of apoptotic neurons were determined by MTT assay or TUNEL staining at designated time; and the expression levels of miR-134 were detected using real-time reverse transcription polymerase chain reaction at the same time. The neuronal cell survival rate was significantly higher, and the amount of apoptotic neurons was significantly decreased in neurons preconditioned with morphine before OGD than that of OGD alone. The neuroprotection induced by morphine preconditioning was partially blocked by upregulating miR-134 expression, and was enhanced by downregulating miR-134 expression. The expression of miR-134 was significantly decreased in morphine-preconditioned neurons alone without transfection. By downregulating miR-134 expression, morphine preconditioning protects primary cortical neurons of mice against injuries induced by OGD.
Torque Modeling and Control of a Variable Compression Engine
Bergström, Andreas
2003-01-01
The SAAB variable compression engine is a new engine concept that enables the fuel consumption to be radically cut by varying the compression ratio. A challenge with this new engine concept is that the compression ratio has a direct influence on the output torque, which means that a change in compression ratio also leads to a change in the torque. A torque change may be felt as a jerk in the movement of the car, and this is an undesirable effect since the driver has no control over the compre...
19 CFR 134.35 - Articles substantially changed by manufacture.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles substantially changed by manufacture. 134... substantially changed by manufacture. (a) Articles other than goods of a NAFTA country. An article used in the United States in manufacture which results in an article having a name, character, or use differing from...
Apitanyasai, Kantamas; Amparyup, Piti; Charoensapsri, Walaiporn; Sangsuriya, Pakkakul; Tassanakajon, Anchalee
2018-05-01
Hemocyte homeostasis-associated protein (PmHHAP) was first identified as a viral-responsive gene, due to a high upregulation in transcription following white spot syndrome virus (WSSV) infection. Functional studies using RNA interference have suggested that PmHHAP is involved in hemocyte homeostasis by controlling apoptosis during WSSV infection. In this study, the role of PmHHAP in host-viral interactions was further investigated. Yeast two-hybrid assay and co-immunoprecipitation revealed that PmHHAP binds to an anti-apoptosis protein, WSSV134. The viral protein WSSV134 is a late protein of WSSV, expressed 24 h post infection (hpi). Gene silencing of WSSV134 in WSSV-infected shrimp resulted in a reduction of the expression level of the viral replication marker genes VP28, wsv477, and ie-1, which suggests that WSSV134 is likely involved in viral propagation. However, co-silencing of PmHHAP and WSSV134 counteracted the effects on WSSV infection, which implies the importance of the host-pathogen interaction between PmHHAP and WSSV134 in WSSV infection. In addition, caspase 3/7 activity was noticeably induced in the PmHHAP and WSSV134 co-silenced shrimp upon WSSV infection. Moreover, PmHHAP and WSSV134 inhibited caspase-induced activation of PmCasp in vitro in a non-competitive manner. Taken together, these results suggest that PmHHAP and WSSV134 play a role in the host-pathogen interaction and work concordantly to control apoptosis in WSSV infection. Copyright © 2018 Elsevier Ltd. All rights reserved.
Eckelbarger, Joseph D; Parker, Marshall H; Yap, Maurice Ch; Buysse, Ann M; Babcock, Jonathan M; Hunter, Ricky; Adelfinskaya, Yelena; Samaritoni, Jack G; Garizi, Negar; Trullinger, Tony K
2017-04-01
Optimization studies on a high-throughput screening (HTS) hit led to the discovery of a series of N-(6-arylpyridazin-3-yl)amides with insecticidal activity. It was hypothesized that the isosteric replacement of the pyridazine ring with a 1,3,4-thiadiazole ring could lead to more potent biological activity and/or a broader sap-feeding pest spectrum. The resulting N-(5-aryl-1,3,4-thiadiazol-2-yl)amides were explored as a new class of insecticides. Several methods for 2-amino-1,3,4-thiadiazole synthesis were used for the preparation of key synthetic intermediates. Subsequent coupling to variously substituted carboxylic acid building blocks furnished the final targets, which were tested for insecticidal activity against susceptible strains of Aphis gossypii (Glover) (cotton aphid), Myzus persicae (Sulzer) (green peach aphid) and Bemisia tabaci (Gennadius) (sweetpotato whitefly). Structure-activity relationship (SAR) studies on both the amide tail and the aryl A-ring of novel N-(5-aryl-1,3,4-thiadiazol-2-yl)amides led to a new class of insecticidal molecules active against sap-feeding insect pests. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
International Nuclear Information System (INIS)
Haggard, D.L.; Tanner, J.E.
1997-06-01
Nondestructive assay (NDA) gamma spectroscopy techniques were used to measure 134/137 Cs ratios on nine PuAl Mark 42 fuel assemblies. The purpose of the ratio measurement was to confirm theoretical burnup calculations. 134/137 Cs ratios were determined from the measured activity based on corrected net peak area counts for the 605 keV peak from 134 Cs and the 662 keV peak from 137 Cs/ 137m Ba. Assembly No. 2 134/137 Cs ratio measured on 4-15-92 was 0.19. The measured 134/137 Cs ratio was decay corrected to be 2.11 on 8-1-84 based on the half lives of 134 Cs and 137 Cs. The measured 134/137 Cs ratio range was 1.90--2.14 for all nine assemblies. These measured values compare to a theoretical ratio of 1.7 on 8-1-84 determined by burnup calculations. Total cesium curie content was also requested and determined using the NDA direct measurements. Gamma spectral data were measured on the nine sectioned Mark 42 fuel assemblies. Measured cesium curie content, decay corrected to 8-1-84, ranged from 18170--24480 curies of 134 Cs and 8620--11646 curies of 137 Cs. Theoretical cesium curie content of 8-1-84 was 15200 curies 134 Cs and 8973 curies 137 Cs. Direct assay cesium ratio is 12% to 26% higher than the predicted ratio of 1.7. The measured 134 Cs data indicate between 20%--61% more activity than that predicted by the burnup code, whereas the measured 137 Cs activity is between 4% less to 30% more than the predicted activity. This information may be used to address issues concerning criticality safety, storage, and shipping of this type of material
Energy Technology Data Exchange (ETDEWEB)
Poellmann, K. [Clariant GmbH (Germany)
2004-08-01
For many years polyalkylene glycols have been used as base fluids for special lubricants. In this matter they compete with polyol esters and polyalphaolefines. Synthesis of polyalkylen glycols is founded upon the anionic polymerisation of ethyleneoxid, propyleneoxid and if necessary of other oxigen-containing monomeres. The flexibility of this synthesis is the reason that polyalkylene glycole is a collective term, including a broad group of base fluids with partly extreme different properties. Typical for polyalkylene glycols is a high viscosity-index, watersolubility and adsorbing power for water, low friction numbers, but also the incompatibility with current mineral-oil-soluble additive systems. Because of this quality profile there has been developped specific niche-applications in the lubricant-area for polyalkylene glycols in the last 30 years, where each of the specific benefits has been used. Among them are watercontaining HFC hydraulicfluids, refrigerator oils, and oils for ethylene-compressors. HFC fluids are formulated with high-viscous, water-soluble polyalkylene glycols. For refrigerator oils in motor-car conditioning the R 134A compatibility of water-insoluble polyalkylene glycols is essential. For the use in ethylene-compressors the crucial point is the insolubility of polyalkylene glycol in ethylene. (orig.)
International Nuclear Information System (INIS)
Massas, I.; Skarlou, C.; Anoussis, J.; Haidouti, C.; Arapis, G.
1999-01-01
The effect of soil pH on 134 Cs TFs as well as the fate of 134 Cs in the extracted oil was studied in a greenhouse experiment with soybean and sunflower plants. A soil with pH 4.2 was used as a basis and its pH value has increased to 5.7, 6.5 and 7.6 (by the addition of different amounts of Ca(OH) 2 ). The lowest TF value was observed in the calcareous soil (pH 7.6), while the highest in the lowest pH (4.2) for the vegetative part and in the pH 6.5 for the edible part for both studied plants. TFs were practically the same for soya plants grown on the three lowest soil pH and reduced significantly only at pH 7.6 for either pods or other plant material. However, the lowest/highest TF was ∼ 4 for pods and ∼ 6 for the other plant material. For the sunflower plants while TFs for other plant material reduced from lowest to highest soil pH by only a factor of 2, for the seeds TFs remained rather constant. The difference in TF between the two studied species in each soil pH was in some cases higher than the difference due to pH effect. When an oil fraction (∼ 20 %) was extracted from seeds of both plants, no 134 Cs was detected. Refs. 4 (author)
17 CFR 1.34 - Monthly record, “point balance”.
2010-04-01
... REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Recordkeeping § 1.34 Monthly record, “point balance”. (a) Each... statement commonly known as a “point balance,” which accrues or brings to the official closing price, or... contracts long and short in the customers' accounts are in balance with those in the carrying futures...
Developing a dynamic control system for mine compressed air networks
Van Heerden, S.W.; Pelzer, R.; Marais, J.H.
2014-01-01
Mines in general, make use of compressed air systems for daily operational activities. Compressed air on mines is traditionally distributed via compressed air ring networks where multiple shafts are supplied with compressed air from an integral system. These compressed air networks make use of a number of compressors feeding the ring from various locations in the network. While these mines have sophisticated control systems to control these compressors, they are not dynamic systems. Compresso...
Environmentally benign synthesis of sydnone containing 1,3,4 ...
Indian Academy of Sciences (India)
TECS
lop benign synthetic methods for sydnone deriva- tives,. 9 we report here a new series of sydnone containing 1,3,4-thiadiazines by microwave irradia- tion under solvent-free conditions. 2. Experimental. 2.1 General remarks. Melting points were determined by open capillary method and are uncorrected. All compounds were.
Charitonidis, N.; Karyotakis, Y.; Gatignon, L.
2017-11-01
Gases with relatively high refractive index, n - 1 ≥ 500 ×10-6 at atmospheric pressure, giving a satisfactory photoelectron yield at relatively low pressures (≤ 5 bar) are rare. These gases are often the only practical solution for low momentum particle identification in conventional secondary beam lines. The refractive index of R134a, one of the most common gases available to the physics community, has never been measured or reported. In the present note, the results of a dedicated experiment to estimate the refractive index of R134a, using mixed hadron/electron beams in the range 0.5-10 GeV are presented.
Final report on CCQM-P151: Halocarbons in dry whole air
Rhoderick, George; Guenther, Franklin; Duewer, David; Lee, Jeongsoon; Seog Kim, Jin; Hall, Bradley; Weiss, Ray; Harth, Christina; Reimann, Stefan; Vollmer, Martin
2014-01-01
The growing awareness of climate change/global warming and continuing concerns regarding stratospheric ozone depletion will require future measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track and control the emissions of these species globally in the atmosphere, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. This report describes the results of a pilot study between National Metrology Institutes and atmospheric research laboratories for several of the more important halocarbons at atmospheric concentration levels. The comparison includes the chlorofluorocarbons (CFCs) dichlorodifluoromethane (CFC 12), trichlorofluoromethane (CFC 11), and 1,1,2-trichlorotrifluoroethane (CFC 113); the hydrochlorofluorocarbons (HCFCs) chlorodifluoromethane (HCFC 22) and 1-chloro-1,1-difluoroethane (HCFC 142b); and the hydrofluorocarbon (HFC) 1,1,1,2-tetrafluoroethane (HFC 134a), all in a dried whole air sample. The objective of this key comparison is to compare the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. Main text. To reach the main text of this paper, click on Final Report. The final report has been peer-reviewed and approved for publication by the CCQM.
