SMA OBSERVATIONS OF THE W3(OH) COMPLEX: PHYSICAL AND CHEMICAL DIFFERENTIATION BETWEEN W3(H{sub 2}O) AND W3(OH)

Energy Technology Data Exchange (ETDEWEB)

Qin, Sheng-Li [Department of Astronomy, Yunnan University, and Key Laboratory of Astroparticle Physics of Yunnan Province, Kunming, 650091 (China); Schilke, Peter; Sánchez-Monge, Álvaro [Physikalisches Institut, Universität zu Köln, Zülpicher Str. 77, D-50937 Köln (Germany); Wu, Jingwen [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Wu, Yuefang [Department of Astronomy, Peking University, Beijing, 100871 (China); Liu, Tie [Korea Astronomy and Space Science Institute 776, Daedeokdaero, Yuseong-gu, Daejeon, Korea 305-348 (Korea, Republic of); Liu, Ying, E-mail: slqin@bao.ac.cn [Department of Physics and Hebei Advanced Thin Film Laboratory, Hebei Normal University, Shijiazhuang 050024 (China)

2015-04-10

We report on the Submillimeter Array (SMA) observations of molecular lines at 270 GHz toward the W3(OH) and W3(H{sub 2}O) complex. Although previous observations already resolved the W3(H{sub 2}O) into two or three sub-components, the physical and chemical properties of the two sources are not well constrained. Our SMA observations clearly resolved the W3(OH) and W3(H{sub 2}O) continuum cores. Taking advantage of the line fitting tool XCLASS, we identified and modeled a rich molecular spectrum in this complex, including multiple CH{sub 3}CN and CH{sub 3}OH transitions in both cores. HDO, C{sub 2}H{sub 5}CN, O{sup 13}CS, and vibrationally excited lines of HCN, CH{sub 3}CN, and CH{sub 3}OCHO were only detected in W3(H{sub 2}O). We calculate gas temperatures and column densities for both cores. The results show that W3(H{sub 2}O) has higher gas temperatures and larger column densities than W3(OH) as previously observed, suggesting physical and chemical differences between the two cores. We compare the molecular abundances in W3(H{sub 2}O) to those in the Sgr B2(N) hot core, the Orion KL hot core, and the Orion Compact Ridge, and discuss the chemical origin of specific species. An east–west velocity gradient is seen in W3(H{sub 2}O), and the extension is consistent with the bipolar outflow orientation traced by water masers and radio jets. A north–south velocity gradient across W3(OH) is also observed. However, with current observations we cannot be assured whether the velocity gradients are caused by rotation, outflow, or radial velocity differences of the sub-components of W3(OH)

Electron Temperatures in W51 Complex from High Resolution, Low ...

Indian Academy of Sciences (India)

2016-01-27

Jan 27, 2016 ... We have made continuum radio observations of these HII regions of the W51 complex at 240, 610, 1060 and 1400 MHz using GMRT with lower resolution (20'' × 15'') at the lowest frequency. The observed spectra of the prominent thermal subcomponents of W51 have been fitted to a free-free emission ...

Necrotising fasciitis as atypical presentation of infection with emerging Neisseria meningitidis serogroup W (MenW) clonal complex 11, the Netherlands, March 2017

NARCIS (Netherlands)

Russcher, Anne; Fanoy, Ewout; van Olden, Ger D. J.; Graafland, Antonie D.; van der Ende, Arie; Knol, Mirjam J.

2017-01-01

In March 2017, a patient with necrotising fasciitis caused by Neisseria meningitidis serogroup W (MenW) clonal complex 11 was diagnosed in the Netherlands. Unusual and severe presentations of MenW infections are common in the current European epidemic. In the Netherlands, the incidence of MenW

Analysis of the Response of a 600 kW Stall Controlled Wind Turbine in Complex Terrain

Energy Technology Data Exchange (ETDEWEB)

Cuerva, A.; Bercebal, D.; De la Cruz, S.; Lopez-Diez, S.; Lopez-Roque, V.; Vazquez-Aguado, A.; Marti, I.; Marchante, M.; Navarro, J. [CIEMAT. Madrid (Spain)

1998-12-31

This work presents a detailed analysis of the operating characteristics of a 600 kW rated power wind turbine installed in complex terrain. The description of the experimental set up and analysis system is included. The relationships between parameters that describe the wind turbine response and the environmental conditions are established via high level statistical analysis, fatigue analysis and analysis is the frequency domain. Dimensionless factors are calculated to explain the intrinsic response of the structure before stochastic and deterministic wind conditions, independently from its size and wind intensity. Finally, conclusions are presented regarding the parameters that affect the loading state and power production of the machine. (Author) 12 refs.

Analysis of the Response of a 600 kW Stall Controlled Wind Turbine in Complex Terrain

International Nuclear Information System (INIS)

Cuerva, A.; Bercebal, D.; De La Cruz, M.; Lopez-Diez, S.; Lopez-Roque, V.; Vazquez-Aguado, A.; Marti, I.; Marchante, M.; Navarro, J.

1998-01-01

This work presents a detailed analysis of the operating characteristics of a 600 kW rated power wind turbine installed in complex terrain. The description of the experimental set up and analysis system is included. The relationships between parameters that describe the wind turbine response and the environmental conditions are established via high level statistical analysis, fatigue analysis and analysis in the frequency domain. Dimension less factors are calculated to explain the intrinsic response of the structure before stochastic and deterministic wind conditions, independently from its size and wind intensity. Finally, conclusions are presented regarding the parameters that affect the loading state and power production of the machine. (Author) 12 refs

A Simplified Method for Laboratory Preparation of Organ Specific Indium 113m Compounds

Energy Technology Data Exchange (ETDEWEB)

Adatepe, M H; Potchen, E James [Washington University School of Medicine, St. Louis (United States)

1969-03-15

Generator systems producing short lived nuclides from longer lived parents have distinct clinical advantages. They are more economical, result in a lower radiation dose, and can make short lived scanning readily available even in areas remote from rapid radiopharmaceutical delivery services. The {sup 113}Sn-{sup 113m}In generator has the additional advantage that, as a transition metal, Indium can be readily complexed into organ specific preparations. 113Sn, a reactor produced nuclide with a 118 day half life, is absorbed on a zirconium or silica gel column. the generator is eluded with 5 to 8 ml of 0.05 N HCL solution at pH 1.3-1.4. The daughter nuclide, {sup 113m}In, has a half life of 1.7 hours and emits a 393 Kev monoenergetic gamma ray. Previous methods for labeling organ specific complexes with {sup 113m}In required terminal autoclaving before injection. With the recent introduction of sterile, apyrogenic {sup 113}Sn-{sup 113m}In generators, we have developed a simplified technique for the laboratory preparation of Indium labeled compounds. This method eliminates autoclaving and titration enabling us to pre-prepare organ specific complexes for blood pool, liver, spleen, brain, kidney and lung scanning.

Quality control of the 113Sn-113mIn generator

International Nuclear Information System (INIS)

Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.

1989-01-01

Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia

47 CFR 15.113 - Power line carrier systems.

Science.gov (United States)

2010-10-01

....113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL RADIO FREQUENCY DEVICES Unintentional... shall submit the details of all existing systems plus any proposed new systems or changes to existing... operation on electric lines which connect the distribution substation to the customer or house wiring. Such...

Best-estimate LOCA simulation in a PWR-W containment building with a detailed 3D GOTHIC model

International Nuclear Information System (INIS)

Jimenez, G.; Fernandez-Cosials, K.; Bocanegra, R.; Lopez-Alonso, E.

2015-01-01

The design-basis accidents in a PWR-W containment building are usually simulated with a lumped parameter model, normally used for license analysis. Nevertheless, some phenomenology is difficult to be simulated with a lumped model: the condensation rate in each structure, stagnant water areas, temperature in different compartments, sumps and recirculation pumps disabled because of lack of water, etc. Therefore, for the detailed study of the thermal-hydraulic (TH) behaviour in every room of the containment building could be more appropriate to do it with a detailed 3D representation of the containment building geometry. The main objective of this project has been to build a 3D PWR-W containment model with the GOTHIC code to analyze the detailed behavior during a design basis accident. In the process of the 3D GOTHIC model development some previous steps were necessary: a detailed CAD model of the containment, followed by a simplified model adapted to the GOTHIC geometric capabilities. Once the geometry has been adapted to the GOTHIC requirements, the 3D model is created with this information. A design-basis accident has been simulated with the 3D model (LBLOCA), and the local TH behaviour is analysed. The results show that in comparison with a lumped parameter model, high temperatures are reached locally. Nevertheless the average pressure behaviour is found to be similar to that given by a lumped parameter model. The present paper demonstrates that is possible to build a 3D PWR-W model with the GOTHIC code with enough resolution to analyse the TH behaviour in each one of the containment rooms but at the same time with reasonable computing time. Once the GOTHIC model has been created a new road is opened enabling the simulation of other accidents such as MSLB, a SBLOCA or even a long-term SBO sequence. This document is made up of an abstract and the slides of the presentation. (authors)

Preventive effects of the novel antimicrobial peptide Nal-P-113 in a rat Periodontitis model by limiting the growth of Porphyromonas gingivalis and modulating IL-1β and TNF-α production.

Science.gov (United States)

Wang, Hong-Yan; Lin, Li; Fu, Wei; Yu, Hui-Yuan; Yu, Ning; Tan, Li-Si; Cheng, Jya-Wei; Pan, Ya-Ping

2017-08-29

P-113 (AKRHHGYKRKFH-NH2) is a 12-amino-acid histidine-rich peptide derived from histatin 5 that is highly degradable in high salt concentrations and biological fluids such as serum, plasma and saliva. Nal-P-113, a novel antimicrobial peptide whose histidine residues are replaced by the bulky amino acids β-naphthylalanine, causes the antimicrobial peptide to retain its bactericidal activity even in physiological environments. This study evaluated the effect of the novel antimicrobial peptide Nal-P-113 in a rat periodontitis model and the mechanisms of action of Nal-P-113 for suppressing periodontitis. Periodontitis was induced in mandibular first molars in rats receiving a ligature and infected with Porphyromonas gingivalis. Animals were randomly divided into six groups: a, P. gingivalis W83 alone; b, P. gingivalis W83 with 6.25 μg/mL of Nal-P-113; c, P. gingivalis W83 with 25 μg/mL of Nal-P-113; d, P. gingivalis W83 with 100 μg/mL of Nal-P-113; e, P. gingivalis W83 with 400 μg/mL of Nal-P-113; and f, control without P. gingivalis W83 or Nal-P-113. Morphometric analysis was used to evaluate alveolar bone loss. Microbiological assessment of the presence of Porphyromonas gingivalis and total bacteria was performed using absolute quantitative real-time PCR and scanning electron microscopy. Gingival tissue was collected for western blot and immunohistochemical assays of IL-1β and TNF-α levels. Alveolar bone loss was inhibited by 100 μg/mL or 400 μg/mL of Nal-P-113 compared to the control group (P periodontal tissue (P periodontitis in rats by limiting the amount of bacteria and modulating IL-1β and TNF-α production. The use of Nal-P-113 in vivo might serve as a beneficial preventive or therapeutic approach for periodontitis.

Theoretical studies on the electronic and optoelectronic properties of [A.2AP(w)/A*.2AP(WC)/C.2AP(w)/C*.2AP(WC)/C.A(w)/C*.A(WC)]-Au8 mismatch nucleobase complexes

Science.gov (United States)

Srivastava, Ruby

2018-01-01

The electronic and optoelectronic properties of [A.2AP(w)/A*.2AP(WC)/C.2AP(w)/C*.2AP(WC)/C.A(w)/ C*.A(WC)]-Au8 metal-mismatch nucleobase complexes are investigated by means of density functional theory and time-dependent methods. We selected these mispairs as 2-aminopurine (2AP) produces incorporation errors when binding with cytosine (C) into the wobble (w) C.2AP(w) mispair, and is tautomerised into Watson-Crick (WC)-like base mispair C*.2AP(WC) and less effectively produces A.2AP(w)/A*.2AP(WC) mispairs. The vertical ionisation potential, vertical electron affinity, hardness and electrophilicity index of these complexes have also been discussed. The modifications of energy levels and charge density distributions of the frontier orbitals are also analysed. The absorption spectra of these complexes lie in the visible region, which suggests their application in fluorescent-bio imaging. The mechanism of cooperativity effect is studied by molecular orbital potential (MEP), atoms-in-molecules (AIM) and natural bond orbital analyses. Most metalated pairs have smaller HOMO-LUMO band gaps than the isolated mismatch nucleobases which suggest interesting consequences for electron transfer through DNA duplexes.

Identification of protein W, the elusive sixth subunit of the Rhodopseudomonas palustris reaction center-light harvesting 1 core complex.

Science.gov (United States)

Jackson, Philip J; Hitchcock, Andrew; Swainsbury, David J K; Qian, Pu; Martin, Elizabeth C; Farmer, David A; Dickman, Mark J; Canniffe, Daniel P; Hunter, C Neil

2018-02-01

The X-ray crystal structure of the Rhodopseudomonas (Rps.) palustris reaction center-light harvesting 1 (RC-LH1) core complex revealed the presence of a sixth protein component, variably referred to in the literature as helix W, subunit W or protein W. The position of this protein prevents closure of the LH1 ring, possibly to allow diffusion of ubiquinone/ubiquinol between the RC and the cytochrome bc 1 complex in analogous fashion to the well-studied PufX protein from Rhodobacter sphaeroides. The identity and function of helix W have remained unknown for over 13years; here we use a combination of biochemistry, mass spectrometry, molecular genetics and electron microscopy to identify this protein as RPA4402 in Rps. palustris CGA009. Protein W shares key conserved sequence features with PufX homologs, and although a deletion mutant was able to grow under photosynthetic conditions with no discernible phenotype, we show that a tagged version of protein W pulls down the RC-LH1 complex. Protein W is not encoded in the photosynthesis gene cluster and our data indicate that only approximately 10% of wild-type Rps. palustris core complexes contain this non-essential subunit; functional and evolutionary consequences of this observation are discussed. The ability to purify uniform RC-LH1 and RC-LH1-protein W preparations will also be beneficial for future structural studies of these bacterial core complexes. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

Large scale IRAM 30 m CO-observations in the giant molecular cloud complex W43

Science.gov (United States)

Carlhoff, P.; Nguyen Luong, Q.; Schilke, P.; Motte, F.; Schneider, N.; Beuther, H.; Bontemps, S.; Heitsch, F.; Hill, T.; Kramer, C.; Ossenkopf, V.; Schuller, F.; Simon, R.; Wyrowski, F.

2013-12-01

We aim to fully describe the distribution and location of dense molecular clouds in the giant molecular cloud complex W43. It was previously identified as one of the most massive star-forming regions in our Galaxy. To trace the moderately dense molecular clouds in the W43 region, we initiated W43-HERO, a large program using the IRAM 30 m telescope, which covers a wide dynamic range of scales from 0.3 to 140 pc. We obtained on-the-fly-maps in 13CO (2-1) and C18O (2-1) with a high spectral resolution of 0.1 km s-1 and a spatial resolution of 12''. These maps cover an area of ~1.5 square degrees and include the two main clouds of W43 and the lower density gas surrounding them. A comparison to Galactic models and previous distance calculations confirms the location of W43 near the tangential point of the Scutum arm at approximately 6 kpc from the Sun. The resulting intensity cubes of the observed region are separated into subcubes, which are centered on single clouds and then analyzed in detail. The optical depth, excitation temperature, and H2 column density maps are derived out of the 13CO and C18O data. These results are then compared to those derived from Herschel dust maps. The mass of a typical cloud is several 104 M⊙ while the total mass in the dense molecular gas (>102 cm-3) in W43 is found to be ~1.9 × 106 M⊙. Probability distribution functions obtained from column density maps derived from molecular line data and Herschel imaging show a log-normal distribution for low column densities and a power-law tail for high densities. A flatter slope for the molecular line data probability distribution function may imply that those selectively show the gravitationally collapsing gas. Appendices are available in electronic form at http://www.aanda.orgThe final datacubes (13CO and C18O) for the entire survey are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/560/A24

Detailed investigation of the gamma-ray emission in the vicinity of SNR W28 with Fermi-LAT

Energy Technology Data Exchange (ETDEWEB)

Hanabata, Y. [Institute for Cosmic-Ray Research, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8582 (Japan); Katagiri, H. [College of Science, Ibaraki University, 2-1-1, Bunkyo, Mito 310-8512 (Japan); Hewitt, J.W. [CRESST, University of Maryland, Baltimore County, Baltimore, MD 21250 (United States); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d' Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Fukazawa, Y. [Department of Physical Sciences, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Fukui, Y.; Hayakawa, T. [Department of Physics and Astrophysics, Nagoya University, Chikusa-ku Nagoya 464-8602 (Japan); Lemoine-Goumard, M. [Centre d' Études Nucléaires de Bordeaux Gradignan, IN2P3/CNRS, Université Bordeaux 1, BP120, F-33175 Gradignan Cedex (France); Pedaletti, G.; Torres, D. F. [Institut de Ciències de l' Espai (IEEE-CSIC), Campus UAB, 08193 Barcelona (Spain); Strong, A. W. [Max-Planck Institut für extraterrestrische Physik, D-85748 Garching (Germany); Yamazaki, R., E-mail: hanabata@icrr.u-tokyo.ac.jp, E-mail: katagiri@mx.ibaraki.ac.jp [Department of Physics and Mathematics, Aoyama Gakuin University, Sagamihara, Kanagawa 252-5258 (Japan)

2014-05-10

We present a detailed investigation of the γ-ray emission in the vicinity of the supernova remnant (SNR) W28 (G6.4–0.1) observed by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. We detected significant γ-ray emission spatially coincident with TeV sources HESS J1800–240A, B, and C, located outside the radio boundary of the SNR. Their spectra in the 2-100 GeV band are consistent with the extrapolation of the power-law spectra of the TeV sources. We also identified a new source of GeV emission, dubbed Source W, which lies outside the boundary of TeV sources and coincides with radio emission from the western part of W28. All of the GeV γ-ray sources overlap with molecular clouds in the velocity range from 0 to 20 km s{sup –1}. Under the assumption that the γ-ray emission toward HESS J1800–240A, B, and C comes from π{sup 0} decay due to the interaction between the molecular clouds and cosmic rays (CRs) escaping from W28, they can be naturally explained by a single model in which the CR diffusion coefficient is smaller than the theoretical expectation in the interstellar space. The total energy of the CRs escaping from W28 is constrained through the same modeling to be larger than ∼2 × 10{sup 49} erg. The emission from Source W can also be explained with the same CR escape scenario.

Detailed investigation of the gamma-ray emission in the vicinity of SNR W28 with Fermi-LAT

International Nuclear Information System (INIS)

Hanabata, Y.; Katagiri, H.; Hewitt, J.W.; Ballet, J.; Fukazawa, Y.; Fukui, Y.; Hayakawa, T.; Lemoine-Goumard, M.; Pedaletti, G.; Torres, D. F.; Strong, A. W.; Yamazaki, R.

2014-01-01

We present a detailed investigation of the γ-ray emission in the vicinity of the supernova remnant (SNR) W28 (G6.4–0.1) observed by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. We detected significant γ-ray emission spatially coincident with TeV sources HESS J1800–240A, B, and C, located outside the radio boundary of the SNR. Their spectra in the 2-100 GeV band are consistent with the extrapolation of the power-law spectra of the TeV sources. We also identified a new source of GeV emission, dubbed Source W, which lies outside the boundary of TeV sources and coincides with radio emission from the western part of W28. All of the GeV γ-ray sources overlap with molecular clouds in the velocity range from 0 to 20 km s –1 . Under the assumption that the γ-ray emission toward HESS J1800–240A, B, and C comes from π 0 decay due to the interaction between the molecular clouds and cosmic rays (CRs) escaping from W28, they can be naturally explained by a single model in which the CR diffusion coefficient is smaller than the theoretical expectation in the interstellar space. The total energy of the CRs escaping from W28 is constrained through the same modeling to be larger than ∼2 × 10 49 erg. The emission from Source W can also be explained with the same CR escape scenario.

Test Results of a 200 W Class Hall Thruster

Science.gov (United States)

Jacobson, David; Jankovsky, Robert S.

1999-01-01

The performance of a 200 W class Hall thruster was evaluated. Performance measurements were taken at power levels between 90 W and 250 W. At the nominal 200 W design point, the measured thrust was 11.3 mN. and the specific impulse was 1170 s excluding cathode flow in the calculation. A laboratory model 3 mm diameter hollow cathode was used for all testing. The engine was operated on laboratory power supplies in addition to a breadboard power processing unit fabricated from commercially available DC to DC converters.

A W Joshi

Indian Academy of Sciences (India)

What can we Learn from the Electromagnetic Spectrum? A W Joshi Alok Kumar · More Details Fulltext PDF. Volume 8 Issue 7 July 2003 pp 76-84 Classroom. Simple, Concept-Centred, Innovative, Open-Ended Experiments in Physics – 1 · A W Joshi Vijay H Raybagkar F I Surve · More Details Fulltext PDF. Volume 8 Issue 9 ...

13 CFR 113.310 - Recruitment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...

study on 113 Sn-113m In generator of the chromatographic column elution mode

International Nuclear Information System (INIS)

Abdel-Halim, A.A.

2002-01-01

this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days

Effect of complexing agents and pH on microstructure and tribological properties of Co-W coatings produced by double pulse electrodeposition

International Nuclear Information System (INIS)

Su Fenghua; Liu Cansen; Huang Ping

2012-01-01

The Co-W coatings were produced by double pulse electrodeposition from aqueous bath with cobalt sulphate and sodium tungstate. Effect of complexing agent and pH value in the plating bath on the microstructure, morphology and hardness of the electrodeposited Co-W coatings were investigated using an X-ray diffraction (XRD), scanning electron microscope (SEM) and a Vickers hardness tester, respectively. The friction and wear properties of the Co-W coatings deposited from different baths were evaluated with a ball-on-disk UMT-3MT tribometer. The correlation among the electrodepositing condition that varied with the complexing agent or pH value, the microstructure and the tribological properties of the deposited Co-W coatings were discussed. The results show that the complexing agent and pH value significantly affect the microstructure and tribological properties of the electrodeposited Co-W coatings. The sodium citrate is the best complexing agent to improve the tribological properties of the electrodeposited Co-W coatings at pH 6.0, followed by the sodium gluconate. The Co-W coatings electrodeposited from the near neutral bath can obtain better tribological properties than those deposited from strong acid or strong alkaline bath. The differences of the tribological properties for Co-W coatings from different baths were attributed to their different hardness, crystal structure and morphological characterizations, which can be optimized by the electrodepositing condition, i.e., the complexing agent and pH value in bath.

Effect of impurities on the growth of {113} interstitial clusters in silicon under electron irradiation

Science.gov (United States)

Nakai, K.; Hamada, K.; Satoh, Y.; Yoshiie, T.

2011-01-01

The growth and shrinkage of interstitial clusters on {113} planes were investigated in electron irradiated Czochralski grown silicon (Cz-Si), floating-zone silicon (Fz-Si), and impurity-doped Fz-Si (HT-Fz-Si) using a high voltage electron microscope. In Fz-Si, {113} interstitial clusters were formed only near the beam incident surface after a long incubation period, and shrank on subsequent irradiation from the backside of the specimen. In Cz-Si and HT-Fz-Si, {113} interstitial clusters nucleated uniformly throughout the specimen without incubation, and began to shrink under prolonged irradiation at higher electron beam intensity. At lower beam intensity, however, the {113} interstitial cluster grew stably. These results demonstrate that the {113} interstitial cluster cannot grow without a continuous supply of impurities during electron irradiation. Detailed kinetics of {113} interstitial cluster growth and shrinkage in silicon, including the effects of impurities, are proposed. Then, experimental results are analyzed using rate equations based on these kinetics.

Intrinsic gas-phase reactivity toward methanol of trinuclear tungsten W(3)S(4) complexes bearing W-X (X = Br, OH) groups.

Science.gov (United States)

Vicent, Cristian; Feliz, Marta; Llusar, Rosa

2008-12-11

Electrospray ionization (ESI) tandem mass spectrometry is used to investigate the gas-phase dissociation of trinuclear sulfide W(3)S(4) complexes containing three diphosphane ligands and three terminal bromine atoms, namely, [W(3)S(4)(dmpe)(3)(Br)(3)](+) (1(+)) or hydroxo groups, [W(3)S(4)(dmpe)(3)(OH)(3)](+) (2(+)) (dmpe = 1,2-bis(dimethylphosphanyl)ethane). Sequential evaporation of two diphosphane ligands is the sole fragmentation channel for the 1(+) cation that yields product ions with one or two unsaturated W-Br functional groups, respectively. Conversely, evaporation of one diphosphane ligand followed by two water molecules is observed for cation 2(+). Complementary deuterium-labeling experiments in conjunction with computational studies provide deep insight into the thermodynamically favored product ion structures found along the fragmentation pathways. From these results, the formation of a series of cluster cations with WBr, WOH, and WO functional groups either on saturated or unsaturated metal sites is proposed. The effect of the properties of these cluster cations, among them chemical composition and coordinative saturation, on their reactivity toward methanol is discussed.

Gas-phase chemistry of Mo, Ru, W, and Os metal carbonyl complexes

International Nuclear Information System (INIS)

Wang, Y.; Qin, Z.; Fan, F.L.

2014-01-01

Metal carbonyl complexes were used for studying the gas-phase chemical behavior of Mo, Ru, W and Os isotopes with an on-line low temperature isothermal gas chromatography apparatus. Short-lived Mo and Ru isotopes were produced by a 252 Cf spontaneous fission source. Short-lived nuclides of W and Os were produced using the heavy ion reactions 19 F + 159 Tb and 165 Ho, respectively. Short-lived products were thermalized in a recoil chamber filled with a gas mixture of helium and carbon monoxide. The carbonyls formed were then transported through capillaries to an isothermal chromatography column for study of the adsorption behavior as a function of temperature. On-line isothermal chromatography (IC) experiments on Teflon (PTFE) and quartz surfaces showed that short-lived isotopes of the listed elements can form carbonyl complexes which are very volatile and interact most likely in physical sorption processes. Deduced adsorption enthalpies of Mo and Ru carbonyls were -38 ± 2 kJ/mol and -36 ± 2 kJ/mol, respectively. These values are in good agreement with literature data, partly obtained with different chromatographic techniques. A validation of the applied Monte Carlo model to deduce adsorption enthalpies with Mo isotopes of different half-lives proved the validity of the underlying adsorption model. The investigations using a gas-jet system coupled to a heavy ion accelerator without any preseparator clearly showed the limitations of the approach. The He and CO gas mixture, which was directly added into the chamber, will result in decomposition of CO gas and produce some aerosol particles. After the experiment of 173 W and 179 Os in the heavy ion experiments, the Teflon column was covered by a yellowish deposit; the adsorption enthalpy of W and Os carbonyls could therefore not be properly deduced using Monte Carlo simulations. (orig.)

Holistyczne kompetencje zawodowe studentów pielęgniarskich studiów magisterskich = The holistic nursing professional competence of students graduate

OpenAIRE

Brodowicz-Król, Magdalena; Zarzycka, Danuta; Stadnicka, Sabina; Bartoń, Elżbieta

2016-01-01

Brodowicz-Król Magdalena, Zarzycka Danuta, Stadnicka Sabina, Bartoń Elżbieta. Holistyczne kompetencje zawodowe studentów pielęgniarskich studiów magisterskich = The holistic nursing professional competence of students graduate. Journal of Education, Health and Sport. 2016;6(8):113-127. eISSN 2391-8306. DOI http://dx.doi.org/10.5281/zenodo.59880 http://ojs.ukw.edu.pl/index.php/johs/article/view/3736 The journal has had 7 points in Ministry of Science and Higher Educat...

Transient heat transfer phenomena of the liquid metal layer cooled by overlying R113 coolant

International Nuclear Information System (INIS)

Cho, J. S.; Seo, K. R.; Jung, C. H.; Park, R. J.; Kim, S. B.

1999-01-01

To understand the fundamental relationship of the natural convection heat transfer in the molten metal pool and the boiling mechanism of the overlying coolant, experiments were performed for the transient heat transfer of the liquid metal pool with overlying R113 coolant with boiling. The simulant molten pool material is tin (Sn) with the melting temperature of 232 deg C. The metal pool is heated from the bottom surface and the coolant is injected onto the molten metal pool. Tests were conducted by changing the bottom surface boundary condition. The bottom heating condition was varied from 8kW to 14kW. As a result the boiling mechanism of the R113 coolant is changed from the nuclear boiling to film boiling. The Nusselt number and the Rayleigh number in the molten metal pool region obtained as functions of time. Analysis was made for the relationship between the heat flux and the temperature difference of the metal layer surface temperature and the boiling coolant bulk temperature

Inhibitors of the alpha-ketoglutarate dehydrogenase complex alter [1-13C]glucose and [U-13C]glutamate metabolism in cerebellar granule neurons.

Science.gov (United States)

Santos, Sónia Sá; Gibson, Gary E; Cooper, Arthur J L; Denton, Travis T; Thompson, Charles M; Bunik, Victoria I; Alves, Paula M; Sonnewald, Ursula

2006-02-15

Diminished activity of the alpha-ketoglutarate dehydrogenase complex (KGDHC), an important component of the tricarboxylic acid (TCA) cycle, occurs in several neurological diseases. The effect of specific KGDHC inhibitors [phosphonoethyl ester of succinyl phosphonate (PESP) and the carboxy ethyl ester of succinyl phosphonate (CESP)] on [1-13C]glucose and [U-13C]glutamate metabolism in intact cerebellar granule neurons was investigated. Both inhibitors decreased formation of [4-13C]glutamate from [1-13C]glucose, a reduction in label in glutamate derived from [1-13C]glucose/[U-13C]glutamate through a second turn of the TCA cycle and a decline in the amounts of gamma-aminobutyric acid (GABA), aspartate, and alanine. PESP decreased formation of [U-13C]aspartate and total glutathione, whereas CESP decreased concentrations of valine and leucine. The findings are consistent with decreased KGDHC activity; increased alpha-ketoglutarate formation; increased transamination of alpha-ketoglutarate with valine, leucine, and GABA; and new equilibrium position of the aspartate aminotransferase reaction. Overall, the findings also suggest that some carbon derived from alpha-ketoglutarate may bypass the block in the TCA cycle at KGDHC by means of the GABA shunt and/or conversion of valine to succinate. The results suggest the potential of succinyl phosphonate esters for modeling the biochemical and pathophysiological consequences of reduced KGDHC activity in brain diseases.

Crystal structure of (OC5W(μ-dppeW(CO5

Directory of Open Access Journals (Sweden)

Hannah F. Drake

2016-10-01

Full Text Available The centrosymmetric title complex, [μ-ethane-1,2-diylbis(diphenylphosphane-κ2P:P′]bis[pentacarbonyltungsten(0], [W2(C26H24P2(CO10], consists of two W(CO5 moieties bridged by a bis(diphenylphosphanylethane (dppe ligand. The W0 atom has a slightly distorted octahedral coordination environment consisting of 5 carbonyl ligands and one P atom from the bridging dppe ligand with the nearest W0 atom 5.625 (5 Å away. The complex resides on a center of symmetry.

Phase V storage (Project W-112) Central Waste Complex operational readiness review, final report

International Nuclear Information System (INIS)

Wight, R.H.

1997-01-01

This document is the final report for the RFSH conducted, Contractor Operational Readiness Review (ORR) for the Central Waste Complex (CWC) Project W-112 and Interim Safety Basis implementation. As appendices, all findings, observations, lines of inquiry and the implementation plan are included

Phase 5 storage (Project W-112) Central Waste Complex operational readiness review, final report

Energy Technology Data Exchange (ETDEWEB)

Wight, R.H.

1997-05-30

This document is the final report for the RFSH conducted, Contractor Operational Readiness Review (ORR) for the Central Waste Complex (CWC) Project W-112 and Interim Safety Basis implementation. As appendices, all findings, observations, lines of inquiry and the implementation plan are included.

Design, performance, and economics of 50-kW and 500-kW vertical axis wind turbines

Science.gov (United States)

Schienbein, L. A.; Malcolm, D. J.

1983-11-01

A review of the development and performance of the DAF Indal 50-kW vertical axis Darrieus wind turbine shows that a high level of technical development and reliability has been achieved. Features of the drive train, braking and control systems are discussed and performance details are presented. Details are also presented of a 500-kW VAWT that is currently in production. A discussion of the economics of both the 50-kW and 500-kW VAWTs is included, showing the effects of charge rate, installed cost, operating cost, performance, and efficiency.

7 CFR 1220.113 - Marketing.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...

32 CFR 724.113 - Application.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...

w zhang

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. W ZHANG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 51. Effect of oxygen vacancies on Li-storage of anatase TiO 2 (001) facets: a first principles study · H CHEN Y H DING X Q TANG W ZHANG J R YIN P ZHANG Y JIANG · More Details ...

42 CFR 66.113 - Publications.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...

28 CFR 551.113 - Counseling.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...

W-geometry

International Nuclear Information System (INIS)

Hull, C.M.