International Nuclear Information System (INIS)
Green, W.J.
1981-12-01
Comparisons have been made between experimental critical heat flux (CHF) data for upflow of water in uniformly heated vertical tubes and values calculated from an empirical CHF correlation developed from Freon-12 data. When this correlation is re-evaluated to account for vapour Prandtl number effects, very good agreement is obtained between experimental data and calculated values over a wide range of coolant conditions. Comparison of values calculated from the revised correlation with 2063 sets of CHF data obtained from experiments with water in vertical, uniformly heated tubes shows a mean ratio of the calculated to experimental CHF of 0.82 and an r.m.s. error of 5.8 per cent for the following coolant conditions: (1) local pressure of 3.4 to 12 MPa; (2) mass flux greater than approx. 300 kg s -1 m -2 , and (3) thermal equilibrium value of exit quality greater than 0.1
Atmospheric chemistry of HFC-134a. Kinetic and mechanistic study of the CF3CFHO2 + NO2 reaction
DEFF Research Database (Denmark)
Møgelberg, T.E.; Nielsen, O.J.; Sehested, J.
1994-01-01
A pulse radiolysis system was used to study the kinetics of the reaction of CF3CFHO2 with NO2. By monitoring the rate of the decay of NO2 using its absorption at 400 nm the reaction rate constant was determined to be k = (5.0 +/- 0.5) x 10(-12) cm3 molecule-1 s-1. A long path length Fourier......-transform infrared technique was used to investigate the thermal decomposition of the product CF3CFHO2NO2. At 296 K in the presence of 700 Torr of air, decomposition of CF3CFHO2NO2 was rapid (greater than 90% decomposition within 3 min). The results are discussed in the context of atmospheric chemistry of CF3CFH2...
Recoil Experiments Using a Compressed Air Cannon
Taylor, Brett
2006-01-01
Ping-Pong vacuum cannons, potato guns, and compressed air cannons are popular and dramatic demonstrations for lecture and lab. Students enjoy them for the spectacle, but they can also be used effectively to teach physics. Recently we have used a student-built compressed air cannon as a laboratory activity to investigate impulse, conservation of…
Neutralized drift compression experiments with a high-intensity ion beam
International Nuclear Information System (INIS)
Roy, P.K.; Yu, S.S.; Waldron, W.L.; Anders, A.; Baca, D.; Barnard, J.J.; Bieniosek, F.M.; Coleman, J.; Davidson, R.C.; Efthimion, P.C.; Eylon, S.; Friedman, A.; Gilson, E.P.; Greenway, W.G.; Henestroza, E.; Kaganovich, I.; Leitner, M.; Logan, B.G.; Sefkow, A.B.; Seidl, P.A.; Sharp, W.M.; Thoma, C.; Welch, D.R.
2007-01-01
To create high-energy density matter and fusion conditions, high-power drivers, such as lasers, ion beams, and X-ray drivers, may be employed to heat targets with short pulses compared to hydro-motion. Both high-energy density physics and ion-driven inertial fusion require the simultaneous transverse and longitudinal compression of an ion beam to achieve high intensities. We have previously studied the effects of plasma neutralization for transverse beam compression. The scaled experiment, the Neutralized Transport Experiment (NTX), demonstrated that an initially un-neutralized beam can be compressed transversely to ∼1 mm radius when charge neutralization by background plasma electrons is provided. Here, we report longitudinal compression of a velocity-tailored, intense, neutralized 25 mA K + beam at 300 keV. The compression takes place in a 1-2 m drift section filled with plasma to provide space-charge neutralization. An induction cell produces a head-to-tail velocity ramp that longitudinally compresses the neutralized beam, enhances the beam peak current by a factor of 50 and produces a pulse duration of about 3 ns. The physics of longitudinal compression, experimental procedure, and the results of the compression experiments are presented
Dynamics of cesium-134 and biomass in treated and untreated turkey oak leaf-litter bags
International Nuclear Information System (INIS)
Croom, J.M.; Ragsdale, H.L.
1978-01-01
Litter bags were prepared from leaves harvested in late fall from turkey oak trees (Quercus laevis) tagged with 134 Cs. Untreated bags and bags treated by soaking in 1000 ppM HgCl 2 were placed in the field on Dec. 7, 1974. Five bags of each treatment were retrieved at 7-, 14-, and 30-day intervals as the experiment progressed. Treated bags remained free of visible fungal hyphae growth for 12 weeks. Untreated bags had lost more weight but less 134 Cs than treated bags after 14 and 56 days, respectively. After 9 months, untreated bags had lost 33% weight and 90% 134 Cs. Although 134 Cs is rapidly leached from litter (ecological half-life approximately equal to 12 weeks), some is retained by fungal hyphae on leaf-litter surfaces. This mechanism of mineral retention in the litter layer could represent adaptation at the ecosystem level for nutrient conservation
Peterson, P Gabriel; Pak, Sung K; Nguyen, Binh; Jacobs, Genevieve; Folio, Les
2012-12-01
This study aims to evaluate the utility of compressed computed tomography (CT) studies (to expedite transmission) using Motion Pictures Experts Group, Layer 4 (MPEG-4) movie formatting in combat hospitals when guiding major treatment regimens. This retrospective analysis was approved by Walter Reed Army Medical Center institutional review board with a waiver for the informed consent requirement. Twenty-five CT chest, abdomen, and pelvis exams were converted from Digital Imaging and Communications in Medicine to MPEG-4 movie format at various compression ratios. Three board-certified radiologists reviewed various levels of compression on emergent CT findings on 25 combat casualties and compared with the interpretation of the original series. A Universal Trauma Window was selected at -200 HU level and 1,500 HU width, then compressed at three lossy levels. Sensitivities and specificities for each reviewer were calculated along with 95 % confidence intervals using the method of general estimating equations. The compression ratios compared were 171:1, 86:1, and 41:1 with combined sensitivities of 90 % (95 % confidence interval, 79-95), 94 % (87-97), and 100 % (93-100), respectively. Combined specificities were 100 % (85-100), 100 % (85-100), and 96 % (78-99), respectively. The introduction of CT in combat hospitals with increasing detectors and image data in recent military operations has increased the need for effective teleradiology; mandating compression technology. Image compression is currently used to transmit images from combat hospital to tertiary care centers with subspecialists and our study demonstrates MPEG-4 technology as a reasonable means of achieving such compression.
Pamula, Venkata Rajesh; Valero-Sarmiento, Jose Manuel; Yan, Long; Bozkurt, Alper; Hoof, Chris Van; Helleputte, Nick Van; Yazicioglu, Refet Firat; Verhelst, Marian
2017-06-01
A compressive sampling (CS) photoplethysmographic (PPG) readout with embedded feature extraction to estimate heart rate (HR) directly from compressively sampled data is presented. It integrates a low-power analog front end together with a digital back end to perform feature extraction to estimate the average HR over a 4 s interval directly from compressively sampled PPG data. The application-specified integrated circuit (ASIC) supports uniform sampling mode (1x compression) as well as CS modes with compression ratios of 8x, 10x, and 30x. CS is performed through nonuniformly subsampling the PPG signal, while feature extraction is performed using least square spectral fitting through Lomb-Scargle periodogram. The ASIC consumes 172 μ W of power from a 1.2 V supply while reducing the relative LED driver power consumption by up to 30 times without significant loss of relevant information for accurate HR estimation.
13 CFR 134.618 - How are awards paid?
2010-01-01
... CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Implementation of the Equal Access to Justice Act § 134... of Financial Operations, SBA, P.O. Box 205, Denver, CO 80201-0205. SBA will pay you the amount awarded within 60 days of receipt of your request unless it is notified that you or another party has...
A new compressed air energy storage refrigeration system
International Nuclear Information System (INIS)
Wang Shenglong; Chen Guangming; Fang Ming; Wang Qin
2006-01-01
In this study, a new compressed air energy storage (CAES) refrigeration system is proposed for electrical power load shifting application. It is a combination of a gas refrigeration cycle and a vapor compression refrigeration cycle. Thermodynamic calculations are conducted to investigate the performance of this system. Economic analysis is performed to study the operating cost of the system, and comparison is made with a vapor compression refrigeration system and an ice storage refrigeration system. The results indicate that the CAES refrigeration system has the advantages of simple structure, high efficiency and low operating cost
Accidental fatal lung injury by compressed air: a case report.
Rayamane, Anand Parashuram; Pradeepkumar, M V
2015-03-01
Compressed air is being used extensively as a source of energy at industries and in daily life. A variety of fatal injuries are caused by improper and ignorant use of compressed air equipments. Many types of injuries due to compressed air are reported in the literature such as colorectal injury, orbital injury, surgical emphysema, and so on. Most of these injuries are accidental in nature. It is documented that 40 pounds per square inch pressure causes fatal injuries to the ear, eyes, lungs, stomach, and intestine. Openings of body are vulnerable to injuries by compressed air. Death due to compressed air injuries is rarely reported. Many cases are treated successfully by conservative or surgical management. Extensive survey of literature revealed no reports of fatal injury to the upper respiratory tract and lungs caused by compressed air. Here, we are reporting a fatal event of accidental death after insertion of compressed air pipe into the mouth. The postmortem findings are corroborated with the history and discussed in detail.
International Nuclear Information System (INIS)
Ishizu, H.; Yamada, T.
2013-01-01
A certified reference material using activated alumina powder certified for activity of 134 Cs and 137 Cs was developed. The results of the verification and the certification are described. The certified reference material can be used for quality assurance of screening activity measurements of 134 Cs and 137 Cs in food/foodstuffs. Commercially available equipments were experimentally tested using the CRM and another CRM including 40 K. The results of these tests are also shown. - Highlights: • CRM of 134 Cs and 137 Cs using activated alumina was developed. • CRM including 134 Cs, 137 Cs and 40 K was also developed. • Results of experimental performance test of commercial inspection equipments using CRMs were shown
A new hyperspectral image compression paradigm based on fusion
Guerra, Raúl; Melián, José; López, Sebastián.; Sarmiento, Roberto
2016-10-01
The on-board compression of remote sensed hyperspectral images is an important task nowadays. One of the main difficulties is that the compression of these images must be performed in the satellite which carries the hyperspectral sensor. Hence, this process must be performed by space qualified hardware, having area, power and speed limitations. Moreover, it is important to achieve high compression ratios without compromising the quality of the decompress image. In this manuscript we proposed a new methodology for compressing hyperspectral images based on hyperspectral image fusion concepts. The proposed compression process has two independent steps. The first one is to spatially degrade the remote sensed hyperspectral image to obtain a low resolution hyperspectral image. The second step is to spectrally degrade the remote sensed hyperspectral image to obtain a high resolution multispectral image. These two degraded images are then send to the earth surface, where they must be fused using a fusion algorithm for hyperspectral and multispectral image, in order to recover the remote sensed hyperspectral image. The main advantage of the proposed methodology for compressing remote sensed hyperspectral images is that the compression process, which must be performed on-board, becomes very simple, being the fusion process used to reconstruct image the more complex one. An extra advantage is that the compression ratio can be fixed in advanced. Many simulations have been performed using different fusion algorithms and different methodologies for degrading the hyperspectral image. The results obtained in the simulations performed corroborate the benefits of the proposed methodology.