1993-01-01

The geometric structure of theories with gauge fields of spins two and higher should involve a higher spin generalisation of Riemannian geometry. Such geometries are discussed and the case of W ∝ -gravity is analysed in detail. While the gauge group for gravity in d dimensions is the diffeomorphism group of the space-time, the gauge group for a certain W-gravity theory (which is W ∝ -gravity in the case d=2) is the group of symplectic diffeomorphisms of the cotangent bundle of the space-time. Gauge transformations for W-gravity gauge fields are given by requiring the invariance of a generalised line element. Densities exist and can be constructed from the line element (generalising √detg μν ) only if d=1 or d=2, so that only for d=1,2 can actions be constructed. These two cases and the corresponding W-gravity actions are considered in detail. In d=2, the gauge group is effectively only a subgroup of the symplectic diffeomorphisms group. Some of the constraints that arise for d=2 are similar to equations arising in the study of self-dual four-dimensional geometries and can be analysed using twistor methods, allowing contact to be made with other formulations of W-gravity. While the twistor transform for self-dual spaces with one Killing vector reduces to a Legendre transform, that for two Killing vectors gives a generalisation of the Legendre transform. (orig.)

21 CFR 113.60 - Containers.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...

Localization of the placenta on gamma chamber with 113m In-lambratene

International Nuclear Information System (INIS)

Shejretova, E.; Blazheva, P.; Kovacheva, S.; Tsanev, Ts.

1977-01-01

The authors describe their experience in applying the radioisotopic method for localization of the placenta on gamma chamber by means of 113m In-lambratene (113m In-cysteamine). This complex is chosen due to its valuable physical characteristics of 113m In as shortliving, with whom lambratene is labelled, with proven irradiation protective properties, with the purpose of lowering irradiation load of the fetus. The authors use unique apparatus, gamma chamber Pho-Gamma HP and conventional scanner during injection of 2 mCi 113m In-lambratene. The authors examined 81 women, 42 of whom were pregnant at 6 to 10 months of gestation and 39 women from the third to the fifth month of gestation because of bleedings, Rh isoimmunization with forthcoming amniocentesis, and state after cesarian section for the first group and impending interruption of pregnancy for the second group. The diagnosis of the placenta localization was supported by cesarian section, delivery and interruption of pregnancy. There was 100% coincidence of the diagnosis. (author)

The study of the reaction e+e-→W+W-

International Nuclear Information System (INIS)

Blondel, A.; Raimondi, P.; Schlatter, W.

1987-01-01

The reaction e + e - →W + W - provides an unique opportunity to test some important aspects of the Standard Model. After a review of the basic relevant measurements, data are presented which simulate the performance of LEP detectors for this process around 95 GeV beam energy. Of particular interest are measurements of the W helicity providing new information on the process. The role of beam polarization is discussed in some detail. 32 figs; 15 refs

13 CFR 113.405 - Housing.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...

13 CFR 113.500 - Employment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...

DEAD-box helicase DDX27 regulates 3′ end formation of ribosomal 47S RNA and stably associates with the PeBoW-complex

Energy Technology Data Exchange (ETDEWEB)

Kellner, Markus; Rohrmoser, Michaela [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany); Forné, Ignasi [Adolf Butenandt Institute, Ludwig Maximilians University of Munich, Center for Integrated Protein Science Munich (CIPSM), Schillerstr. 44, Munich 80336 (Germany); Voss, Kirsten; Burger, Kaspar; Mühl, Bastian; Gruber-Eber, Anita [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany); Kremmer, Elisabeth [Institute of Molecular Immunology, Helmholtz Center Munich, Marchioninistr. 25, Munich 81377 (Germany); Imhof, Axel [Adolf Butenandt Institute, Ludwig Maximilians University of Munich, Center for Integrated Protein Science Munich (CIPSM), Schillerstr. 44, Munich 80336 (Germany); Eick, Dirk, E-mail: eick@helmholtz-muenchen.de [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany)

2015-05-15

PeBoW, a trimeric complex consisting of pescadillo (Pes1), block of proliferation (Bop1), and the WD repeat protein 12 (WDR12), is essential for processing and maturation of mammalian 5.8S and 28S ribosomal RNAs. Applying a mass spectrometric analysis, we identified the DEAD-box helicase DDX27 as stably associated factor of the PeBoW-complex. DDX27 interacts with the PeBoW-complex via an evolutionary conserved F×F motif in the N-terminal domain and is recruited to the nucleolus via its basic C-terminal domain. This recruitment is RNA-dependent and occurs independently of the PeBoW-complex. Interestingly, knockdown of DDX27, but not of Pes1, induces the accumulation of an extended form of the primary 47S rRNA. We conclude that DDX27 can interact specifically with the Pes1 and Bop1 but fulfils critical function(s) for proper 3′ end formation of 47S rRNA independently of the PeBoW-complex. - Highlights: • DEAD-box helicase DDX27 is a new constituent of the PeBoW-complex. • The N-terminal F×F motif of DDX27 interacts with the PeBoW components Pes1 and Bop1. • Nucleolar anchoring of DDX27 via its basic C-terminal domain is RNA dependent. • Knockdown of DDX27 induces a specific defect in 3′ end formation of 47S rRNA.

21 CFR 163.113 - Cocoa.

Science.gov (United States)

2010-04-01

... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...

23 CFR 660.113 - Construction.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...

111In,113In-labelled platelets. I

International Nuclear Information System (INIS)

Komarek, P.; Poledne, R.; Charvat, J.; Konopkova, M.; Komarkova, I.

1983-01-01

111 In-8-hydroxyquinoline (oxine) is used for labelling blood platelets which serves diagnostic purposes in medicine. For the preparation of the complex of radioactive indium with oxine, 111 In and sup(113m)In were used under optimal conditions. Two different preparation methods for the labelled complex are described. Both methods studied the effect of pH, the amount of chelate agents and the mode of filtration on the yields of the labelled oxine. The blood platelets labelling is influenced not only by the quality of labelled oxine but also by their number. The organ distribution in laboratory animals proved that platelets were not impaired during separation and labelling and that they were suitable for diagnostic use. (author)

An automated system for selective fission product separations; decays of 113-115Pd

International Nuclear Information System (INIS)

Meikrantz, D.H.; Gehrke, R.J.; McIsaac, L.D.; Baker, J.D.; Greenwood, R.C.

1981-01-01

A microcomputer controlled radiochemical separation system has been developed for the isolation and study of fission products with half-lives of approx. >= 10 s. The system is based upon solvent extraction with three centrifugal contactors coupled in series, which provides both rapid and highly efficient separations with large decontamination factors. This automated system was utilized to study the radioactive decays of 113-115 Pd via solvent extraction of the Pd-dimethylglyoxime complex from 252 Cf fission products. As a result of this effort, γ-rays associated with the decay of approx. equal to 90-s sup(113,113m)Pd, 149-s 114 Pd and 47-s 115 Pd have been identified. The isotopic assignments to each of these Pd radioactivities have been confirmed from observation of the growth and decay curves of their respective Ag daughters. In addition, previously unreported Ag γ-rays have been assigned; one to the decay of 69-s 113 Ag, and two to the decay of 19-s 115 Ag. (orig.)

14 CFR 1240.113 - Financial accounting.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...

48 CFR 49.113 - Cost principles.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...

Dicty_cDB: CHC113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

42 CFR 56.113 - Grantee accountability.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...

24 CFR 27.113 - Foreclosure costs.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...

10 CFR 71.113 - Document control.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...

The Plasmodium protein P113 supports efficient sporozoite to liver stage conversion in vivo.

Science.gov (United States)

Offeddu, Vittoria; Rauch, Manuel; Silvie, Olivier; Matuschewski, Kai

2014-02-01

Invasive stages of Plasmodium parasites possess distinct integral and peripheral membrane proteins that mediate host cell attachment and invasion. P113 is an abundant protein in detergent-resistant high molecular weight complexes in Plasmodium schizonts, but is unusual since expression extends to gametocytes and sporozoites. In this study, we tested whether P113 performs important functions for parasite propagation in Plasmodium berghei. We show that pre-erythrocytic expression of P113 displays key signatures of upregulated in infectious sporozoites (UIS) genes, including control by the liver stage master regulator SLARP. Targeted gene deletion resulted in viable blood stage parasites that displayed no signs of blood stage growth defects. p113(-) parasites propagated normally through the life cycle until mature sporozoites, but displayed defects during natural sporozoite transmission, leading to a delay to patency in infected animals. By comparative in vitro and in vivo analysis of pre-erythrocytic development and using a xeno-diagnostic test we show that ablation of P113 results in lower sporozoite to liver stage conversion and, as a consequence, reduced merozoite output in vivo, without delaying liver stage development. We conclude that p113 is dispensable for Plasmodium life cycle progression and plays auxiliary roles during pre-erythrocytic development. Copyright © 2014 Elsevier B.V. All rights reserved.

9 CFR 113.7 - Multiple fractions.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...

49 CFR 194.113 - Information summary.

Science.gov (United States)

2010-10-01

... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...

Global epidemiology of capsular group W meningococcal disease (1970-2015): Multifocal emergence and persistence of hypervirulent sequence type (ST)-11 clonal complex.

Science.gov (United States)

Mustapha, Mustapha M; Marsh, Jane W; Harrison, Lee H

2016-03-18

Following an outbreak in Mecca Saudi Arabia in 2000, meningococcal strains expressing capsular group W (W) emerged as a major cause of invasive meningococcal disease (IMD) worldwide. The Saudi Arabian outbreak strain (Hajj clone) belonging to the ST-11 clonal complex (cc11) is similar to W cc11 causing occasional sporadic disease before 2000. Since 2000, W cc11 has caused large meningococcal disease epidemics in the African meningitis belt and endemic disease in South America, Europe and China. Traditional molecular epidemiologic typing suggested that a majority of current W cc11 burden represented global spread of the Hajj clone. However, recent whole genome sequencing (WGS) analyses revealed significant genetic heterogeneity among global W cc11 strains. While continued spread of the Hajj clone occurs in the Middle East, the meningitis belt and South Africa have co-circulation of the Hajj clone and other unrelated W cc11 strains. Notably, South America, the UK, and France share a genetically distinct W cc11 strain. Other W lineages persist in low numbers in Europe, North America and the meningitis belt. In summary, WGS is helping to unravel the complex genomic epidemiology of group W meningococcal strains. Wider application of WGS and strengthening of global IMD surveillance is necessary to monitor the continued evolution of group W lineages. Copyright © 2016 Elsevier Ltd. All rights reserved.

19 CFR 113.35 - Individual sureties.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...

7 CFR 1710.113 - Loan security.

Science.gov (United States)

2010-01-01

... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...

Dicty_cDB: VFB113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

Radiative corrections to e+e- → W+W- in the Weinberg model

NARCIS (Netherlands)

Veltman, M.J.G.; Lemoine, M.

1980-01-01

The one-loop radiation corrections to the process e+e- ->W+W- are calculated in the Weinberg model. The corrections are computed in a c.m. energy range of 180-1000 GeV. The dependence on the Higgs mass is studied in detail; it is found that variations in the Higgs mass from 10-1000 GeV give rise

38 CFR 75.113 - Data breach.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...

Metathesis Polymerization Reactions Induced by the Bimetallic Complex (Ph4P2[W2(μ-Br3Br6

Directory of Open Access Journals (Sweden)

Despoina Chriti

2015-12-01

Full Text Available The reactivity of the bimetallic complex (Ph4P2[W2(μ-Br3Br6] ({W 2.5 W}7+, a′2e3 towards ring opening metathesis polymerization (ROMP of norbornene (NBE and some of its derivatives, as well as the mechanistically related metathesis polymerization of phenylacetylene (PA, is presented. Our results show that addition of a silver salt (AgBF4 is necessary for the activation of the ditungsten complex. Polymerization of PA proceeds smoothly in tetrahydrofuran (THF producing polyphenylacetylene (PPA in high yields. On the other hand, the ROMP of NBE and its derivatives is more efficient in CH2Cl2, providing high yields of polymers. 13C Cross Polarization Magic Angle Spinning (CPMAS spectra of insoluble polynorbornadiene (PNBD and polydicyclopentadiene (PDCPD revealed the operation of two mechanisms (metathetic and radical for cross-linking, with the metathesis pathway prevailing.

13 CFR 113.540 - Advertising.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...

48 CFR 32.113 - Customary contract financing.

Science.gov (United States)

2010-10-01

... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...

48 CFR 432.113 - Customary contract financing.

Science.gov (United States)

2010-10-01

... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...

13 CFR 113.450 - Athletics.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...

Preparation of an sup(113m) indium generator

International Nuclear Information System (INIS)

Ling, H.W.

1979-01-01

This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt

5 CFR 831.113 - Payments to children.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...

21 CFR 113.5 - Current good manufacturing practice.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...

CONSTRUCTION OF AGGREGATE NATIONAL ECONOMIC MODEL WITH DETAILED REPRESENTATION OF THE FOREST COMPLEX

Directory of Open Access Journals (Sweden)

Blam Yu. Sh.

2014-09-01

Full Text Available Autonomy of the industrial forecasts often exacerbated by the lack of direct connection with the economic forecasts on the macro level. On the other hand it is desirable to simulate the industrial strategy in a fairly high degree of isolation, so that it does not depend at every moment on description of other activities or levels of hierarchy. To study the effects of national economic relations on the development of industrial complex we propose to use a spatial model of the national economy, which describes modalities of the researched industries in more detail. Quantitative parameters, obtained using basic Interregional Cross-sectoral Optimization Model (OMMM against the external development of the industrial complex, are used to form an aggregated model with a detailed representation with unsignificant loss of information. Thus, the above described model is intended to harmonize national economic decisions with forecasts obtained from industry models in real terms. The conversion procedure is based on the properties of the model of «mutual» problems and information from basic OMMM. The final result is a production-transport cost model within a «traditional» industrial structure.

40 CFR 113.3 - Definitions.

Science.gov (United States)

2010-07-01

... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...

13 CFR 113.510 - Recruitment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...

19 CFR 113.0 - Scope.

Science.gov (United States)

2010-04-01

... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...

34 CFR 668.113 - Request for review.

Science.gov (United States)

2010-07-01

... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...

46 CFR 113.25-6 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...

14 CFR 1214.113 - Allocation of risk.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...

Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

International Nuclear Information System (INIS)

Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

2012-01-01

T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

6 CFR 11.3 - Demand for payment.

Science.gov (United States)

2010-01-01

... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...

9 CFR 113.4 - Exemptions to tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...

46 CFR 113.05-7 - Environmental tests.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...

9 CFR 113.33 - Mouse safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...

sup(113m)In chelate complexes

International Nuclear Information System (INIS)

Abram, S.; Abram, U.; Spies, H.; Muenze, R.

1985-01-01

A series of 7 indiumdialkyldithiocarbamates (R=ethyl, n-propyl, i-propyl, n-butyl, i-butyl, -(CH 2 ) 5 -, -(CH 2 ) 2 -O-(CH 2 ) 2 -) has been prepared by reacting InCl 3 with aqueous solutions of the ligands. The products have been investigated at various concentration levels. The properties of the products at the lower concentration levels have been studied by thin-layer chromatography, electrophoresis and by determination of the octanol/water partition. A comparison of the results with the behaviour of the well-characterized tris(dialkyldithiocarbamato)indium(III) complexes is given. (author)

Design, performance and economics of the DAF Indal 50 kW and 375 kW vertical axis wind turbine

Science.gov (United States)

Schienbein, L. A.; Malcolm, D. J.

1982-03-01

A review of the development and performance of the DAF Indal 50 kW vertical axis Darrieus wind turbines shows that a high level of technical development and reliability has been achieved. Features of the drive train, braking and control systems are discussed and performance details are presented. A description is given of a wind-diesel hybrid presently being tested. Details are also presented of a 375 kW VAWT planned for production in late 1982. A discussion of the economics of both the 50 kW and 375 kW VAWTs is included, showing the effects of charge rate, installed cost, operating cost, performance and efficiency. The energy outputs are translated into diesel fuel cost savings for remote communities.

9 CFR 113.326 - Avian Pox Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...

9 CFR 113.39 - Cat safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...

46 CFR 113.10-9 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...

46 CFR 113.43-5 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...

9 CFR 113.40 - Dog safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...

Higher dimensional uniformisation and W-geometry

International Nuclear Information System (INIS)

Govindarajan, S.

1995-01-01

We formulate the uniformisation problem underlying the geometry of W n -gravity using the differential equation approach to W-algebras. We construct W n -space (analogous to superspace in supersymmetry) as an (n-1)-dimensional complex manifold using isomonodromic deformations of linear differential equations. The W n -manifold is obtained by the quotient of a Fuchsian subgroup of PSL(n,R) which acts properly discontinuously on a simply connected domain in bfCP n-1 . The requirement that a deformation be isomonodromic furnishes relations which enable one to convert non-linear W-diffeomorphisms to (linear) diffeomorphisms on the W n -manifold. We discuss how the Teichmueller spaces introduced by Hitchin can then be interpreted as the space of complex structures or the space of projective structures with real holonomy on the W n -manifold. The projective structures are characterised by Halphen invariants which are appropriate generalisations of the Schwarzian. This construction will work for all ''generic'' W-algebras. (orig.)

W+W- production at the LHC. Fiducial cross sections and distributions in NNLO QCD

International Nuclear Information System (INIS)

Grazzini, Massimiliano; Wiesemann, Marius; Kallweit, Stefan; California Univ., Santa Barbara, CA; Pozzorini, Stefano; California Univ., Santa Barbara, CA; Rathlev, Dirk

2016-05-01

We consider QCD radiative corrections to W + W - production at the LHC and present the first fully differential predictions for this process at next-to-next-to-leading order (NNLO) in perturbation theory. Our computation consistently includes the leptonic decays of the W bosons, taking into account spin correlations, off-shell effects and non-resonant contributions. Detailed predictions are presented for the different-flavour channel pp→μ + e - ν μ anti ν e +X at √(s)=8 and 13 TeV. In particular, we discuss fiducial cross sections and distributions in the presence of standard selection cuts used in experimental W + W - and H→W + W - analyses at the LHC. The inclusive W + W - cross section receives large NNLO corrections, and, due to the presence of a jet veto, typical fiducial cuts have a sizeable influence on the behaviour of the perturbative expansion. The availability of differential NNLO predictions, both for inclusive and fiducial observables, will play an important role in the rich physics programme that is based on precision studies of W + W - signatures at the LHC.

Single Cell Oil Production from Hydrolysates of Inulin by a Newly Isolated Yeast Papiliotrema laurentii AM113 for Biodiesel Making.

Science.gov (United States)

Wang, Guangyuan; Liu, Lin; Liang, Wenxing

2018-01-01

Microbial oils are among the most attractive alternative feedstocks for biodiesel production. In this study, a newly isolated yeast strain, AM113 of Papiliotrema laurentii, was identified as a potential lipid producer, which could accumulate a large amount of intracellular lipids from hydrolysates of inulin. P. laurentii AM113 was able to produce 54.6% (w/w) of intracellular oil in its cells and 18.2 g/l of dry cell mass in a fed-batch fermentation. The yields of lipid and biomass were 0.14 and 0.25 g per gram of consumed sugar, respectively. The lipid productivity was 0.092 g of oil per hour. Compositions of the fatty acids produced were C 14:0 (0.9%), C 16:0 (10.8%), C 16:1 (9.7%), C 18:0 (6.5%), C 18:1 (60.3%), and C 18:2 (11.8%). Biodiesel obtained from the extracted lipids could be burnt well. This study not only provides a promising candidate for single cell oil production, but will also probably facilitate more efficient biodiesel production.

49 CFR 214.113 - Head protection.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...

33 CFR 136.113 - Other compensation.

Science.gov (United States)

2010-07-01

...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...

Tungsten phosphanylarylthiolato complexes [W{PhP(2-SC6H4)2-kappa3S,S',P} 2] and [W{P(2-SC6H4)3-kappa4S,S',S",P}2]: synthesis, structures and redox chemistry.

Science.gov (United States)

Hildebrand, Alexandra; Lönnecke, Peter; Silaghi-Dumitrescu, Luminita; Hey-Hawkins, Evamarie

2008-09-14

PhP(2-SHC6H4)2 (PS2H2) reacts with WCl6 with reduction of tungsten to give the air-sensitive tungsten(IV) complex [W{PhP(2-SC6H4)2-kappa(3)S,S',P}2] (1). 1 is oxidised in air to [WO{PhPO(2-SC6H4)2-kappa(3)S,S',O}{PhP(2-SC6H4)2-kappa(3)S,S',P}] (2). The attempted synthesis of 2 by reaction of 1 with iodosobenzene as oxidising agent was unsuccessful. [W{P(2-SC6H4)3-kappa(4)S,S',S",P}2] (3) was formed in the reaction of P(2-SHC6H4)3 (PS3H3) with WCl6. The W(VI) complex 3 contains two PS3(3-) ligands, each coordinated in a tetradentate fashion resulting in a tungsten coordination number of eight. The reaction of 3 with AgBF4 yields the dinuclear tungsten complex [W2{P(2-SC6H4)3-kappa(4)S,S',S",P}3]BF4 (4). Complexes 1-4 were characterised by spectral methods and X-ray structure determination.

7 CFR 1955.113 - Price (housing).

Science.gov (United States)

2010-01-01

... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...

W-026, health physics instrumentation operational test report

International Nuclear Information System (INIS)

Hackworth, M.F.

1998-01-01

This report documents the testing of the Health Physics Instrumentation associated with phase 2 and 3 start-up of Project W-026, WRAP. The Health Physics Instrumentation includes: Alpha and Beta Continuous Air Monitors (CAMS), Personnel Contamination Monitors (PCMs), Gamma Area Radiation Monitors (ARMs), Criticality Monitors, Alpha and Beta Smear Sample Counters, Portable Friskers, and Operator Breathing Zone Air Samplers. This OTR will cover only the Health Physics Instrumentation that was tested under the Operational test Plan for Health Physics Instrumentation (Phase 2 and 3). That instrumentation included: Alpha CAMS, Beta CAMs and ARMs located in rooms 107 and 113 of 2336-W. The remaining Health Physics Instrumentation that will be used for phase 2 and 3 start-up is tested during calibrations. These calibrations are outside the scope of the Operational Test Plan

A 66pW Discontinuous Switch-Capacitor Energy Harvester for Self-Sustaining Sensor Applications.

Science.gov (United States)

Wu, Xiao; Shi, Yao; Jeloka, Supreet; Yang, Kaiyuan; Lee, Inhee; Sylvester, Dennis; Blaauw, David

2016-06-01

We present a discontinuous harvesting approach for switch capacitor DC-DC converters that enables ultra-low power energy harvesting. By slowly accumulating charge on an input capacitor and then transferring it to a battery in burst-mode, switching and leakage losses in the DC-DC converter can be optimally traded-off with the loss due to non-ideal MPPT operation. The harvester uses a 15pW mode controller, an automatic conversion ratio modulator, and a moving sum charge pump for low startup energy upon a mode switch. In 180nm CMOS, the harvester achieves >40% end-to-end efficiency from 113pW to 1.5μW with 66pW minimum input power, marking a >10× improvement over prior ultra-low power harvesters.

Detailed Structural Analysis of Critical Wendelstein 7-X Magnet System Components

International Nuclear Information System (INIS)

Egorov, K.

2006-01-01

The Wendelstein 7-X (W7-X) stellarator experiment is presently under construction and assembly in Greifswald, Germany. The goal of the experiment is to verify that the stellarator magnetic confinement concept is a viable option for a fusion reactor. The complex W7-X magnet system requires a multi-level approach to structural analysis for which two types of finite element models are used: Firstly, global models having reasonably coarse meshes with a number of simplifications and assumptions, and secondly, local models with detailed meshes of critical regions and elements. Widely known sub-modelling technique with boundary conditions extracted from the global models is one of the approaches for local analysis with high assessment efficiency. In particular, the winding pack (WP) of the magnet coils is simulated in the global model as a homogeneous orthotropic material with effective mechanical characteristic representing its real composite structure. This assumption allows assessing the whole magnet system in terms of general structural factors like forces and moments on the support elements, displacements of the main components, deformation and stress in the coil casings, etc. In a second step local models with a detailed description of more critical WP zones are considered in order to analyze their internal components like conductor jackets, turn insulation, etc. This paper provides an overview of local analyses of several critical W7-X magnet system components with particular attention on the coil winding packs. (author)

Ethylenediaminetetramethylene phosphate labelled with Indium-113 m (sup(113m)In-EDTMP) in bone scintigraphy

International Nuclear Information System (INIS)

Guzman Acevedo, C.

1981-08-01

Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable

Background analysis for the beta-spectrum of the isotope 113Cd in the COBRA experiment

Energy Technology Data Exchange (ETDEWEB)

Platzek, Stephan [Technische Universitaet Dresden (Germany); Collaboration: COBRA-Collaboration

2016-07-01

The COBRA experiment uses Cadmium-Zinc-Telluride as detector material. This semiconductor contains several isotopes that are candidates for neutrinoless double beta-decay. Due to the natural abundance of the detector material various other isotopes are present as well. One of them is {sup 113}Cd with an abundance of about 12%. The fourfold forbidden non-unique beta-decay of {sup 113}Cd is a rare process with a half-life of about 8.10{sup 15} years. The shape of the spectrum is still topic of scientific discussions because of various forecasts given by theoretical models. The signal related to this decay is by far the most prominent in the COBRA setup causing more than 98% of the total rate. In this talk potential background components contributing to the {sup 113}Cd beta-spectrum are discussed with the aim to develop a detailed background simulation with the program VENOM (based on Geant4), that includes background sources originating from cosmic activation as well as natural radioactivity and detector specific effects.

Experiment planning using high-level component models at W7-X

International Nuclear Information System (INIS)

Lewerentz, Marc; Spring, Anett; Bluhm, Torsten; Heimann, Peter; Hennig, Christine; Kühner, Georg; Kroiss, Hugo; Krom, Johannes G.; Laqua, Heike; Maier, Josef; Riemann, Heike; Schacht, Jörg; Werner, Andreas; Zilker, Manfred

2012-01-01

Highlights: ► Introduction of models for an abstract description of fusion experiments. ► Component models support creating feasible experiment programs at planning time. ► Component models contain knowledge about physical and technical constraints. ► Generated views on models allow to present crucial information. - Abstract: The superconducting stellarator Wendelstein 7-X (W7-X) is a fusion device, which is capable of steady state operation. Furthermore W7-X is a very complex technical system. To cope with these requirements a modular and strongly hierarchical component-based control and data acquisition system has been designed. The behavior of W7-X is characterized by thousands of technical parameters of the participating components. The intended sequential change of those parameters during an experiment is defined in an experiment program. Planning such an experiment program is a crucial and complex task. To reduce the complexity an abstract, more physics-oriented high-level layer has been introduced earlier. The so-called high-level (physics) parameters are used to encapsulate technical details. This contribution will focus on the extension of this layer to a high-level component model. It completely describes the behavior of a component for a certain period of time. It allows not only defining simple value ranges but also complex dependencies between physics parameters. This can be: dependencies within components, dependencies between components or temporal dependencies. Component models can now be analyzed to generate various views of an experiment. A first implementation of such an analyze process is already finished. A graphical preview of a planned discharge can be generated from a chronological sequence of component models. This allows physicists to survey complex planned experiment programs at a glance.

9 CFR 113.2 - Testing aids.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...

27 CFR 21.113 - Isopropyl alcohol.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...

9 CFR 113.451 - Tetanus Antitoxin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...

9 CFR 11.3 - Scar rule.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...

Author Details

African Journals Online (AJOL)

Aderogba, KA. Vol 5, No 2 (2011) - Articles Spatio-Temporal Variation in Water Quality of Orle River Basin, S.W. Nigeria Abstract PDF · Vol 5, No 5 (2011) - Articles Significance of Kaduna River to Kaduna Refining and Petrochemicals Complex: Some Checks and Balances Abstract PDF. ISSN: 2070-0083. AJOL African ...

13 CFR 113.410 - Comparable facilities.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...

21 CFR 113.81 - Product preparation.

Science.gov (United States)

2010-04-01

...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...

49 CFR 230.113 - Wheels and tire defects.

Science.gov (United States)

2010-10-01

... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...

On the origin of W-algebras

International Nuclear Information System (INIS)

Bilal, A.; Kogan, I.I.

1991-01-01

We show that the complex and projective structures on 2D Riemann surfaces are determined by the solutions to the linear differential equations obtained by the hamiltonian reduction of Sl(2,C) connections by the gauge parabolic subgroup. The compatibility of complex (μ) and projective (T) structures appears as the associated zero-curvature condition on the reduced symplectic manifold and is nothing but the conformal Ward identity. Generalizing this construction to the reduction of Sl(n,C) connections by the maximal parabolic gauge subgroup, we obtain generalized complex (μ,ρ,...) and projective (T,W,...) structures. From their compatibility conditions we explicitly obtain the Ward identities of W n -gravity and the operator product expansions of the W n -algebras. The associated linear differential equations (one of which involves the basic differential operator of the nth reduction of the KP hierarchy) allow for a geometric interpretation of the W-symmetries in terms of deformations of flag configurations in the jet bundle Γ (n-1) . We also show how to derive the W n -Ward identities from the quantization of the (2+1)-dimensional Chern-Simons theory. (orig.)

Transition Metal Complexes of Cr, Mo, W and Mn Containing η¹(S)-2,5-Dimethylthiophene, Benzothiophene and Dibenzothiophene Ligands

Energy Technology Data Exchange (ETDEWEB)

Reynolds, Michael [Iowa State Univ., Ames, IA (United States)

2000-09-21

The UV photolysis of hexanes solutions containing the complexes M(CO)₆ (M=Cr, Mo, W) or CpMn(CO)₃ (Cp=η⁵-C₅H₅) and excess thiophene (T*) (T*=2,5-dimethylthiophene (2,5-Me₂T), benzothiophene (BT), and dibenzothiophene (DBT)) produces the η¹(S)-T* complexes (CO)₅M(η¹(S)-T*) 1-8 or Cp(CO)₂Mn(η¹(S)-T*)9-11, respectively. However, when T*=DBT, and M=Mo, a mixture of two products result which includes the η¹(S)-DBT complex (CO)₅Mo(η¹(S)-DBT) 4a and the unexpected π-complex (CO)₃Mo(η{sup 6}-DBT) 4b as detected by ¹H NMR. The liability of the η¹(S)-T* ligands is illustrated by the rapid displacement of DBT in the complex (CO)₅W(η¹(S)-DBT) (1) by THF, and also in the complexes (CO)₅Cr(η¹(S)-DBT) (5) and CpMn(CO)₂(η¹(S)-DBT) (9) by CO (1 atm) at room temperature. Complexes 1-11 have been characterized spectroscopically (¹H NMR, IR) and when possible isolated as analytically pure solids (elemental analysis, EIMS). Single crystal, X-ray structural determinations are reported for (Cη)₅W(η¹(S)-DBT) and Cp(CO)₂Mn(η¹(S)-DBT).

47 CFR 25.113 - Station licenses and launch authority.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...

Simple addition of silica to an alkane solution of Wilkinson WMe6 or Schrock W alkylidyne complex give active complex for saturated and unsaturated hydrocarbons metathesis

KAUST Repository

Callens, Emmanuel

2015-08-24

Addition of PDA silica to a solution of the Wilkinson WMe6 as well as the Schrock W neopentilidyne tris neopentyl complex catalyzes linear or cyclic alkanes to produce respectively a distribution of linear alkanes from methane up to triacontane or a mixture of cyclic and macrocyclic hydrocarbons. This single catalytic system transforms also linear α-olefins into higher and lower homologues via isomerization/metathesis mechanism (ISOMET). This complex is also efficient towards functionalized olefins. Unsaturated fatty acid esters (FAEs) are converted into diesters corresponding to self-metathesis products.

9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...

9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...

9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...

9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...

9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...

14 CFR 13.113 - Noncompliance with the investigative process.

Science.gov (United States)

2010-01-01

... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...

9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...

9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...

Flexible power 90W to 120W ArF immersion light source for future semiconductor lithography

Science.gov (United States)

Burdt, R.; Thornes, J.; Duffey, T.; Bibby, T.; Rokitski, R.; Mason, E.; Melchior, J.; Aggarwal, T.; Haran, D.; Wang, J.; Rechtsteiner, G.; Haviland, M.; Brown, D.

2014-03-01

Semiconductor market demand for improved performance at lower cost continues to drive enhancements in excimer light source technologies. Increased output power, reduced variability in key light source parameters, and improved beam stability are required of the light source to support immersion lithography, multi-patterning, and 450mm wafer applications in high volume semiconductor manufacturing. To support future scanner needs, Cymer conducted a technology demonstration program to evaluate the design elements for a 120W ArFi light source. The program was based on the 90W XLR 600ix platform, and included rapid power switching between 90W and 120W modes to potentially support lot-to-lot changes in desired power. The 120W requirements also included improved beam stability in an exposure window conditionally reduced by 20%. The 120W output power is achieved by efficiency gains in system design, keeping system input power at the same level as the 90W XLR 600ix. To assess system to system variability, detailed system testing was conducted from 90W - 120W with reproducible results.

9 CFR 113.122 - Salmonella Choleraesuis Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...

9 CFR 113.120 - Salmonella Typhimurium Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...

37 CFR 11.3 - Suspension of rules.

Science.gov (United States)

2010-07-01

... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...

Preparation of sup(113m)In-labelled compounds of radiopharmaceutical interest. Part of a coordinated programme on radiopharmaceuticals

International Nuclear Information System (INIS)

Servian, J.; Robles, A.

1975-06-01

Techniques for the preparation and control of already known and new sup(113m)In-radiopharmaceuticals were investigated. New rapid procedures for the control and preparation of a number of radiopharmaceuticals were developed and standardized. After biological distribution studies and clinical tests, new techniques for the preparation of the following indium-113 radiopharmaceuticals were adopted: a) Indium - labelled colloids of: S, Al(OH) 3 , Fe(OH) 3 and AlPO 4 for liver and spleen scintigraphy. b) Indium labelled chelates using the ligands EDTA, DTPA, TTHA (Triethylene-tetramine-hexaacetic acid) and DHPTA (Diamino-hydroxy-propane-tetraacetic acid) for brain scintigraphy. c) Indium labelled Fe(OH) 3 macroaggregates and microspheres for lung scintigraphy. d) Several complexes of sup(113m)In with different ligands (fluoride, tartrate, pyrophosphate, tripolyphosphate, trimetaphosphate, EHDP (or ethane-1-hydroxy-1, 1-diphosphonate), ethylendiamine-pyrophosphate were synthesized and its potential use as bone-scanning agents were evaluated. It was found that the complexes with tartrate, tripolyphosphate and EHDP show appreciable skeletal uptake (bone/muscle ratio are 9.0, 5.5, and 4.7 respectively), although they are inferior to the sup(99m)Tc bone-scanning agents. e) A new simple technique is proposed for the preparation of highly concentrated sup(113m)In solutions. The technique is based on the precipitation of In(OH) 3 , millipore filtration and redissolution in a small volume of 0.05 N HCl

Addendum to the Closure Report for Corrective Action Unit 113: Area 25 R-MAD Facility, Nevada National Security Site, Nevada

International Nuclear Information System (INIS)

2011-01-01

This addendum to the Closure Report for Corrective Action Unit 113: Area 25, Reactor Maintenance, Assembly, and Disassembly Facility, Building 3110, Nevada Test Site, Nevada, DOE/NV--891-VOL I-Rev. 1, dated July 2003, provides details of demolition, waste disposal, and use restriction (UR) modification for Corrective Action Unit 113, Area 25 R-MAD Facility. Demolition was completed on July 15, 2010, when the last of the building debris was disposed. Final field activities were concluded on August 30, 2010, after all equipment was demobilized and UR signs were posted. This work was funded by the American Recovery and Reinvestment Act.

Preparation of Radio-pharmaceuticals-III: An evaluation of the eluate from a {sup 113}Sn-{sup 113m}In cow system

Energy Technology Data Exchange (ETDEWEB)

Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)

1969-03-15

In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.

9 CFR 113.317 - Parvovirus Vaccine (Canine).

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...

FDE-vdW: A van der Waals inclusive subsystem density-functional theory

Energy Technology Data Exchange (ETDEWEB)

Kevorkyants, Ruslan; Pavanello, Michele, E-mail: m.pavanello@rutgers.edu [Department of Chemistry, Rutgers University, Newark, New Jersey 07102 (United States); Eshuis, Henk [Department of Chemistry and Biochemistry, Montclair State University, Montclair, New Jersey 07043 (United States)

2014-07-28

We present a formally exact van der Waals inclusive electronic structure theory, called FDE-vdW, based on the Frozen Density Embedding formulation of subsystem Density-Functional Theory. In subsystem DFT, the energy functional is composed of subsystem additive and non-additive terms. We show that an appropriate definition of the long-range correlation energy is given by the value of the non-additive correlation functional. This functional is evaluated using the fluctuation–dissipation theorem aided by a formally exact decomposition of the response functions into subsystem contributions. FDE-vdW is derived in detail and several approximate schemes are proposed, which lead to practical implementations of the method. We show that FDE-vdW is Casimir-Polder consistent, i.e., it reduces to the generalized Casimir-Polder formula for asymptotic inter-subsystems separations. Pilot calculations of binding energies of 13 weakly bound complexes singled out from the S22 set show a dramatic improvement upon semilocal subsystem DFT, provided that an appropriate exchange functional is employed. The convergence of FDE-vdW with basis set size is discussed, as well as its dependence on the choice of associated density functional approximant.

Ibuprofen-in-cyclodextrin-in-W/O/W emulsion - Improving the initial and long-term encapsulation efficiency of a model active ingredient.

Science.gov (United States)

Hattrem, Magnus N; Kristiansen, Kåre A; Aachmann, Finn L; Dille, Morten J; Draget, Kurt I

2015-06-20

A challenge in formulating water-in-oil-in-water (W/O/W) emulsions is the uncontrolled release of the encapsulated compound prior to application. Pharmaceuticals and nutraceuticals usually have amphipathic nature, which may contribute to leakage of the active ingredient. In the present study, cyclodextrins (CyDs) were used to impart a change in the relative polarity and size of a model compound (ibuprofen) by the formation of inclusion complexes. Various inclusion complexes (2-hydroxypropyl (HP)-β-CyD-, α-CyD- and γ-CyD-ibuprofen) were prepared and presented within W/O/W emulsions, and the initial and long-term encapsulation efficiency was investigated. HP-β-CyD-ibuprofen provided the highest encapsulation of ibuprofen in comparison to a W/O/W emulsion with unassociated ibuprofen confined within the inner water phase, with a four-fold increase in the encapsulation efficiency. An improved, although lower, encapsulation efficiency was obtained for the inclusion complex γ-CyD-ibuprofen in comparison to HP-β-CyD-ibuprofen, whereas α-CyD-ibuprofen had a similar encapsulation efficiency to that of unassociated ibuprofen. The lower encapsulation efficiency of ibuprofen in combination with α-CyD and γ-CyD was attributed to a lower association constant for the γ-CyD-ibuprofen inclusion complex and the ability of α-CyD to form inclusion complexes with fatty acids. For the W/O/W emulsion prepared with HP-β-CyD-ibuprofen, the highest encapsulation of ibuprofen was obtained at hyper- and iso-osmotic conditions and by using an excess molar ratio of CyD to ibuprofen. In the last part of the study, it was suggested that the chemical modification of the HP-β-CyD molecule did not influence the encapsulation of ibuprofen, as a similar encapsulation efficiency was obtained for an inclusion complex prepared with mono-1-glucose-β-CyD. Copyright © 2015 Elsevier B.V. All rights reserved.

Interdependence of Pes1, Bop1, and WDR12 controls nucleolar localization and assembly of the PeBoW complex required for maturation of the 60S ribosomal subunit.

Science.gov (United States)

Rohrmoser, Michaela; Hölzel, Michael; Grimm, Thomas; Malamoussi, Anastassia; Harasim, Thomas; Orban, Mathias; Pfisterer, Iris; Gruber-Eber, Anita; Kremmer, Elisabeth; Eick, Dirk

2007-05-01

The PeBoW complex is essential for cell proliferation and maturation of the large ribosomal subunit in mammalian cells. Here we examined the role of PeBoW-specific proteins Pes1, Bop1, and WDR12 in complex assembly and stability, nucleolar transport, and pre-ribosome association. Recombinant expression of the three subunits is sufficient for complex formation. The stability of all three subunits strongly increases upon incorporation into the complex. Only overexpression of Bop1 inhibits cell proliferation and rRNA processing, and its negative effects could be rescued by coexpression of WDR12, but not Pes1. Elevated levels of Bop1 induce Bop1/WDR12 and Bop1/Pes1 subcomplexes. Knockdown of Bop1 abolishes the copurification of Pes1 with WDR12, demonstrating Bop1 as the integral component of the complex. Overexpressed Bop1 substitutes for endogenous Bop1 in PeBoW complex assembly, leading to the instability of endogenous Bop1. Finally, indirect immunofluorescence, cell fractionation, and sucrose gradient centrifugation experiments indicate that transport of Bop1 from the cytoplasm to the nucleolus is Pes1 dependent, while Pes1 can migrate to the nucleolus and bind to preribosomal particles independently of Bop1. We conclude that the assembly and integrity of the PeBoW complex are highly sensitive to changes in Bop1 protein levels.

Yeast Interacting Proteins Database: YBR228W, YLR135W [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available YBR228W SLX1 Subunit of a complex, with Slx4p, that hydrolyzes 5' branches from duplex...of a complex, with Slx4p, that hydrolyzes 5' branches from duplex DNA in response to stalled or converging r

9 CFR 113.315 - Feline Rhinotracheitis Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113.315 Section 113.315 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Inspection Service and observed each day for 14 days post-challenge. The rectal temperature of each animal...

9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...

19 CFR 113.33 - Corporations as principals.

Science.gov (United States)

2010-04-01

... president, treasurer, or secretary of the corporation. The officer's signature shall be prima facie evidence... 19 Customs Duties 1 2010-04-01 2010-04-01 false Corporations as principals. 113.33 Section 113.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

9 CFR 113.101 - Leptospira Pomona Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.103 - Leptospira Canicola Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.105 - Leptospira Hardjo Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.65 - Brucella Abortus Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65... Bacterial Vaccines § 113.65 Brucella Abortus Vaccine. Brucella Abortus Vaccine shall be prepared as a desiccated live culture bacterial vaccine from smooth colonial forms of the Brucella abortus organism...

9 CFR 113.123 - Salmonella Dublin Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...

49 CFR 199.113 - Employee assistance program.

Science.gov (United States)

2010-10-01

... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee assistance program (EAP) for its employees and supervisory personnel who will determine whether an employee... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199...

A Study on Liver Scan using 113mIn Colloid

International Nuclear Information System (INIS)

Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi

1969-01-01

There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.

Coset realization of unifying W-algebras

International Nuclear Information System (INIS)

Blumenhagen, R.; Huebel, R.

1994-06-01

We construct several quantum coset W-algebras, e.g. sl(2,R)/U(1) and sl(2,R)+sl(2,R)/sl(2,R), and argue that they are finitely nonfreely generated. Furthermore, we discuss in detail their role as unifying W-algebras of Casimir W-algebras. We show that it is possible to give coset realizations of various types of unifying W-algebras, e.g. the diagonal cosets based on the symplectic Lie algebras sp(2n) realize the unifying W-algebras which have previously been introduced as 'WD -n '. In addition, minimal models of WD -n are studied. The coset realizations provide a generalization of level-rank-duality of dual coset pairs. As further examples of finitely nonfreely generated quantum W-algebras we discuss orbifolding of W-algebras which on the quantum level has different properties than in the classical case. We demonstrate in some examples that the classical limit according to Bowcock and Watts of these nonfreely finitely generated quantum W-algebras probably yields infinitely nonfreely generated classical W-algebras. (orig.)

Concentrations of /sup 113m/Cd in the marine environment

Energy Technology Data Exchange (ETDEWEB)

Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.

1980-09-18

Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.

9 CFR 113.329 - Newcastle Disease Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329 Section 113.329 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF.... Challenge virus shall be provided or approved by Animal and Plant Health Inspection Service. (4) If at least...

9 CFR 113.106 - Clostridium Chauvoei Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Chauvoei Bacterin. 113.106 Section 113.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... Animal and Plant Health Inspection Service, shall be used for challenge 14 to 15 days following the last...

9 CFR 113.107 - Clostridium Haemolyticum Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Haemolyticum Bacterin. 113.107 Section 113.107 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... challenge 14 to 15 days following the last injection of the product. Each of eight vaccinates and each of...

9 CFR 113.306 - Canine Distemper Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of the...

9 CFR 113.302 - Distemper Vaccine-Mink.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or ferrets...

Contribution of type W human endogenous retroviruses to the human genome: characterization of HERV-W proviral insertions and processed pseudogenes.

Science.gov (United States)

Grandi, Nicole; Cadeddu, Marta; Blomberg, Jonas; Tramontano, Enzo

2016-09-09

Human endogenous retroviruses (HERVs) are ancient sequences integrated in the germ line cells and vertically transmitted through the offspring constituting about 8 % of our genome. In time, HERVs accumulated mutations that compromised their coding capacity. A prominent exception is HERV-W locus 7q21.2, producing a functional Env protein (Syncytin-1) coopted for placental syncytiotrophoblast formation. While expression of HERV-W sequences has been investigated for their correlation to disease, an exhaustive description of the group composition and characteristics is still not available and current HERV-W group information derive from studies published a few years ago that, of course, used the rough assemblies of the human genome available at that time. This hampers the comparison and correlation with current human genome assemblies. In the present work we identified and described in detail the distribution and genetic composition of 213 HERV-W elements. The bioinformatics analysis led to the characterization of several previously unreported features and provided a phylogenetic classification of two main subgroups with different age and structural characteristics. New facts on HERV-W genomic context of insertion and co-localization with sequences putatively involved in disease development are also reported. The present work is a detailed overview of the HERV-W contribution to the human genome and provides a robust genetic background useful to clarify HERV-W role in pathologies with poorly understood etiology, representing, to our knowledge, the most complete and exhaustive HERV-W dataset up to date.

Influences on physicians' adoption of electronic detailing (e-detailing).

Science.gov (United States)

Alkhateeb, Fadi M; Doucette, William R

2009-01-01

E-detailing means using digital technology: internet, video conferencing and interactive voice response. There are two types of e-detailing: interactive (virtual) and video. Currently, little is known about what factors influence physicians' adoption of e-detailing. The objectives of this study were to test a model of physicians' adoption of e-detailing and to describe physicians using e-detailing. A mail survey was sent to a random sample of 2000 physicians practicing in Iowa. Binomial logistic regression was used to test the model of influences on physician adoption of e-detailing. On the basis of Rogers' model of adoption, the independent variables included relative advantage, compatibility, complexity, peer influence, attitudes, years in practice, presence of restrictive access to traditional detailing, type of specialty, academic affiliation, type of practice setting and control variables. A total of 671 responses were received giving a response rate of 34.7%. A total of 141 physicians (21.0%) reported using of e-detailing. The overall adoption model for using either type of e-detailing was found to be significant. Relative advantage, peer influence, attitudes, type of specialty, presence of restrictive access and years of practice had significant influences on physician adoption of e-detailing. The model of adoption of innovation is useful to explain physicians' adoption of e-detailing.

Whole genome typing of the recently emerged Canadian serogroup W Neisseria meningitidis sequence type 11 clonal complex isolates associated with invasive meningococcal disease.

Science.gov (United States)

Tsang, Raymond S W; Ahmad, Tauqeer; Tyler, Shaun; Lefebvre, Brigitte; Deeks, Shelley L; Gilca, Rodica; Hoang, Linda; Tyrrell, Gregory; Van Caeseele, Paul; Van Domselaar, Gary; Jamieson, Frances B

2018-04-01

This study was performed to analyze the Canadian invasive serogroup W Neisseria meningitidis (MenW) sequence type 11 (ST-11) clonal complex (CC) isolates by whole genome typing and to compare Canadian isolates with similar isolates from elsewhere. Whole genome typing of 30 MenW ST-11 CC, 20 meningococcal group C (MenC) ST-11 CC, and 31 MenW ST-22 CC isolates was performed on the Bacterial Isolate Genome Sequence database platform. Canadian MenW ST-11 CC isolates were compared with the 2000 MenW Hajj outbreak strain, as well as with MenW ST-11 CC from other countries. Whole genome typing showed that the Canadian MenW ST-11 CC isolates were distinct from the traditional MenW ST-22 CC; they were not capsule-switched contemporary MenC strains that incorporated MenW capsules. While some recent MenW disease cases in Canada were caused by MenW ST-11 CC isolates showing relatedness to the 2000 MenW Hajj strain, many were non-Hajj isolates similar to current MenW ST-11 isolates found globally. Geographical and temporal variations in genotypes and surface protein antigen genes were found among the MenW ST-11 CC isolates. The current MenW ST-11 isolates did not arise by capsule switching from contemporary MenC ST-11 isolates. Both the Hajj-related and non-Hajj MenW ST-11 CC strains were associated with invasive meningococcal disease in Canada. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

Whole genome typing of the recently emerged Canadian serogroup W Neisseria meningitidis sequence type 11 clonal complex isolates associated with invasive meningococcal disease

Directory of Open Access Journals (Sweden)

Raymond S.W. Tsang

2018-04-01

Full Text Available Objectives: This study was performed to analyze the Canadian invasive serogroup W Neisseria meningitidis (MenW sequence type 11 (ST-11 clonal complex (CC isolates by whole genome typing and to compare Canadian isolates with similar isolates from elsewhere. Methods: Whole genome typing of 30 MenW ST-11 CC, 20 meningococcal group C (MenC ST-11 CC, and 31 MenW ST-22 CC isolates was performed on the Bacterial Isolate Genome Sequence database platform. Canadian MenW ST-11 CC isolates were compared with the 2000 MenW Hajj outbreak strain, as well as with MenW ST-11 CC from other countries. Results: Whole genome typing showed that the Canadian MenW ST-11 CC isolates were distinct from the traditional MenW ST-22 CC; they were not capsule-switched contemporary MenC strains that incorporated MenW capsules. While some recent MenW disease cases in Canada were caused by MenW ST-11 CC isolates showing relatedness to the 2000 MenW Hajj strain, many were non-Hajj isolates similar to current MenW ST-11 isolates found globally. Geographical and temporal variations in genotypes and surface protein antigen genes were found among the MenW ST-11 CC isolates. Conclusions: The current MenW ST-11 isolates did not arise by capsule switching from contemporary MenC ST-11 isolates. Both the Hajj-related and non-Hajj MenW ST-11 CC strains were associated with invasive meningococcal disease in Canada. Keywords: Neisseria meningitidis, Invasive meningococcal disease, Whole genome typing

Pollen sources in the Bojanów forest complex identified on honeybee pollen load by microscopic analysis

Directory of Open Access Journals (Sweden)

Ernest Stawiarz

2017-11-01

Full Text Available The aim of this study was to determine sources of pollen for the honeybee in the Bojanów forest complex, Nowa Dęba Forest District (southeastern Poland. Sampling of pollen loads from bees extended from the beginning of May until the end of September 2016 and was carried out at 7-day intervals using pollen traps mounted at the entrance of beehives. A total of 73 pollen load samples were collected from the study area. Fifty-nine taxa from 31 plant families were identified in the analyzed material. From 4 to 21 taxa (average 9.5 were recorded in one sample. The pollen of Brassicaceae (“others”, Taraxacum type, Solidago type, and Rumex had the highest frequency in the pollen loads examined. Apart from these four taxa, pollen grains of Rubus type, Poaceae (“others”, Calluna, Fagopyrum, Trifolium repens s. l., Phacelia, Aster type, Melampyrum, Quercus, Cornus, and Veronica were recorded in the dominant pollen group. The forest habitat taxa that provided pollen rewards to honeybees in the Bojanów forest complex were the following: Rubus, Calluna, Prunus, Tilia, Frangula alnus, Pinus, Quercus, Cornus, Robinia pseudoacacia, Salix, and Vaccinium. Apart from forest vegetation, the species from meadows and wastelands adjacent to this forest complex, represented by Taraxacum, Rumex, Plantago, Poaceae, Trifolium repens, and Solidago, proved to be an important source of pollen. The study indicates that forest communities are a valuable source of pollen for pollinating insects from early spring through to late fall.

Gadolinium heteropoly complex K 17[Gd(P 2W 17O 61) 2] as a potential MRI contrast agent

Science.gov (United States)

Sun, Guoying; Feng, Jianghua; Wu, Huifeng; Pei, Fengkui; Fang, Ke; Lei, Hao

2004-10-01

Gadolinium heteropoly complex K17[Gd(P2W17O61)2] has been evaluated by in vitro and in vivo experiments as a potential contrast agent for magnetic resonance imaging (MRI). The thermal analysis and conductivity study indicate that this complex has good thermal stability and wide pH stability range. The T1 relaxivity is 7.59 mM-1 s-1 in aqueous solution and 7.97 mM-1 s-1 in 0.725 mmol l-1 bovine serum albumin (BSA) solution at 25 °C and 9.39 T, respectively. MR imaging of three male Sprague-Dawley rats showed remarkable enhancement in rat liver after intravenous injection, which persisted longer than with Gd-DTPA. The signal intensity increased by 57.1±16.9% during the whole imaging period at 0.082 mmol kg-1dose. Our preliminary in vitro and in vivo studies indicate that K17[Gd(P2W17O61)2] is a potential liver-specific MRI contrast agent.

Investigations on the indium-113m isotope generators

International Nuclear Information System (INIS)

Oniciu, L.; Veglia, A.

1975-01-01

Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)

13 CFR 113.3-3 - Structural accommodations for handicapped clients.

Science.gov (United States)

2010-01-01

... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...

75 FR 10026 - Proposed Collection; Comment Request for Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR...

Science.gov (United States)

2010-03-04

... W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR, W-3PR, and W-3SS AGENCY: Internal Revenue Service....C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W- 3cPR, W-3PR, and W-3SS. DATES: Written comments should be received on or...

48 CFR 18.113 - Interagency acquisitions under the Economy Act.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interagency acquisitions under the Economy Act. 18.113 Section 18.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.113 Interagency acquisitions under...

40 CFR 63.113 - Process vent provisions-reference control technology.

Science.gov (United States)

2010-07-01

... § 63.113 Process vent provisions—reference control technology. (a) The owner or operator of a Group 1... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process vent provisions-reference control technology. 63.113 Section 63.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

9 CFR 113.64 - General requirements for live bacterial vaccines.

Science.gov (United States)

2010-01-01

... bacterial vaccines. 113.64 Section 113.64 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.64 General requirements for live bacterial vaccines... bacterial vaccine shall meet the requirements in this section. (a) Purity test. Final container samples of...

32 CFR Appendix A to Part 113 - Certificate of Compliance

Science.gov (United States)

2010-07-01

... 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL Pt. 113, App. A Appendix A to Part 113—Certificate... consumer credit transaction to which this form refers. (If the unpaid balance has been adjusted as a...

46 CFR 113.35-9 - Mechanical engine order telegraph systems.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems. 113.35-9 Section 113.35-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-9 Mechanical engine order...

27 CFR 40.113 - Change in location to another region.

Science.gov (United States)

2010-04-01

... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer shall...

9 CFR 113.300 - General requirements for live virus vaccines.

Science.gov (United States)

2010-01-01

... vaccines. 113.300 Section 113.300 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Virus Vaccines § 113.300 General requirements for live virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a live virus vaccine shall meet the...

13 CFR 113.520 - Job classification and structure.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Job classification and structure. 113.520 Section 113.520 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION... males or for females; (b) Maintain or establish separate lines of progression, seniority lists, career...

Measurement of the W mass at LEP

CERN Document Server

Przysiezniak, H

2000-01-01

The mass of the W boson is measured using W pair events collected with the ALEPH, DELPHI, L3 and OPAL detectors at LEP2. Three methods are used: the cross section method, the lepton energy spectrum method and the direct reconstruction method, where the latter is described more in detail. For data collected at E/sub cm/=161, 172 and 183 GeV, the following combined preliminary result is obtained: M/sub W//sup LEP/=80.37+or-0.08 GeV/c/sup 2/. (5 refs).

Structural insights into the regulation of Bacillus subtilis SigW activity by anti-sigma RsiW.

Directory of Open Access Journals (Sweden)

Shankar Raj Devkota

Full Text Available Bacillus subtilis SigW is localized to the cell membrane and is inactivated by the tight interaction with anti-sigma RsiW under normal growth conditions. Whereas SigW is discharged from RsiW binding and thus initiates the transcription of its regulon under diverse stress conditions such as antibiotics and alkaline shock. The release and activation of SigW in response to extracytoplasmic signals is induced by the regulated intramembrane proteolysis of RsiW. As a ZAS (Zinc-containing anti-sigma family protein, RsiW has a CHCC zinc binding motif, which implies that its anti-sigma activity may be regulated by the state of zinc coordination in addition to the proteolytic cleavage of RsiW. To understand the regulation mode of SigW activity by RsiW, we determined the crystal structures of SigW in complex with the cytoplasmic domain of RsiW, and compared the conformation of the CHCC motif in the reduced/zinc binding and the oxidized states. The structures revealed that RsiW inhibits the promoter binding of SigW by interacting with the surface groove of SigW. The interaction between SigW and RsiW is not disrupted by the oxidation of the CHCC motif in RsiW, suggesting that SigW activity might not be regulated by the zinc coordination states of the CHCC motif.

9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...

21 CFR 211.113 - Control of microbiological contamination.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Control of microbiological contamination. 211.113 Section 211.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and...

Yeast Interacting Proteins Database: YNL189W, YDR318W [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available ponent of the COMA complex (Ctf19p, Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits that are in cont...t of the COMA complex (Ctf19p, Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits that are in contact w

9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...

9 CFR 113.409 - Tuberculin-PPD Bovis, Intradermic.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tuberculin-PPD Bovis, Intradermic. 113... REQUIREMENTS Diagnostics and Reagents § 113.409 Tuberculin—PPD Bovis, Intradermic. Tuberculin—PPD Bovis... completed product from each serial shall be subjected to a comparison specificity test using a Reference PPD...

9 CFR 113.206 - Wart Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...

40 CFR 600.113-78 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-78... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-78 Fuel economy calculations. The...

40 CFR 600.113-88 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...

40 CFR 600.113-93 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-93... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-93 Fuel economy calculations. The...

A general computation model based on inverse analysis principle used for rheological analysis of W/O rapeseed and soybean oil emulsions

Science.gov (United States)

Vintila, Iuliana; Gavrus, Adinel

2017-10-01

The present research paper proposes the validation of a rigorous computation model used as a numerical tool to identify rheological behavior of complex emulsions W/O. Considering a three-dimensional description of a general viscoplastic flow it is detailed the thermo-mechanical equations used to identify fluid or soft material's rheological laws starting from global experimental measurements. Analyses are conducted for complex emulsions W/O having generally a Bingham behavior using the shear stress - strain rate dependency based on a power law and using an improved analytical model. Experimental results are investigated in case of rheological behavior for crude and refined rapeseed/soybean oils and four types of corresponding W/O emulsions using different physical-chemical composition. The rheological behavior model was correlated with the thermo-mechanical analysis of a plane-plane rheometer, oil content, chemical composition, particle size and emulsifier's concentration. The parameters of rheological laws describing the industrial oils and the W/O concentrated emulsions behavior were computed from estimated shear stresses using a non-linear regression technique and from experimental torques using the inverse analysis tool designed by A. Gavrus (1992-2000).

A determination of the mass and width of the W boson at LEP2

CERN Document Server

Palacios, J P

2001-01-01

During 1998 and 1999 LEP produced electron-positron collisions at centre of mass energies ranging between 189 and 202 GeV. An integrated luminosity of 372 pb sup - sup 1 was collected by the DELPHI experiment during this period. From these data, samples of events with e nu-bar sub e qq-bar', mu nu-bar submu qq-bar' and tau nu-bar subtau qq-bar' final states were selected. These were analysed to obtain values for the mass and width of the W boson using the method of invariant mass direct reconstruction. Combining the results obtained for both running periods and the three l nu-bar sub l qq-bar' channels, the following values are obtained: M sub w = 80.308 +- 0.113 (stat) +- 0.038 (syst) GeV GAMMA sub w = 1.857 +- 0.298 (stat) +- 0.155 (syst) GeV

9 CFR 113.209 - Rabies Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... Killed Virus Vaccines § 113.209 Rabies Vaccine, Killed Virus. Rabies Vaccine (Killed Virus) shall be prepared from virus-bearing cell cultures or nerve tissues obtained from animals that have developed rabies...

9 CFR 202.113 - Rule 13: Written hearing.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 13: Written hearing. 202.113 Section 202.113 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... waiver of the right to file such evidence. (g) Extension of time for depositions. If any party timely...

13 CFR 113.455 - Textbooks and curricular material.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Textbooks and curricular material. 113.455 Section 113.455 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Se...

27 CFR 11.3 - Application.

Science.gov (United States)

2010-04-01

... THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.3 Application. (a) General. The regulations in this part apply to transactions between industry members and trade buyers. (b) Transactions...

9 CFR 113.312 - Rabies Vaccine, Live Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from virus-bearing... administration. (iii) Observe all animals for signs of rabies until scheduled time to sacrifice. If animals show...

9 CFR 113.38 - Guinea pig safety test.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the animals...

Measurement of the Standard Model W+W- production cross-section using the ATLAS experiment on the LHC

International Nuclear Information System (INIS)

Zeman, Martin

2014-01-01

Measurements of di-boson production cross-sections are an important part of the physics programme at the CERN Large Hadron Collider. These physics analyses provide the opportunity to probe the electroweak sector of the Standard Model at the TeV scale and could also indicate the existence of new particles or probe beyond the Standard Model physics. The excellent performance of the LHC through years 2011 and 2012 allowed for very competitive measurements. This thesis provides a comprehensive overview of the experimental considerations and methods used in the measurement of the W + W - production cross-section in proton-proton collisions at √s = 7 TeV and 8 TeV. The treatise covers the material in great detail, starting with the introduction of the theoretical framework of the Standard Model and follows with an extensive discussion of the methods implemented in recording and reconstructing physics events in an experiment of this magnitude. The associated online and offline software tools are included in the discussion. The relevant experiments are covered, including a very detailed section about the ATLAS detector. The final chapter of this thesis contains a detailed description of the analysis of the W-pair production in the leptonic decay channels using the datasets recorded by the ATLAS experiment during 2011 and 2012 (Run I). The analyses use 4.60 fb -1 recorded at √s = 7 TeV and 20.28 fb -1 recorded at 8 TeV. The experimentally measured cross section for the production of W bosons at the ATLAS experiment is consistently enhanced compared to the predictions of the Standard Model at centre-of-mass energies of 7 TeV and 8 TeV. The thesis concludes with the presentation of differential cross-section measurement results. (author) [fr

Boosted W/Z Tagging at ATLAS

CERN Document Server

Dattagupta, Aparajita; The ATLAS collaboration

2016-01-01

A detailed study of the techniques for identifying boosted hadronically decaying W or Z bosons is presented. The best performing algorithm for reconstructing, grooming and tagging bosonic jets as seen in studies using 8 TeV data and simulation is validated for W bosons with a wide range of transverse momenta using 13 TeV data and MC simulations. The same is studied for Z bosons in 13 TeV MC simulation. Improvement in tagger performance using detector tracking information is also studied. In addition, given that a hadronic jet has been identified as resulting from the hadronic decay of a W or Z, a technique is developed to discriminate between W and Z bosons using 8 TeV data. The alternative of using variable-R jets for capturing the hadronic decay products compared to standard techniques is also discussed.

49 CFR 215.113 - Defective plain bearing wedge.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...

19 CFR 113.55 - Cancellation of export bonds.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cancellation of export bonds. 113.55 Section 113... export bonds. (a) Manner of cancellation. A bond to assure exportation as defined in § 101.1 of this... shall be signed by a revenue officer of the foreign country to which the merchandise is exported, unless...

9 CFR 113.6 - Animal and Plant Health Inspection Service testing.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal and Plant Health Inspection Service testing. 113.6 Section 113.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Applicability § 113.6 Animal and Plant Health Inspection Service testing. A...

On W1+∞ 3-algebra and integrable system

Directory of Open Access Journals (Sweden)

Min-Ru Chen

2015-02-01

Full Text Available We construct the W1+∞ 3-algebra and investigate its connection with the integrable systems. Since the W1+∞ 3-algebra with a fixed generator W00 in the operator Nambu 3-bracket recovers the W1+∞ algebra, it is intrinsically related to the KP hierarchy. For the general case of the W1+∞ 3-algebra, we directly derive the KP and KdV equations from the Nambu–Poisson evolution equation with the different Hamiltonian pairs of the KP hierarchy. Due to the Nambu–Poisson evolution equation involves two Hamiltonians, the deep relationship between the Hamiltonian pairs of KP hierarchy is revealed. Furthermore we give a realization of the W1+∞ 3-algebra in terms of a complex bosonic field. Based on the Nambu 3-brackets of the complex bosonic field, we derive the (generalized nonlinear Schrödinger equation and give an application in optical soliton.

Disruption and functional analysis of seven ORFs on chromosome IV: YDL057w, YDL012c, YDL010w, YDL009c, YDL008w (APC11), YDL005c (MED2) and YDL003w (MCD1).

Science.gov (United States)

Smith, K N; Iwanejko, L; Loeillet, S; Fabre, F; Nicolas, A

1999-09-15

In the context of the EUROFAN project, we have carried out the systematic disruption of seven ORFs on chromosome IV of Saccharomyces cerevisiae using the long flanking homology technique to replace each ORF with the KanMX cassette. Targeted disruption of YDL057w, YDL012c, or YDL010w with YDL009c (the two ORFs overlap) confers no overt defects in haploid growth on a variety of media at different temperatures, in mating, or in the sporulation of diploids homozygous for the disruption. By contrast, YDL008w and YDL003w disruptants are non-viable. The product of YDL008w (elsewhere identified as APC11) is a component of the anaphase promoting complex. YDL003w (also termed MCD1) is a homologue of Schizosaccharomyces pombe rad21, an essential gene implicated in DNA double-strand break repair and nuclear organization in fission yeast. In budding yeast, this ORF has been shown by several laboratories to encode a protein involved in sister chromatid cohesion and chromosome condensation. The remaining ORF, YDL005c (also termed MED2), encodes a component of the transcriptional activator complex known as Mediator. Disruption of YDL005c confers a modest slow growth phenotype on rich medium and a more severe phenotype on minimal medium, aberrant cellular morphology, and mating defects; diploids homozygous for the disruption cannot sporulate. Copyright 1999 John Wiley & Sons, Ltd.

Complex Problems in Entrepreneurship Education: Examining Complex Problem-Solving in the Application of Opportunity Identification

Directory of Open Access Journals (Sweden)

Yvette Baggen

2017-01-01

Full Text Available In opening up the black box of what entrepreneurship education (EE should be about, this study focuses on the exploration of relationships between two constructs: opportunity identification (OI and complex problem-solving (CPS. OI, as a domain-specific capability, is at the core of entrepreneurship research, whereas CPS is a more domain-general skill. On a conceptual level, there are reasons to believe that CPS skills can help individuals to identify potential opportunities in dynamic and nontransparent environments. Therefore, we empirically investigated whether CPS relates to OI among 113 masters students. Data is analyzed using multiple regressions. The results show that CPS predicts the number of concrete ideas that students generate, suggesting that having CPS skills supports the generation of detailed, potential business ideas of good quality. The results of the current study suggest that training CPS, as a more domain-general skill, could be a valuable part of what should be taught in EE.