Cupriavidus necator JMP134 rapidly reduces furfural with a Zn-dependent alcohol dehydrogenase.
Li, Qunrui; Metthew Lam, L K; Xun, Luying
2011-11-01
Ethanol is a renewable biofuel, and it can be produced from lignocellulosic biomass. The biomass is usually converted to hydrolysates that consist of sugar and sugar derivatives, such as furfural. Yeast ferments sugar to ethanol, but furfural higher than 3 mM is inhibitory. It can take several days for yeast cells to reduce furfural to non-inhibitory furfuryl alcohol before producing ethanol. Bioreduction of furfural to furfuryl alcohol before fermentation may relieve yeast from furfural toxicity. We observed that Cupriavidus necator JMP134, a strict aerobe, rapidly reduced 17 mM furfural to less than 3 mM within 14 min with cell turbidity of 1.0 at 600 nm at 50°C. The rapid reduction consumed ethanol. The "furfural reductase" (FurX) was purified, and it oxidized ethanol to acetaldehyde and reduced furfural to furfuryl alcohol with NAD(+) as the cofactor. The protein was identified with mass spectrometry fingerprinting to be a hypothetical protein belonging to Zn-dependent alcohol dehydrogenase family. The furX-inactivation mutant of C. necator JMP134 lost the ability to rapidly reduce furfural, and Escherichia coli producing recombinant FurX gained the ability. Thus, an alcohol dehydrogenase enabled bacteria to rapidly reduce furfural with ethanol as the reducing power.
Accumulation, distribution and excretion of 134Cs and 65Zn by the green mussels (Perna Viridis)
International Nuclear Information System (INIS)
Chen Shunhua; Zhong Chuangguang; Yan Yuanyi; Zhao Xiaokui; Peng Yefang; Shi Qiong
1997-10-01
Two important radionuclides 134 Cs and 65 Zn were applied to study the accumulation, distribution and excretion of radioactive nuclides in organs and tissues of green mussel Perna Viridis. the results showed that the uptake rate of 134 Cs by green mussels was very low and the concentration factor (CF) for 134 Cs in the byssus approximated to 1. This CF value was lower than that of other tissues and organs of mussels, but its excretion rate was much higher than that of soft tissues. It was also found that the byssus of mussels had a special ability to accumulate 65 Zn. Concentration factor (CF) for 65 Zn in the byssus could reach as high as 900, which was much higher than that of any other tissues. However, its excretion rate was lower than that of other tissues and organs. The uptake rate of 65 Zn by soft tissues was markedly higher than that of 134 Cs. The mussels could also highly concentrate the low level 65 Zn even if specific activity of 65 Zn was very low in the environmental seawater. Results of radioactive trace experiments showed that the absorption of 134 Cs and 65 Zn by Perna Viridis was selective
Microbuckling compression failure of a radiation-induced wood/polymer composite
International Nuclear Information System (INIS)
Boey, F.Y.C.
1990-01-01
A wood/polymer composite was produced by impregnating Ramin wood with methyl methacrylate monomer and subsequently polymerizing it by gamma irradiation. To assess the improvement in compression strength of the wood caused by the polymer impregnation, a microbuckling compression failure mechanism was used to model the compression failure of the composite. Such a mechanism was found to predict a linear relationship between the compression strength and the percentage polymer impregnation (by weight). Uniaxial compression test results at 45(±5)% and 90(±5)% relative humidity levels, after being statistically analysed, showed that such a linear relationship was valid for up to 100% polymer impregnation. (author)
Optimization of Error-Bounded Lossy Compression for Hard-to-Compress HPC Data
Energy Technology Data Exchange (ETDEWEB)
Di, Sheng; Cappello, Franck
2018-01-01
Since today’s scientific applications are producing vast amounts of data, compressing them before storage/transmission is critical. Results of existing compressors show two types of HPC data sets: highly compressible and hard to compress. In this work, we carefully design and optimize the error-bounded lossy compression for hard-tocompress scientific data. We propose an optimized algorithm that can adaptively partition the HPC data into best-fit consecutive segments each having mutually close data values, such that the compression condition can be optimized. Another significant contribution is the optimization of shifting offset such that the XOR-leading-zero length between two consecutive unpredictable data points can be maximized. We finally devise an adaptive method to select the best-fit compressor at runtime for maximizing the compression factor. We evaluate our solution using 13 benchmarks based on real-world scientific problems, and we compare it with 9 other state-of-the-art compressors. Experiments show that our compressor can always guarantee the compression errors within the user-specified error bounds. Most importantly, our optimization can improve the compression factor effectively, by up to 49% for hard-tocompress data sets with similar compression/decompression time cost.
International Nuclear Information System (INIS)
Turpie, A.G.; Hirsh, J.; Gent, M.; Julian, D.; Johnson, J.
1989-01-01
In a randomized trial of neurosurgical patients, groups wearing graduated compression stockings alone (group 1) or graduated compression stockings plus intermittent pneumatic compression (IPC) (group 2) were compared with an untreated control group in the prevention of deep vein thrombosis (DVT). In both active treatment groups, the graduated compression stockings were continued for 14 days or until hospital discharge, if earlier. In group 2, IPC was continued for seven days. All patients underwent DVT surveillance with iodine 125-labeled fibrinogen leg scanning and impedance plethysmography. Venography was carried out if either test became abnormal. Deep vein thrombosis occurred in seven (8.8%) of 80 patients in group 1, in seven (9.0%) of 78 patients in group 2, and in 16 (19.8%) of 81 patients in the control group. The observed differences among these rates are statistically significant. The results of this study indicate that graduated compression stockings alone or in combination with IPC are effective methods of preventing DVT in neurosurgical patients
Concentration of 134Cs and 137Cs in Malaysian palm products
International Nuclear Information System (INIS)
Yii Mei Wo; Nor Aza Hassan; Narizan Sanusi
2008-08-01
Until today, countries importing food products from Malaysia, in region such as Indian Continental, Middle East, Central Europe and Central America still require the products to be tested for the radioactive contamination particularly for 134 Cs and 137 Cs. Information extracted from 3371 analytical results observed on isotopic concentration for 134 Cs and 137 Cs in the exported Malaysia origins palm products between years 2002 until 2007 had been summarized and reported in this work. Data shown that the concentration level of the concerned radio nuclides are below the minimum detectable activity and also well below maximum permissible limits adopted by Malaysian Government and also the international bodies. (Author)
A soft compressive sensor using dielectric elastomers
International Nuclear Information System (INIS)
Zhang, Hongying; Wang, Michael Yu; Li, Jisen; Zhu, Jian
2016-01-01
This paper proposes a methodology to design, analyze and fabricate a soft compressive sensor, made of dielectric elastomers that are able to recover from large strain. Each module of the compressive sensor is modeled as a capacitor, comprising a DE membrane sandwiched between two compliant electrodes. When the sensor modules aligned in an array were subject to a compressive load, the induced deformation on the corresponding module resulted in capacitance increase. By detecting the capacitance signal, not only the position but also the magnitude of the compressive load were obtained. We built an analytical model to simulate the mechanical–electrical responses of two common soft sensor structures, namely with and without an embedded air chamber. The simulation results showed that the air embedded prototype improved the sensitivity of the sensor significantly, which was consistent with the experimental results, where the sensitivity is enhanced from 0.05 N −1 to 0.91 N −1 . Furthermore, the effect of the air chamber dimension on the sensitivity is also discussed theoretically and experimentally. It concluded that the detection range increased with the air chamber height over length ratio. (paper)
Effect of evaporator temperature on vapor compression refrigeration system
Directory of Open Access Journals (Sweden)
Abdullah A.A.A. Al-Rashed
2011-12-01
Full Text Available This paper presents a comparable evaluation of R600a (isobutane, R290 (propane, R134a, R22, for R410A, and R32 an optimized finned-tube evaporator, and analyzes the evaporator effect on the system coefficient of performance (COP. Results concerning the response of a refrigeration system simulation software to an increase in the amount of oil flowing with the refrigerant are presented. It is shown that there is optima of the apparent overheat value, for which either the exchanged heat or the refrigeration coefficient of performance (COP is maximized: consequently, it is not possible to optimize both the refrigeration COP and the evaporator effect. The obtained evaporator optimization results were incorporated in a conventional analysis of the vapor compression system. For a theoretical cycle analysis without accounting for evaporator effects, the COP spread for the studied refrigerants was as high as 11.7%. For cycle simulations including evaporator effects, the COP of R290 was better than that of R22 by up to 3.5%, while the remaining refrigerants performed approximately within a 2% COP band of the R22 baseline for the two condensing temperatures considered.
Zhao, Xianxian; Tang, Juan; Wang, Xu; Yang, Ruoheng; Zhang, Xiaoping; Gu, Yunfu; Li, Xi; Ma, Menggen
2015-05-01
Furfural and 5-hydroxymethylfurfural (HMF) are the two main aldehyde compounds derived from pentoses and hexoses, respectively, during lignocellulosic biomass pretreatment. These two compounds inhibit microbial growth and interfere with subsequent alcohol fermentation. Saccharomyces cerevisiae has the in situ ability to detoxify furfural and HMF to the less toxic 2-furanmethanol (FM) and furan-2,5-dimethanol (FDM), respectively. Herein, we report that an uncharacterized gene, YNL134C, was highly up-regulated under furfural or HMF stress and Yap1p and Msn2/4p transcription factors likely controlled its up-regulated expression. Enzyme activity assays showed that YNL134C is an NADH-dependent aldehyde reductase, which plays a role in detoxification of furfural to FM. However, no NADH- or NADPH-dependent enzyme activity was observed for detoxification of HMF to FDM. This enzyme did not catalyse the reverse reaction of FM to furfural or FDM to HMF. Further studies showed that YNL134C is a broad-substrate aldehyde reductase, which can reduce multiple aldehydes to their corresponding alcohols. Although YNL134C is grouped into the quinone oxidoreductase family, no quinone reductase activity was observed using 1,2-naphthoquinone or 9,10-phenanthrenequinone as a substrate, and phylogenetic analysis indicates that it is genetically distant to quinone reductases. Proteins similar to YNL134C in sequence from S. cerevisiae and other microorganisms were phylogenetically analysed. Copyright © 2015 John Wiley & Sons, Ltd.
Babbitt, Wm Randall; Barber, Zeb W; Renner, Christoffer
2011-12-15
Compressive sampling has been previously proposed as a technique for sampling radar returns and determining sparse range profiles with a reduced number of measurements compared to conventional techniques. By employing modulation on both transmission and reception, compressive sensing in ranging is extended to the direct measurement of range profiles without intermediate measurement of the return waveform. This compressive ranging approach enables the use of pseudorandom binary transmit waveforms and return modulation, along with low-bandwidth optical detectors to yield high-resolution ranging information. A proof-of-concept experiment is presented. With currently available compact, off-the-shelf electronics and photonics, such as high data rate binary pattern generators and high-bandwidth digital optical modulators, compressive laser ranging can readily achieve subcentimeter resolution in a compact, lightweight package.