Human endogenous retrovirus type W (HERV-W) in schizophrenia: a new avenue of research at the gene-environment interface.

Science.gov (United States)

Leboyer, Marion; Tamouza, Ryad; Charron, Dominique; Faucard, Raphaél; Perron, Hervé

2013-03-01

Provide a synthetic review of recent studies evidencing an association between human endogenous retrovirus-W (HERV-W) and schizophrenia. Bibliography analysis and contextual synthesis. Epidemiological studies suggest that the aetiology of schizophrenia is complex and involves a complex interplay of genetic and environmental factors such as infections. Eight percentof the human genome consists of human endogenous retroviruses (HERV), and this part of the genome was previously thought to be without importance, but new research has refuted this. HERVs share similarities with viruses and it is assumed that HERVs are present in the genome as a result of retroviruses infecting germ line cells many million years ago. A specific type of HERVs, called HERV-W, has through several recent studies been associated with schizophrenia. Elevated transcription of HERV-W elements has been documented, and antigens of HERV-W envelope and capsid proteins have been found in blood samples from patients. Viruses that have been implicated in pathology of schizophrenia, such as herpes and influenza, have been shown to activate HERV-W elements, and such activation has been associated with elevated biomarkers of systemic inflammation. New research indicates that HERV-W may be an important genetic factor interplaying with the environmental risk factor of infections and that, through this, HERV-W may be important for disease pathogenesis. A lifelong scenario of a detrimental interaction between infectious agents and HERV-W genes may decipher the actual development and course of schizophrenia. Further research is needed to find out if specific treatment strategies could reduce the expression of HERV-W and if this will be associated with remission.

40 CFR 745.113 - Certification and acknowledgment of disclosure.

Science.gov (United States)

2010-07-01

... disclosure. 745.113 Section 745.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... may produce permanent neurological damage, including learning disabilities, reduced intelligence... required by § 745.110(a); or (ii) Waived the opportunity. (6) When one or more agents are involved in the...

Induced codeposition of nanocrystalline Co-W coatings and their mechanical properties

International Nuclear Information System (INIS)

Belevskij, Stanislav

2012-01-01

The aim of the research: the complex investigation of induced codeposition mechanism of Co-W coatings obtaining from citrate electrolyte and determining the conditions of electrodeposition that provide the coatings the properties that could compete with the hard chromium electroplating coatings. The scientific novelty and originality of the work: for the first time it is demonstrated that citrate electrolyte used for electrodeposition of Co-W alloy is a mixture of complex compounds, whose composition is determined by the pH. At high pH values, its main component is hetero polynuclear complex with a molecular weight over 1200 g / mol. The totality of the results obtained by different methods (gel-chromatography, voltammetry, the methods of physicochemical hydrodynamics, determination of the composition of coatings, the current efficiency, etc.), can conclude that the chemical composition of electrodeposited Co-W coatings is determined by the hetero polynuclear complex composition on the one hand and the pH near-electrode layer on the other. However, the pH near-electrode layer depends on the rate of the parallel hydrogen evolution reaction (defined by the potential of electrodeposition and the hydrodynamic conditions). The increasing of the pH near-electrode layer shifts the chemical equilibrium toward to the formation of complex products with high molecular weight. It was confirmed the existence of hetero polynuclear Co-W-citrate complex compound, where the atomic ratio of Co:W is equal to 1:1. Solved scientific problem: The experimental proof of the fact that the formation of cobalt-tungsten coatings from citric electrolyte is the result of electrochemical reduction of polynuclear heterometallic complex. The research object is the chemical composition of citrate electrolyte (identification of the contained complexes) and induced codeposition of Co-W coatings from citrate electrolyte. The determination of the influence of the degree of the electrodeposition

9 CFR 113.42 - Detection of lymphocytic choriomeningitis contamination.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of lymphocytic choriomeningitis contamination. 113.42 Section 113.42 Animals and Animal Products ANIMAL AND PLANT HEALTH... contamination. The test for detection of lymphocytic choriomeningitis (LCM) virus provided in this section shall...

Rola leptyny w regulacji metabolizmu lipidów i węglowodanów

Directory of Open Access Journals (Sweden)

Patrycja Gogga*

2011-01-01

Full Text Available Leptyna jest białkiem wydzielanym głównie przez tkankę tłuszczową, a jej stężenie we krwi jest ściśle związane z ilością zapasów energetycznych zgromadzonych w adipocytach. Jako hormon leptyna ma niezwykle szeroki zakres działania. Białko to bezpośrednio lub za pośrednictwem układu współczulnego bierze udział w regulacji metabolizmu energetycznego. Leptyna hamuje biosyntezę triacylogliceroli w wątrobie i tkance tłuszczowej, a także w mięśniach szkieletowych, obniżając tym samym ilość odkładanych w nich lipidów. W adipocytach leptyna zmniejsza ekspresję genów kodujących syntazę kwasów tłuszczowych (FAS i karboksylazę acetylo-CoA (ACC – główne enzymy szlaku biosyntezy kwasów tłuszczowych. Zwiększa z kolei ekspresję genu kodującego lipazę zależną od hormonów (HSL, co stymuluje hydrolizę triacylogliceroli w tkance tłuszczowej. Ponadto leptyna wzmaga utlenianie kwasów tłuszczowych w adipocytach, mięśniach szkieletowych oraz w mięśniu sercowym, wywołując wzrost ekspresji genów kodujących podstawowe dla tego procesu enzymy, palmitoilotransferazę karnitynową 1 (CPT1 i dehydrogenazę acylo-CoA o średniej długości łańcucha (MCAD. Wykazano również, że hormon ten zwiększa wrażliwość tkanek na insulinę i poprawia tolerancję glukozy – pod wpływem leptyny wzrasta transport glukozy do komórek oraz intensywność glikolizy.Wiadomo, że leptyna bierze udział w długoterminowej regulacji pobierania pokarmu, jednak coraz więcej badań wskazuje, że ma ona również wpływ na przemiany substratów energetycznych w tkankach obwodowych. Leptyna może zatem kontrolować homeostaz�� energetyczną organizmu wywołując zmiany metabolizmu lipidów i węglowodanów, przede wszystkim w tkance tłuszczowej i w mięśniach.

Reductive trapping of [(OC){sub 5}W-W(CO){sub 5}]{sup 2-} in a mixed-valent Sm{sup II/III} calix[4]pyrrolide sandwich

Energy Technology Data Exchange (ETDEWEB)

Deacon, Glen B.; Guo, Zhifang [School of Chemistry, Monash University, VIC (Australia); Junk, Peter C.; Wang, Jun [College of Science and Engineering, James Cook University, Townsville, QLD (Australia)

2017-07-10

Reduction of tungsten hexacarbonyl by the divalent samarium(II) complex [Sm{sub 2}(N{sub 4}Et{sub 8})(thf){sub 4}] ((N{sub 4}Et{sub 8}){sup 4-}=meso-octaethylcalix[4]pyrrolide) in toluene at ambient temperature gave the remarkable heteronuclear mixed-valent samarium(II/III)/tungsten complex [{(thf)_2Sm"I"I(N_4Et_8)Sm"I"I"I(thf)}{sub 2}{(μ-OC)_2W_2(CO)_8}], which features the trapping of a rare [W{sub 2}(CO){sub 10}]{sup 2-} anion with an unsupported W-W bond. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

9 CFR 113.207 - Encephalomyelitis Vaccine, Eastern, Western, and Venezuelan, Killed Virus.

Science.gov (United States)

2010-01-01

..., Western, and Venezuelan, Killed Virus. 113.207 Section 113.207 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.207 Encephalomyelitis...

13 CFR 113.535 - Effect of state or local law or other requirements.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of state or local law or other requirements. 113.535 Section 113.535 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... obligation to comply with §§ 113.500 through 113.550 is not obviated or alleviated by the existence of any...

Solid solubility in 1:13 phase of doping element for La(Fe,Si13 alloys

Directory of Open Access Journals (Sweden)

S. T. Zong

2016-05-01

Full Text Available The influences of Ni, Cr and Nb as substitution elements for Fe were investigated. The change in microstructure and the magnetic properties have been discussed in detail. Substitution elements Ni, Cr and Nb not only have limited solubility in NaZn13-type (1:13 phase, but also hinder the peritectoid reaction. Ni element mainly enters into La-rich phase while Cr element mainly concentrates in α-Fe phase, which both have detriment effect on the peritectoid reaction, leading to a large residual of impurity phases after annealing and a decrease of magnetic entropy change. Besides, Ni and Cr participated in peritectoid reaction by entering parent phases but slightly entering 1:13 phase, which would cause the disappearance of first order magnetic phase transition. A new phase (Fe,Si2Nb was found when Nb element substitutes Fe in La(Fe,Si13, suggesting that Nb does not participate in peritectoid reaction and only exists in (Fe,Si2Nb phase after annealing. The alloy with Nb substitution maintains the first order magnetic phase transition character.

The VirtualwindoW for nuclear applications

Energy Technology Data Exchange (ETDEWEB)

Anderson, M.O.; McKay, M.D.; Willis, W.D.

1997-08-01

Throughout the Department of Energy (DOE) complex there are numerous facilities which were constructed to research and develop nuclear materials during the cold war era. As a result, there are now many facilities such as reactors which require dismantlement and clean up. Technological advances over the past 10 years have significantly increased the state of computers, electronics and automated machinery. Because of this rapid growth, the technology of robotics has played a key role in clean up and remote operations. While robotic systems which perform hazardous tasks are being advanced, the human interface has not. Only within the past few years has the human/machine interface been addressed. A growing concern with the rapid advances in technology is that the robotic systems will become so complex that operators will be overwhelmed by the complexity and number of controls. Thus there is an on going effort within the remote and teleoperated robotic field to develop better man-machine interfaces. The Department of Energy`s Idaho National Engineering Laboratory (INEL) has been researching methods to simplify this interface including telepresence techniques which are applicable to nuclear environments. Initial telepresence research conducted at the INEL developed a concept called the VirtualwindoW. This system minimizes the complexity of remote stereo viewing controls and provides the operator the `feel` of viewing the environment in a natural setting. The VirtualwindoW has shown that the man-machine interface can be simplified while increasing operator performance. This paper deals with the continuing research and development of the VirtualwindoW system to provide a standard camera interface. An application of the VirtualwindoW in the dismantlement of the Chicago Pile-Five (CP-5) reactor at Argonne National Laboratory-East is discussed.

The Virtualwindo W for nuclear applications

International Nuclear Information System (INIS)

Anderson, M.O.; McKay, M.D.; Willis, W.D.

1997-01-01

Throughout the Department of Energy (DOE) complex there are numerous facilities which were constructed to research and develop nuclear materials during the cold war era. As a result, there are now many facilities such as reactors which require dismantlement and clean up. Technological advances over the past 10 years have significantly increased the state of computers, electronics and automated machinery. Because of this rapid growth, the technology of robotics has played a key role in clean up and remote operations. While robotic systems which perform hazardous tasks are being advanced, the human interface has not. Only within the past few years has the human/machine interface been addressed. A growing concern with the rapid advances in technology is that the robotic systems will become so complex that operators will be overwhelmed by the complexity and number of controls. Thus there is an on going effort within the remote and teleoperated robotic field to develop better man-machine interfaces. The Department of Energy's Idaho National Engineering Laboratory (INEL) has been researching methods to simplify this interface including telepresence techniques which are applicable to nuclear environments. Initial telepresence research conducted at the INEL developed a concept called the VirtualwindoW. This system minimizes the complexity of remote stereo viewing controls and provides the operator the 'feel' of viewing the environment in a natural setting. The VirtualwindoW has shown that the man-machine interface can be simplified while increasing operator performance. This paper deals with the continuing research and development of the VirtualwindoW system to provide a standard camera interface. An application of the VirtualwindoW in the dismantlement of the Chicago Pile-Five (CP-5) reactor at Argonne National Laboratory-East is discussed

14 CFR 1221.113 - Use of the NASA Flags.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Flags. 1221.113 Section 1221.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...

27 CFR 22.113 - Receipt of tax-free alcohol.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Receipt of tax-free alcohol. 22.113 Section 22.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Withdrawal and...

9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.

Science.gov (United States)

2010-01-01

... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus...

Young Stellar Objects in the Massive Star-forming Regions W51 and W43

Energy Technology Data Exchange (ETDEWEB)

Saral, G.; Audard, M. [Department of Astronomy, University of Geneva, Ch. d’Ecogia 16, 1290 Versoix (Switzerland); Hora, J. L.; Martínez-Galarza, J. R.; Smith, H. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Koenig, X. P. [Yale University, Department of Astronomy, 208101, New Haven, CT 06520-8101 (United States); Motte, F. [Institut de Plantologie et d’Astrophysique de Grenoble, Univ. Grenoble Alpes—CNRS-INSU, BP 53, F-38041 Grenoble Cedex 9 (France); Nguyen-Luong, Q. [National Astronomical Observatory of Japan, Chile Observatory, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Saygac, A. T. [Istanbul University, Faculty of Science, Astronomy and Space Sciences Department, Istanbul-Turkey (Turkey)

2017-04-20

We present the results of our investigation of the star-forming complexes W51 and W43, two of the brightest in the first Galactic quadrant. In order to determine the young stellar object (YSO) populations in W51 and W43 we used color–magnitude relations based on Spitzer mid-infrared and 2MASS/UKIDSS near-infrared data. We identified 302 Class I YSOs and 1178 Class II/transition disk candidates in W51, and 917 Class I YSOs and 5187 Class II/transition disk candidates in W43. We also identified tens of groups of YSOs in both regions using the Minimal Spanning Tree (MST) method. We found similar cluster densities in both regions, even though Spitzer was not able to probe the densest part of W43. By using the Class II/I ratios, we traced the relative ages within the regions and, based on the morphology of the clusters, we argue that several sites of star formation are independent of one another in terms of their ages and physical conditions. We used spectral energy distribution-fitting to identify the massive YSO (MYSO) candidates since they play a vital role in the star formation process, and then examined them to see if they are related to any massive star formation tracers such as UCH ii regions, masers, or dense fragments. We identified 17 MYSO candidates in W51, and 14 in W43, respectively, and found that groups of YSOs hosting MYSO candidates are positionally associated with H ii regions in W51, though we do not see any MYSO candidates associated with previously identified massive dense fragments in W43.

14 CFR 135.113 - Passenger occupancy of pilot seat.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Passenger occupancy of pilot seat. 135.113... Operations § 135.113 Passenger occupancy of pilot seat. No certificate holder may operate an aircraft type certificated after October 15, 1971, that has a passenger seating configuration, excluding any pilot seat, of...

7 CFR 760.113 - Refunds; joint and several liability.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Refunds; joint and several liability. 760.113 Section... Agricultural Disaster Assistance Programs § 760.113 Refunds; joint and several liability. (a) In the event that... provided that interest will in all cases run from the date of the original disbursement. (b) All persons...

Electroweak corrections to charged-current e+e-->4 fermion processes: Technical details and further results

International Nuclear Information System (INIS)

Denner, A.; Dittmaier, S.; Roth, M.; Wieders, L.H.

2005-01-01

The complete electroweak O(α) corrections have been calculated for the charged-current four-fermion production processes e + e - ->ν τ τ + μ - ν-bar μ , ud-bar μ - ν-bar μ , and ud-bar sc-bar . Here, technical details of this calculation are presented. These include the algebraic reduction of spinor chains to a few standard structures and the consistent implementation of the finite width of the W boson. To this end, a generalization of the complex-mass scheme to the one-loop level is proposed, and the practical application of this method is described. Finally, the effects of the complete O(α) corrections to various differential cross sections of physical interest are discussed and compared to predictions based on the double-pole approximation, revealing that the latter approximation is not sufficient to fully exploit the potential of a future linear collider in an analysis of W-boson pairs at high energies

Effect of W content in solid solution on properties and microstructure of (Ti,W)C-Ni{sub 3}Al cermets

Energy Technology Data Exchange (ETDEWEB)

Huang, Bin; Xiong, Weihao, E-mail: whxiong@hust.edu.cn; Zhang, Man; Jing, Yong; Li, Baolong; Luo, Haifeng; Wang, Shengqing

2016-08-15

(Ti{sub 1-x}W{sub x})C solid solutions (x = 0.05, 0.15, 0.25, 0.35) were synthesized by carbothermal reduction and then were used as hard phases to prepare (Ti,W)C-Ni{sub 3}Al cermets by vacuum sintering. (Ti,W)C-Ni{sub 3}Al cermets showed weak core-rim structure carbide particles embedded in Ni{sub 3}Al binder. As W content in (Ti,W)C increased, core-rim structure of carbide particles got weaker and the contrast of particles lowered down in SEM-BSE morphologies. Furthermore, the densification of cermets was promoted with W content in solid solution increasing, meanwhile TRS and toughness of cermets were improved obviously. In this paper, the wettability of molten metal on different group transition metal carbides was discussed in detail based on valence-electron configurations (VECs) of carbides. - Highlights: • (Ti{sub 1-x}W{sub x})C solid solutions were synthesized by carbothermal reduction. • (Ti,W)C-Ni{sub 3}Al cermets were prepared through powder metallurgy route. • The increase of W can improve wetting and densification significantly. • (Ti,W)C-Ni{sub 3}Al cermets showed a weak core-rim structure particles embedded in binder. • Wetting behavior were discussed from valence-electron configurations of carbides.

113Cd NMR as a Probe of the Active Sites of Metalloenzymes

NARCIS (Netherlands)

Armitage, Ian M.; Schoot Uiterkamp, Antonius J.M.; Chlebowski, Jan F.; Coleman, Joseph E.

1978-01-01

113Cd NMR has been used to study the active site metal ion(s) of the 113Cd(II) derivatives of four Zn(II) metalloenzymes, carboxypeptidase A, carbonic anhydrases, alkaline phosphatase, and superoxide dismutase. The resonances of the enzyme-bound 113Cd(II) ions are extremely sensitive to ligand

13 CFR 113.425 - Counseling and use of appraisal and counseling materials.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Counseling and use of appraisal and counseling materials. 113.425 Section 113.425 Business Credit and Assistance SMALL BUSINESS... Activities Prohibited § 113.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A...

Oil encapsulation in core-shell alginate capsules by inverse gelation II: comparison between dripping techniques using W/O or O/W emulsions.

Science.gov (United States)

Martins, Evandro; Poncelet, Denis; Rodrigues, Ramila Cristiane; Renard, Denis

2017-09-01

In the first part of this article, it was described an innovative method of oil encapsulation from dripping-inverse gelation using water-in-oil (W/O) emulsions. It was noticed that the method of oil encapsulation was quite different depending on the emulsion type (W/O or oil-in-water (O/W)) used and that the emulsion structure (W/O or O/W) had a high impact on the dripping technique and the capsules characteristics. The objective of this article was to elucidate the differences between the dripping techniques using both emulsions and compare the capsule properties (mechanical resistance and release of actives). The oil encapsulation using O/W emulsions was easier to perform and did not require the use of emulsion destabilisers. However, capsules produced from W/O emulsions were more resistant to compression and showed the slower release of actives over time. The findings detailed here widened the knowledge of the inverse gelation and gave opportunities to develop new techniques of oil encapsulation.

9 CFR 113.25 - Culture media for detection of bacteria and fungi.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Culture media for detection of bacteria and fungi. 113.25 Section 113.25 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Standard Procedures § 113.25 Culture media for detection of bacteria and fungi. (a...

Beta-delayed proton emitter $^{113}Xe$

CERN Document Server

Hagberg, E; Jonson, B; Jørgensen, B; Kugler, E; Mowinckel, T

1973-01-01

The ISOLDE facility at the CERN synchrocyclotron has been used for extending the series of beta -delayed proton emitters in xenon to masses lighter than those previously observed (/sup 115,117/Xe). Owing to the rapid decrease of the yields, experiments with solid-state counters were inconclusive, and instead a new and much more sensitive method based on nuclear emulsions was developed. The mass range 111-114 showed one new activity, /sup 113/Xe, with a half-life of 2.8+or-0.2 sec. From measurements of the track lengths for a total of 1130 protons from /sup 113/Xe it was possible to determine the energy spectrum. The results extend the systematics of beta -strength functions in the light xenon isotopes. (19 refs).

19 CFR 113.1 - Authority to require security or execution of bond.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Authority to require security or execution of bond. 113.1 Section 113.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS General Provisions § 113.1 Authority to require security or...

Properties of emulsions stabilised by sodium caseinate–chitosan complexes

NARCIS (Netherlands)

Zinoviadou, K.; Scholten, E.; Moschakis, T.; Biliaderis, C.G.

2012-01-01

Oil-in-water emulsions (10%, w/w, oil) were prepared at pH 5.7 by using electrostatically formed complexes of 0.5% (w/w) sodium caseinate (Na-CAS) and 0–0.6% (w/w) chitosan. Emulsions stabilized by complexes with increased levels of chitosan (>0.2% w/w) had a smaller average droplet size and

Thermal-hydraulic analysis best-estimate of an accident in the containment a PWR-W reactor with GOTHIC code using a 3D model detailed; Analisis termo-hidraulico best-estimate de un accidente en contencion de un reactor PWR-W con el codigo GOTHIC mediante un modelo 3D detallado

Energy Technology Data Exchange (ETDEWEB)

Bocanegra, R.; Jimenez, G.

2013-07-01

The objective of this project will be a model of containment PWR-W with the GOTHIC code that allows analyzing the behavior detailed after a design basis accident or a severe accident. Unlike the models normally used in codes of this type, the analysis will take place using a three-dimensional model of the containment, being this much more accurate.

Effective field theory analysis of new physics in e{sup +}e{sup -}{yields}W{sup +}W{sup -} at a linear collider

Energy Technology Data Exchange (ETDEWEB)

Buchalla, G.; Cata, O.; Rahn, R. [Muenchen Univ. (Germany). Fakultaet fuer Physik; Schlaffer, M. [Muenchen Univ. (Germany). Fakultaet fuer Physik; Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

2013-02-15

We analyze new physics contributions to e{sup +}e{sup -}{yields}W{sup +}W{sup -} at the TeV energy scale, employing an effective field theory framework. A complete basis of next-to-leading order operators in the standard model effective Lagrangian is used, both for the nonlinear and the linear realization of the electroweak sector. The elimination of redundant operators via equations-of-motion constraints is discussed in detail. Polarized cross sections for e{sup +}e{sup -}{yields}W{sup +}W{sup -} (on-shell) are computed and the corrections to the standard model results are given in an expansion for large s/M{sup 2}{sub W}. The dominant relative corrections grow with s and can be fully expressed in terms of modified gauge-fermion couplings. These corrections are interpreted in the context of the Goldstone boson equivalence theorem. Explicit new physics models are considered to illustrate the generation and the potential size of the coefficients in the effective Lagrangian. Brief comments are made on the production of W{sup +}W{sup -} pairs at the LHC.

W-Band Sheet Beam Klystron Design

International Nuclear Information System (INIS)

Scheitrum, G.; Caryotakis, G.; Burke, A.; Jensen, A.; Jongewaard, E.; Krasnykh, A.; Neubauer, M.; Phillips, R.; Rauenbuehler, K.

2011-01-01

Sheet beam devices provide important advantages for very high power, narrow bandwidth RF sources like accelerator klystrons (1). Reduced current density and increased surface area result in increased power capabi1ity, reduced magnetic fields for focusing and reduced cathode loading. These advantages are offset by increased complexity, beam formation and transport issues and potential for mode competition in the ovennoded cavities and drift tube. This paper will describe the design issues encountered in developing a 100 kW peak and 2 kW average power sheet beam k1ystron at W-band including beam formation, beam transport, circuit design, circuit fabrication and mode competition.

Chiral W-gravities for general extended conformal algebras

International Nuclear Information System (INIS)

Hull, C.M.

1991-01-01

The gauging of any chiral extended conformal symmetry of any two-dimensional field theory is achieved by coupling to the appropriate chiral W-gravity. Only a linear coupling to the W-gravity gauge fields is needed. The gauging of algebras with central charges requires the introduction of spin-zero gauge fields corresponding to the central charges. The example of Liouville theory is discussed in detail and a new way of coupling it to gravity is obtained. (orig.)

13 CFR 113.135 - Designation of responsible employee and adoption of grievance procedures.

Science.gov (United States)

2010-01-01

... employee and adoption of grievance procedures. 113.135 Section 113.135 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES... Programs or Activities Receiving Federal Financial Assistance Introduction § 113.135 Designation of...

Tank 241-TX-113 rotary mode core sampling and analysis plan

International Nuclear Information System (INIS)

McCain, D.J.

1998-01-01

This sampling and analysis plan (SAP) identities characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for push mode core samples from tank 241-TX-113 (TX-113). The Tank Characterization Technical Sampling Basis document identities Retrieval, Pretreatment and Immobilization as an issue that applies to tank TX-113. As a result, a 150 gram composite of solids shall be made and archived for that program. This tank is not on a Watch List

Young stellar population and star formation history ofW4 HII region/Cluster Complex

Science.gov (United States)

Panwar, Neelam

2018-04-01

The HII region/cluster complex has been a subject of numerous investigations to study the feedback effect of massive stars on their surroundings. Massive stars not only alter the morphology of the parental molecular clouds, but also influence star formation, circumstellar disks and the mass function of low-mass stars in their vicinity. However, most of the studies of low-mass stellar content of the HII regions are limited only to the nearby regions. We study the star formation in the W4 HII region using deep optical observations obtained with the archival data from Canada - France - Hawaii Telescope, Two-Micron All Sky Survey, Spitzer, Herschel and Chandra. We investigate the spatial distribution of young stellar objects in the region, their association with the remnant molecular clouds, and search for the clustering to establish the sites of recent star formation. Our analysis suggests that the influence of massive stars on circumstellar disks is significant only to thei! r immediate neighborhood. The spatial correlation of the young stars with the distribution of gas and dust of the complex indicate that the clusters would have formed in a large filamentary cloud. The observing facilities at the 3.6-m Devasthal Optical Telescope (DOT), providing high-resolution spectral and imaging capabilities, will fulfill the major objectives in the study of HII regions.

9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed Virus. 113.215 Section 113.215 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...

Measurement of the $W$ boson mass with the D0 detector

Energy Technology Data Exchange (ETDEWEB)

Abazov, Victor Mukhamedovich; et al.

2014-01-30

We give a detailed description of the measurement of the $W$ boson mass, $M_W$, performed on an integrated luminosity of 4.3 fb$^{-1}$, which is based on similar techniques as used for our previous measurement done on an independent data set of 1 fb$^{-1}$ of data. The data were collected using the D0 detector at the Fermilab Tevatron Collider. This data set yields $1.68\\times 10^6$ $W\\rightarrow e\

Formation of W(3)A(1) electron-transferring flavoprotein (ETF) hydroquinone in the trimethylamine dehydrogenase x ETF protein complex.

Science.gov (United States)

Jang, M H; Scrutton, N S; Hille, R

2000-04-28

The electron-transferring flavoprotein (ETF) from Methylophilus methylotrophus (sp. W(3)A(1)) exhibits unusual oxidation-reduction properties and can only be reduced to the level of the semiquinone under most circumstances (including turnover with its physiological reductant, trimethylamine dehydrogenase (TMADH), or reaction with strong reducing reagents such as sodium dithionite). In the present study, we demonstrate that ETF can be reduced fully to its hydroquinone form both enzymatically and chemically when it is in complex with TMADH. Quantitative titration of the TMADH x ETF protein complex with sodium dithionite shows that a total of five electrons are taken up by the system, indicating that full reduction of ETF occurs within the complex. The results indicate that the oxidation-reduction properties of ETF are perturbed upon binding to TMADH, a conclusion further supported by the observation of a spectral change upon formation of the TMADH x ETF complex that is due to a change in the environment of the FAD of ETF. The results are discussed in the context of ETF undergoing a conformational change during formation of the TMADH x ETF electron transfer complex, which modulates the spectral and oxidation-reduction properties of ETF such that full reduction of the protein can take place.

Cold H I clouds near the supernova remnant W44

International Nuclear Information System (INIS)

Sato, F.

1986-01-01

The cold H I clouds near the supernova remnant W44 are investigated by the use of the Maryland-Green Bank Survey (Westerhout 1973). Several clouds with a mean diameter of about 20 pc are distributed in the region. They do not seem to make a shell around W44, contrary to the suggestion by Knapp and Kerr (1974) based on the low-resolution data at coarse grids. Some of them form a chain, about 100 pc in length, extending approximately along the galactic equator. It resembles the cold H I cloud near W3 and W4. The major constituent of the clouds is probably the hydrogen molecule, and the total mass of the entire complex amounts to 25,000 81,000 solar masses. The estimated Jeans mass indicates that they will contract to dense molecular clouds. Therefore, it may safely be concluded that the cold H1 cloud complex near W44 is a giant molecular cloud at an early evolutionary stage. 14 references

Natural bond orbital analysis of molecular interactions: Theoretical study of W(CO)5 complexes with E(PH3)2 and NHEMe ligands (E=C, Si, Ge, Sn, Pb)

International Nuclear Information System (INIS)

Nguyen Thi Ai Nhung; Huynh Thi Phuong Loan; Duong Tuan Quang; Pham Van Tat

2014-01-01

The complexes with ligands carbodiphosphorane-analogues (called tetrylones) [(CO) 5 W-{E(PH 3 ) 2 }] (W5-EP 2 ) and N-heterocyclic carbene-analogues (called tetrylenes) [(CO) 5 W-{NHE Me }] (W5-NHE Me ) when E=C-Pb have been studied using natural bond orbital (NBO) method. The NBO analysis provides a consistent picture of the chemical bonding is two entire families of transition metal complexes of tetrylone and tetrylene ligands in term of donor-acceptor interactions, showing the correlation of these interactions with Wiberg bond indies (WBI), natural partial charges, and the energetically highest lying occupied molecular orbitals for σ and π orbitals of free ligands E(PH 3 ) 2 and NHE Me . Analysis of the bonding situation reveals that in E(PH 3 ) 2 and NHE Me ligands, the energy level of the π orbital rises, whereas that of the σ orbital decreases as atom E becomes heavier. The complexes with head-on-bonded ligands have (CO) 5 W←E donation which comes from the σ-lone-pair orbital of E(PH 3 ) 2 and NHE Me where E=C for tetrylones and E=C, Si, Ge for tetrylenes, whereas the (CO) 5 W←E donation in the side-on bonded complexes when E becomes heavier arises from the π-lone-pair orbital of E(PH 3 ) 2 and NHE Me ligands which is the HOMO of the free ligands. This makes the heavier adducts of tetrylones and tetrylenes become stronger donors than the lighter systems. The NBO analysis suggests that the E(PH 3 ) 2 ligands are strong σ-donors and strong π-acceptors while the NHE Me ligands are strong σ-donors and weak π-acceptors. This is possible for tetrylones that have two lone-pair orbitals available for donation, whereas the tetrylenes have only one lone-pair orbital available for donation. (author)

HERV-W group evolutionary history in non-human primates: characterization of ERV-W orthologs in Catarrhini and related ERV groups in Platyrrhini.

Science.gov (United States)

Grandi, Nicole; Cadeddu, Marta; Blomberg, Jonas; Mayer, Jens; Tramontano, Enzo

2018-01-19

The genomes of all vertebrates harbor remnants of ancient retroviral infections, having affected the germ line cells during the last 100 million years. These sequences, named Endogenous Retroviruses (ERVs), have been transmitted to the offspring in a Mendelian way, being relatively stable components of the host genome even long after their exogenous counterparts went extinct. Among human ERVs (HERVs), the HERV-W group is of particular interest for our physiology and pathology. A HERV-W provirus in locus 7q21.2 has been coopted during evolution to exert an essential role in placenta, and the group expression has been tentatively linked to Multiple Sclerosis and other diseases. Following up on a detailed analysis of 213 HERV-W insertions in the human genome, we now investigated the ERV-W group genomic spread within primate lineages. We analyzed HERV-W orthologous loci in the genome sequences of 12 non-human primate species belonging to Simiiformes (parvorders Catarrhini and Platyrrhini), Tarsiiformes and to the most primitive Prosimians. Analysis of HERV-W orthologous loci in non-human Catarrhini primates revealed species-specific insertions in the genomes of Chimpanzee (3), Gorilla (4), Orangutan (6), Gibbon (2) and especially Rhesus Macaque (66). Such sequences were acquired in a retroviral fashion and, in the majority of cases, by L1-mediated formation of processed pseudogenes. There were also a number of LTR-LTR homologous recombination events that occurred subsequent to separation of Catarrhini sub-lineages. Moreover, we retrieved 130 sequences in Marmoset and Squirrel Monkeys (family Cebidae, Platyrrhini parvorder), identified as ERV1-1_CJa based on RepBase annotations, which appear closely related to the ERV-W group. Such sequences were also identified in Atelidae and Pitheciidae, representative of the other Platyrrhini families. In contrast, no ERV-W-related sequences were found in genome sequence assemblies of Tarsiiformes and Prosimians. Overall, our

G.W. Ritchey's Optical Work for the Army during WWI.

Science.gov (United States)

Abrahams, Peter

2015-01-01

During the first World War, the Mount Wilson optical shop was remodeled into a production facility, making lenses and prisms for military optics. G.W. Ritchey, H.S. Kinney, and J.S. Dalton managed the project, joined by Ritchey's son Willis and a large team of workers. Tens of thousands of lenses and prisms were produced, notably the exacting roof prisms needed for altimeters.This sizeable project is documented in correspondence and a 'Report on Technical Details of Optical Work', authored by G.W. Ritchey and reproduced in typewriter carbon copy with tipped-in photographs. The retrofitting of the MWO optical shop, and the complicated production methods, are detailed in the report.

Functions of Ceramide Synthase Paralogs YPR114w and YJR116w of Saccharomyces cerevisiae.

Directory of Open Access Journals (Sweden)

Shamroop K Mallela

Full Text Available Ceramide is synthesized in yeast by two redundant acyl-CoA dependent synthases, Lag1 and Lac1. In lag1∆ lac1∆ cells, free fatty acids and sphingoid bases are elevated, and ceramides are produced through the redundant alkaline ceramidases Ypc1 and Ydc1, working backwards. Even with all four of these genes deleted, cells are surviving and continue to contain small amounts of complex sphingolipids. Here we show that these residual sphingolipids are not synthesized by YPR114w or YJR116w, proteins of unknown function showing a high degree of homology to Lag1 and Lac1. Indeed, the hextuple lag1∆ lac1∆ ypc1∆ ydc1∆ ypr114w∆ yjr116w∆ mutant still contains ceramides and complex sphingolipids. Yjr116w∆ exhibit an oxygen-dependent hypersensitivity to Cu2+ due to an increased mitochondrial production of reactive oxygen species (ROS and a mitochondrially orchestrated programmed cell death in presence of copper, but also a general copper hypersensitivity that cannot be counteracted by the antioxidant N-acetyl-cysteine (NAC. Myriocin efficiently represses the synthesis of sphingoid bases of ypr114w∆, but not its growth. Both yjr116w∆ and ypr114w∆ have fragmented vacuoles and produce less ROS than wild type, before and after diauxic shift. Ypr114w∆/ypr114w∆ have an increased chronological life span. Thus, Yjr116w and Ypr114w are related, but not functionally redundant.

7 CFR 1221.113 - Financial statements.

Science.gov (United States)

2010-01-01

... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.113 Financial statements. (a) As requested by the Secretary, the Board shall prepare...

Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate

Science.gov (United States)

Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.

2014-01-01

This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197

CRC-113 gene expression signature for predicting prognosis in patients with colorectal cancer.

Science.gov (United States)

Nguyen, Minh Nam; Choi, Tae Gyu; Nguyen, Dinh Truong; Kim, Jin-Hwan; Jo, Yong Hwa; Shahid, Muhammad; Akter, Salima; Aryal, Saurav Nath; Yoo, Ji Youn; Ahn, Yong-Joo; Cho, Kyoung Min; Lee, Ju-Seog; Choe, Wonchae; Kang, Insug; Ha, Joohun; Kim, Sung Soo

2015-10-13

Colorectal cancer (CRC) is the third leading cause of global cancer mortality. Recent studies have proposed several gene signatures to predict CRC prognosis, but none of those have proven reliable for predicting prognosis in clinical practice yet due to poor reproducibility and molecular heterogeneity. Here, we have established a prognostic signature of 113 probe sets (CRC-113) that include potential biomarkers and reflect the biological and clinical characteristics. Robustness and accuracy were significantly validated in external data sets from 19 centers in five countries. In multivariate analysis, CRC-113 gene signature showed a stronger prognostic value for survival and disease recurrence in CRC patients than current clinicopathological risk factors and molecular alterations. We also demonstrated that the CRC-113 gene signature reflected both genetic and epigenetic molecular heterogeneity in CRC patients. Furthermore, incorporation of the CRC-113 gene signature into a clinical context and molecular markers further refined the selection of the CRC patients who might benefit from postoperative chemotherapy. Conclusively, CRC-113 gene signature provides new possibilities for improving prognostic models and personalized therapeutic strategies.

Solid waste operations complex engineering verification program plan

International Nuclear Information System (INIS)

Bergeson, C.L.

1994-01-01

This plan supersedes, but does not replace, the previous Waste Receiving and Processing/Solid Waste Engineering Development Program Plan. In doing this, it does not repeat the basic definitions of the various types or classes of development activities nor provide the rigorous written description of each facility and assign the equipment to development classes. The methodology described in the previous document is still valid and was used to determine the types of verification efforts required. This Engineering Verification Program Plan will be updated on a yearly basis. This EVPP provides programmatic definition of all engineering verification activities for the following SWOC projects: (1) Project W-026 - Waste Receiving and Processing Facility Module 1; (2) Project W-100 - Waste Receiving and Processing Facility Module 2A; (3) Project W-112 - Phase V Storage Facility; and (4) Project W-113 - Solid Waste Retrieval. No engineering verification activities are defined for Project W-112 as no verification work was identified. The Acceptance Test Procedures/Operational Test Procedures will be part of each project's Title III operation test efforts. The ATPs/OTPs are not covered by this EVPP

Simpler criterion on W state for perfect quantumstate splitting and quantum teleportation

Institute of Scientific and Technical Information of China (English)

无

2009-01-01

A simpler criterion is presented to judge whether a W state can be taken as quantum channel forperfectly splitting or teleporting an arbitrary single-qubit state. If the W state is usable,the detailed manipulations in the two quantum information processes are amply shown. Moreover,some relevant discussions are made.

Rheological and droplet size analysis of W/O/W multiple emulsions containing low concentrations of polymeric emulsifiers

Directory of Open Access Journals (Sweden)

DRAGANA D. VASILJEVIĆ

2009-07-01

Full Text Available Multiple emulsions are complex dispersion systems which have many potential applications in pharmaceutics, cosmetics and the food industry. In practice, however, significant problems may arise because of their thermodynamic instability. In this study, W/O/W multiple emulsion systems containing low concentration levels of lipophilic polymeric primary emulsifiers cetyl dimethicone copolyol and PEG–30 dipolyhydroxystearate were evaluated. The concentrations of the primary emulsifiers were set at 1.6 and 2.4 % w/w in the final emulsions. Rheological and droplet size analysis of the investigated samples showed that the type and concentration of the primary lipophilic polymeric emulsifier markedly affected the characteristics of the multiple emulsions. The multiple emulsion prepared with 2.4 % w/w PEG–30 dipolyhydroxystearate as the primary emulsifier exhibited the highest apparent viscosity, yield stress and elastic modulus values, as well as the smallest droplet size. Furthermore, these parameters remained relatively constant over the study period, confirming the high stability of the investigated sample. The results obtained indicate that the changes observed in the investigated samples over time could be attributed to the swelling/breakdown mechanism of the multiple droplets. Such changes could be adequately monitored by rheological and droplet size analysis.

TED Study of Si(113) Surfaces

Science.gov (United States)

Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.

A TED study of Si(113) surfaces was carried out. Reflections from the 3 × 2 reconstruction were seen at room temperature, while half-order reflections were very faint. The surface showed the phase transition between the 3 × 1 and the disordered (rough) structures at about 930°C. The (113) surface structure at room temperature was analyzed using TED intensity. Four kinds of structure models proposed previously, including both the 3 × 1 and the 3 × 2 reconstructed structures, were examined. The R-factors calculated using the energy-optimized atomic coordinates are not sufficiently small. After minimization of the R-factors, Dabrowski's 3 × 2 structure model is most agreeable, while Ranke's 3 × 1 and 3 × 2 structure models are not to be excluded. STM observation showed that the surface is composed of small domains of the 3 × 2 structure.

Miejsce muzeów w turystyce kulturowej w Polsce

OpenAIRE

Krakowiak, Beata

2013-01-01

The article presents the museums, their potential and their significance for cultural tourism in Poland. Its aims are achieved through a presentation of registered national museums, ‘monuments of history’, museum buildings and the cultural activities undertaken by these institutions Artykuł dotyczy potencjału muzealnego oraz jego znaczenia dla turystyki kulturowej w Polsce. Zamierzone cele pracy realizowane są poprzez prezentację muzeów rejestrowanych, narodowych, muzeów-pomników histor...

13 CFR 113.110 - Remedial and affirmative action and self-evaluation.

Science.gov (United States)

2010-01-01

... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...

For wind turbines in complex terrain, the devil is in the detail

Science.gov (United States)

Lange, Julia; Mann, Jakob; Berg, Jacob; Parvu, Dan; Kilpatrick, Ryan; Costache, Adrian; Chowdhury, Jubayer; Siddiqui, Kamran; Hangan, Horia

2017-09-01

The cost of energy produced by onshore wind turbines is among the lowest available; however, onshore wind turbines are often positioned in a complex terrain, where the wind resources and wind conditions are quite uncertain due to the surrounding topography and/or vegetation. In this study, we use a scale model in a three-dimensional wind-testing chamber to show how minor changes in the terrain can result in significant differences in the flow at turbine height. These differences affect not only the power performance but also the life-time and maintenance costs of wind turbines, and hence, the economy and feasibility of wind turbine projects. We find that the mean wind, wind shear and turbulence level are extremely sensitive to the exact details of the terrain: a small modification of the edge of our scale model, results in a reduction of the estimated annual energy production by at least 50% and an increase in the turbulence level by a factor of five in the worst-case scenario with the most unfavorable wind direction. Wind farm developers should be aware that near escarpments destructive flows can occur and their extent is uncertain thus warranting on-site field measurements.

Report of the working group on precision measurements. - Measurement of the W boson mass and width

International Nuclear Information System (INIS)

Brock, R.; Erler, J.; Kim, Y.-K.; Marciano, W.; Ashmanskas, W.; Baur, U.; Ellison, J.; Lancaster, M.; Nodulman, L.; Rha, J.; Waters, D.; Womersley, J.

2000-01-01

We discuss the prospects for measuring the W mass and width in Run II. The basic techniques used to measure M W are described and the statistical, theoretical and detector-related uncertainties are discussed in detail. Alternative methods of measuring the W mass at the Tevatron and the prospects for M W measurements at other colliders are also described

Discovery of the charged vector bosons (W+-) conveying weak interaction

International Nuclear Information System (INIS)

Kiss, D.

1983-01-01

The unified Weinberg-Salam-Glashow theory of weak and electromagnetic interactions assumes the existence of two charged (W) and one neutral (Z) intermediate vector bosons of the unified electroweak interaction. These particles were discovered at the end of 1982 with the CERN's SPS proton-antiproton colliding beams. Technical aspects of the production and detection of W and Z bosons, the first results and their importance are described in detail. (D.Gy.)

9 CFR 113.202 - Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Type 2 Vaccine, Killed Virus. 113.202 Section 113.202 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.202 Canine Hepatitis and Canine...

9 CFR 3.113 - Primary enclosures used to transport marine mammals.

Science.gov (United States)

2010-01-01

... marine mammals. 3.113 Section 3.113 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... the animals, their handlers, or other persons. (d) Marine mammals transported in the same primary... used. Within the primary enclosures used to transport marine mammals, the animals will be maintained on...

Field dependence of T1 for hyperpolarized [1-13C]pyruvate

DEFF Research Database (Denmark)

Chattergoon, N.; Martnez-Santiesteban, F.; Handler, W. B.

2013-01-01

conformation and properties of the dissolution media such as buffer composition, solution pH, temperature and magnetic field. We have measured the magnetic field dependence of the spin–lattice relaxation time of hyperpolarized [1-13C]pyruvate using field-cycled relaxometry. [1-13C]pyruvate was hyperpolarized...

RATIONAL AGGREGATION OF THE PRODUCTION LIST OF THE ECONOMIC MODEL WITH THE DETAILED TIMBER COMPLEX (ASSESSMENT ON THE BASE OF THE EXPERIMENTAL CALCULATIONS

Directory of Open Access Journals (Sweden)

Mkrtchyan G. M.

2015-09-01

Full Text Available The main principle of developing specialized model complexes is based on the approach when the detailed description of the object (the core, the main body is added by the description of the context. In addition to the above, the core of the system can be made up in turns by objects picked up from the context. Developing the models on separate subsystems of the economy, presented in details in the basic model, leads to creation of problems (equations with many variables and parameters where for the specific goals of analysis (and forecasting it is not at all obligatory to use the full-scale model. Such redundancy is unnecessary while using this model for scenario calculations in the context of “branch ” problems. The authors provide experimental calculations which allow evaluating the influence of aggregation on resulting information. Average year growth rates of production by branches of timber complex are considered as resulting information. Closeness of decisions on these indicators proves the hypothesis about possibility and rationality of such aggregation of the economic context for the timber complex.

Dynamic Consolidation and Investigation of Nanostructural W-Cu / W-Y Cylindrical Billets

Science.gov (United States)

Godibadze, B.; Dgebuadze, A.; Chagelishvili, E.; Mamniashvili, G.; Peikrishvili, A.

2018-03-01

higher than 0.5 wt. %. Investigation revealed that the Y rich phases were complex (W-Y) oxides formed during the sintering process. Also very interesting to use doping chromium with yttrium-containing alloys. e.g. (W - 10÷12 Cr -0.5÷2 Y) wt. %. The extent up to which yttrium acts as an active element improving the adherence and stability of the protective Cr 2 O 3 layer formed during oxidation is assessed. The structure and characteristics of the obtained samples depends on the phase content, distribution of phases and processing parameters during explosive synthesis and consolidation. Cu – (10-30%) W powder mixtures were formed into cylindrical rods using a hot shock wave consolidation (HSWC) process. Different type of Cu - W precursor composition containing 10, 20 and 30% of nanoscale W were consolidated near theoretical density under 900°C The loading intensity was under 10 GPa. The investigation showed that the combination of high temperatures (above 800°C) and two stage shock wave compression was beneficial to the consolidation of the W-Cu & W-Y composites, resulting in high densities, good integrity and good electronic properties.

On the mechanism of imine elimination from Fischer tungsten carbene complexes

Directory of Open Access Journals (Sweden)

Philipp Veit

2016-06-01

Full Text Available (Aminoferrocenyl(ferrocenylcarbene(pentacarbonyltungsten(0 (CO5W=C(NHFcFc (W(CO5(E-2 is synthesized by nucleophilic substitution of the ethoxy group of (CO5W=C(OEtFc (M(CO5(1Et by ferrocenyl amide Fc-NH– (Fc = ferrocenyl. W(CO5(E-2 thermally and photochemically eliminates bulky E-1,2-diferrocenylimine (E-3 via a formal 1,2-H shift from the N to the carbene C atom. Kinetic and mechanistic studies to the formation of imine E-3 are performed by NMR, IR and UV–vis spectroscopy and liquid injection field desorption ionization (LIFDI mass spectrometry as well as by trapping experiments for low-coordinate tungsten complexes with triphenylphosphane. W(CO5(E-2 decays thermally in a first-order rate-law with a Gibbs free energy of activation of ΔG‡298K = 112 kJ mol−1. Three proposed mechanistic pathways are taken into account and supported by detailed (time-dependent densitiy functional theory [(TD-DFT] calculations. The preferred pathway is initiated by an irreversible CO dissociation, followed by an oxidative addition/pseudorotation/reductive elimination pathway with short-lived, elusive seven-coordinate hydrido tungsten(II intermediates cis(N,H-W(CO4(H(Z-15 and cis(C,H-W(CO4(H(Z-15.

Angiogeneza w reumatoidalnym zapaleniu stawów

Directory of Open Access Journals (Sweden)

Anna Kotulska

2011-02-01

Full Text Available Angiogeneza jest procesem powstawania nowych włosowatychnaczyń krwionośnych z uprzednio istniejących włośniczek. Angiogenezawystępuje w życiu pozapłodowym i jest regulowana przezzespół czynników proangiogennych i antyangiogennych (tab. I.Zwiększona angiogeneza towarzyszy kilku stanom chorobowym. Jestniezbędna dla wzrostu nowotworów złośliwych. Choroby nienowotworowe,w tym reumatoidalne zapalenie stawów, są także związanez nasiloną angiogenezą. Wykazano tworzenie nowych naczyńw zmienionej zapalnie błonie maziowej stawów, co jest najważniejszązmianą patologiczną u chorych na reumatoidalne zapalenie stawów.U chorych stwierdzono zaburzoną regulację czynników proangiogennychi hamujących ten proces. Leki hamujące zapalenie błonymaziowej bezpośrednio lub pośrednio ograniczają angiogenezę.Możliwe jest, że oddziaływanie na proces angiogenezy będzie stanowićjeden z mechanizmów terapeutycznych leków stosowanychu chorych na reumatoidalne zapalenie stawów.

Interaction of actinide ions with [NaP5W30O110]14- and [P2W18O62]6-

International Nuclear Information System (INIS)

Choppin, G.R.; Wall, D.E.

2003-01-01

Stability constants (log β 101 ) of Th 4+ , UO 2 2+ , NpO 2 + and Am 3+ with [NaP 5 W 30 O 110 ] 14- were determined by solvent extraction (μ = 0.1M NaCl) and found to be 6.18 ± 0.07, 3.80 ± 0.06, 2.98 ± 0.04, and 5.85 ± 0.05, respectively. The order of stability constants: Th 4+ > Am 3+ > UO 2 2+ > NpO 2 + is due to electrostatic repulsion between the actinyl oxygens and oxygens on the polyoxometalate surface. The order of stability constants for metal complexes with [P 2 W 18 O 62 ] 6- is Th 4+ > UO 2 2+ > Eu 3+ >NpO 2 + because the steric repulsion between actinyl oxygens and oxygens on polyoxometalate are less important. Enthalpies of complexation were measured by calorimetric titration of Th 4+ , UO 2 2+ , Nd 3+ with [NaP 5 W 30 O 110 ] 14- and [P 2 W 18 O 62 ] 6- . The results indicate that the conformation and charge distribution of the microscopic surface structures are important factors in the formation of pseudocolloids. (author)

Scintigraphy of the Placenta With {sup 113m}In

Energy Technology Data Exchange (ETDEWEB)

Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)

1969-05-15

The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)

7 CFR 1463.113 - Issuance of payments in event of death.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Issuance of payments in event of death. 1463.113 Section 1463.113 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS 2005-2014 TOBACCO TRANSITION PROGRAM Tobacco Transition Payment Program ...

Strain, magnetic anisotropy, and anisotropic magnetoresistance in (Ga,Mn)As on high-index substrates: Application to (113)A -oriented layers

Science.gov (United States)

Dreher, L.; Donhauser, D.; Daeubler, J.; Glunk, M.; Rapp, C.; Schoch, W.; Sauer, R.; Limmer, W.

2010-06-01

Based on a detailed theoretical examination of the lattice distortion in high-index epilayers in terms of continuum mechanics, expressions are deduced that allow the calculation and experimental determination of the strain tensor for (hhl) -oriented (Ga,Mn)As layers. Analytical expressions are derived for the strain-dependent free-energy density and for the resistivity tensor for monoclinic and orthorhombic crystal symmetries, phenomenologically describing the magnetic anisotropy and anisotropic magnetoresistance by appropriate anisotropy and resistivity parameters, respectively. Applying the results to (113)A orientation with monoclinic crystal symmetry, the expressions are used to determine the strain tensor and the shear angle of a series of (113)A -oriented (Ga,Mn)As layers by high-resolution x-ray diffraction and to probe the magnetic anisotropy and anisotropic magnetoresistance at 4.2 K by means of angle-dependent magnetotransport. Whereas the transverse-resistivity parameters are nearly unaffected by the magnetic field, the parameters describing the longitudinal resistivity are strongly field dependent.

13 CFR 113.525 - Fringe benefits.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fringe benefits. 113.525 Section... benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit, service, policy or plan, any...

78 FR 63570 - Proposed Collection; Comment Request for Forms W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY

Science.gov (United States)

2013-10-24

... W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury..., the IRS is soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8BEN-E, Certificate of Status of Beneficial Owner for...

Residual stress in Ni-W electrodeposits

DEFF Research Database (Denmark)

Mizushima, Io; Tang, Peter Torben; Hansen, Hans Nørgaard

2006-01-01

In the present work, the residual stress in Ni–W layers electrodeposited from electrolytes based on NiSO4 and Na2WO4, is investigated. Citrate, glycine and triethanolamine were used as complexing agents, enabling complex formation between the nickel ion and tungstate. The results show that the type...... of complexing agent and the current efficiency have an influence on the residual stress. In all cases, an increase in tensile stress in the deposit with time after deposition was observed. Pulse plating could improve the stress level for the electrolyte containing equal amounts of citrate...

Firmy rodzinne w Polsce w dobie globalizacji

OpenAIRE

Zalewska, Agnieszka

2016-01-01

Celem publikacji jest ukazanie dorobku naukowego, głównie polskich i ukraińskich uczonych, w zakresie uwarunkowań procesów i rezultatów internacjonalizacji przedsiębiorstw oraz jej wpływu na funkcjonowanie biznesu w dobie globalizacji. Opracowanie stanowi istotny wkład w zakresie teorii i praktyki w proces restrukturyzacji przedsiębiorstw w kierunku ich internacjonalizacji. Może posłużyć jako inspiracja do stworzenia strategii opartej na poszukiwaniach (prospector strategy), co będzie sprzyja...

36 CFR 11.3 - Power to revoke.

Science.gov (United States)

2010-07-01

... AND PARKSCAPE SYMBOLS § 11.3 Power to revoke. Permission granted under this part by the Director may... injurious to their integrity or inconsistent with the purposes of the National Park Service in the fields of...

Lectures on W algebras and W gravity

International Nuclear Information System (INIS)

Pope, C.N.

1992-01-01

We give a review of the extended conformal algebras, known as W algebras, which contain currents of spins higher than 2 in addition to the energy-momentum tensor. These include the non-linear W N algebras; the linear W ∞ and W 1+∞ algebras; and their super-extensions. We discuss their applications to the construction of W-gravity and W-string theories. (author). 46 refs

Low concentration ratio solar array for low Earth orbit multi-100 kW application. Volume 1: Design, analysis and development tests

Science.gov (United States)

1983-01-01

A preliminary design effort directed toward a low concentration ratio photovoltaic array system capable of delivering multihundred kilowatts (300 kW to 1000 kW range) in low earth orbit is described. The array system consists of two or more array modules each capable of delivering between 113 kW to 175 kW using silicon solar cells or gallium arsenide solar cells, respectively. The array module deployed area is 1320 square meters and consists of 4356 pyramidal concentrator elements. The module, when stowed in the Space Shuttle's payload bay, has a stowage volume of a cube with 3.24 meters on a side. The concentrator elements are sized for a geometric concentration ratio (GCR) of six with an aperture area of .25 sq. m. The structural analysis and design trades leading to the baseline design are discussed. It describes the configuration, as well as optical, thermal and electrical performance analyses that support the design and overall performance estimates for the array are described.

Analysis of lithofacies cyclicity in the Miocene Coal Complex of the Bełchatów lignite deposit, south-central Poland

Directory of Open Access Journals (Sweden)

Mastej Wojciech

2015-12-01

Full Text Available Markov chain analysis was applied to studies of cyclic sedimentation in the Coal Complex of the Bełchatów mining field (part of the Bełchatów lignite deposit. The majority of ambiguous results of statistical testing that were caused by weak, statistically undetectable advantage of either cyclicity over environmental barriers or vice versa, could be explained if only the above-mentioned advantages appeared in the neighbourhood. Therefore, in order to enhance the credibility of statistical tests, a new approach is proposed here in that matrices of observed transition numbers from different boreholes should be added to increase statistical reliability if they originated in a homogeneous area. A second new approach, which consists of revealing statistically undetectable cyclicity of lithofacies alternations, is proposed as well. All data were derived from the mining data base in which differentiation between lithology and sedimentary environments was rather weak. For this reason, the methodological proposals are much more important than details of the sedimentation model in the present paper. Nevertheless, they did reveal some interesting phenomena which may prove important in the reconstruction of peat/lignite environmental conditions. First of all, the presence of cyclicity in the sedimentation model, i.e., cyclic alternation of channel and overbank deposits, represents a fluvial environment. It was also confirmed that the lacustrine subenvironment was cut off from a supply of clastic material by various types of mire barriers. Additionally, our analysis revealed new facts: (i these barriers also existed between lakes in which either carbonate or clay sedimentation predominated; (ii there was no barrier between rivers and lakes in which clay sedimentation predominated; (iii barriers were less efficient in alluvial fan areas but were perfectly tight in regions of phytogenic or carbonate sedimentation; (iv groundwater, rather than surface flow

29 CFR Appendix A to Subpart W to... - Figures W-14 through W-28

Science.gov (United States)

2010-07-01

... 29 Labor 8 2010-07-01 2010-07-01 false Figures W-14 through W-28 A Appendix A to Subpart W to part 1926 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION...; Overhead Protection Pt. 1926, Subpt. W, App. A Appendix A to Subpart W to part 1926—Figures W-14 through W...

14 CFR 61.113 - Private pilot privileges and limitations: Pilot in command.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Private pilot privileges and limitations: Pilot in command. 61.113 Section 61.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND...

47 CFR 74.113 - Supplementary reports with application for renewal of license.

Science.gov (United States)

2010-10-01

... renewal of license. 74.113 Section 74.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... covered. (4) Power employed, field intensity measurements and visual and aural observations and the types... respective types of transmissions. (5) Estimated degree of public participation in reception and the results...

2607-W6 sanitary drainfield replacement

International Nuclear Information System (INIS)

Simmons, F.M.

1994-05-01

The septic 2607-W6 which supports the 222-S complex is operating at 200% capacity. The septic tank has been inspected and found to be sound. Test hole excavations of the existing drainfield indicate that it is disposing of the current waste water effluent load as opposed to treating it. The system is over 40 years old and has not been approved by the Washington State Department of Health. Under the existing operating conditions it is subject to imminent failure. No additional tie-ins or increases in personnel are allowed which will increase the flow to the 2607-W6 system

Genome Sequence of the Biocontrol Strain Pseudomonas fluorescens F113

Science.gov (United States)

Redondo-Nieto, Miguel; Barret, Matthieu; Morrisey, John P.; Germaine, Kieran; Martínez-Granero, Francisco; Barahona, Emma; Navazo, Ana; Sánchez-Contreras, María; Moynihan, Jennifer A.; Giddens, Stephen R.; Coppoolse, Eric R.; Muriel, Candela; Stiekema, Willem J.; Rainey, Paul B.; Dowling, David; O'Gara, Fergal; Martín, Marta

2012-01-01

Pseudomonas fluorescens F113 is a plant growth-promoting rhizobacterium (PGPR) that has biocontrol activity against fungal plant pathogens and is a model for rhizosphere colonization. Here, we present its complete genome sequence, which shows that besides a core genome very similar to those of other strains sequenced within this species, F113 possesses a wide array of genes encoding specialized functions for thriving in the rhizosphere and interacting with eukaryotic organisms. PMID:22328765

Hafty w sztambuchach Biblioteki Uniwersyteckiej w Poznaniu

Directory of Open Access Journals (Sweden)

Karolina Nowaczyk

2011-01-01

Full Text Available W artykule przedstawiono hafty znajdujące się w sztambuchach z XVIII i XIX wieku pochodzących ze zbiorów Biblioteki Uniwersyteckiej w Poznaniu. Omówione zostały zarówno technika wykonania haftów, jak i ich wartość artystyczna, a także znaczenie wskazanych przykładów dla historii hafciarstwa amatorskiego na ziemiach polskich. Artykuł jest jednocześnie próbą zwrócenia uwagi na istniejącą w tamtym okresie sztukę hafciarską o wyłącznie amatorskim charakterze oraz na kopiowanie i powtarzalność wzorów, co pozwala na określenie ich jako typowych dla danej epoki.

Geochemistry of Gneisses from Dabie Complex and Tongbai Complex in Qinling-Tongbai-Dabie Orogenic Belt: Implications for Location of Yangtze-Sino-Korean Suture

Institute of Scientific and Technical Information of China (English)

无

2000-01-01

The Dabie complex (DC) and the Tongbai complex (TBC) are separately distributed in the middle and eastern parts of the Qinling-Tongbai-Dabie orogenic belt. In this study, the Dabie complex can be divided into two units: one is the complex with no high pressure and ultrahigh pressure metamorphic rocks (DC1), and the other is the complex containing coesite-bearing eclogite lenses or boudins (DC2). Gneisses are predominant in the TBC, DC1 and DC2. Major and trace element data of gneisses in the TBC, DC1 and DC2 show them to be the orthogneisses. The gneisses in the DC1 have higher incompatible element contents and higher ratios of w(K2O)/w(Na2O) and w(La)n/w(Yb)n than those in the DC2. However, no obvious differences arise in other element contents and the ratios of w(La)/w( Nb), w(Nb)/w(Th), w(Nb)/w(Hf), w(Ba)/w(La), w(Sm)/w(Nd) and w(Th)/w(U) between the gneisses in the DC2 and those in the DC1. These observations suggest that the protoliths of the gneisses in the DC2 have affinities to those in the DC1. The difference between the DC1 and DC2 gneisses in incompat- ible element contents could reflect the difference in their partial melting extent. The TBC gneisses are geochemically similar to the DC1 gneisses, suggesting that the TBC and DC1 gneisses are the same lithologic unit in the Qinling-Tongbai-Dabie orogenic belt and that they have experienced similar formations and evolution histories. In the Qinling-Tongbai area, the TBC is part of the northern blocks of the Yangtze craton. Given the similarity of geochemical characteristics, the rock assemblage and the ages between the TBC and DC1 gneisses, we can infer that the Dabie complex also belongs to the northern blocks of the Yangtze craton. In terms of the distribution of eciogites and metamorphic facies, we propose that the collisionai suture in the Dabie area is distributed along the Xiaotian-Mozitan fault, at the contact with the Shang-Dan-Tongbai fault to the west.

48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.

Science.gov (United States)

2010-10-01

... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and Health...

High Level Expression and Purification of the Clinically Active Antimicrobial Peptide P-113 in Escherichia coli

Directory of Open Access Journals (Sweden)

Kuang-Ting Cheng

2018-03-01

Full Text Available P-113, which was originally derived from the human saliva protein histatin 5, is a histidine-rich antimicrobial peptide with the sequence AKRHHGYKRKFH. P-113 is currently undergoing phase II clinical trial as a pharmaceutical agent to fight against fungal infections in HIV patients with oral candidiasis. Previously, we developed a new procedure for the high-yield expression and purification of hG31P, an analogue and antagonist of human CXCL8. Moreover, we have successfully removed lipopolysaccharide (LPS, endotoxin associated with hG31P in the expression with Escherichia coli. In this paper, we have used hG31P as a novel fusion protein for the expression and purification of P-113. The purity of the expressed P-113 is more than 95% and the yield is 4 mg P-113 per liter of E. coli cell culture in Luria-Bertani (LB medium. The antimicrobial activity of the purified P-113 was tested. Furthermore, we used circular dichroism (CD and nuclear magnetic resonance (NMR spectroscopy to study the structural properties of P-113. Our results indicate that using hG31P as a fusion protein to obtain large quantities of P-113 is feasible and is easy to scale up for commercial production. An effective way of producing enough P-113 for future clinical studies is evident in this study.

9 CFR 113.102 - Leptospira Icterohaemorrhagiae Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Icterohaemorrhagiae... REQUIREMENTS Inactivated Bacterial Products § 113.102 Leptospira Icterohaemorrhagiae Bacterin. Leptospira Icterohaemorrhagiae Bacterin shall be produced from a culture of Leptospira icterohaemorrhagiae which has been...

Influence of ionic complexation on release rate profiles from multiple water-in-oil-in-water (W/O/W) emulsions.

Science.gov (United States)

Bonnet, Marie; Cansell, Maud; Placin, Frédéric; David-Briand, Elisabeth; Anton, Marc; Leal-Calderon, Fernando

2010-07-14

Water-in-oil-in-water (W/O/W) double emulsions were prepared, and the kinetics of release of magnesium ions from the internal to the external water phase was followed. Different chelating agents (phosvitin and gluconate) were used to bind magnesium within the prospect of improving the ion retention in the internal aqueous droplets. Magnesium release was monitored for 1 month of storage, for each formulation, with and without chelation, at two storage temperatures (4 and 25 degrees C). Leakage occurred without film rupturing (coalescence) and was mainly due to entropically driven diffusion/permeation phenomena. The experimental results revealed a clear correlation between the effectiveness of chelating agents to delay the delivery and their binding capacity characterized by the equilibrium affinity constant. The kinetic data (percent released versus time curves) were interpreted within the framework of a kinetic model based on diffusion and taking into account magnesium chelation.

Well-Defined Surface Species [(≡Si - O -)W(=O)Me3] Prepared by Direct Methylation of [(≡Si - O -)W(=O)Cl3], a Catalyst for Cycloalkane Metathesis and Transformation of Ethylene to Propylene

KAUST Repository

Hamieh, Ali Imad Ali

2015-04-03

The silica-supported tungsten oxo-trimethyl complex [(≡Si - O -)W(=O)Me3] was synthesized using a novel SOMC synthetic approach. By grafting the inexpensive stable compound WOCl4 on the surface of silica, partially dehydroxylated at 700 °C (SiO2-700), a well-defined monopodal surface complex [(≡Si - O -)W(=O)Cl3] was produced. The supported complex directly methylated with ZnMe2 and transformed into [(≡Si - O -)W(=O)Me3], which we fully characterized by microanalysis, IR, mass balance and SS NMR (1H, 13C, 1H-13C HETCOR, 1H-1H DQ and TQ). [(≡Si - O)W(=O)Me3] has two conformational isomers on the surface at room temperature. The conversion of one to the other was observed at 318 K by variable-temperature 13C CP/MAS and 1H spin echo MAS solid-state NMR; this was also confirmed by NMR and DFT calculations. [(≡Si - O)W(=O)Me3] was found to be active in cyclooctane metathesis and to have a wide distribution range in ring-contracted and ring-expanded products. In addition, [(≡Si - O)W(=O)Me3] proved to be highly active for selective transformation of ethylene to propylene compared to other silica-supported organometallic complexes. (Chemical Equation Presented). © 2015 American Chemical Society.