Energy Technology Data Exchange (ETDEWEB)
Sreenivasa Chari, M.; Manjaiah, K.M. [Indian Agricultural Research Institute, Division of Soil Science and Agricultural Chemistry, New Delhi - 110012 (India); Sachdev, P.; Sachdev, M.S. [Indian Agricultural Research Institute, Nuclear Research Laboratory, New Delhi - 110012 (India)
2011-07-15
A greenhouse pot culture experiment was conducted to study the effect of graded levels of waste mica (0, 10, 20 and 40 g kg{sup -1}) on reducing the radiocesium uptake by spinach (Spinacia olerecea L) and lettuce (Lactuca sativa L.) grown in {sup 134}Cs-contaminated (at 37 k Bq kg{sup -1} soil) Inceptisols, Vertisols and Ultisols. The biomass yield, and potassium content and its uptake by crops have been significantly improved by waste mica application. The crops grown in Vertisols recorded higher biomass yield, and K content and its uptake as compared with Inceptisols and Ultisols. The average {sup 134}Cs transfer factor values recorded were: 0.21, 0.17 and 0.26 at the first cutting, 0.15, 0.12 and 0.28 at the second cutting and 0.07, 0.05 and 0.23 at the third cutting from Inceptisols, Vertisols and Ultisols, respectively. Waste mica significantly suppressed radiocesium uptake, the effect being more pronounced at 40 g mica kg{sup -1} soil. There exists an inverse relationship between the {sup 134}Cs transfer factors with plant potassium content and also the K uptake by the crops. (authors)
Energy Technology Data Exchange (ETDEWEB)
Haggard, D.L.; Tanner, J.E.
1997-06-01
Nondestructive assay (NDA) gamma spectroscopy techniques were used to measure {sup 134/137}Cs ratios on nine PuAl Mark 42 fuel assemblies. The purpose of the ratio measurement was to confirm theoretical burnup calculations. {sup 134/137}Cs ratios were determined from the measured activity based on corrected net peak area counts for the 605 keV peak from {sup 134}Cs and the 662 keV peak from {sup 137}Cs/{sup 137m}Ba. Assembly No. 2 {sup 134/137}Cs ratio measured on 4-15-92 was 0.19. The measured {sup 134/137}Cs ratio was decay corrected to be 2.11 on 8-1-84 based on the half lives of {sup 134}Cs and {sup 137}Cs. The measured {sup 134/137}Cs ratio range was 1.90--2.14 for all nine assemblies. These measured values compare to a theoretical ratio of 1.7 on 8-1-84 determined by burnup calculations. Total cesium curie content was also requested and determined using the NDA direct measurements. Gamma spectral data were measured on the nine sectioned Mark 42 fuel assemblies. Measured cesium curie content, decay corrected to 8-1-84, ranged from 18170--24480 curies of {sup 134}Cs and 8620--11646 curies of {sup 137}Cs. Theoretical cesium curie content of 8-1-84 was 15200 curies {sup 134}Cs and 8973 curies {sup 137}Cs. Direct assay cesium ratio is 12% to 26% higher than the predicted ratio of 1.7. The measured {sup 134}Cs data indicate between 20%--61% more activity than that predicted by the burnup code, whereas the measured {sup 137}Cs activity is between 4% less to 30% more than the predicted activity. This information may be used to address issues concerning criticality safety, storage, and shipping of this type of material.
A Modeling of Compressible Droplets in a Fluid
Boudin, Laurent; Desvilletter, Laurent; Motte, Renaud
2003-01-01
In this work, we are interested in a complex fluid-kinetic model that aims to take into account the compressibility of the droplets of the spray. The ambient fluid is described by Euler-like equations, in which the transfer of momentum and energy form the droplets is taken into account, while the spray is represented by a probability density function satisfying a Vlasov-like equation. Implicit terms crop up because of the compressibility of the droplets. After having derived...
International Nuclear Information System (INIS)
Friedman, A.; Barnard, J.J.; Cohen, R.H.; Grote, D.P.; Lund, S.M.; Sharp, W.M.; Faltens, A.; Henestroza, E.; Jung, J.-Y.; Kwan, J.W.; Lee, E.P.; Leitner, M.A.; Logan, B.G.; Vay, J.-L.; Waldron, W.L.; Davidson, R.C.; Dorf, M.; Gilson, E.P.; Kaganovich, I.D.
2009-01-01
Intense beams of heavy ions are well suited for heating matter to regimes of emerging interest. A new facility, NDCX-II, will enable studies of warm dense matter at ∼1 eV and near-solid density, and of heavy-ion inertial fusion target physics relevant to electric power production. For these applications the beam must deposit its energy rapidly, before the target can expand significantly. To form such pulses, ion beams are temporally compressed in neutralizing plasma; current amplification factors of ∼50-100 are routinely obtained on the Neutralized Drift Compression Experiment (NDCX) at LBNL. In the NDCX-II physics design, an initial non-neutralized compression renders the pulse short enough that existing high-voltage pulsed power can be employed. This compression is first halted and then reversed by the beam's longitudinal space-charge field. Downstream induction cells provide acceleration and impose the head-to-tail velocity gradient that leads to the final neutralized compression onto the target. This paper describes the discrete-particle simulation models (1-D, 2-D, and 3-D) employed and the space-charge-dominated beam dynamics being realized.
A Streaming PCA VLSI Chip for Neural Data Compression.
Wu, Tong; Zhao, Wenfeng; Guo, Hongsun; Lim, Hubert H; Yang, Zhi
2017-12-01
Neural recording system miniaturization and integration with low-power wireless technologies require compressing neural data before transmission. Feature extraction is a procedure to represent data in a low-dimensional space; its integration into a recording chip can be an efficient approach to compress neural data. In this paper, we propose a streaming principal component analysis algorithm and its microchip implementation to compress multichannel local field potential (LFP) and spike data. The circuits have been designed in a 65-nm CMOS technology and occupy a silicon area of 0.06 mm. Throughout the experiments, the chip compresses LFPs by 10 at the expense of as low as 1% reconstruction errors and 144-nW/channel power consumption; for spikes, the achieved compression ratio is 25 with 8% reconstruction errors and 3.05-W/channel power consumption. In addition, the algorithm and its hardware architecture can swiftly adapt to nonstationary spiking activities, which enables efficient hardware sharing among multiple channels to support a high-channel count recorder.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
This paper summarizes mainly on HFC, PFC and SF{sub 6} the trends in the last one year in technologies and regulations that can make compatible the ozone layer protection and the global warming prevention. Activities of the HFC/PHC task force established jointly by TEAP and IPCC are very important in deciding the future positions of HFC, PFC and SF{sub 6}. This paper reports the status of activities taken during fiscal 1999. IPCC reviewed the method of calculating the quantity of greenhouse effect gas emission. The paper introduces from its draft the gist of calculating the discharge quantity of HFC, PFC and SF{sub 6}. Introduction is given from the HFC/PFC task force report the actual status of using coolants, foaming agents and aerosols using HFC, PFC and SF{sub 6}, and the trends of developing substitution technologies. The paper introduces a fluorocarbon destruction technology as an international trend in discharge suppression measures. The paper reports movements of COP-5 in fiscal 1999 for gases other than the three gases including HFC. Chlorobromo-methane was indicated as a new substance, and n-propyl-bromide was decided to continue with measurement of ozone destruction coefficient. (NEDO)
Dissociative properties of 1,1,1,2-tetrafluoroethane obtained by computational chemistry
Hayashi, Toshio; Ishikawa, Kenji; Sekine, Makoto; Hori, Masaru
2018-06-01
The electronic properties and dissociative channels of the alternative to the CCl2F2 (CFC-12) refrigerant, 1,1,1,2-tetrafluoroethane (HFC-134a) with a low global warming potential (GWP, 1430), were revealed by computational chemistry. The results show that CF3 + and CHF2 + ions are mainly produced by ionization. The CF3CH2 + ion is produced by ion pair formation and by direct ionization in the energy region higher than approximately 15 eV, but also in small amounts by the ionization of the dissociated CF3CH2 radical. This information is useful for etching process engineers in leading-edge semiconductor manufacturing.
Microbunching and RF Compression
International Nuclear Information System (INIS)
Venturini, M.; Migliorati, M.; Ronsivalle, C.; Ferrario, M.; Vaccarezza, C.
2010-01-01
Velocity bunching (or RF compression) represents a promising technique complementary to magnetic compression to achieve the high peak current required in the linac drivers for FELs. Here we report on recent progress aimed at characterizing the RF compression from the point of view of the microbunching instability. We emphasize the development of a linear theory for the gain function of the instability and its validation against macroparticle simulations that represents a useful tool in the evaluation of the compression schemes for FEL sources.
International Nuclear Information System (INIS)
Fukatsu, Hiroshi; Naganawa, Shinji; Yumura, Shinnichiro
2008-01-01
This study was aimed to validate the performance of a novel image compression method using a neural network to achieve a lossless compression. The encoding consists of the following blocks: a prediction block; a residual data calculation block; a transformation and quantization block; an organization and modification block; and an entropy encoding block. The predicted image is divided into four macro-blocks using the original image for teaching; and then redivided into sixteen sub-blocks. The predicted image is compared to the original image to create the residual image. The spatial and frequency data of the residual image are compared and transformed. Chest radiography, computed tomography (CT), magnetic resonance imaging, positron emission tomography, radioisotope mammography, ultrasonography, and digital subtraction angiography images were compressed using the AIC lossless compression method; and the compression rates were calculated. The compression rates were around 15:1 for chest radiography and mammography, 12:1 for CT, and around 6:1 for other images. This method thus enables greater lossless compression than the conventional methods. This novel method should improve the efficiency of handling of the increasing volume of medical imaging data. (author)
International Nuclear Information System (INIS)
Zheng Jiemin; Li Hongyan; Niu Tianxin; Chen Ziyuan; Tang Shirong
2009-01-01
Pot experiment was conducted to investigate the accumulation dynamics of 134 Cs in shoots of Rumex acetosa, Rumex hastatus and Helianthus annuus grown in 134 Cs contaminated soil under greenhouse condition. Results showed that shoot biomass of H. annuus was significantly higher than that of R. acetosa and R. hastatus; among 3 plant species, 13 '4Cs specific activity in shoots was the highest in H. annuus after treatment for 50 days, however after treatment for 70 days, that in R. acetosa was the highest. Bioaccumulation ratio reached 1.5, 1.4 and 1.3 in R. acetosa, R. hastatus and H. annuus at the end of experiment, respectively, and the former two plants kept with trend of continuously increasing during the experiment period. Three plants were tolerant to 134 Cs contaminated slil and capable to translocate 134 Cs from soil to plants. Among them, H. annuus removed greatest 134 Cs amount in the above ground part, and R. acetosa, R. hastatus showed higher tranclocation factor of Cs than H. annuus. Three plants are promising for phytoremediation of soil contaminated with radiocesium, and also could be used for phytoremediation of radiocesium and heavy metals complex contamination, potentially. (authors)
Experimental study of conjugate heat transfer from liquid metal layer cooled by overlying freon
International Nuclear Information System (INIS)
Cho, J.S.; Suh, K.Y.; Chung, C.H.; Park, R.J.; Kim, S.B.
2001-01-01
Steady-state and transient experiments were performed for the heat transfer from the liquid metal pool with overlying Freon (R113) coolant in the process of boiling. The simulant molten pool material is tin (Sn) with the melting temperature of 232 Celsius degrees. The metal pool is heated from the bottom surface and the coolant is injected onto the molten metal pool. Tests were conducted under the condition of the bottom surface heating in the test section and the forced convection of the R113 coolant being injected onto the molten metal pool. The bottom heating condition was varied from 8 kW to 14 kW. The temperature distributions of the metal layer and coolant were obtained in the steady-state experiment. The boiling mechanism of the R113 coolant was changed from the nucleate boiling to film boiling in the transient experiment. The critical heat flux (CHF) phenomenon was observed during the transition from the nucleate boiling to the film boiling. Also, the Nusselt (Nu) number and the Rayleigh (Ra) number in the molten metal pool region were obtained as functions of time. Analysis was done for the relationship between the heat flux and the temperature difference between the metal layer surface and the boiling coolant. In this experiment, the heat transfer is achieved with accompanying solidification in the molten metal pool by the boiling R113 coolant there above. The present test results of the natural convection heat transfer on the molten metal pool are higher than those of the liquid metal natural convection heat transfer without coolant boiling. It can be interpreted that the heat transfer rate is enhanced by the overlying boiling coolant having the high heat removal rate. Analysis of the relationship between the heat flux and the difference between the metal layer surface temperature and the coolant bulk boiling temperature revealed that the CHF occurs when the temperature difference reaches a neighborhood of 50 Celsius degrees. Also, if the temperature
Compressing a spinodal surface at fixed area: bijels in a centrifuge.
Rumble, Katherine A; Thijssen, Job H J; Schofield, Andrew B; Clegg, Paul S
2016-05-11
Bicontinuous interfacially jammed emulsion gels (bijels) are solid-stabilised emulsions with two inter-penetrating continuous phases. Employing the method of centrifugal compression we find that macroscopically the bijel yields at relatively low angular acceleration. Both continuous phases escape from the top of the structure, making any compression immediately irreversible. Microscopically, the bijel becomes anisotropic with the domains aligned perpendicular to the compression direction which inhibits further liquid expulsion; this contrasts strongly with the sedimentation behaviour of colloidal gels. The original structure can, however, be preserved close to the top of the sample and thus the change to an anisotropic structure suggests internal yielding. Any air bubbles trapped in the bijel are found to aid compression by forming channels aligned parallel to the compression direction which provide a route for liquid to escape.
International Nuclear Information System (INIS)
Wang Fengzhe; Pan Shinong; An Qi; Shu Hong; Li Qi; Sun He; Zhang Guangxin; Guo Qiyong
2010-01-01
Objective: To evaluate the value of ice-compression therapy in mice skeletal muscle after acute crush injuries and correlate treatment effect with different compression time by MR DTI. Methods: Forty Weistar mice were randomly divided into 4 groups by random number table method: control group (A), 5 min compression time group (B), 15 min compression time group (C) and 30 min compression time group (D). Diffusion tensor imaging examinations were performed before, immediately after, 24, 48 and 72 hours after injuries. ADC and FA values were calculated by fiber tracking tool. The morphological changes were confirmed by histopathology, and immunohistochemical methods were used for the assessment of Desmin expression with mean of A value. Statistical analysis by LSD-t test and Spearman rank correlation. Results: (1) For every group before injuries, ADC values were (1.38±0.04) × 10 -3 , (1.38±0.08) × 10 -3 , (1.34±0.05) × 10 -3 , (1.36±0.09) × 10 -3 mm 2 /s respectively, FA value were 0.46±0.05, 0.45±0.03, 0.45±0.05, 0.48±0.04 respectively. ADC values increased significantly and FA values reduced in each group immediately after injuries compared with pre-injury values. ADC values were (1.84± 0.10) × 10 -3 (1.79±0.09) × 10 -3 , (1.55±0.07) × 10 -3 , (1.57±0.04) × 10 -3 mm 2 /s respectively, FA value were 0.21±0.04, 0.26±0.03, 0.31±0.02, 0.30±0.04 respectively. ADC values were still higher and FA values lower than pre-injury values at 24 hours after injury in A, B groups. ADC values were (1.54±0.13) × 10 -3 , (1.57±0.13) × 10 -3 mm 2 /s, FA value were 0.25±0.03, 0.26±0.02. (2) DTT showed fibers distorted and the number of fiber bundles reduced, some separation and displacement in each group immediately after injury. C, D groups improved more than A, B groups over time. (3) The disorder arrangement of skeletal muscle cells with edema and filaments separation were found in HE staining after injury, but the degree mitigated in C, D groups. Desmin
Atom-vacancy ordering and magnetic susceptibility of nonstoichiometric hafnium carbide
International Nuclear Information System (INIS)
Gusev, A.I.; Zyryanova, A.N.
1999-01-01
Experimental results on magnetic susceptibility of nonstoichiometric hafnium carbide HfC y (0.6 0.71 , HfC 0.78 and HfC 0.83 in the range of 870-930 K the anomalies are revealed which are associated with superstructure short-range ordering in a non-metallics sublattice. It is shown that a short-range order in HfC 0.71 and HfC 0.78 carbides corresponds to Hf 3 C 2 ordered phase, and in HfC 0.83 carbide - to Hf 6 C 5 ordered phase. HfC 0.78 carbide is found to possesses zero magnetic susceptibility in temperature range 910-980 K [ru
Calibration of the SH134-20 Standard Gain Horn
DEFF Research Database (Denmark)
Pivnenko, Sergey; Breinbjerg, Olav
This report documents the measurement of the linearly polarized SH134-20 Standard Gain Horn. The measurement comprises on-axis gain, on-axis polarization characteristics, and reflection coefficient at 111 frequencies in the frequency range from 22-33 GHz. The measurement was carried out at the DTU...
Mining compressing sequential problems
Hoang, T.L.; Mörchen, F.; Fradkin, D.; Calders, T.G.K.
2012-01-01
Compression based pattern mining has been successfully applied to many data mining tasks. We propose an approach based on the minimum description length principle to extract sequential patterns that compress a database of sequences well. We show that mining compressing patterns is NP-Hard and
Adiabatic compression and radiative compression of magnetic fields
International Nuclear Information System (INIS)
Woods, C.H.
1980-01-01
Flux is conserved during mechanical compression of magnetic fields for both nonrelativistic and relativistic compressors. However, the relativistic compressor generates radiation, which can carry up to twice the energy content of the magnetic field compressed adiabatically. The radiation may be either confined or allowed to escape
Equation of state and thermmodynamic properties of 1,1,1,2-tetrafluoroethane (refrigerant R134a)
International Nuclear Information System (INIS)
Vas'kov, E.T.
1995-01-01
An equation of state and tables of thermodynamic properties of R134a in the saturation state and in the one-phase region are obtained in the temperature interval 320-500 K at pressures ranging from 0.01 to 7.5 MPa
A Novel Range Compression Algorithm for Resolution Enhancement in GNSS-SARs
Directory of Open Access Journals (Sweden)
Yu Zheng
2017-06-01
Full Text Available In this paper, a novel range compression algorithm for enhancing range resolutions of a passive Global Navigation Satellite System-based Synthetic Aperture Radar (GNSS-SAR is proposed. In the proposed algorithm, within each azimuth bin, firstly range compression is carried out by correlating a reflected GNSS intermediate frequency (IF signal with a synchronized direct GNSS base-band signal in the range domain. Thereafter, spectrum equalization is applied to the compressed results for suppressing side lobes to obtain a final range-compressed signal. Both theoretical analysis and simulation results have demonstrated that significant range resolution improvement in GNSS-SAR images can be achieved by the proposed range compression algorithm, compared to the conventional range compression algorithm.
Soil to plant transfer of 134Cs for olive and orange trees: preliminary results
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Papanicolaou, E.; Haidouti, C.
1995-01-01
The objective of this research programme was to calculate values of transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) in a long term glasshouse pot experiment, started in 1994. Radiocaesium contamination in the different tree parts as well as the importance of the storage or cycling of 134 Cs will also be examined. The experiment was conducted in large pots filled with a calcareous, heavy soil (115 kg/pot) where olive and orange trees, two years after grafting were transplanted. The soil was added to the pot in layers ca. 2 cm thick on the top of which the radioactive solution was added in small drops. Caesium-134 as CsCl (0.5 mCi) was added to each pot. The soil in the pots was watered to field capacity and left to stand for eight weeks for the 134 Cs to reach equilibrium. Plant samples were taken at fruit maturity, eight months after transplanting. It is noticed that the length of experimentation is rather short for tree crops and the data should be considered as preliminary ones with indicative tendencies. Under these conditions plant contamination was generally very low in both plant species studied. The concentration ratios (CR) of 134 Cs for the studied crops did not differ much and they ranged from 0.0007 to 0.002 for olive trees and from 0.0006 to 0.001 for orange trees. Leaves compared to other plant parts showed the highest CR value in both crops. Furthermore new leaves and branches of the olive trees showed higher CR values than the old ones by approximately a factor of two. Potassium content of the different plant parts showed significant differences and they were higher in leaves and fruits. There is no correlation between K content and transfer factors of Cs in the different plant parts of both crops. To study the effect of soil type on CRs of 134 Cs for olive and orange trees a similar experiment was established two months later, using a sandy and acid soil. Based on first results, higher values of transfer factors of 134
International Nuclear Information System (INIS)
Glass, A.J.
1975-01-01
The interest in using large lasers to achieve a very short and intense pulse for generating fusion plasma has provided a strong impetus to reexamine the possibilities of optical pulse compression at high energy. Pulse compression allows one to generate pulses of long duration (minimizing damage problems) and subsequently compress optical pulses to achieve the short pulse duration required for specific applications. The ideal device for carrying out this program has not been developed. Of the two approaches considered, the Gires--Tournois approach is limited by the fact that the bandwidth and compression are intimately related, so that the group delay dispersion times the square of the bandwidth is about unity for all simple Gires--Tournois interferometers. The Treacy grating pair does not suffer from this limitation, but is inefficient because diffraction generally occurs in several orders and is limited by the problem of optical damage to the grating surfaces themselves. Nonlinear and parametric processes were explored. Some pulse compression was achieved by these techniques; however, they are generally difficult to control and are not very efficient. (U.S.)
Bent Shaped 1,3,4-Oxadiazole/Thiadiazole heterocyclic rings ...
Indian Academy of Sciences (India)
Two series of bent shaped 1,3,4-oxadiazole/thiadiazole heterocyclic ring containing liquid crystalline (LC) compounds were synthesized and characterized by FT-IR, 1H, 13C-NMR and ESI-Mass spectro-scopic techniques. Liquid crystal properties were investigated by polarized optical microscopy and differential scanning ...