Well-Defined Surface Species [(≡Si - O -)W(=O)Me3] Prepared by Direct Methylation of [(≡Si - O -)W(=O)Cl3], a Catalyst for Cycloalkane Metathesis and Transformation of Ethylene to Propylene

KAUST Repository

Hamieh, Ali Imad Ali; Chen, Yin; Abdel-Azeim, Safwat; Abou-Hamad, Edy; Goh, Li Min Serena; Samantaray, Manoja; Dey, Raju; Cavallo, Luigi; Basset, Jean-Marie

2015-01-01

The silica-supported tungsten oxo-trimethyl complex [(≡Si - O -)W(=O)Me3] was synthesized using a novel SOMC synthetic approach. By grafting the inexpensive stable compound WOCl4 on the surface of silica, partially dehydroxylated at 700 °C (SiO2-700), a well-defined monopodal surface complex [(≡Si - O -)W(=O)Cl3] was produced. The supported complex directly methylated with ZnMe2 and transformed into [(≡Si - O -)W(=O)Me3], which we fully characterized by microanalysis, IR, mass balance and SS NMR (1H, 13C, 1H-13C HETCOR, 1H-1H DQ and TQ). [(≡Si - O)W(=O)Me3] has two conformational isomers on the surface at room temperature. The conversion of one to the other was observed at 318 K by variable-temperature 13C CP/MAS and 1H spin echo MAS solid-state NMR; this was also confirmed by NMR and DFT calculations. [(≡Si - O)W(=O)Me3] was found to be active in cyclooctane metathesis and to have a wide distribution range in ring-contracted and ring-expanded products. In addition, [(≡Si - O)W(=O)Me3] proved to be highly active for selective transformation of ethylene to propylene compared to other silica-supported organometallic complexes. (Chemical Equation Presented). © 2015 American Chemical Society.

Ekspansja muzeów w Europie Środkowej?

Directory of Open Access Journals (Sweden)

Jagodzińska, Katarzyna

2015-06-01

Full Text Available Przedmiotem artykułu są rozważania na temat specyfiki Europy Środkowej w zakresie kolekcji i muzeów sztuki współczesnej oraz możliwość stworzenia alternatywy regionalnej dla krajów zachodnich. Kontekstem dla tych rozważań jest ekspansjonistyczna polityka współczesnych muzeów, która w związku z licznymi nowymi inwestycjami – w szczególności Luwru, Fundacji Guggenheima, Ermitażu – budzi w świecie muzeologicznym różnorakie dylematy. Autorka omawia światowe "marki muzealne" inwestujące w Europie Środkowej, zastanawia się nad skutkami ekspansji tych "koncernów" dla kultury w regionie, wskazuje też na potencjał regionu, który można wykorzystać bez posiłkowania się nazwiskami światowych kolekcjonerów.

9 CFR 113.452 - Erysipelothrix Rhusiopathiae Antibody.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Antibody... REQUIREMENTS Antibody Products § 113.452 Erysipelothrix Rhusiopathiae Antibody. Erysipelothrix Rhusiopathiae Antibody is a specific antibody product containing antibodies directed against one or more somatic antigens...

Silver Cation Coordination Study to AsW9 Ligand – A Trilacunar Arsenotungstate Compound

Directory of Open Access Journals (Sweden)

Berta Lavinia

2017-06-01

Full Text Available Objective: The main objective of this research is to find the coordination ratio between AsW9 and Ag+, as a preliminary study for synthesizing a new silver-arsenotungstate complex. Material and method: The ligand:cation molar ratio in complexes was determined by conductometric and potentiometric titrations of AsW9 with silver salts: CH3COOAg, AgNO3. Results: The ratio was obtained from the inflexion points of the curves when molar ratio was plotted versus conductivity, or from the equivalence point when silver added volume was plotted versus pH value. Each graphic shows one point of inflexion corresponding to 1:1.54 ratio of AsW9:Ag+. In the same manner, the equivalent volumes determined by graphical method gave the ratio 1:1.53. The spectral results confirmed that a AsW9:Ag+ complex was formed since the ligand absorption maxima values have been changed from 190 nm to 197 nm in the case of using AgNO3 and 196 nm for CH3COOAg corresponding to the W=Od bond, and from 246.5 nm to 274 nm (AgNO3 and 270 nm (CH3COO-Ag+ for the W-Ob,c-W bond. Conclusions: Silver cation exhibit a preference for AsW9 in a ratio of 3 to 2. This ratio can be associated to a sandwich type arrangement, with two trilacunary Keggin building blocks incorporating 3 metal cations in a tetrahedral geometry.

Review of the Properties of the W Boson at LEP, and the Precision Determination of its Mass

CERN Document Server

Ströhmer, R

2003-01-01

We review the precision measurement of the mass and couplings of the W Boson at LEP. The total and differential W+W- cross section is used to extract the WWZ and WWgamma couplings. We discuss the techniques used by the four LEP experiments to determine the W mass in different decay channels, and present the details of methods used to evaluate the sources of systematic uncertainty.

113Cd-NMR investigation of a cadmium-substituted copper, zinc-containing superoxide dismutase from yeast

DEFF Research Database (Denmark)

Kofod, Pauli; Bauer, Rogert; Danielsen, Eva

1991-01-01

113Cd nuclear magnetic resonance spectroscopy has been used to investigate the metal binding sites of cadmium-substituted copper,zinc-containing superoxide dismutase from baker's yeast. NMR signals were obtained for 113Cd(II) at the Cu site as well as for 113Cd(II) at the Zn site. The two subunits...

Higher-spin extended conformal algebras and W-gravities

International Nuclear Information System (INIS)

Hull, C.M.

1991-01-01

The construction of classical W 3 gravity is reviewed. It is suggested that the hidden symmetry for quantum W 3 gravity in the chiral gauge is not SL(3, R) but a group contraction of this, ISL(2, R). This is extended to W N gravity, and the case of W 4 gravity is presented in detail. The gauge transformations are realized on D free bosons, with the spin-n conserved current (2 ≤ n ≤ N) taking the form d sub(i i ...i n ) δ + Φ sup(i 1 ) δ + Φ sup(i n ) for some constant tensor d sub(i i ...i n ). The d-tensors must satisfy N-2 non-linear algebraic constraints and these constraints are shown to be satisfied if the d-tensors are taken to be the structure-tensors of an Nth degree Jordan algebra. The relation with Jordan algebras is used to give solutions of the d-tensor constraints for any value of D, N. The free-boson construction of the W N algebras is generalized to give a Sugaware-type construction of a large class of classical extended conformal algebras. The chiral gauging of any classical extended conformal algebra is shown to require only a linear Noether coupling to world-sheet gauge-fields, while gauging a non-chiral algebra in general leads to a non-polynomial action. A number of examples are examined, including W ∞ W-supergravity, Knizhnik-Berschadsky supergravity and 'W N/M ' algebras. Theories of higher-spin W-gravity of the type described are only possible in one and two space-time dimensions, and the one-dimensional cases is briefly discussed. The covariant formulation of W-gravity is briefly discussed and the relation between classical and quantum extended conformal algebras is analyzed. (orig.)

Deactivation of the EBR-II complex

International Nuclear Information System (INIS)

Michelbacher, J.A.; Earle, O.K.; Henslee, S.P.; Wells, P.B.; Zahn, T.P.

1996-01-01

In January of 1994, the Department of Energy mandated the termination of the Integral Fast Reactor (IFR) Program, effective October 1, 1994. To comply with this decision, Argonne National Laboratory-West (ANL-W) prepared a plan providing detailed requirements to place the Experimental Breeder Reactor-II (EBR-II) in a radiologically and industrially safe condition, including removal of all irradiated fuel assemblies from the reactor plant, and removal and stabilization of the primary and secondary sodium, a liquid metal used to transfer heat within the reactor plant. The ultimate goal of the deactivation process is to place the EBR-II complex in a stable condition until a decontamination and decommissioning (D and D) plan can be prepared, thereby minimizing requirements for maintenance and surveillance and maximizing the amount of time for radioactive decay. The final closure state will be achieved in full compliance with federal, state and local environmental, safety, and health regulations and requirements. The decision to delay the development of a detailed D and D plan has necessitated this current action

Deactivation of the EBR-II complex

Energy Technology Data Exchange (ETDEWEB)

Michelbacher, J A; Earle, O K; Henslee, S P; Wells, P B; Zahn, T P

1996-01-01

In January of 1994, the Department of Energy mandated the termination of the Integral Fast Reactor (IFR) Program, effective October 1, 1994. To comply with this decision, Argonne National Laboratory-West (ANL-W) prepared a plan providing detailed requirements to place the Experimental Breeder Reactor-II (EBR-II) in a radiologically and industrially safe condition, including removal of all irradiated fuel assemblies from the reactor plant, and removal and stabilization of the primary and secondary sodium, a liquid metal used to transfer heat within the reactor plant. The ultimate goal of the deactivation process is to place the EBR-II complex in a stable condition until a decontamination and decommissioning (D and D) plan can be prepared, thereby minimizing requirements for maintenance and surveillance and maximizing the amount of time for radioactive decay. The final closure state will be achieved in full compliance with federal, state and local environmental, safety, and health regulations and requirements. The decision to delay the development of a detailed D and D plan has necessitated this current action.

Non-local matrix generalizations of W-algebras

International Nuclear Information System (INIS)

Bilal, A.

1995-01-01

There is a standard way to define two symplectic (hamiltonian) structures, the first and second Gelfand-Dikii brackets, on the space of ordinary m th -order linear differential operators L=-d m +U 1 d m-1 +U 2 d m-2 +..+U m . In this paper, I consider in detail the case where the U k are nxn-matrix-valued functions, with particular emphasis on the (more interesting) second Gelfand-Dikii bracket. Of particular interest is the reduction to the symplectic submanifold U 1 =0. This reduction gives rise to matrix generalizations of (the classical version of) the non-linear W m -algebras, called V n,m -algebras. The non-commutativity of the matrices leads to non-local terms in these V n,m -algebras. I show that these algebras contain a conformal Virasoro subalgebra and that combinations W k of the U k can be formed that are nxn-matrices of conformally primary fields of spin k, in analogy with the scalar case n=1. In general however, the V m,n -algebras have a much richer structure than the W m -algebras as can be seen on the examples of the non-linear and non-local Poisson brackets {(U 2 ) ab (σ),(U 2 ) cd (σ')}, {(U 2 ) ab (σ),(W 3 ) cd (σ')} and {(W 3 ) ab (σ),(W 3 ) cd (σ')} which I work out explicitly for all m and n. A matrix Miura transformation is derived, mapping these complicated (second Gelfand-Dikii) brackets of the U k to a set of much simpler Poisson brackets, providing the analogue of the free-field representation of the W m -algebras. (orig.)

Production of W + W - pairs via γ * γ * → W + W - subprocess with photon transverse momenta

Science.gov (United States)

Łuszczak, Marta; Schäfer, Wolfgang; Szczurek, Antoni

2018-05-01

We discuss production of W + W - pairs in proton-proton collisions induced by two-photon fusion including, for a first time, transverse momenta of incoming photons. The unintegrated inelastic fluxes (related to proton dissociation) of photons are calculated based on modern parametrizations of deep inelastic structure functions in a broad range of their arguments ( x and Q 2). In our approach we can get separate contributions of different W helicities states. Several one- and two-dimensional differential distributions are shown and discussed. The present results are compared to the results of previous calculations within collinear factorization approach. Similar results are found except of some observables such as e.g. transverse momentum of the pair of W + and W -. We find large contributions to the cross section from the region of large photon virtualities. We show decomposition of the total cross section as well as invariant mass distribution into the polarisation states of both W bosons. The role of the longitudinal F L structure function is quantified. Its inclusion leads to a 4-5% decrease of the cross section, almost independent of M WW .

Zmienność zasobów termicznych w Polsce w aspekcie obserwowanych zmian klimatu

Directory of Open Access Journals (Sweden)

Agnieszka Sulikowska

2016-06-01

Full Text Available Obserwowany wzrost temperatury powietrza na półkuli północnej, zwłaszcza w Europie, może prowadzić do znacznych zmian w fenologii roślin, a w konsekwencji także w produkcji rolnej. Celem pracy jest ocena zróżnicowania przestrzennego zasobów termicznych na obszarze Polski oraz ich zmienności w okresie 1951–2010 w obliczu zmieniających się warunków termicznych. Analizę przeprowadzono z wykorzystaniem dobowych wartości temperatury powietrza. Zasoby termiczne zdefiniowane zostały za pomocą sum temperatur efektywnych (Growing Degree Days – GDD obliczonych dla wartości progowych temperatury powietrza: 0°C, 5°C i 10°C. Następstwem analizy zróżnicowania przestrzennego zasobów termicznych była ocena ich zmienności wieloletniej oraz tendencji zmian. Badania objęły w szczególności regiony sadownicze odznaczające się największą powierzchnią upraw drzew owocowych oraz wielkością zbiorów jabłek, śliw i wiśni. Uzyskane wyniki potwierdzają zwiększenie zasobów termicznych na obszarze kraju, będące konsekwencją wydłużającego się okresu wegetacyjnego.

Obituary Dr A. W. Kloos (1880—1952)

NARCIS (Netherlands)

Ooststroom, van S.J.

1952-01-01

At the end of the previous number of “Blumea” could just be inserted the death notice of one of the honorary collaborators of the Rijksherbarium, Dr Ir A. W. Kloos, who passed away in his home at Dordrecht on June 3rd, 1952. A more detailed obituary may follow here. Abraham Willem Kloos was born at

Clonal replacement and expansion among invasive meningococcal isolates of serogroup W in France.

Science.gov (United States)

Hong, Eva; Barret, Anne-Sophie; Terrade, Aude; Denizon, Mélanie; Antona, Denise; Aouiti-Trabelsi, Myriam; Deghmane, Ala-Eddine; Parent du Châtelet, Isabelle; Levy-Bruhl, Daniel; Taha, Muhamed-Kheir

2018-02-01

Neisseria meningitidis group W (NmW) belonging to the clonal complex ST-11 (NmW/cc11) spread in Europe and in France in 2000 and declined thereafter. In France, invasive meningococcal disease (IMD) due to NmW increased again in 2012 and thereafter since 2015. Several sub-lineages of NmW/cc11 are circulating worldwide with successive epidemic waves. We aimed to describe recent epidemiological trends of NmW in France and to explore the microbiological and epidemiological characteristics associated with different NmW/cc11 sub-lineages. The epidemiology of NmW was described based on data collected through mandatory notification of IMD and strain typing data for culture-confirmed and PCR-confirmed cases for the period 2000-2016. All culture-confirmed cases due to NmW from the period 2010-2016 were characterised by whole genome sequencing (WGS). A detailed epidemiological analysis was performed for culture-confirmed cases on the basis of WGS data. During the period 2010-2016, genotyping was obtained for 148 cases including all the 132 culture-confirmed cases, among which 127 were matched with epidemiological data, and 16 PCR-confirmed cases (out of a total of 47 PCR-confirmed cases). An increase in IMD was observed in 2012 and was linked to isolates belonging to the "Anglo-French-Hajj" sub-lineage. These isolates have decreased significantly since 2013 and have been replaced by NmW/cc11 isolates related to the "South American - UK" sub-lineage which caused a marked increase in the number of cases of NmW in 2016. In this sub-lineage, the "original UK strain" was first detected in 2012 and increased thereafter, followed by the recently described "UK 2013-strain". Isolates related to the "South American-UK" sub-lineage represented 45% of all NmW cultured isolates from the whole period 2010-2016 but were the most frequent isolates in 2016, representing 76% of the total NmW typed isolates and 94% of the typed NmW/cc11 isolates. A changing pattern in the epidemiology of NmW

21 CFR 56.113 - Suspension or termination of IRB approval of research.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Suspension or termination of IRB approval of research. 56.113 Section 56.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... termination of IRB approval of research. An IRB shall have authority to suspend or terminate approval of...

21 CFR 113.83 - Establishing scheduled processes.

Science.gov (United States)

2010-04-01

... commercial production runs should be determined on the basis of recognized scientific methods to be of a size... CONTAINERS Production and Process Controls § 113.83 Establishing scheduled processes. Scheduled processes for... production shall be adequately provided for in establishing the scheduled process. Critical factors, e.g...

9 CFR 113.328 - Fowl Laryngotracheitis Vaccine.

Science.gov (United States)

2010-01-01

... REQUIREMENTS Live Virus Vaccines § 113.328 Fowl Laryngotracheitis Vaccine. Fowl Laryngotracheitis Vaccine shall be prepared from virus-bearing cell culture fluids or embryonated chicken eggs. Only Master Seed... each serial of modified live virus vaccine shall be tested for safety as provided in this paragraph...

Doświadczalna analiza współczynników oporów lokalnych na kolankach w systemach przewodów wielowarstwowych

Directory of Open Access Journals (Sweden)

Natalia Krystyna Gietka

2015-03-01

Full Text Available Zastosowanie tworzyw sztucznych jako materiału do budowy instalacji wymusiło konieczność weryfikacji dostępnych obecnie informacji dotyczących wartości współczynników oporów lokalnych, które stanowią niezbędną wiedzę potrzebną do obliczania wartości strat energii mechanicznej, jakie powstają w trakcie przepływu. Współczynniki te mają duże znaczenie w obliczeniach hydraulicznych wymiarowanej instalacji. Wpływają one na końcowy wynik w istotny sposób, dlatego nieprawidłowe ich przyjęcie może prowadzić do poważnych w skutkach błędów. Niestety wartości podawane przez producentów, normy czy też literaturę są inne w porównaniu z wartościami uzyskiwanymi metodą doświadczalnych badań. W artykule zaprezentowane zostały wyniki badań doświadczalnych, mających na celu wyznaczenie wartości współczynników oporów lokalnych na kolankach 90° trzech określonych średnic, pochodzących od czterech wybranych producentów systemów instalacyjnych. Otrzymane wartości współczynników oporów lokalnych porównano z wartościami, jakie podawane są przez producenta złączek, wyznaczonymi według normy PN-76/M-34034: 1976 oraz dostępnymi w literaturze przedmiotu.

Hydrothermal alteration in oceanic ridge volcanics: A detailed study at the Galapagos Fossil Hydrothermal Field

Science.gov (United States)

Ridley, W.I.; Perfit, M.R.; Josnasson, I.R.; Smith, M.F.

1994-01-01

The Galapagos Fossil Hydrothermal Field is composed of altered oceanic crust and extinct hydrothermal vents within the eastern Galapagos Rift between 85??49???W and 85??55???W. The discharge zone of the hydrothermal system is revealed along scarps, thus providing an opportunity to examine the uppermost mineralized, and highly altered interior parts of the crust. Altered rocks collected in situ by the submersible ALVIN show complex concentric alteration zones. Microsamples of individual zones have been analysed for major/minor, trace elements, and strontium isotopes in order to describe the complex compositional details of the hydrothermal alteration. Interlayered chlorite-smectite and chlorite with disequilibrium compositions dominate the secondary mineralogy as replacement phases of primary glass and acicular pyroxene. Phenocrysts and matrix grains of plagioclase are unaffected during alteration. Using a modification of the Gresens' equation we demonstrate that the trivalent rare earth elements (REEs) are relatively immobile, and calculate degrees of enrichment and depletion in other elements. Strontium isotopic ratios increase as Sr concentrations decrease from least-altered cores to most-altered rims and cross-cutting veins in individual samples, and can be modeled by open system behaviour under low fluid-rock ratio (< 10) conditions following a period of lower-temperature weathering of volcanics within the rift zone. The complex patterns of element enrichment and depletion and strontium isotope variations indicate mixing between pristine seawater and ascending hot fluids to produce a compositional spectrum of fluids. The precipitation of base-metal sulfides beneath the seafloor is probably a result of fluid mixing and cooling. If, as suggested here, the discharge zone alteration occurred under relatively low fluid-rock ratios, then this shallow region must play an important role in determining the exit composition of vent fluids in marine hydrothermal systems

Influence of Polycarboxylate Superplasticizers on Rheological Properties of Cement Slurries Used in Drilling Technologies / Wpływ Superplastyfikatorów Z Grupy Polikarboksylanów Na Właściwości Reologiczne Zaczynów Cementowych Stosowanych W Technologiach Wiertniczych

Science.gov (United States)

Stryczek, Stanisław; Wiśniowski, Rafał; Gonet, Andrzej; Złotkowski, Albert; Ziaja, Jan

2013-09-01

Sealing slurries, mainly the cement-based ones, are concentrated dispersive systems, containing solid particles of considerably developed specific surface. Rheologically, such systems are very complex. This also stems from the fact that the rheological properties have a significant effect on: • additives and admixtures modifying technological properties of fresh and set slurries, • chemically complex mechanism of hydration in a slurry in a function of time. Special attention should paid to plasticizing (plasticizers PL) and liquefying (traditional and new- -generation superplasticizers SP) admixtures affecting the modification and optimization of rheological properties of fresh cement slurries as far as providing efficiency of sealing of casing pipes is concerned. Laboratory analyses were focused on proving the following thesis: properly selected type of superplasticizer [by BASF Polska Sp.z o.o. (The Chemical Company) - Admixtures for Concrete Division] advantageously affects the rheological parameters of sealing slurry based on metallurgical cement CEM III /A 32,5. The following variables were used in the analyses: • type of superplasticizer, • type of batch fluid. The laboratory experiments were made on superplasticizers produced by BASF: • SKY 501, • SKY 503, • SKY 591, • ACE 430, • Glenium 115. The superplasticizer concentration in the slurry was 0.5 wt% (as compared with mass of dry cement). Water to cement ratio for the analyzed sealing slurries was equal to 0.5. The sealing slurries were made of metallurgical cement CEM III/A 32,5 N-LH/HSR/N Lafarge Cement S.A. in Małogoszcz. Zaczyny uszczelniające, a zwłaszcza typu cementowego, są skoncentrowanymi układami dyspersyjnymi, zawierającymi cząstki stałe o znacznie rozwiniętej powierzchni właściwej. Układy takie pod względem reologicznym należą do niezwykle złożonych. Wynika to między innymi z faktu, że na właściwości reologiczne w sposób istotny wpływają: • dodatki i

75 FR 38179 - Proposed Collection; Comment Request for Forms W-8BEN, W-8ECI, W-8EXP, and W-8IMY

Science.gov (United States)

2010-07-01

... W-8BEN, W-8ECI, W- 8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice... soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8ECI, Certificate of Foreign Person's Claim for Exemption From Withholding...

Generator 113Sn- 113mIn. Study of the most important characteristics in the evaluate composition for the preparation of clinical labelled compounds

International Nuclear Information System (INIS)

Adan, L.; Rebollo, D. V.

1978-01-01

The design for the construction of a generator 113 S n -113m l n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs

A Study of $W^{+}W^{-}\\gamma$ Events at LEP

CERN Document Server

Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, Akos; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Kramer, T; Krieger, P; Von Krogh, J; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

2004-01-01

A study of W+W- events accomanied by hard photon radiation produced in e+e- collisions at LEP is presented. Events consistent with being two on-shell W bosons and an isolated photon are selected from 681 pb^-1 of data recorded at 180 GeV < sqrt(s) < 209 GeV. For these data , 187 W+W- candidates are selected with photon energies greater than 2.5 GeV. The selected events are used to determine the W+ W- gamma cross section at five values of sqrt(s). The results are consistent with the Standard Model expectation. These data provide constraints on the related O(alpha) systematic uncertainties on the measurement of the W boson mass at LEP. Finally, the data are used to derive 95% C.L. upper limits on possible anomalous contributions to the W+ W- gamma gamma and W+ W- Z0 gamma vertices.

W-320 Project thermal modeling

Energy Technology Data Exchange (ETDEWEB)

Sathyanarayana, K., Fluor Daniel Hanford

1997-03-18

This report summarizes the results of thermal analysis performed to provide a technical basis in support of Project W-320 to retrieve by sluicing the sludge in Tank 241-C-106 and to transfer into Tank 241-AY-102. Prior theraml evaluations in support of Project W-320 safety analysis assumed the availability of 2000 to 3000 CFM, as provided by Tank Farm Operations, for tank floor cooling channels from the secondary ventilation system. As this flow availability has no technical basis, a detailed Tank 241-AY-102 secondary ventilation and floor coating channel flow model was developed and analysis was performed. The results of the analysis show that only about 150 cfm flow is in floor cooLing channels. Tank 241-AY-102 thermal evaluation was performed to determine the necessary cooling flow for floor cooling channels using W-030 primary ventilation system for different quantities of Tank 241-C-106 sludge transfer into Tank 241-AY-102. These sludge transfers meet different options for the project along with minimum required modification of the ventilation system. Also the results of analysis for the amount of sludge transfer using the current system is presented. The effect of sludge fluffing factor, heat generation rate and its distribution between supernatant and sludge in Tank 241-AY-102 on the amount of sludge transfer from Tank 241-C-106 were evaluated and the results are discussed. Also transient thermal analysis was performed to estimate the time to reach the steady state. For a 2 feet sludge transfer, about 3 months time will be requirad to reach steady state. Therefore, for the purpose of process control, a detailed transient thermal analysis using GOTH Computer Code will be required to determine transient response of the sludge in Tank 241-AY-102. Process control considerations are also discussed to eliminate the potential for a steam bump during retrieval and storage in Tanks 241-C-106 and 241-AY-102 respectively.

Spinor Field Realizations of Non-critical $W_{2,s}$ Strings

OpenAIRE

Duan, Yi-Shi; Liu, Yu-Xiao; Zhang, Li-Jie

2005-01-01

In this paper, we construct the nilpotent Becchi-Rouet-Stora-Tyutin($BRST$) charges of spinor non-critical $W_{2,s}$ strings. The cases of $s=3,4$ are discussed in detail, and spinor realization for $s=4$ is given explicitly. The $BRST$ charges are graded.

Spinor field realizations of non-critical W2,s strings

International Nuclear Information System (INIS)

Duan, Y.S.; Liu, Y.X.; Zhang, L.J.

2004-01-01

In this paper, we construct the nilpotent Becchi-Rouet-Stora-Tyutin (BRST) charges of spinor non-critical W2,s strings. The cases of s=3,4 are discussed in detail, and spinor realization for s=4 is given explicitly. The BRST charges are graded

25 CFR 39.113 - What are the special accountability requirements for the gifted and talented program?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false What are the special accountability requirements for the gifted and talented program? 39.113 Section 39.113 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE... Talented Programs § 39.113 What are the special accountability requirements for the gifted and talented...

7 CFR 4287.113 - Release of collateral.

Science.gov (United States)

2010-01-01

... Loans § 4287.113 Release of collateral. (a) All releases of collateral with a value exceeding $100,000... loan. The Agency may, at its discretion, require an appraisal of the remaining collateral in cases... (a) of this section, lenders may, over the life of the loan, release collateral (other than personal...

Reactivity of solvent alcohol on degradation of CFC113

International Nuclear Information System (INIS)

Nakagawa, Seiko

2003-01-01

1,1,2-Trichloro-trifluoroethane (CFC113) was dissolved in alkaline 1-butanol, 2-butanol, iso-butyl alcohol, and phenyl ethyl alcohol and irradiated with 60 Co gamma rays after purged with pure nitrogen gas. In all these solvents, the concentration of CFC113 and hydroxide ion decreased and that of chloride ion increased with a dose observed in 2-propanol solution. The reaction efficiency increases in order of 1-butanol< iso-butyl alcohol< phenyl ethyl alcohol<2-butanol<2-propanol. The solvent effect will depend on the binding energy of the αC-H of the alcohol molecule and electron affinity and dipole moment of the ketones or aldehydes produced from the alcohols

Physical properties of W gravities and W strings

International Nuclear Information System (INIS)

Das, S.R.; Dhar, A.; Rama, S.K.

1991-01-01

This paper investigates some basic physical properties of W gravities and W strings, using a free field realization. The authors argue that the configuration space of W gravities have global characteristics in addition to the Euler characteristic. The authors identify one such global quantity to be a monopole charge and show how this charge appears in the exponents. The free energy would then involve a θ parameter. Using a BRST procedure the authors find all the physical states of W 3 and W 4 gravities, and show that physical operators are nonsingular composites of the screening charge operators. (The latter are not physical operators for N ≥ 3.) For W strings we show how the W constraints lead to the emergence of a single (and not many) extra dimension coming from the W-gravity sector. By analyzing the resulting dispersion relations the authors find that both the lower and upper critical dimensions are lowered compared to ordinary two-dimensional gravity. The pure W gravity spectrum reveals an intriguing numerological connection with unitary minimal models coupled to ordinary gravity

Spuścizny konserwatorów zbiorów, kierowników i dyrektorów Biblioteki Poznańskiego Towarzystwa Przyjaciół Nauk

Directory of Open Access Journals (Sweden)

Michał Boksa

2011-01-01

Full Text Available Artykuł prezentuje sylwetki konserwatorów zbiorów, kierowników i dyrektorów Biblioteki Poznańskiego Towarzystwa Przyjaciół Nauk (PTPN oraz to, co po nich pozostało w postaci archiwaliów. Od momentu powstania Biblioteka PTPN gromadziła rękopisy lub całe spuścizny wybitnych osób, w tym kierujących tą placówką. Również inne biblioteki i archiwa zakładowe instytucji, z którymi byli oni związani, włączały do swych zbiorów ich materiały archiwalne. Spuścizny Ludwiki Dobrzyńskiej-Rybickiej i Ryszarda Marciniaka znajdują się zarówno w Bibliotece PTPN, jak i w Polskiej Akademii Nauk Archiwum w Warszawie Oddział w Poznaniu. Znaczna część materiałów archiwalnych Bolesława Erzepkiego trafiła natomiast do Działu Zbiorów Specjalnych Biblioteki Raczyńskich w Poznaniu. Szczątkowe materiały archiwalne można też znaleźć w Archiwum Uniwersytetu im. Adama Mickiewicza w Poznaniu (Ludwika Dobrzyńska-Rybicka oraz w Archiwum Biblioteki Uniwersyteckiej w Poznaniu (Ludwika Dobrzyńska-Rybicka, Jan Baumgart, Aniela Koehlerówna.

Ground state properties of new element Z=113 and its alpha decay chain

International Nuclear Information System (INIS)

Tai Fei; Chen Dinghan; Xu Chang; Ren Zhongzhou

2005-01-01

The authors investigate the ground state properties of the new element 278 113 and of the α-decay chain with different models, where the new element Z=113 has been produced at RIKEN in Japan by cold-fusion reaction. The experimental decay energies are reproduced by the deformed relativistic mean-field model, by the Skyrme-Hartree-Fock (SHF) model, and by the macroscopic-microscopic model. Theoretical half-lives also reasonably agree with the data. Calculations further show that prolate deformation is important for the ground states of the nuclei in the α-decay chain of 278 113. The common points and differences among different models are compared and discussed. (author)

Planning for closure and deactivation of the EBR-II complex

International Nuclear Information System (INIS)

Michelbacher, J.A.; Henslee, S.P.; Poland, H.F.; Wells, P.B.

1997-01-01

In January 1994, DOE terminated the Integral Fast Reactor (IFR) Program. Argonne National Laboratory-West (ANL-W) prepared a detailed plan to put Experimental Breeder Reactor-II (EBR-II) in a safe condition, including removal of irradiated fueled subassemblies from the plant, transfer of subassemblies, and removal and stabilization of primary and secondary sodium liquid heat transfer metal. The goal of deactivation is to stabilize the EBR-II complex until decontamination and decommissioning (D ampersand D) is implemented, thereby minimizing maintenance and surveillance. Deactivation of a sodium cooled reactor presents unique concerns. Residual sodium in the primary and secondary systems must be either reacted or inerted to preclude concerns with explosive sodium-air reactions. Also, residual sodium on components will effectively solder these items in place, making removal unfeasible. Several special cases reside in the primary system, including primary cold traps, a cesium trap, a cover gas condenser, and systems containing sodium-potassium alloy. The sodium or sodium-potassium alloy in these components must be reacted in place or the components removed. The Sodium Components Maintenance Shop at ANL-W provides the capability for washing primary components, removing residual quantities of sodium while providing some decontamination capacity. Considerations need to be given to component removal necessary for providing access to primary tank internals for D ampersand D activities, removal of hazardous materials, and removal of stored energy sources. ANL-W's plan for the deactivation of EBR-II addresses these issues, providing for an industrially and radiologically safe complex, requiring minimal surveillance during the interim period between deactivation and D ampersand D. Throughout the deactivation and closure of the EBR-II complex, federal environmental concerns will be addressed, including obtaining the proper permits for facility condition and waste processing

Multi-kW single fiber laser based on an extra large mode area fiber design

Science.gov (United States)

Langner, Andreas; Such, Mario; Schötz, Gerhard; Just, Florian; Leich, Martin; Schwuchow, Anka; Grimm, Stephan; Zimer, Hagen; Kozak, Marcin; Wedel, Björn; Rehmann, Georg; Bachert, Charley; Krause, Volker

2012-02-01

The quality of Yb-doped fused bulk silica produced by sintering of Yb-doped fused silica granulates has improved greatly in the past five years [1 - 4]. In particular, the refractive index and doping level homogeneity of such materials are excellent and we achieved excellent background fiber attenuation of the active core material down to about 20 dB/km at 1200 nm. The improvement of the Yb-doped fused bulk silica has enabled the development of multi-kW fiber laser systems based on a single extra large multimode laser fiber (XLMA fiber). When a single active fiber is used in combination with the XLMA multimode fiber of 1200 μm diameter simple and robust high power fiber laser setups without complex fiber coupling and fiber combiner systems become possible. In this papper, we will discuss in detail the development of the core material based on Yb-doped bulk silica and the characterization of Yb-doped fibers with different core compositions. We will also report on the excellent performance of a 4 kW fiber laser based on a single XLMA-fiber and show the first experimental welding results of steel sheets achieved with such a laser.