International Nuclear Information System (INIS)
Chen, Tianjun; Gao, Fei; Feng, Sifang; Yang, Tian; Chen, Mingwei
2015-01-01
MicroRNAs have been shown to act as crucial modulators during carcinogenesis. Recent studies have implied that miR-134 expression associated with epithelial-to-mesenchymal transition phenotype and invasive potential of NSCLC cells. Our study investigated the pathogenic implications of miR-134 in small cell lung cancer (SCLC). Overexpression or inhibition MiR-134 expression by miR-134 mimics or miR-134 inhibitors (anti-miR-134) in SCLC cell lines was detected using qRT-PCR. Lactate dehydrogenase (LDH) assay, MTT assays and flow cytometry were performed in order to clarify the growth and apoptosis of SCLC cells which had been transfected with miR-134 mimics or anti-miR-134. WWOX expression in H69 cells was detected by qRT-PCR and western blot, respectively. The results showed that overexpression miR-134 was significantly promoting SCLC cells growth and inhibit its apoptosis. In addition, reduced miR-134 expression was significantly correlated with cell growth inhibition and apoptosis promotion. Furthermore, transfection of miR-134 mimics into the SCLC cells markedly down-regulated the level of WWOX, whereas, anti-miR-134 up-regulated WWOX expression. We also found that overexpression WWOX attenuate miR-134 induced H69 cells growth, and promote cell apoptosis. Moreover, miR-134 promoted cell proliferation and inhibit apoptosis via the activation of ERK1/2 pathway. These findings suggest that miR-134 may be an ideal diagnostic and prognostic marker, and may be attributed to the molecular therapy of SCLC. - Highlights: • MiR-134 play roles in small cell lung cancer cell growth and apoptosis. • MiR-134 negative regulated the level of WWOX in H69 cells. • WWOX overexpression attenuate miR-134 induced H69 cells growth. • MiR-134 promotes cell growth via the activation of ERK1/2 pathway
28 CFR 13.4 - Procedures: Responsibilities of the Attorney General.
2010-07-01
... SPECIAL NUCLEAR MATERIALS REWARDS REGULATIONS § 13.4 Procedures: Responsibilities of the Attorney General... Special Nuclear Materials Rewards Act, the Attorney General shall: (a) Refer such submission for review to... whether that alien and members of his immediate family may receive immigrant visas and be admitted to the...
Uptake and loss of Cesium - 134 by the snail Biomphalaria glabrata (Say, 1818)
International Nuclear Information System (INIS)
Kikuchi, O.K.; Mastro, N.L. del.
1988-07-01
The uptake and loss of Cs-134 produced in IEA-R1 reactor of IPEN was observed in fresh water adult snails. Two activites were employed: 3.700 and 18.500 Bq/1. A monochannel analyses was used for radiactivity couting and the number of egg-laying and embryo were registered. Maximum uptake occured approximately at 8 th day and the biological half-life was about 6 days. Although the egg-laying and embryo number were diminished with Cs-134 presence, it is not possible to affirm that result due to the small number of animals used. (author) [pt
Compressing DNA sequence databases with coil
Directory of Open Access Journals (Sweden)
Hendy Michael D
2008-05-01
Full Text Available Abstract Background Publicly available DNA sequence databases such as GenBank are large, and are growing at an exponential rate. The sheer volume of data being dealt with presents serious storage and data communications problems. Currently, sequence data is usually kept in large "flat files," which are then compressed using standard Lempel-Ziv (gzip compression – an approach which rarely achieves good compression ratios. While much research has been done on compressing individual DNA sequences, surprisingly little has focused on the compression of entire databases of such sequences. In this study we introduce the sequence database compression software coil. Results We have designed and implemented a portable software package, coil, for compressing and decompressing DNA sequence databases based on the idea of edit-tree coding. coil is geared towards achieving high compression ratios at the expense of execution time and memory usage during compression – the compression time represents a "one-off investment" whose cost is quickly amortised if the resulting compressed file is transmitted many times. Decompression requires little memory and is extremely fast. We demonstrate a 5% improvement in compression ratio over state-of-the-art general-purpose compression tools for a large GenBank database file containing Expressed Sequence Tag (EST data. Finally, coil can efficiently encode incremental additions to a sequence database. Conclusion coil presents a compelling alternative to conventional compression of flat files for the storage and distribution of DNA sequence databases having a narrow distribution of sequence lengths, such as EST data. Increasing compression levels for databases having a wide distribution of sequence lengths is a direction for future work.
Causes of seasonal variations of Cs-134/137 activity concentrations in surface air
International Nuclear Information System (INIS)
Hoetzl, H.; Winkler, R.
1993-01-01
In winter months maxima of Cs-134/137 activity concentrations in air are observed at several locations in Europe. To clarify this phenomenon, from October 1991 to November 1992 we performed a program for aerosol collection on a short-term scale based on collecting intervals of 48-72 hours. The local meteorological parameters were determined simultaneously. Statistical analysis of these observations reveiled a highly significant positive correlation between Cs-137 activity concentration and the so-called 'Stagnationsindex'. Based on this relationship the seasonal variations of Cs-134/137 concentrations in ground-level air can be explained by atmospheric inversion conditions frequently occurring during fall- and wintermonths. (orig.) [de
Thermodynamic and aerodynamic meanline analysis of wet compression in a centrifugal compressor
International Nuclear Information System (INIS)
Kang, Jeong Seek; Cha, Bong Jun; Yang, Soo Seok
2006-01-01
Wet compression means the injection of water droplets into the compressor of gas turbines. This method decreases the compression work and increases the turbine output by decreasing the compressor exit temperature through the evaporation of water droplets inside the compressor. Researches on wet compression, up to now, have been focused on the thermodynamic analysis of wet compression where the decrease in exit flow temperature and compression work is demonstrated. This paper provides thermodynamic and aerodynamic analysis on wet compression in a centrifugal compressor for a microturbine. The meanline dry compression performance analysis of centrifugal compressor is coupled with the thermodynamic equation of wet compression to get the meanline performance of wet compression. The most influencing parameter in the analysis is the evaporative rate of water droplets. It is found that the impeller exit flow temperature and compression work decreases as the evaporative rate increases. And the exit flow angle decreases as the evaporative rate increases
Mammographic compression in Asian women.
Lau, Susie; Abdul Aziz, Yang Faridah; Ng, Kwan Hoong
2017-01-01
To investigate: (1) the variability of mammographic compression parameters amongst Asian women; and (2) the effects of reducing compression force on image quality and mean glandular dose (MGD) in Asian women based on phantom study. We retrospectively collected 15818 raw digital mammograms from 3772 Asian women aged 35-80 years who underwent screening or diagnostic mammography between Jan 2012 and Dec 2014 at our center. The mammograms were processed using a volumetric breast density (VBD) measurement software (Volpara) to assess compression force, compression pressure, compressed breast thickness (CBT), breast volume, VBD and MGD against breast contact area. The effects of reducing compression force on image quality and MGD were also evaluated based on measurement obtained from 105 Asian women, as well as using the RMI156 Mammographic Accreditation Phantom and polymethyl methacrylate (PMMA) slabs. Compression force, compression pressure, CBT, breast volume, VBD and MGD correlated significantly with breast contact area (pAsian women. The median compression force should be about 8.1 daN compared to the current 12.0 daN. Decreasing compression force from 12.0 daN to 9.0 daN increased CBT by 3.3±1.4 mm, MGD by 6.2-11.0%, and caused no significant effects on image quality (p>0.05). Force-standardized protocol led to widely variable compression parameters in Asian women. Based on phantom study, it is feasible to reduce compression force up to 32.5% with minimal effects on image quality and MGD.
International Nuclear Information System (INIS)
Ravikumar, T.S.; Mohan Lal, D.
2009-01-01
R134a has been accepted as the single major refrigerant in the automobile industry and it has been used worldwide. But, the problem associated with it is the use of the PAG oil as the lubricant. Unlike the conventional mineral oil, the synthetic PAG oil used with R134a is highly hygroscopic in nature. The PAG lubricants come with different additives unique for different compressors. This leads to serious service issues. Therefore, a refrigerant, which will be readily available to replace R12, and also compatible with mineral oil, is needed. In the present study the readily available R134a is used in place of R12. However, to avoid PAG oil and to use the conventional mineral oil as lubricant, R134a is mixed with the commercially available hydrocarbon blend, (45.2% R290 and 56.8% R600a) in the proportion of 91% and 9%, respectively by mass. The quantity of hydrocarbons used is well below the lower flammable limit. This new mixture R134a/R600a/R290 is tested in the air-conditioning system of a passenger car 'on road' in the true running conditions and compared with the results that has been obtained with R12. The cool down performance under varying speed and varying ambient conditions, system performance under severe accelerating conditions and bumper-to-bumper traffic conditions is studied. The test results show that the new blend can be a promising substitute for the existing R12 systems and it can eliminate the use of hygroscopic PAG oil.
N-(5-Benzylsulfanyl-1,3,4-thiadiazol-2-yl-2-(piperidin-1-ylacetamide
Directory of Open Access Journals (Sweden)
D. S. Ismailova
2014-03-01
Full Text Available The title compound, C16H20N4OS2, was synthesized by the reaction of 2-benzylsulfanyl-5-chloroacetamido-1,3,4-thiadiazole and piperidine in a 1:2 ratio. The planes of the acetamide and 1,3,4-thiadiazole units are twisted by 10.8 (4°. The thiadiazole S atom and the acetamide O atom are syn-oriented due to a hypervalent S...O interaction of 2.628 (4 Å. In the crystal, molecules form centrosymmetric dimers via N—H...N hydrogen bonds. These dimers are further connected by C—H...O interactions into (100 layers.
A New Algorithm for the On-Board Compression of Hyperspectral Images
Directory of Open Access Journals (Sweden)
Raúl Guerra
2018-03-01
Full Text Available Hyperspectral sensors are able to provide information that is useful for many different applications. However, the huge amounts of data collected by these sensors are not exempt of drawbacks, especially in remote sensing environments where the hyperspectral images are collected on-board satellites and need to be transferred to the earth’s surface. In this situation, an efficient compression of the hyperspectral images is mandatory in order to save bandwidth and storage space. Lossless compression algorithms have been traditionally preferred, in order to preserve all the information present in the hyperspectral cube for scientific purposes, despite their limited compression ratio. Nevertheless, the increment in the data-rate of the new-generation sensors is making more critical the necessity of obtaining higher compression ratios, making it necessary to use lossy compression techniques. A new transform-based lossy compression algorithm, namely Lossy Compression Algorithm for Hyperspectral Image Systems (HyperLCA, is proposed in this manuscript. This compressor has been developed for achieving high compression ratios with a good compression performance at a reasonable computational burden. An extensive amount of experiments have been performed in order to evaluate the goodness of the proposed HyperLCA compressor using different calibrated and uncalibrated hyperspectral images from the AVIRIS and Hyperion sensors. The results provided by the proposed HyperLCA compressor have been evaluated and compared against those produced by the most relevant state-of-the-art compression solutions. The theoretical and experimental evidence indicates that the proposed algorithm represents an excellent option for lossy compressing hyperspectral images, especially for applications where the available computational resources are limited, such as on-board scenarios.
Greenland, Kasey O; Merryweather, Andrew S; Bloswick, Donald S
2011-09-01
To determine the feasibility of predicting static and dynamic peak back-compressive forces based on (1) static back compressive force values at the lift origin and destination and (2) lifting speed. Ten male subjects performed symmetric mid-sagittal floor-to-shoulder, floor-to-waist, and waist-to-shoulder lifts at three different speeds (slow, medium, and fast), and with two different loads (light and heavy). Two-dimensional kinematics and kinetics were captured. Linear regression analyses were used to develop prediction equations, the amount of predictability, and significance for static and dynamic peak back-compressive forces based on a static origin and destination average (SODA) back-compressive force. Static and dynamic peak back-compressive forces were highly predicted by the SODA, with R(2) values ranging from 0.830 to 0.947. Slopes were significantly different between slow and fast lifting speeds (p assessments at the origin and destination of a lifting task. This could be valuable for enhancing job design and analysis in the workplace and for large-scale studies where a full analysis of each lifting task is not feasible.