Aerozoloterapia w praktyce zawodowej pielęgniarki pediatrycznej = Aerosolotherapy in professional practice pediatric nurse

Directory of Open Access Journals (Sweden)

Bogumiła Małecka

2016-08-01

any contribution of respiratory function of stress in the inspiration phase and is therefore widely used in pediatrics. The aim of the article is to present the proper techniques of nebulization. Lack of knowledge regarding nebulization techniques among both parents and medical personnel leads to errors that affect the therapeutic process. Widely understood development of medical science enforces continuous education not only health care workers, but as well   patients and their careers. Medication administration using aerosol therapy is complex and absolutely requires close cooperation between the child, parents and device based on detailed knowledge of the proper techniques of surgery.   Key words: nebulization, children, pediatric nurse, family.

Characterization of the genome of the dairy Lactobacillus helveticus bacteriophage {Phi}AQ113.

Science.gov (United States)

Zago, Miriam; Scaltriti, Erika; Rossetti, Lia; Guffanti, Alessandro; Armiento, Angelarita; Fornasari, Maria Emanuela; Grolli, Stefano; Carminati, Domenico; Brini, Elena; Pavan, Paolo; Felsani, Armando; D'Urzo, Annalisa; Moles, Anna; Claude, Jean-Baptiste; Grandori, Rita; Ramoni, Roberto; Giraffa, Giorgio

2013-08-01

The complete genomic sequence of the dairy Lactobacillus helveticus bacteriophage ΦAQ113 was determined. Phage ΦAQ113 is a Myoviridae bacteriophage with an isometric capsid and a contractile tail. The final assembled consensus sequence revealed a linear, circularly permuted, double-stranded DNA genome with a size of 36,566 bp and a G+C content of 37%. Fifty-six open reading frames (ORFs) were predicted, and a putative function was assigned to approximately 90% of them. The ΦAQ113 genome shows functionally related genes clustered together in a genome structure composed of modules for DNA replication/regulation, DNA packaging, head and tail morphogenesis, cell lysis, and lysogeny. The identification of genes involved in the establishment of lysogeny indicates that it may have originated as a temperate phage, even if it was isolated from natural cheese whey starters as a virulent phage, because it is able to propagate in a sensitive host strain. Additionally, we discovered that the ΦAQ113 phage genome is closely related to Lactobacillus gasseri phage KC5a and Lactobacillus johnsonii phage Lj771 genomes. The phylogenetic similarities between L. helveticus phage ΦAQ113 and two phages that belong to gut species confirm a possible common ancestral origin and support the increasing consideration of L. helveticus as a health-promoting organism.

ARP/wARP and molecular replacement: the next generation

International Nuclear Information System (INIS)

Cohen, Serge X.; Ben Jelloul, Marouane; Long, Fei; Vagin, Alexei; Knipscheer, Puck; Lebbink, Joyce; Sixma, Titia K.; Lamzin, Victor S.; Murshudov, Garib N.; Perrakis, Anastassis

2008-01-01

A systematic test shows how ARP/wARP deals with automated model building for structures that have been solved by molecular replacement. A description of protocols in the flex-wARP control system and studies of two specific cases are also presented. Automatic iterative model (re-)building, as implemented in ARP/wARP and its new control system flex-wARP, is particularly well suited to follow structure solution by molecular replacement. More than 100 molecular-replacement solutions automatically solved by the BALBES software were submitted to three standard protocols in flex-wARP and the results were compared with final models from the PDB. Standard metrics were gathered in a systematic way and enabled the drawing of statistical conclusions on the advantages of each protocol. Based on this analysis, an empirical estimator was proposed that predicts how good the final model produced by flex-wARP is likely to be based on the experimental data and the quality of the molecular-replacement solution. To introduce the differences between the three flex-wARP protocols (keeping the complete search model, converting it to atomic coordinates but ignoring atom identities or using the electron-density map calculated from the molecular-replacement solution), two examples are also discussed in detail, focusing on the evolution of the models during iterative rebuilding. This highlights the diversity of paths that the flex-wARP control system can employ to reach a nearly complete and accurate model while actually starting from the same initial information

Reagent' sets for the concentration of sup(99m)Tc and sup(113m)In

International Nuclear Information System (INIS)

Bianco de Salas, G.N.; Arciprete, J.; Mitta, A.E.A.

1976-10-01

A simple technique for the concentration of the eluates from 99 Mo/sup(99m)Tc and 113 Sn/sup(113m)In generators is described. The reagents' sets provided by the C.N.E.A. for the labelling of different radiopharmaceuticals can be used by only reducing their volumes proportionally. Both concentration techniques for Tc-99m and In-113m will be supplied to users as reagents' sets. (author) [es

Aspekt formalnoprawny stosowania systemów ustalania lokalizacji w czasie rzeczywistym do eliminacji marnotrawstwa w procesie budowlanym

Directory of Open Access Journals (Sweden)

Piotr Nowotarski

2017-06-01

Full Text Available W artykule przedstawiono ideę systemów typu RTLS pod kątem wykorzystania ich w celu eliminacji marnotrawstwa w procesie budowlanym. Opisywane systemy z punktu widzenia strumienia wartości są pomocne w wykrywaniu czynności niedodających wartości. Autorzy przedstawili temat w aspekcie formalno-prawnym związanym z monitorowaniem i śledzeniem pracowników podczas pracy. Zwrócono uwagę na niezbędne dokumenty, pozwolenia, zgłoszenia i zgody pracowników, które zgodnie z obowiązującym w Polsce prawem należy posiadać, aby móc wykorzystywać tego typu systemy do zbierania i przetwarzania danych o lokalizacji pracowników w trakcie wykonywania prac.

Design study of wind turbines, 50 kW to 3000 kW for electric utility applications: Executive summary

Science.gov (United States)

1977-01-01

Preliminary designs of low power (50 to 500 kW) and high power (500 to 3000 kW) wind generator systems (WGS) for electric utility applications were developed. These designs provide the bases for detail design, fabrication, and experimental demonstration testing of these units at selected utility sites. Several feasible WGS configurations were evaluated, and the concept offering the lowest energy cost potential and minimum technical risk for utility applications was selected. The selected concept was optimized utilizing a parametric computer program prepared for this purpose. The utility requirements evaluation task examined the economic, operational and institutional factors affecting the WGS in a utility environment, and provided additional guidance for the preliminary design effort. Results of the conceptual design task indicated that a rotor operating at constant speed, driving an AC generator through a gear transmission is the most cost effective WGS configuration.

In vivo red blood cell compatibility testing using indium-113m tropolone-labeled red blood cells

International Nuclear Information System (INIS)

Morrissey, G.J.; Gravelle, D.; Dietz, G.; Driedger, A.A.; King, M.; Cradduck, T.D.

1988-01-01

In vivo radionuclide crossmatch is a method for identifying compatible blood for transfusion when allo- or autoantibodies preclude the use of conventional crossmatching techniques. A technique for labeling small volumes of donor red blood cells with [/sup 113m/In]tropolone is reported. The use of /sup 113m/In minimizes the accumulation of background radioactivity and the radiation dose especially so when multiple crossmatches are performed. Labeling red cells with [/sup 113m/In]tropolone is faster and easier to perform than with other radionuclides. Consistently high labeling efficiencies are obtained and minimal /sup 113m/In activity elutes from the labeled red blood cells. A case study involving 22 crossmatches is presented to demonstrate the technique. The radiation dose equivalent from /sup 113m/In is significantly less than with other radionuclides that may be used to label red cells

Preparation and evaluation of a self-nanoemulsifying drug delivery system loaded with Akebia saponin D–phospholipid complex

Science.gov (United States)

Shen, Jinyang; Bi, Jianping; Tian, Hongli; Jin, Ye; Wang, Yuan; Yang, Xiaolin; Yang, Zhonglin; Kou, Junping; Li, Fei

2016-01-01

Background Akebia saponin D (ASD) exerts various pharmacological activities but with poor oral bioavailability. In this study, a self-nanoemulsifying drug delivery system (SNEDDS) based on the drug–phospholipid complex technique was developed to improve the oral absorption of ASD. Methods ASD–phospholipid complex (APC) was prepared using a solvent-evaporation method and characterized by infrared spectroscopy, differential scanning calorimetry, morphology observation, and solubility test. Oil and cosurfactant were selected according to their ability to dissolve APC, while surfactant was chosen based on its emulsification efficiency in SNEDDS. Pseudoternary phase diagrams were constructed to determine the optimized APC-SNEDDS formulation, which was characterized by droplet size determination, zeta potential determination, and morphology observation. Robustness to dilution and thermodynamic stability of optimized formulation were also evaluated. Subsequently, pharmacokinetic parameters and oral bioavailability of ASD, APC, and APC-SNEDDS were investigated in rats. Results The liposolubility significantly increased 11.4-fold after formation of APC, which was verified by the solubility test in n-octanol. Peceol (Glyceryl monooleate [type 40]), Cremophor® EL (Polyoxyl 35 castor oil), and Transcutol HP (Diethylene glycol monoethyl ether) were selected as oil, surfactant, and cosurfactant, respectively. The optimal formulation was composed of Glyceryl monooleate (type 40), Polyoxyl 35 castor oil, Diethylene glycol monoethyl ether, and APC (1:4.5:4.5:1.74, w/w/w/w), which showed a particle size of 148.0±2.7 nm and a zeta potential of −13.7±0.92 mV after dilution with distilled water at a ratio of 1:100 (w/w) and good colloidal stability. Pharmacokinetic studies showed that APC-SNEDDS exhibited a significantly greater Cmax1 (733.4±203.8 ng/mL) than ASD (437.2±174.2 ng/mL), and a greater Cmax2 (985.8±366.6 ng/mL) than ASD (180.5±75.1 ng/mL) and APC (549.7±113

Bose-Einstein correlations in W+ W- events at LEP2

CERN Document Server

van Dalen, Jorn A

2000-01-01

Analyses of Bose-Einstein Correlations in w+w- events at LEP2 by the four LEP collaborations are presented. In particular, Bose-Einstein correlations in w+w- overlap are investigated and the possible existence of these correlations between particles coming from different W's, which may influence the W mass measurements in the fully-hadronic channel e+e- --+ w+w- --+ qiihq3ij<. No evidence for such an inter-W Bose-Einstein correlation is found by L3 and ALEPH. Possible indication of these correlations by DELPHI is mentioned.

Cleaner combustion developing detailed chemical kinetic models

CERN Document Server

Battin-Leclerc, Frédérique; Simmie, John M

2013-01-01

This book describes the reactive chemistry of minor pollutants within extensively validated detailed mechanisms for traditional fuels, and also for innovative surrogates, describing the complex chemistry of new, environmentally important bio-fuels.

Akcentuacja zapożyczonych leksemów czasownikowych w gwarze staroobrzędowców mieszkających w regionie suwalsko-augustowskim

Directory of Open Access Journals (Sweden)

Dorota Angelika Paśko-Koneczniak

2015-12-01

Full Text Available Stress patterns in loan verb lexemes in the dialect used by the Old Believers living in the Suwałki-Augustów region The aim of the article is to present the stress pattern phenomenon in loan verb lexemes which function in the Russian dialect of the Old Believers from the Suwałki-Augustów Region. In the last decades, the insular dialect, separated from the general Russian language, has been influenced by the Polish language. Such influence is visible, in particular, in the vocabulary, in the form of loan translations and idiomatic expressions. Stress patterns, along with the root vocabulary and the morphological system, still remains one of the indicators of the Russian essence of the dialect. The native vocabulary of the Old Believers’ dialect maintains Russian accentuation patterns. A similar situation is observed in the case of stress patterns in lexemes borrowed from Polish, which undergo a stress accentuation adaptation; that is, they feature a shift in the place of the stress in relation to the source language. In loan verb morphemes, one can notice the pattern of stress which is not fixed and depends upon the morphological form or, sometimes, the paroxitonic stress, which results from the influence of the Polish language.   Akcentuacja zapożyczonych leksemów czasownikowych w gwarze staroobrzędowców mieszkających w regionie suwalsko-augustowskim Celem artykułu jest zaprezentowanie zjawiska akcentuacji w zapożyczonych leksemach czasownikowych, funkcjonujących w rosyjskiej gwarze staroobrzędowców z regionu suwalsko-augustowskiego. W ciągu ostatnich kilkudziesięciu lat badana gwara wyspowa, odseparowana od rosyjskiego języka ogólnego, podlega znacznemu wpływowi języka polskiego. Wpływ polszczyzny widoczny jest szczególnie w zasobie leksykalnym w postaci zapożyczeń, kalk i w idiomatyce. Akcentuacja obok rdzennego zasobu leksykalnego i systemu morfologicznego nadal pozostaje jednym z wyznaczników rosyjskości gwary

Anticandida Activity Is Retained in P-113, a 12-Amino-Acid Fragment of Histatin 5

OpenAIRE

Rothstein, David M.; Spacciapoli, Peter; Tran, Linh T.; Xu, Tao; Roberts, F. Donald; Dalla Serra, Mauro; Buxton, Deborah K.; Oppenheim, Frank G.; Friden, Phillip

2001-01-01

Through the analysis of a series of 25 peptides composed of various portions of the histatin 5 sequence, we have identified P-113, a 12-amino-acid fragment of histatin 5, as the smallest fragment that retains anticandidal activity comparable to that of the parent compound. Amidation of the P-113 C terminus increased the anticandidal activity of P-113 approximately twofold. The three histidine residues could be exchanged for three hydrophobic residues, with the fragment retaining anticandidal ...

MASSIVE STARS IN THE Cl 1813-178 CLUSTER: AN EPISODE OF MASSIVE STAR FORMATION IN THE W33 COMPLEX

International Nuclear Information System (INIS)

Messineo, Maria; Davies, Ben; Figer, Donald F.; Trombley, Christine; Kudritzki, R. P.; Valenti, Elena; Najarro, F.; Michael Rich, R.

2011-01-01

Young massive (M > 10 4 M sun ) stellar clusters are a good laboratory to study the evolution of massive stars. Only a dozen of such clusters are known in the Galaxy. Here, we report about a new young massive stellar cluster in the Milky Way. Near-infrared medium-resolution spectroscopy with UIST on the UKIRT telescope and NIRSPEC on the Keck telescope, and X-ray observations with the Chandra and XMM satellites, of the Cl 1813-178 cluster confirm a large number of massive stars. We detected 1 red supergiant, 2 Wolf-Rayet stars, 1 candidate luminous blue variable, 2 OIf, and 19 OB stars. Among the latter, twelve are likely supergiants, four giants, and the faintest three dwarf stars. We detected post-main-sequence stars with masses between 25 and 100 M sun . A population with age of 4-4.5 Myr and a mass of ∼10, 000 M sun can reproduce such a mixture of massive evolved stars. This massive stellar cluster is the first detection of a cluster in the W33 complex. Six supernova remnants and several other candidate clusters are found in the direction of the same complex.

Samostanowienie narodów w prawie międzynarodowym

OpenAIRE

Żbikowski, Wawrzyniec

2015-01-01

W artykule omówiono zasadę samostanowienia narodów funkcjonującą w prawie międzynarodowym od momentu uchwalenia Karty Narodów Zjednoczonych. Po przedstawieniu tła historycznego ukazano źródła funkcjonowania tej zasady oraz problematykę związaną z jej podmiotowym i przedmiotowym zakresem. Dokonano tego na podstawie analizy źródeł, praktyki oraz poglądów doktryny. Podjęto też kwestię realizacji prawa do samostanowienia jako jednego z możliwych kryteriów państwowości. W końcowej części szeroko o...

Shear deformation and relaxed lattice constant of (Ga,Mn)As layers on GaAs(113)A

Energy Technology Data Exchange (ETDEWEB)

Dreher, Lukas; Daeubler, Joachim; Glunk, Michael; Schoch, Wladimir; Limmer, Wolfgang; Sauer, Rolf [Institut fuer Halbleiterphysik, Universitaet Ulm, D-89069 Ulm (Germany)

2008-07-01

The shear deformation and the relaxed lattice constant of compressively strained (Ga,Mn)As layers with Mn concentrations of up to 5%, pseudomorphically grown on GaAs(113)A and GaAs(001) substrates by low-temperature molecular-beam epitaxy, have been studied by high resolution X-ray diffraction (HRXRD) measurements. Rocking curves reveal a triclinic distortion of the (113)A layers with a shear direction towards the [001] crystallographic axis, whereas the (001) layers are tetragonally distorted along [001]. The relaxed lattice constants were derived from {omega}-2{theta} scans for the symmetric (113) and (004) Bragg reflections, taking the elastic anisotropy of the cubic system into account. The increase of the lattice constant with Mn content has been found to be smaller for the (113)A layers than for the (001) layers, presumably due to the enhanced amount of excess As in the (113)A layers.

SPECYFIKA REALIZACJI LINIOWYCH INWESTYCJI W PASIE DROGOWYM W AGLOMERACJI MIEJSKIEJ Z UWZGLĘDNIENIEM OBSZARÓW ZABYTKOWYCH

Directory of Open Access Journals (Sweden)

Andrzej MARECKI

Full Text Available Treścią referatu jest problematyka budowlanego procesu inwestycyjnego w pasie drogowym na terenie miast. W aglomeracjach miejskich realizacja zadań związanych z budową, przebudową lub modernizacją ciągów drogowych lub sieci infrastruktury liniowej związana jest z pokonaniem szczególnych utrudnień. Wynika to nie tylko ze specyfiki technologicznej ale również z szeroko pojętej interakcji społecznych. Inwestorzy realizujący zadania w miastach muszą szukać nie tylko innowacyjnych rozwiązań technicznych ale również muszą spełniać, często - „wygórowane” oczekiwania społeczne. W referacie omówione zostaną typowe zagrożenia procesu inwestycyjnego na etapach koncepcji, projektowania, realizacji i eksploatacji - ze szczególnym uwzględnieniem aspektów dotyczących realizacji liniowych robót budowlanych na obszarach objętych warunkami ochrony, wynikającymi z zapisów ustawy o ochronie zabytków[1]. Należy podkreślić, że ochrona ta zgodnie z Art. 4 przedmiotowej Ustawy polega, na podejmowaniu przez organy administracji publicznej działań mających między innymi na celu: zapewnienie warunków prawnych, organizacyjnych i finansowych, umożliwiających trwałe zachowanie zabytków oraz ich zagospodarowanie i utrzymanie. Przekłada się to na obligatoryjny warunek prowadzenia prac konserwatorskich, restauratorskich i oczywiście robót budowlanych za pozwoleniem właściwego konserwatora zabytków i pod jego nadzorem. Realizacja liniowych zadań inwestycyjnych z natury rzeczy odbywa się nie tylko w obszarze wpływu zabytków nieruchomych ale także w bezpośrednim kontakcie z zabytkami archeologicznymi tj. – zabytkami nieruchomymi, będącymi powierzchniową, podziemną lub podwodną pozostałością egzystencji i działalności człowieka, złożoną z nawarstwień kulturowych i znajdujących się w nich wytworów bądź ich śladów. Warunkiem pogodzenia interesów stron tego skomplikowanego procesu

14 CFR 152.113 - Application requirements: Airport planning.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Application requirements: Airport planning....113 Application requirements: Airport planning. (a) Application for Federal assistance. An eligible sponsor or planning agency that desires to obtain Federal aid for eligible airport master planning or...

9 CFR 113.213 - Pseudorabies Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pseudorabies Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.213 Pseudorabies Vaccine, Killed Virus. Pseudorabies Vaccine, Killed...

ZASTOSOWANIE METOD GIS W ANALIZIE STRUKTURY PRZESTRZENNEJ OBSZARÓW WIEJSKICH GMINY SŁAWNO W POWIECIE OPOCZYŃSKIM

Directory of Open Access Journals (Sweden)

Przemysław LEŃ

Full Text Available Celem pracy jest przedstawienie możliwości wykorzystania narzędzi GIS w analizie struktury przestrzennej obszarów wiejskich. Badania przeprowadzono w 34 wsiach gminy Sławno położonej w powiecie opoczyńskim, województwo łódzkie. W pracy przeprowadzono analizy dotyczące struktury władania gruntami, analizy użytkowania gruntami, jak również analizę rozdrobnienia gruntów gospodarstw indywidualnych. Otrzymane wyniki pozwolą określić stan struktury przestrzennej obszarów wiejskich Polski centralnej.

Prezentacja innych dochodów całkowitych w sprawozdaniach finansowych wybranych spółek publicznych w Polsce w latach 2009–2011

Directory of Open Access Journals (Sweden)

Bogusława Bek-Gaik

2013-04-01

Full Text Available Inne całkowite dochody to nowa kategoria ekonomiczna, dopiero testowana w praktyce gospodarczej. Oczywi-sty wydaje się fakt zapotrzebowania na badanie aspektów praktycznych dotyczących prezentacji innych całkowitych dochodów w sprawozdaniu z dochodów całkowitych. Zasadniczym celem niniejszego artykułu jest zbadanie, jaką formę prezentacji innych całkowitych dochodów w sprawozdaniu z całkowitych dochodów wybrały polskie spółki giełdowe, jaka jest istotność wyniku całkowitego oraz średnia liczba pozycji ujawnia-nych w ramach innych zysków całkowitych przez badane spółki publiczne (struktura innych zysków całko-witych. Metodą badawczą zastosowaną w artykule były studia literaturowe, analiza regulacji dotyczących sprawozdania z całkowitych dochodów (głównie MSR 1 oraz analiza sprawozdań finansowych sporządzo-nych zgodnie z Międzynarodowymi Standardami Sprawozdawczości Finansowej wybranych polskich spółek publicznych w latach 2009–2011. Wyniki badań wskazują, że w praktyce mamy do czynienia z indywidual-nym podejściem do zasad prezentacji informacji o innych całkowitych dochodach. Niewątpliwą wadą takie-go sposobu prezentacji jest brak możliwości porównywania poszczególnych kategorii sprawozdań między spółkami; analiza porównawcza jest pracochłonna i wymaga poszukiwania danych w wielu notach.

Effect of impurities on the growth of {113} interstitial clusters in silicon under electron irradiation

OpenAIRE

Nakai, K.; Hamada, K.; Satoh, Y.; Yoshiie, T.

2011-01-01

The growth and shrinkage of interstitial clusters on {113} planes were investigated in electron irradiated Czochralski grown silicon (Cz-Si), floating-zone silicon (Fz-Si), and impurity-doped Fz-Si (HT-Fz-Si) using a high voltage electron microscope. In Fz-Si, {113} interstitial clusters were formed only near the beam incident surface after a long incubation period, and shrank on subsequent irradiation from the backside of the specimen. In Cz-Si and HT-Fz-Si, {113} interstitial clusters nucle...

Rozłam w operaizmie w świetle dynamiki włoskiego ruchu robotniczego w „czerwonym dziesięcioleciu” (1969–1980

Directory of Open Access Journals (Sweden)

Zbigniew Marcin Kowalewski

2015-12-01

Full Text Available Operaizm powstał w 1960–1961 roku z inicjatywy Raniero Panzieriego jako nurt radykalnej odnowy teoretycznej marksizmu w walce z obiektywizmem i historyzmem oraz równie radykalnej odnowy strategicznej ruchu robotniczego w walce z dominującym w nim reformizmem. Miał mieć za podstawę materialistyczną lekturę Kapitału „z robotniczego punktu widzenia”. Wkrótce okazało się, że jest głęboko podzielony teoretycznie i politycznie. W 1963 roku w środowisku operaistycznym nastąpił rozłam. Większość skupiona wokół Maria Trontiego oddzieliła się, dokonując antymaterialistycznej rewizji marksizmu i stworzyła metafizykę autonomii robotniczej. Ogromna fala walk robotniczych w latach 1969–1980 przyniosła wyraźne rozstrzygnięcia w fundamentalnych kwestiach spornych, które podzieliły operaistów.

Czynniki prognostyczne progresji radiologicznej w reumatoidalnym zapaleniu stawów

Directory of Open Access Journals (Sweden)

Piotr Wiland

2010-08-01

Full Text Available Możliwość przewidywania odległych konsekwencji reumatoidalnegozapalenia stawów ma zasadnicze znaczenie dla podejmowaniawłaściwych decyzji terapeutycznych u danego chorego. Markeryprognostyczne są pomocne w identyfikacji chorych o dużym ryzykuszybkiej progresji radiologicznej. Utwierdzają one lekarzaw decyzji o rozpoczęciu intensywnego leczenia u chorych z możliwąznaczną destrukcją stawów w ciągu następnych kilku lat.W artykule zaprezentowano pilotażowy model ryzyka dla przewidywaniaszybkiej progresji radiologicznej. W celu stworzenia tegomodelu posłużono się danymi, w tym wynikami badań radiologicznychpochodzącymi z badania ASPIRE, w którym porównywanomonoterapię metotreksatem z leczeniem skojarzonym metotreksatemi infliksymabem. W tym modelu wybrano wyjściowe parametry,które są łatwe do uzyskania w rutynowej praktyce klinicznej,takie jak: stężenie białka C-reaktywnego, wartość odczynuopadania krwinek czerwonych, liczbę obrzękniętych stawów orazmiano czynnika reumatoidalnego. Ten macierzowy model ryzykamoże być przydatny w ocenie ryzyka postępującego uszkodzeniastawów, szczególnie u chorych z wczesnym zapaleniem stawów.

Complex distal insertions of the tibialis posterior tendon: detailed anatomic and MR imaging investigation in cadavers

Energy Technology Data Exchange (ETDEWEB)

Pastore, Daniel; Cerri, Giovanni G. [University of Sao Paulo, Department of Radiology, Sao Paulo, Sao Paulo (Brazil); VA Medical Center, University of California, Department of Radiology, San Diego, CA (United States); Dirim, Berna; Wangwinyuvirat, Mani; Belentani, Clarissa L.; Trudell, Debra J.; Resnick, Donald L. [VA Medical Center, University of California, Department of Radiology, San Diego, CA (United States); Haghighi, Parviz [VA Medical Center, University of California, Department of Radiology, San Diego, CA (United States); VA Medical Center, University of California, Department of Histology, San Diego, CA (United States)

2008-09-15

The purpose of this report was to demonstrate the normal complex insertional anatomy of the tibialis posterior tendon (TPT) in cadavers using magnetic resonance (MR) imaging with anatomic and histologic correlation. Ten cadaveric ankles were used according to institutional guidelines. MR T1-weighted spin echo imaging was performed to demonstrate aspects of the complex anatomic distal insertions of the TPT in cadaveric specimens. Findings on MR imaging were correlated with those derived from anatomic and histologic study. Generally, the TPT revealed a low signal in all MR images, except near the level of the medial malleolus, where the TPT suddenly changed direction and ''magic angle'' artifact could be observed. In five out of ten specimens (50%), a type I accessory navicular bone was found in the TPT. In all cases with a type I accessory navicular bone, the TPT had an altered signal in this area. Axial and coronal planes on MR imaging were the best in identifying the distal insertions of the TPT. A normal division of the TPT was observed just proximal to the insertion into the navicular bone in five specimens (100%) occurring at a maximum proximal distance from its attachment to the navicular bone of approximately 1.5 to 2 cm. In the other five specimens, in which a type I accessory navicular bone was present, the TPT directly inserted into the accessory bone and a slip less than 1.5 mm in thickness could be observed attaching to the medial aspect of the navicular bone (100%). Anatomic inspection confirmed the sites of the distal insertions of the components of the TPT. MR imaging enabled detailed analysis of the complex distal insertions of the TPT as well as a better understanding of those features of its insertion that can simulate a lesion. (orig.)

The Effects of Antimicrobial Peptide Nal-P-113 on Inhibiting Periodontal Pathogens and Improving Periodontal Status

Directory of Open Access Journals (Sweden)

Hongyan Wang

2018-01-01

Full Text Available Periodontal disease consists of chronic gingival inflammation characterized by both degradation of the periodontal connective tissue and alveolar bone loss. Drug therapy is used as an auxiliary treatment method in severe chronic periodontitis, aggressive periodontitis, and periodontitis-associated systemic disease. Nal-P-113, a modified antimicrobial peptide, specifically replaces the histidine residues of P-113 with the bulky amino acid β-naphthylalanine, and our previous studies have verified that this novel peptide is not toxic to the human body within a certain concentration range. The objective of the present study was to evaluate the effect of Nal-P-113 on periodontal pathogens and periodontal status in clinical studies. In a split-mouth clinical trial, the pocket depth and bleeding index values tended to decrease in the experimental group compared with those in the control group. SEM results verified that Nal-P-113 restrained the maturation of plaque. Based on real-time polymerase chain reaction, the levels of Fusobacterium nucleatum, Streptococcus gordonii, Treponema denticola, and Porphyromonas gingivalis in subgingival plaque were decreased when the subjects were given Nal-P-113. Bacterial growth curve analysis and a biofilm susceptibility assay verified that Nal-P-113 at a concentration of 20 μg/mL restrained the growth of S. gordonii, F. nucleatum, and P. gingivalis and biofilm formation. Therefore, Nal-P-113 effectively reduces periodontal pathogens and ameliorates periodontal status.

Analiza poziomu zgodności ocen dwóch terapeutów manualnych (MT w diagnozie skręcenia miednicy na podstawie wybranych testów manualnych.

Directory of Open Access Journals (Sweden)

Michał Cichosz

2015-06-01

  Streszczenie Wstęp Skręcenie (torsja miednicy jest w fizjoterapii oraz medycynie manualnej często stawianym rozpoznaniem opartym głównie na podstawie badania fizykalnego oraz danych z wywiadu pacjenta. Coraz częściej łączy się je i opisuje wspólnie z dysfunkcją stawów krzyżowo- biodrowych (SIJD, której nie towarzyszy ból, jedynie zmiany w przestrzennym funkcjonowaniu kompleksu miedniczego. Cel pracy: Celem niniejszej pracy jest ocena poziomu zgodności ocen dwóch terapeutów manualnych (MT dla wybranych testów diagnostycznych stawów krzyżowo- biodrowych. Materiał badawczy: Badania przeprowadzono na 180 osobowej grupie studentów w wieku między 20 a 30 lat. Wyniki: Największą zgodność szacunków, określaną jako znaczną odnotowano jedynie w przypadku testu ASLR, przy wartości k= 0,62. Pozostałe testy charakteryzowały się niższymi wartościami zgodności. Wnioski: Większość analizowanych testów charakteryzuje się umiarkowana oraz niższą wartością zgodności wyników. Na poziom zgodności ocen ma wpływ typu budowy ciała badanego.   Summary Introduction: The twist (torsion of the pelvis is in physiotherapy and manual medicine based diagnosis is often posed mainly based on physical examination, and data the patient's history. More often they combine them and describes, together with dysfunction of the sacroiliac joints (SIJD, which is not accompanied by pain, only changes in the spatial functioning of pelvic complex. Aim: The  purpose  of  this  study  is  to  assess  the level  of  compliance  reviews  two manual  therapists (MT for  selected  diagnostic  tests  the  sacroiliac  joints. Research material: The research was conducted on 180 members of a group of students aged between 20 and 30 years. Results: The biggest compliance estimates, defined as significant was noted only in the ASLR test, with values of k = 0,62. Other tests were characterized by lower values of conformity. Conclusions: Most of

Project W-314 specific test and evaluation plan 241-AN-B valve pit

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-B Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

9 CFR 113.28 - Detection of mycoplasma contamination.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of mycoplasma contamination... REQUIREMENTS Standard Procedures § 113.28 Detection of mycoplasma contamination. The heart infusion test, using... for mycoplasma contamination is prescribed in an applicable Standard Requirement or in the filed...

20 CFR 726.113 - Disclosure of confidential information.

Science.gov (United States)

2010-04-01

... MINE OPERATOR'S INSURANCE Authorization of Self-Insurers § 726.113 Disclosure of confidential... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Disclosure of confidential information. 726... authorized self-insurer or applicant for the authorization of self-insurance obtained by the Office shall be...

7 CFR 1421.113 - Recourse marketing assistance loans.

Science.gov (United States)

2010-01-01

... assistance loan collateral may not be delivered or forfeited to CCC in satisfaction of the loan indebtedness... 7 Agriculture 10 2010-01-01 2010-01-01 false Recourse marketing assistance loans. 1421.113 Section... CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS GRAINS AND SIMILARLY HANDLED...

Investigation of low-cost oligoanthraquinones for alkaline, aqueous rechargeable batteries with cell potential up to 1.13 V

Science.gov (United States)

Dražević, Emil; Andersen, Anders Søndergaard; Wedege, Kristina; Henriksen, Martin Lahn; Hinge, Mogens; Bentien, Anders

2018-03-01

The transition to renewable energy sources has created need for stationary, low-cost electrical energy storage. A possible technology to address both cost and environmental concerns are batteries based on organic materials. The use of oligoanthraquinones as a replacement for metal hydrides or cadmium in nickel hydroxide rechargeable batteries is investigated in detail regarding polymer composition, electrochemical reversibility and electroactive species cost. Two different oligoanthraquinones are paired with a nickel hydroxide cathode and demonstrate cycling stability dependent on parameters such as supporting electrolyte strength, C-rate, and anode swelling. The energy efficiencies are up to 75% and the cell potential up to 1.13 V. Simple functionalization of the basic structure increases the cell potential by 100 mV.