Energy Technology Data Exchange (ETDEWEB)
1991-01-01
There are two ozone-neutral materials that could substitute the strongly ozone-destructive refrigerant R12, namely 1,1 difluoroethane (R152a) and 1,1,1,2 tetrafluoroethane (R134a). R152a has excellent thermodynamic and energetic properties. It is innocuous and easy to produce. Its great drawback is its inflammability due to the four hydrogen atoms per molecule. R134a is chemically inert and non-flammable, but its mixing behaviour with refrigerating oils poses problems. Idealised refrigeration processes using R134a show somewhat lower performance data than these using R128 so R134a would be expected to have a slightly greater primary energy demand. It may turn out that by using a mixture of R152a and R134a the unfavourable properties of the two components when used singly can be mutually moderated or completely neutralised, as follows. Addition of R134a neutralises the inflammability of R152a. A mixture may be expected to have more favourable thermodynamic and energetic properties than R134a alone. The foremost aim of the project was to determine by experiment the thermodynamic properties of the mixture of R152a and R134a. (orig./EF)
Expandable image compression system: A modular approach
International Nuclear Information System (INIS)
Ho, B.K.T.; Lo, S.C.; Huang, H.K.
1986-01-01
The full-frame bit-allocation algorithm for radiological image compression can achieve an acceptable compression ratio as high as 30:1. It involves two stages of operation: a two-dimensional discrete cosine transform and pixel quantization in the transformed space with pixel depth kept accountable by a bit-allocation table. The cosine transform hardware design took an expandable modular approach based on the VME bus system with a maximum data transfer rate of 48 Mbytes/sec and a microprocessor (Motorola 68000 family). The modules are cascadable and microprogrammable to perform 1,024-point butterfly operations. A total of 18 stages would be required for transforming a 1,000 x 1,000 image. Multiplicative constants and addressing sequences are to be software loaded into the parameter buffers of each stage prior to streaming data through the processor stages. The compression rate for 1K x 1K images is expected to be faster than one image per sec
Structure and Properties of Silica Glass Densified in Cold Compression and Hot Compression
Guerette, Michael; Ackerson, Michael R.; Thomas, Jay; Yuan, Fenglin; Bruce Watson, E.; Walker, David; Huang, Liping
2015-10-01
Silica glass has been shown in numerous studies to possess significant capacity for permanent densification under pressure at different temperatures to form high density amorphous (HDA) silica. However, it is unknown to what extent the processes leading to irreversible densification of silica glass in cold-compression at room temperature and in hot-compression (e.g., near glass transition temperature) are common in nature. In this work, a hot-compression technique was used to quench silica glass from high temperature (1100 °C) and high pressure (up to 8 GPa) conditions, which leads to density increase of ~25% and Young’s modulus increase of ~71% relative to that of pristine silica glass at ambient conditions. Our experiments and molecular dynamics (MD) simulations provide solid evidences that the intermediate-range order of the hot-compressed HDA silica is distinct from that of the counterpart cold-compressed at room temperature. This explains the much higher thermal and mechanical stability of the former than the latter upon heating and compression as revealed in our in-situ Brillouin light scattering (BLS) experiments. Our studies demonstrate the limitation of the resulting density as a structural indicator of polyamorphism, and point out the importance of temperature during compression in order to fundamentally understand HDA silica.
Streaming Compression of Hexahedral Meshes
Energy Technology Data Exchange (ETDEWEB)
Isenburg, M; Courbet, C
2010-02-03
We describe a method for streaming compression of hexahedral meshes. Given an interleaved stream of vertices and hexahedral our coder incrementally compresses the mesh in the presented order. Our coder is extremely memory efficient when the input stream documents when vertices are referenced for the last time (i.e. when it contains topological finalization tags). Our coder then continuously releases and reuses data structures that no longer contribute to compressing the remainder of the stream. This means in practice that our coder has only a small fraction of the whole mesh in memory at any time. We can therefore compress very large meshes - even meshes that do not file in memory. Compared to traditional, non-streaming approaches that load the entire mesh and globally reorder it during compression, our algorithm trades a less compact compressed representation for significant gains in speed, memory, and I/O efficiency. For example, on the 456k hexahedra 'blade' mesh, our coder is twice as fast and uses 88 times less memory (only 3.1 MB) with the compressed file increasing about 3% in size. We also present the first scheme for predictive compression of properties associated with hexahedral cells.
A multiphase compressible model for the simulation of multiphase flows
International Nuclear Information System (INIS)
Caltagirone, J.P.; Vincent, St.; Caruyer, C.
2011-01-01
A compressible model able to manage incompressible two-phase flows as well as compressible motions is proposed. After a presentation of the multiphase compressible concept, the new model and related numerical methods are detailed on fixed structured grids. The presented model is a 1-fluid model with a reformulated mass conservation equation which takes into account the effects of compressibility. The coupling between pressure and flow velocity is ensured by introducing mass conservation terms in the momentum and energy equations. The numerical model is then validated with four test cases involving the compression of an air bubble by water, the liquid injection in a closed cavity filled with air, a bubble subjected to an ultrasound field and finally the oscillations of a deformed air bubble in melted steel. The numerical results are compared with analytical results and convergence orders in space are provided. (authors)
12 CFR 204.134 - Linked time deposits and transaction accounts.
2010-01-01
... RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) Interpretations § 204.134...) establishes general reserve requirements on transaction accounts and nonpersonal time deposits. Under section... other than to allow the payment of higher interest through the avoidance of reserve requirements. As the...
Mammography image compression using Wavelet
International Nuclear Information System (INIS)
Azuhar Ripin; Md Saion Salikin; Wan Hazlinda Ismail; Asmaliza Hashim; Norriza Md Isa
2004-01-01
Image compression plays an important role in many applications like medical imaging, televideo conferencing, remote sensing, document and facsimile transmission, which depend on the efficient manipulation, storage, and transmission of binary, gray scale, or color images. In Medical imaging application such Picture Archiving and Communication System (PACs), the image size or image stream size is too large and requires a large amount of storage space or high bandwidth for communication. Image compression techniques are divided into two categories namely lossy and lossless data compression. Wavelet method used in this project is a lossless compression method. In this method, the exact original mammography image data can be recovered. In this project, mammography images are digitized by using Vider Sierra Plus digitizer. The digitized images are compressed by using this wavelet image compression technique. Interactive Data Language (IDLs) numerical and visualization software is used to perform all of the calculations, to generate and display all of the compressed images. Results of this project are presented in this paper. (Author)
DEFF Research Database (Denmark)
Christensen, Mette; Larsen, Lars A; Kauppinen, Sakari
2010-01-01
delivery of microRNAs in vivo by use of recombinant adeno-associated virus (rAAV). rAAV-mediated overexpression of miR-134 in neurons of the postnatal mouse brain provided evidence for a negative role of miR-134 in dendritic arborization of cortical layer V pyramidal neurons in vivo, thereby confirming...
Improving compressed air system performance: A sourcebook for industry
Mckane, Aimee T.
2003-01-01
Compressed air is used widely throughout industry and is often considered the "fourth utility" at many facilities. Almost every industrial plant, from a small machine shop to an immense pulp and paper mill, has some type of compressed air system. In many cases, the compressed air system is so vital that the facility cannot operate without it. Plant air compressor systems can vary in size from a small unit of 5 horsepower (hp) to huge systems with more than 50,000 hp. In many industrial facili...
Evaluation of mammogram compression efficiency
International Nuclear Information System (INIS)
Przelaskowski, A.; Surowski, P.; Kukula, A.
2005-01-01
Lossy image coding significantly improves performance over lossless methods, but a reliable control of diagnostic accuracy regarding compressed images is necessary. The acceptable range of compression ratios must be safe with respect to as many objective criteria as possible. This study evaluates the compression efficiency of digital mammograms in both numerically lossless (reversible) and lossy (irreversible) manner. Effective compression methods and concepts were examined to increase archiving and telediagnosis performance. Lossless compression as a primary applicable tool for medical applications was verified on a set 131 mammograms. Moreover, nine radiologists participated in the evaluation of lossy compression of mammograms. Subjective rating of diagnostically important features brought a set of mean rates given for each test image. The lesion detection test resulted in binary decision data analyzed statistically. The radiologists rated and interpreted malignant and benign lesions, representative pathology symptoms, and other structures susceptible to compression distortions contained in 22 original and 62 reconstructed mammograms. Test mammograms were collected in two radiology centers for three years and then selected according to diagnostic content suitable for an evaluation of compression effects. Lossless compression efficiency of the tested coders varied, but CALIC, JPEG-LS, and SPIHT performed the best. The evaluation of lossy compression effects affecting detection ability was based on ROC-like analysis. Assuming a two-sided significance level of p=0.05, the null hypothesis that lower bit rate reconstructions are as useful for diagnosis as the originals was false in sensitivity tests with 0.04 bpp mammograms. However, verification of the same hypothesis with 0.1 bpp reconstructions suggested their acceptance. Moreover, the 1 bpp reconstructions were rated very similarly to the original mammograms in the diagnostic quality evaluation test, but the
13 CFR 134.704 - What are the effects of the appeal on the procurement at issue?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the effects of the appeal on the procurement at issue? 134.704 Section 134.704 Business Credit and Assistance SMALL BUSINESS...
13 CFR 134.707 - When does the D/GC transmit the protest file and to whom?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When does the D/GC transmit the protest file and to whom? 134.707 Section 134.707 Business Credit and Assistance SMALL BUSINESS...
[Clinical feature of chronic compressive optic neuropathy without optic atrophy].
Jiang, Libin; Shi, Jitong; Liu, Wendong; Kang, Jun; Wang, Ningli
2014-12-01
To investigate the clinical feature of the chronic compressive optic neuropathy without optic atrophy. Retrospective cases series study. The clinical data of 25 patients (37 eyes) with chronic compressive optic neuropathy without optic atrophy, treated in Beijing Tongren Eye Center, Beijing Tongren Hospital, Capital Medical University, from October, 2005 to March, 2014, were collected. Those patients had been showing visual symptoms for 6 months or longer, but missed diagnosed or misdiagnosed as other eye diseases due to their normal or slightly changed fundi. The collected data including visual acuities, visual fields, neuroimaging and/or pathologic diagnosis were analyzed. Among the 25 patients, there were 5 males and 20 females, and their ages range from 9 to 74 years [average (47.5 ± 13.4) years]. All patients suffered progressive impaired vision in single eye or both eyes, without exophthalmos or abnormal eye movements. Except one patient had a headache, other patients did not show systemic symptoms. The corrected visual acuities were between HM to 1.0, and their appearances of optic discs and colors of fundi were normal. After neuroimaging and/or pathological examination, it was proven that 14 patients suffered tuberculum sellae meningiomas, 5 patients with hypophysoma, 3 patient with optic nerve sheath meningioma in orbital apex, 1 patient with cavernous hemangioma, 1 patient with vascular malformation in orbital apex and 1 patient with optic nerve glioma. Among the 19 patients whose suffered occupied lesions of saddle area, 14 patients underwent visual field examinations, and only 4 patients showed classic visual field defects caused by optic chiasmal lesions. Occult progressive visual loss was the most important clinical feature of the disease.
International Nuclear Information System (INIS)
Ramzaev, V.; Barkovsky, A.; Gromov, A.; Ivanov, S.; Kaduka, M.
2014-01-01
In 2011–2013, sampling of epiphytic fruticose lichens of the genera Usnea, Bryoria and Alectoria was carried out on Sakhalin and Kuril Islands (the Sakhalin region, Russia) to investigate contamination of these organisms with the Fukushima-derived 134 Cs and 137 Cs. Activities of the radionuclides were determined in all 56 samples of lichens taken for the analysis. After correction for radioactive decay (on 15 March 2011), the activity concentrations ranged from 2.1 Bq kg −1 (d.w.) to 52 Bq kg −1 for 134 Cs and from 2.3 Bq kg −1 to 52 Bq kg −1 for 137 Cs. Cesium-134 and 137 Cs activities for the whole set of lichens (n = 56) were strongly positively correlated; Spearman's rank correlation coefficient was calculated as 0.991 (P < 0.01). The activity concentrations of 134 Cs and 137 Cs in Usnea lichens from the Sakhalin and Kunashir islands declined with a factor of three in the period from 2011 to 2013. The average biological half-time for both cesium radionuclides in lichens of the genus Usnea is estimated as 1.3 y. The mean of 0.99 ± 0.10 and median of 0.99 were calculated for the decay corrected 134 Cs/ 137 Cs activities ratios in the lichens (n = 56). The radionuclides ratio in the lichens did not depend on location of sampling site, species and the time that had passed after the Fukushima accident. The regression analysis has shown the background pre-Fukushima level of 137 Cs of 0.4 ± 0.3 Bq kg −1 , whereas the ratio between the Fukushima-borne 134 Cs and 137 Cs in the lichens was estimated as 1.04. The 134 Cs/ 137 Cs activities ratio in lichens from the Sakhalin region is consistent with the ratios reported by others for the heavy contaminated areas on Honshu Island in Japan following the Fukushima accident. The activity concentrations of natural 7 Be in lichens from the Sakhalin region varied between 100 Bq kg −1 and 600 Bq kg −1 ; the activity concentrations did not exhibit temporal variations during a 2y-period of observations. The
2010-01-01
... consumption and water consumption of automatic commercial ice makers. 431.134 Section 431.134 Energy... of energy consumption and water consumption of automatic commercial ice makers. (a) Scope. This... consumption, but instead calculate the energy use rate (kWh/100 lbs Ice) by dividing the energy consumed...
Does the quality of chest compressions deteriorate when the chest compression rate is above 120/min?
Lee, Soo Hoon; Kim, Kyuseok; Lee, Jae Hyuk; Kim, Taeyun; Kang, Changwoo; Park, Chanjong; Kim, Joonghee; Jo, You Hwan; Rhee, Joong Eui; Kim, Dong Hoon
2014-08-01
The quality of chest compressions along with defibrillation is the cornerstone of cardiopulmonary resuscitation (CPR), which is known to improve the outcome of cardiac arrest. We aimed to investigate the relationship between the compression rate and other CPR quality parameters including compression depth and recoil. A conventional CPR training for lay rescuers was performed 2 weeks before the 'CPR contest'. CPR anytime training kits were distributed to respective participants for self-training on their own in their own time. The participants were tested for two-person CPR in pairs. The quantitative and qualitative data regarding the quality of CPR were collected from a standardised check list and SkillReporter, and compared by the compression rate. A total of 161 teams consisting of 322 students, which includes 116 men and 206 women, participated in the CPR contest. The mean depth and rate for chest compression were 49.0±8.2 mm and 110.2±10.2/min. Significantly deeper chest compression depths were noted at rates over 120/min than those at any other rates (47.0±7.4, 48.8±8.4, 52.3±6.7, p=0.008). Chest compression depth was proportional to chest compression rate (r=0.206, pcompression including chest compression depth and chest recoil by chest compression rate. Further evaluation regarding the upper limit of the chest compression rate is needed to ensure complete full chest wall recoil while maintaining an adequate chest compression depth. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
Compressive sensing in medical imaging.
Graff, Christian G; Sidky, Emil Y
2015-03-10
The promise of compressive sensing, exploitation of compressibility to achieve high quality image reconstructions with less data, has attracted a great deal of attention in the medical imaging community. At the Compressed Sensing Incubator meeting held in April 2014 at OSA Headquarters in Washington, DC, presentations were given summarizing some of the research efforts ongoing in compressive sensing for x-ray computed tomography and magnetic resonance imaging systems. This article provides an expanded version of these presentations. Sparsity-exploiting reconstruction algorithms that have gained popularity in the medical imaging community are studied, and examples of clinical applications that could benefit from compressive sensing ideas are provided. The current and potential future impact of compressive sensing on the medical imaging field is discussed.
Compressed air system audit in a chemical company
Energy Technology Data Exchange (ETDEWEB)
Radgen, P. [Fraunhofer ISI, Karlsruhe (Germany)
2005-07-01
This paper describes the results achieved during a compressed air system audit at a chemical company in Switzerland. The aim of the audit conducted in Muttenz at the site of Clariant Schweiz AG was to analyse the installed compressed air system and its operation in order to identify energy and cost saving potentials. Because there was measurement equipment already installed, it was not necessary to install a new meter. Instead the existing data had to be extracted from the controlled system and regrouped for the analysis. Aggregated data for 2003 and 2004 and a set of detailed data acquired in the course of one week were used for the analysis. The audit identified a number of measures to improve the compressed air system, but had to conclude that the saving potentials at this site are below average. The audit included the compressors, the air treatment and air distribution up to production or storage buildings. The saving potential identified was quantified as about 300 000 kWh/a, or 13.3% of the compressed air energy demand. The cost savings were calculated to be around 41 852 Swiss Franks. (orig.)
PRESS: A Novel Framework of Trajectory Compression in Road Networks
Song, Renchu; Sun, Weiwei; Zheng, Baihua; Zheng, Yu
2014-01-01
Location data becomes more and more important. In this paper, we focus on the trajectory data, and propose a new framework, namely PRESS (Paralleled Road-Network-Based Trajectory Compression), to effectively compress trajectory data under road network constraints. Different from existing work, PRESS proposes a novel representation for trajectories to separate the spatial representation of a trajectory from the temporal representation, and proposes a Hybrid Spatial Compression (HSC) algorithm ...
Jawień, Arkadiusz; Cierzniakowska, Katarzyna; Cwajda-Białasik, Justyna; Mościcka, Paulina
2010-01-01
Introduction The aim of the research was to compare the dynamics of venous ulcer healing when treated with the use of compression stockings as well as original two- and four-layer bandage systems. Material and methods A group of 46 patients suffering from venous ulcers was studied. This group consisted of 36 (78.3%) women and 10 (21.70%) men aged between 41 and 88 years (the average age was 66.6 years and the median was 67). Patients were randomized into three groups, for treatment with the ProGuide two-layer system, Profore four-layer compression, and with the use of compression stockings class II. In the case of multi-layer compression, compression ensuring 40 mmHg blood pressure at ankle level was used. Results In all patients, independently of the type of compression therapy, a few significant statistical changes of ulceration area in time were observed (Student’s t test for matched pairs, p ulceration area in each of the successive measurements was observed in patients treated with the four-layer system – on average 0.63 cm2/per week. The smallest loss of ulceration area was observed in patients using compression stockings – on average 0.44 cm2/per week. However, the observed differences were not statistically significant (Kruskal-Wallis test H = 4.45, p > 0.05). Conclusions A systematic compression therapy, applied with preliminary blood pressure of 40 mmHg, is an effective method of conservative treatment of venous ulcers. Compression stockings and prepared systems of multi-layer compression were characterized by similar clinical effectiveness. PMID:22419941
A Fast Faraday Cup for the Neutralized Drift Compression Experiment
Sefkow, Adam; Coleman, Joshua E; Davidson, Ronald C; Efthimion, Philip; Eylon, Shmuel; Gilson, Erik P; Greenway, Wayne; Henestroza, Enrique; Kwan, Joe W; Roy, Prabir K; Vanecek, David; Waldron, William; Welch, Dale; Yu, Simon
2005-01-01
Heavy ion drivers for high energy density physics applications and inertial fusion energy use space-charge-dominated beams which require longitudinal bunch compression in order to achieve sufficiently high beam intensity at the target. The Neutralized Drift Compression Experiment-1A (NDCX-1A) at Lawrence Berkeley National Laboratory (LBNL) is used to determine the effective limits of neutralized drift compression. NDCX-1A investigates the physics of longitudinal drift compression of an intense ion beam, achieved by imposing an initial velocity tilt on the drifting beam and neutralizing the beam's space-charge with background plasma. Accurately measuring the longitudinal compression of the beam pulse with high resolution is critical for NDCX-1A, and an understanding of the accessible parameter space is modeled using the LSP particle-in-cell (PIC) code. The design and preliminary experimental results for an ion beam probe which measures the total beam current at the focal plane as a function of time are summari...
Gmz: a Gml Compression Model for Webgis
Khandelwal, A.; Rajan, K. S.
2017-09-01
Geography markup language (GML) is an XML specification for expressing geographical features. Defined by Open Geospatial Consortium (OGC), it is widely used for storage and transmission of maps over the Internet. XML schemas provide the convenience to define custom features profiles in GML for specific needs as seen in widely popular cityGML, simple features profile, coverage, etc. Simple features profile (SFP) is a simpler subset of GML profile with support for point, line and polygon geometries. SFP has been constructed to make sure it covers most commonly used GML geometries. Web Feature Service (WFS) serves query results in SFP by default. But it falls short of being an ideal choice due to its high verbosity and size-heavy nature, which provides immense scope for compression. GMZ is a lossless compression model developed to work for SFP compliant GML files. Our experiments indicate GMZ achieves reasonably good compression ratios and can be useful in WebGIS based applications.
International Nuclear Information System (INIS)
Zhu Shoupeng; Xia Fen; Yang Weidong
1993-05-01
A fitted equation to describe the retention of 134 Cs in whole body is obtained by a whole body counter. The equation consists of two half-life components, the fast component is T 1/2 = 0.07 d and the slow component is T 1/2 = 16.14 d. Two fitted equations describing the retention of 134 Cs in skeleton and testes are also introduced. The T 1/2 in skeleton is 5.73 d and in testes is 5.21 d. The results of investigating radioimmunotoxicological effect induced by 134 Cs show that the inhibition of thymus cells is higher than bone marrow cells, the spleen T-lymphocytes is more sensitive to 134 Cs than B-lymphocytes and lymphocytes of peripheral immune organ are more sensitive to radiation than central immune cells and thymus cells. The study of radiogenotoxicological effect induced by 134 Cs shows that the chromosome aberration frequencies and PCE micronucleus formation in bone marrow cells are significantly high, it can induce chromosome aberrations of spermatogonia and increases the abnormality of sperm. The relations between injected dose and abnormalities can be expressed by power functions
27 CFR 478.134 - Sale of firearms to law enforcement officers.
2010-04-01
... AMMUNITION Records § 478.134 Sale of firearms to law enforcement officers. (a) Law enforcement officers... complete Form 4473 or Form 5300.35. The law enforcement officer purchasing the firearm may purchase a...) In Federal law enforcement offices, the supervisor in charge of the office to which the Federal...