Synthesis in situ of gold nanoparticles by a dialkynyl Fischer carbene complex anchored to glass surfaces

International Nuclear Information System (INIS)

Bertolino, María Candelaria; Granados, Alejandro Manuel

2016-01-01

Highlights: • Fischer carbene 1-W reacts via cycloaddition without Cu(I) with azide terminal surface. • This reaction on the surface is regioselective to internal triple bond of 1-W. • 1-W bound to glass surface produce AuNps in situ fixed to the surface. • This ability is independent of how 1-W is bonded to the surface. • This hybrid surface can be valuable as SERS substrate or in heterogeneous catalysis. - Abstract: In this work we present a detailed study of classic reactions such as “click reaction” and nucleophilic substitution reaction but on glass solid surface (slides). We used different reactive center of a dialkynylalcoxy Fischer carbene complex of tungsten(0) to be anchored to modified glass surface with amine, to obtain aminocarbene, and azide terminal groups. These cycloaddition reaction showed regioselectivity to internal triple bond of dialkynyl Fischer carbene complex without Cu(I) as catalyst. Anyway the carbene anchored was able to act as a reducing agent to produce in situ very stable gold nanoparticles fixed on surface. We showed the characterization of modified glasses by contact angle measurements and XPS. Synthesized nanoparticles were characterized by SEM, XPS, EDS and UV–vis. The modified glasses showed an important enhancement Raman-SERS. This simple, fast and robust method to create a polifunctional and hybrid surfaces can be valuable in a wide range of applications such as Raman-SERS substrates and other optical fields.

Synthesis in situ of gold nanoparticles by a dialkynyl Fischer carbene complex anchored to glass surfaces

Energy Technology Data Exchange (ETDEWEB)

Bertolino, María Candelaria, E-mail: cbertolino@fcq.unc.edu.ar; Granados, Alejandro Manuel, E-mail: ale@fcq.unc.edu.ar

2016-10-15

Highlights: • Fischer carbene 1-W reacts via cycloaddition without Cu(I) with azide terminal surface. • This reaction on the surface is regioselective to internal triple bond of 1-W. • 1-W bound to glass surface produce AuNps in situ fixed to the surface. • This ability is independent of how 1-W is bonded to the surface. • This hybrid surface can be valuable as SERS substrate or in heterogeneous catalysis. - Abstract: In this work we present a detailed study of classic reactions such as “click reaction” and nucleophilic substitution reaction but on glass solid surface (slides). We used different reactive center of a dialkynylalcoxy Fischer carbene complex of tungsten(0) to be anchored to modified glass surface with amine, to obtain aminocarbene, and azide terminal groups. These cycloaddition reaction showed regioselectivity to internal triple bond of dialkynyl Fischer carbene complex without Cu(I) as catalyst. Anyway the carbene anchored was able to act as a reducing agent to produce in situ very stable gold nanoparticles fixed on surface. We showed the characterization of modified glasses by contact angle measurements and XPS. Synthesized nanoparticles were characterized by SEM, XPS, EDS and UV–vis. The modified glasses showed an important enhancement Raman-SERS. This simple, fast and robust method to create a polifunctional and hybrid surfaces can be valuable in a wide range of applications such as Raman-SERS substrates and other optical fields.

Polityka rachunkowości spółek notowanych na GPW w Warszawie w zakresie ujmowania przychodów z kontraktów deweloperskich

Directory of Open Access Journals (Sweden)

Renata Dyląg

2010-04-01

Full Text Available Głównym przedmiotem działalności jednostek z branży deweloperskiej jest rea-lizacja kontraktów deweloperskich, polegających na budowie (bezpośrednio lub poprzez podwykonawców a następnie sprzedaży powierzchni w budynkach handlowych, rozrywkowych, biurowych, hotelowych i mieszkalnych. Brak precyzyjnych rozwią-zań dotyczących ujmowania przychodów z tych kontraktów powodował, że niektóre jednostki ujmowały przychody w momencie przekazania nieruchomości nabywcy (zgodnie z MSR 18 „Przychody”, natomiast inne ujmowały przychody w trakcie trwania okresu budowy tej nieruchomości (zgodnie z MSR 11 „Umowy o budowę”. Celem artykułu jest ocena – przyjmowanych przez spółki deweloperskie noto-wane na warszawskiej Giełdzie Papierów Wartościowych – rozwiązań dotyczących ujmowania przychodów i wyników z kontraktów deweloperskich oraz zaprezento-wanie wpływu interpretacji KIMSF 15 „Umowy dotyczące budowy nieruchomości” na sprawozdawczość tych spółek.

23 CFR 635.113 - Bid opening and bid tabulations.

Science.gov (United States)

2010-04-01

... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.113 Bid opening and bid tabulations. (a) All bids... contractors, during the period following the opening of bids and before the award of the contract shall not be...

Postoperative complications following intraoperative radiotherapy in abdominopelvic malignancy: A single institution analysis of 113 consecutive patients.

Science.gov (United States)

Abdelfatah, Eihab; Page, Andrew; Sacks, Justin; Pierorazio, Phillip; Bivalacqua, Trinity; Efron, Jonathan; Terezakis, Stephanie; Gearhart, Susan; Fang, Sandy; Safar, Bashar; Pawlik, Timothy M; Armour, Elwood; Hacker-Prietz, Amy; Herman, Joseph; Ahuja, Nita

2017-06-01

Intraoperative radiotherapy (IORT) has advantages over external beam radiation therapy (EBRT). Few studies have described side effects associated with its addition. We evaluated our institution's experience with abdominopelvic IORT to assess safety by postoperative complication rates. Prospectively collected IRB-approved database of all patients receiving abdominopelvic IORT (via high dose rate brachytherapy) at Johns Hopkins Hospital between November 2006 and May 2014 was reviewed. Patients were discussed in multidisciplinary conferences. Those selected for IORT were patients for whom curative intent resection was planned for which IORT could improve margin-negative resection and optimize locoregional control. Perioperative complications were classified via Clavien-Dindo scale for postoperative surgical complications. A total of 113 patients were evaluated. Most common diagnosis was sarcoma (50/113, 44%) followed by colorectal cancer (45/113, 40%), most of which were recurrent (84%). There were no perioperative deaths. A total of 57% of patients experienced a complication Grade II or higher: 24% (27/113) Grade II; 27% (30/113) Grade III; 7% (8/113) Grade IV. Wound complications were most common (38%), then gastrointestinal (25%). No radiotherapy variables were significantly associated with complications on uni/multi-variate analysis. Our institution's experience with IORT demonstrated historically expected postoperative complication rates. IORT is safe, with acceptable perioperative morbidity. © 2017 Wiley Periodicals, Inc.

Education and training in radiological protection for diagnostic and interventional procedures ICRP 113 in brief

International Nuclear Information System (INIS)

Salama, S.; Gomaa, M. A.; Alshoufi, J.H.

2013-01-01

The international commission on radiological protection (ICRP) is the primary body in protection against ionizing radiation. Among its latest publication is ICRP publication 113 e ducation and training in radiological protection for diagnostic and interventional procedures . This document introduces diagnostic and interventional medical procedures using ionizing radiations in deep details. The document is approved by the commission in October 2010 and translated into Arabic at December 2011. This work is a continuation of the efforts series to translate some of the most important of the radiological protection references into the Arabic; aiming to maximize the benefit. The previous translation include WHO handbook on indoor radon: a public health perspective, issued by world health organization 2009 and Radiation Protection in Medicine, ICRP Publication 105 2007 that translated into Arabic with support of Arab atomic energy authority at 2011.

9 CFR 113.30 - Detection of Salmonella contamination.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of Salmonella contamination... REQUIREMENTS Standard Procedures § 113.30 Detection of Salmonella contamination. The test for detection of Salmonella contamination provided in this section shall be conducted when such a test is prescribed in an...

9 CFR 113.32 - Detection of Brucella contamination.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of Brucella contamination... REQUIREMENTS Standard Procedures § 113.32 Detection of Brucella contamination. The test for detection of Brucella contamination provided in this section shall be conducted when such a test is prescribed in an...

24 CFR 3280.113 - Glass and glazed openings.

Science.gov (United States)

2010-04-01

... glazing material is considered to be any glazing material capable of passing the requirements of Safety... URBAN DEVELOPMENT MANUFACTURED HOME CONSTRUCTION AND SAFETY STANDARDS Planning Considerations § 3280.113... shall meet the requirements of § 3280.403 the “Standard for Windows and Sliding Glass Doors Used in...

$W^+ W^-$ + Jet: Compact Analytic Results

Energy Technology Data Exchange (ETDEWEB)

Campbell, John [Fermilab; Miller, David [Glasgow U.; Robens, Tania [Dresden, Tech. U.

2016-01-14

In the second run of the LHC, which started in April 2015, an accurate understanding of Standard Model processes is more crucial than ever. Processes including electroweak gauge bosons serve as standard candles for SM measurements, and equally constitute important background for BSM searches. We here present the NLO QCD virtual contributions to W+W- + jet in an analytic format obtained through unitarity methods and show results for the full process using an implementation into the Monte Carlo event generator MCFM. Phenomenologically, we investigate total as well as differential cross sections for the LHC with 14 TeV center-of-mass energy, as well as a future 100 TeV proton-proton machine. In the format presented here, the one-loop virtual contributions also serve as important ingredients in the calculation of W+W- pair production at NNLO.

9 CFR 113.27 - Detection of extraneous viable bacteria and fungi in live vaccines.

Science.gov (United States)

2010-01-01

... bacteria and fungi in live vaccines. 113.27 Section 113.27 Animals and Animal Products ANIMAL AND PLANT... bacteria and fungi in live vaccines. Unless otherwise specified by the Administrator or elsewhere exempted... Seed Bacteria shall be tested for extraneous viable bacteria and fungi as prescribed in this section. A...

40 CFR 91.113 - Requirement of certification-emission control information label and engine identification number.

Science.gov (United States)

2010-07-01

... control information label and engine identification number. 91.113 Section 91.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF EMISSIONS FROM... certification—emission control information label and engine identification number. (a) The engine manufacturer...

CP violating observables in e$^{-}$e$^{+}$ --> W$^{-}$W$^{+}$

CERN Document Server

Chang, D; Phillips, I

1993-01-01

We consider various integrated lepton charge-energy asymmetries and azimuthal asymmetries as tests of CP violation in the process $e^-e^+ \\to W^-W^+$. These asymmetries are sensitive to different linear combinations of the CP violating form factors in the three gauge boson $W^-W^+$ production vertex, and can distinguish dispersive and absorptive parts of the form factors. It makes use of purely hadronic and purely leptonic modes of $W$'s decays as well as the mixed modes. The techniques of using the kinematics of jets or missing momentum to construct CP--odd observables are also employed. These CP violating observables are illustrated in the generalized Left-Right Model and the Charged Higgs Model.

Measurement of placental blood flow by the sup(113m)In accumulation method

International Nuclear Information System (INIS)

Olkkonen, H.; Suonio, S.

1976-01-01

The present work introduces the use of isotope In-113m in the assessment of placental blood flow. It is almost completely bound to plasma transferrin. Owing to this and its short half-life, In-113m introduces considerably slighter radiation dose to the fetus than Tc-99m. A typical tracer appearance curve is given and the In accumulation index is calculated. (M.S.)

pH-dependent absorption spectra of rhodopsin mutant E113Q: On the role of counterions and protein

Science.gov (United States)

Xie, Peng; Zhou, Panwang; Alsaedi, Ahmed; Zhang, Yan

2017-03-01

The absorption spectra of bovine rhodopsin mutant E113Q in solutions were investigated at the molecular level by using a hybrid quantum mechanics/molecular mechanics (QM/MM) method. The calculations suggest the mechanism of the absorption variations of E113Q at different pH values. The results indicate that the polarizations of the counterions in the vicinity of Schiff base under protonation and unprotonation states of the mutant E113Q would be a crucial factor to change the energy gap of the retinal to tune the absorption spectra. Glu-181 residue, which is close to the chromophore, cannot serve as the counterion of the protonated Schiff base of E113Q in dark state. Moreover, the results of the absorption maximum in mutant E113Q with the various anions (Cl-, Br-, I- and NO3-) manifested that the mutant E113Q could have the potential for use as a template of anion biosensors at visible wavelength.

Growth and characterization of Ge nano-structures on Si(113) by adsorbate-mediated epitaxy; Wachstum und Charakterisierung von Ge-Nanostrukturen auf Si(113) durch Adsorbat-modifizierte Epitaxie

Energy Technology Data Exchange (ETDEWEB)

Clausen, T.

2006-11-15

In the work presented here Ge nano-structures on Si(113) substrates have been grown by adsorbate-mediated epitaxy at sample temperatures between 400 C and 700 C. The Ge nano-islands and nano-layers have been investigated regarding their atomic reconstruction, morphology, strain state, chemical composition and defect structure. Various in-situ and ex-situ experimental techniques have been used, as there are low-energy electron diffraction, low-energy electron microscopy, X-ray photoemission electron microscopy, spot profile analysis low-energy electron diffraction, grazing incidence X-ray diffraction, scanning tunneling microscopy, atomic force microscopy, scanning electron microscopy and transmission electron microscopy. On a clean Si(113) surface Ge preferentially nucleates at surface step edges and forms a wetting layer exhibiting a Ge-(2 x 2) surface reconstruction. With increasing growth temperature the Ge islands are elongated in the [33 anti 2] direction. Simultaneously, the average island size increases with decreasing island density. From the Arrhenius-like behaviour of the island density, a Ge adatom diffusion barrier height of about 0.53 eV is deduced. At 600 C the Si concentration of the islands amounts to about 41% and the residual lattice strain of the islands is found to about 23 %. The adsorption of Gallium on a clean Si(113) substrate leads to the formation of well ordered surface facets in the [1 anti 10] direction with a periodicity of about 43 nm in the [33 anti 2] direction. From reciprocal space maps in different ({kappa} {sub perpendicular} {sub to} -{kappa} {sub parallel}) planes both facet angles are determined to be about 9.8 with respect to the [113] direction. Thus the facet orientations are identified to be (112) and (115), showing (6 x 1) and (4 x 1) surface reconstructions, respectively. Ge deposition on the faceted Si(113) leads to a high density of ordered 3D Ge nano-islands beaded at the surface facets. The size of these islands is

9 CFR 113.10 - Testing of bulk material for export or for further manufacture.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing of bulk material for export or for further manufacture. 113.10 Section 113.10 Animals and Animal Products ANIMAL AND PLANT HEALTH... manufacture. When a product is prepared in a licensed establishment for export in large multiple-dose...

Postawy konsumentów wobec reklam kredytów hipotecznych

OpenAIRE

Kmita, Emilia

2011-01-01

Najważniejszym aspektem poznawczym niniejszej pracy była analiza postaw konsumentów wobec reklam, ze szczególnym uwzględnieniem tych prezentujących kredyty hipoteczne. Weryfikacji postawionych przez mnie hipotez dokonałam poprzez badanie ankietowe przeprowadzone wśród klientów banku Pekao S.A. w Nowym Sączu. Wyniki badań wskazują, iż konsumenci zazwyczaj nie darzą reklam zbyt dużą sympatią czy zaufaniem. W przypadku podejmowania ważnych decyzji życiowych jakimi jest zakup własnego domu oraz w...

W mass and W asymmetry at CDF

International Nuclear Information System (INIS)

Leone, S.

1991-05-01

The lepton charge asymmetry from W decaying into a lepton and a neutrino is discussed (preliminary result). This measurement gives information on parton distribution functions at low x values. The derivation of the recently published W mass value of 79.91 ± 0.39 GeV/c 2 is also presented. M W is used to set an upper limit on the top quark mass. 13 refs., 4 figs., 1 tab

A study of $W^{+}W^{-}\\gamma$ events at LEP

CERN Document Server

Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, A; Axen, D; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Bock, P; Boeriu, O; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, A; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, F L; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, R J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, D; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L; Kramer, T; Krieger, P; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, H; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Ströhmer, R; Strom, D; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vannerem, P; Vertesi, R; Verzocchi, M; Vollmer, C F; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L; Von Krogh, J

2004-01-01

A study of W/sup +/W/sup -/ events accompanied by hard photon radiation, E/sub gamma />2.5 GeV, produced in e^{+}e^{-} collisions at LEP is presented. Events consistent with being two on- shell W-bosons and an isolated photon are selected from 681 pb/sup -1 / of data recorded at 180 GeV< square root s<209 GeV. From the sample of 187 selected W/sup +/W/sup -/ gamma candidates with photon energies greater than 2.5 GeV, the W/sup +/W/sup -/ gamma cross- section is determined at five values of square root s. The results are consistent with the standard model expectation. Averaging over all energies, the ratio of the observed cross-section to the standard model expectation is R(data/SM)=0.99+or-0.09+or-0.04, where the errors represent the statistical and systematic uncertainties respectively. These data provide constraints on the related O( alpha ) systematic uncertainties on the measurement of the W-boson mass at LEP. Finally, the data are used to derive 95% confidence level upper limits on possible anomalo...

Charakterystyka etiologiczna udarów mózgu leczonych w Klinice Neurologii UM w Białymstoku z analizą czynników ryzyka

Directory of Open Access Journals (Sweden)

Anna Syta-Krzyżanowska

2010-03-01

Full Text Available Wstęp: W przeprowadzonych w Polsce badaniach epidemiologicznych stwierdzono utrzymujący się od kilkunastu lat wysoki współczynnik zapadalności na pierwszy w życiu udar mózgu, wzrastający wykładniczo z wiekiem oraz połączony z wciąż dużą śmiertelnością. Poznanie czynników ryzyka oraz wprowadzenie profilaktyki może istotnie zmniejszyć powyższe wskaźniki. Celem pracy było przeprowadzenie analizy epidemiologicznej pacjentów z udarem mózgu hospitalizowanych na Pododdziale Udarowym Kliniki Neurologii USK w Białymstoku. Uwzględniono w szczególności etiologię z czynnikami ryzyka oraz śmiertelnością w zależności od wieku i płci chorych. Materiał i metody: Rozpatrzono wszystkie przypadki pacjentów hospitalizowanych w Klinice Neurologii USK w Białymstoku z powodu udaru mózgu w ciągu pełnego roku kalendarzowego. Posłużono się ankietami prowadzonymi w ramach Narodowego Programu Profilaktyki i Leczenia Chorób Sercowo-Naczyniowych (POLKARD. Obliczenia statystyczne wykonywano przy użyciu programu Statistica w wersji 8.0. Wyniki: Przeanalizowano wyniki 408 pacjentów, w tym 185 (45,3% kobiet oraz 223 (54,7% mężczyzn z rozpoznanym: krwotokiem podpajęczynówkowym – 6,9%, krwotokiem śródmózgowym – 12,5% oraz udarem niedokrwiennym – 80,6%. Etiologię zatorową pochodzenia sercowego zdiagnozowano u 39,4%, zakrzep dużych naczyń u 35%, natomiast udar zatokowy u 11,6% pacjentów. Najczęstszym czynnikiem ryzyka udaru niedokrwiennego mózgu było nadciśnienie tętnicze (81,2%, następnie migotanie przedsionków i choroba niedokrwienna serca (38%. Zmarło 11,6% chorych z udarem niedokrwiennym mózgu oraz 21,5% z udarem krwotocznym. Średnia śmiertelność wyniosła 13,5%. Wnioski: Najczęstszym czynnikiem ryzyka udaru mózgu było nadciśnienie tętnicze, które szczególnie często współwystępowało z dodatkowym czynnikiem ryzyka udaru niedokrwiennego mózgu. Prowadzenie leczenia udaru mózgu w pododdzia

Linearizing W-algebras

International Nuclear Information System (INIS)

Krivonos, S.O.; Sorin, A.S.

1994-06-01

We show that the Zamolodchikov's and Polyakov-Bershadsky nonlinear algebras W 3 and W (2) 3 can be embedded as subalgebras into some linear algebras with finite set of currents. Using these linear algebras we find new field realizations of W (2) 3 and W 3 which could be a starting point for constructing new versions of W-string theories. We also reveal a number of hidden relationships between W 3 and W (2) 3 . We conjecture that similar linear algebras can exist for other W-algebra as well. (author). 10 refs

Cilium transition zone proteome reveals compartmentalization and differential dynamics of ciliopathy complexes

Czech Academy of Sciences Publication Activity Database

Dean, S.; Moreira-Leite, F.; Varga, Vladimír; Gull, K.

2016-01-01

Roč. 113, č. 35 (2016), E5135-E5143 ISSN 0027-8424 Institutional support: RVO:68378050 Keywords : transition zone * cilium/flagellum * BBSome * MKS/B9 complex * trypanosome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.661, year: 2016

New and noteworthy species of lichens from the Augustów Forest (northeastern Poland

Directory of Open Access Journals (Sweden)

Anna Matwiejuk

2018-01-01

Full Text Available The Augustów Forest is one of the biggest forest complex in Poland. In this paper, 13 rare species of lichens from Augustów Forest are presented. Four of these species are new to Augustów Forest: Bacidina egenula, Lecanora persimilis, Rhizocarpon reductum, Scoliciosporum pruinosum and one species, Rhizocarpon hochstetteri, is new to northeastern Poland. Short notes on their features and distributions are provided.

Boson-fermion symmetries in the W-Pt region

International Nuclear Information System (INIS)

Warner, D.D.

1985-01-01

The concept of symmetry in the Interacting Boson Model (IBM) description of even-even nuclei has proved to be one of the model's most important elements, because they provide benchmarks in the formulation of a unified description of a broad range of nuclei. The importance of the recently proposed symmetries in odd-even systems can thus be viewed in the same light, and their role in pointing to a simple prescription for the changing collective structure in odd A nuclei throughout a major shell is likely to prove even more essential, given the much greater complexity of the boson-fermion (IBFM) Hamiltonian. The group structure of a boson-fermion system is described by U/sup B/(6) x U/sup F/(m) where m specifies the number of states available to the odd fermion, and thus depends on the single particle space assumed. The ability to construct group chains corresponding to the symmetries SU(5), SU(3) or 0(6) depends on the value of m. Of the structures studied in detail to date, the case of m = 12 is the one with the broadest potential. The fermion is allowed to occupy orbits with j = 1/2, 3/2 and 5/2, so that the assumed single particle space corresponds to the negative parity states available to an odd neutron at the end of the N = 82-126 shell, namely, P/sub 1/2/, p/sub 3/2/ and f/sub 5/2/. The region of interest thus spans the W-Pt nuclei, and since one prerequisite for an odd-A symmetry is the existence of that same symmetry in the neighboring even-even core nucleus, the odd Pt nuclei around A = 196 offer the obvious testing ground for the 0(6) limit of U(6/12). The heavier even-even W nuclei, on the other hand, have the characteristics of an axial rotor, and hence the negative parity structure of the neighboring odd W isotopes offers the possibility to study the validity of the SU(3) limit. Given a definition and understanding of these two limits, the construction of a simple description of the transitional Os nuclei can be considered

Historia i znaczenie zbiorów Biblioteki Katedry Filologii Germańskiej Uniwersytetu Mikołaja Kopernika w Toruniu – depozyt w Bibliotece Uniwersyteckiej w Toruniu

Directory of Open Access Journals (Sweden)

Wiesław Sieradzan

2014-12-01

Full Text Available Jedną z bardziej interesujących części zbiorów Biblioteki Głównej UMK jest znajdujący się tam od niedawna depozyt Biblioteki Katedry Filologii Germańskiej. Jego geneza łączy się nierozerwalnie z dziejami Uniwersytetu oraz samej Katedry, kształcącej germanistów już od ponad 40 lat. Celem autora jest poznanie tego księgozbioru, zarówno pod względem jego proweniencji, jak i wartości dla germanistów i historyków. Ważną kwestia jest ustalenie głównych twórców biblioteki germanistycznej po II wojnie światowej, jak również po reaktywacji Katedry Filologii Germańskiej w 1969 r. Depozyt Katedry Filologii Germańskiej w BG UMK liczy 7627 tomów. Już sam fakt sposobu jego powstawania, szczególnie po II wojnie światowej, głównie drogą zabezpieczania zbiorów poniemieckich, a ponadto zakupów i darów, musiał wpłynąć na różnorodność gatunkową oraz proweniencję. W depozycie daje się zauważyć mnogość ośrodków, z których nastąpiło rozproszenie zbiorów bibliotecznych. W ujęciu geograficznym jest to obszar od Greifswaldu na zachodzie po Królewiec na wschodzie. Od Gdańska i Słupska na północy aż po Dzierżoniów (Reichenbach, Świdnicę (Schweidnitz oraz Wrocław na południu. W księgozbiorze tym można wyróżnić prozę i poezję niemiecką ze szczególnym uwzględnieniem twórców z XIX i pierwszej połowy XX w., następnie opracowania krytyczne literatury niemieckiej, słowniki języka niemieckiego w tym rozmaitych jego dialektów.Ustalenia niewątpliwie autora potwierdzają tezę, że charakteryzowany księgozbiór ma niewątpliwie nie tylko ciekawą proweniencję, często udokumentowaną znakami własnościowymi w postaci pięknych exlibrisów lub superexlibrisów, ale przede wszystkim znaczną wagę dla filologów germańskich. Może bowiem stanowić cenną pomoc naukową dla badań językoznawczych i historycznych (historia Niemiec i Skandynawii. Kryje on jeszcze, pomimo powyższych ustale

PIERWIASTKI ŚLADOWE W WYBRANYCH WODACH MINERALNYCH DOSTĘPNYCH W HANDLU

Directory of Open Access Journals (Sweden)

Adam Paweł PIECH

Full Text Available Butelkowane wody mineralne stanowią istotne źródło zaspokajania zapotrzebowania na wodę w codziennej diecie człowieka. Ze względu na łatwość przyswajania przez organizm składników mineralnych zawartych w wodach mineralnych konieczne jest świadome wybieranie produktu o składzie dostosowanym do indywidualnych potrzeb. Oprócz makroskładników, których charakterystyka ilościowa zawsze widnieje na etykietach, wody mineralne zawierają również mikroelementy. Celem pracy była analiza koncentracji pierwiastków śladowych w 22 butelkowanych wodach mineralnych dostępnych w handlu na terenie Rzeszowa. Artykuł zawiera główne zagadnienia dotyczące znaczenia wody dla prawidłowego funkcjonowania organizmu oraz wpływu mikroelementów na zdrowie człowieka. W badaniach zastosowano metodę całkowitego odbicia promieniowania rentgenowskiego TXRF. Analizy wykazały obecność 18 pierwiastków śladowych w badanych wodach: Al, As, Ba, Br, Co, Cr, Cu, Fe, Ge, I, Mn, Ni, P, Rb, Se, Sr, Ti, Zn. Najwyższe stężenia mikroskładników w przeważającej większości występują w wodach leczniczych. Żadna z badanych wód mogąca służyć jako stałe źródło płynów w diecie (wody nisko-, średnio- i wysokozmineralizowane nie zawiera mikroskładników w ilości, która pozwalałaby na fizjologiczno-odżywcze oddziaływanie na organizm. Dodatkowo wykazano, że pomiędzy stężeniem bromu i germanu istnieje silna korelacja dodatnia R2 = 0,993.

21 CFR 20.113 - Voluntary product defect reports.

Science.gov (United States)

2010-04-01

... confidential commercial or financial information and in § 20.63 for personal privacy. (b) If the report is... would identify the person submitting the report and any data or information falling within the exemption... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Voluntary product defect reports. 20.113 Section...

19 CFR 200.735-113 - Miscellaneous statutory provisions.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Miscellaneous statutory provisions. 200.735-113... Government Service.” (b) Chapter 11 of Title 18, United States Code, relating to bribery, graft, and... agent of a foreign principal registered under the Foreign Agents Registration Act (18 U.S.C. 219). [31...

9 CFR 113.214 - Parvovirus Vaccine, Killed Virus (Canine).

Science.gov (United States)

2010-01-01

... REQUIREMENTS Killed Virus Vaccines § 113.214 Parvovirus Vaccine, Killed Virus (Canine). Parvovirus Vaccine... antibody against canine parvovirus to determine susceptibility. A constant virus-varying serum... vaccinates and the controls shall be challenged with virulent canine parvovirus furnished or approved by...

Project W-314 specific test and evaluation plan for 241-AN-A valve pit

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-A Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

PRZEBIEG SYMULACJI KOMPUTEROWEJ PROCESU OCZYSZCZANIA SCIEKÓW KOMUNALNYCH W REAKTORZE OSADU CZYNNEGO

Directory of Open Access Journals (Sweden)

Zbigniew KOWALEWSKI

2016-05-01

Full Text Available Celem badań było ustalenie wpływu ilości i zakresu parametrów jakości ścieków surowych na wiarygodność wyników symulacji, co umożliwiłoby ustalenie optymalnej częstotliwości ich monitoringu, niezbędnego do pozyskiwania danych do modelowania w programach ASM. W artykule przedstawiono metodykę prowadzenia symulacji komputerowej procesu oczyszczania ścieków komunalnych w reaktorach biologicznych z osadem czynnym. Zaprezentowano sposób przygotowania i przetwarzania danych wejściowych do modelu oraz sposoby oceny i weryfikacji wyników symulacji za pomocą testów statystycznych. Modelowanie było wykonane w programie BioWin na przykładzie oczyszczalni ścieków komunalnych „Kujawy” w Krakowie. W oparciu o wstępne wyniki niniejszych badań można wnioskować, że w celu uzyskania wiarygodnych wyników symulacji pracy bioreaktora w modelu ASM niezbędne jest prowadzenie monitoringu podstawowych paramentów jakości ścieków online.

Rytuksymab – miejsce w leczeniu reumatoidalnego zapalenia stawów

Directory of Open Access Journals (Sweden)

Małgorzata Tłustochowicz

2011-02-01

Full Text Available Rytuksymab jest przeciwciałem powodującym niszczenie limfocytówB zaangażowanych w proces zapalny w chorobach autoimmunologicznych.W reumatoidalnym zapaleniu stawów jest zalecanyu chorych, u których utrzymuje się aktywny proces zapalny, mimoleczenia klasycznymi lekami modyfikującymi przebieg chorobyi lekami anty-TNF-α. U tych chorych jest lekiem bardzo skutecznym,skuteczniejszym niż inny lek z grupy anty-TNF-α. Rytuksymabmoże być stosowany przez wiele lat, a jego skuteczność utrzymujesię na tym samym poziomie. Najczęstsze zdarzenia niepożądanewystępują w czasie wlewu leku, są one głównie związane z uwalnianiemcytokin z limfocytów B. Częstość i natężenie tych reakcjiznacznie się zmniejsza po premedykacji glikokortykosteroidami,a także przy kolejnych podaniach leku. Innymi powikłaniami sąinfekcje, ale ich liczba nie jest większa niż w populacji chorych nareumatoidalne zapalenie stawów. W artykule przedstawiono praktyczneaspekty kwalifikacji chorego do leczenia rytuksymabemoraz sposób przygotowania i podawania wlewu.

W/SiC X-ray multilayers optimized for use above 100 keV

DEFF Research Database (Denmark)

Windt, D.L.; Dongey, S.; Hailey, C.J.

2002-01-01

-derived optical constants, which we determined from reflectance-vs-incidence angle measurements also made using synchrotron radiation, in the range E=120 - 180 keV. We describe our experimental investigation in detail, compare the new W/SiC multilayers with both W/Si and W/B4C films that have been studied......We have developed a new depth-graded multilayer system comprising W and SiC layers, suitable for use as hard X-ray reflective coatings operating in the energy range 100 - 200 keV. Grazing incidence X-ray reflectance at E=8 keV was used to characterize the interface widths, as well as the temporal...... and thermal stability in both periodic and depth-graded W/SiC structures, while synchrotron radiation was used to measure the hard X-ray reflectance of a depth-graded multilayer designed specifically for use in the range Esimilar to150 - 170 keV. We have modeled the hard X-ray reflectance using newly...

W/SiC x-ray multilayers optimized for use above 100 keV

DEFF Research Database (Denmark)

Windt, D.L.; Donguy, S.; Hailey, C.J.

2003-01-01

optical constants, which we determined from reflectance versus incidence angle measurements also made using synchrotron radiation, in the range E = 120-180 keV. We describe our experimental investigation in detail, compare the new W/SiC multilayers with both W/Si and W/B4C films that have been studied......We have developed a new depth-graded multilayer system comprising W and SiC layers, suitable for use as hard x-ray reflective coatings operating in the energy range 100-200 keV. Grazing-incidence x-ray reflectance at E = 8 keV was used to characterize the interface widths, as well as the temporal...... and thermal stability in both periodic and depth-graded W/SiC structures, whereas synchrotron radiation was used to measure the hard x-ray reflectance of a depth-graded multilayer designed specifically for use in, the range Esimilar to150-170 keV. We have modeled the hard x-ray reflectance using newly derived...

OBLICZENIE PRZEPŁYWÓW MAKSYMALNYCH I ICH REDUKCJI W ZLEWNI ZURBANIZOWANEJ

Directory of Open Access Journals (Sweden)

Mariusz BARSZCZ

2016-03-01

Full Text Available W pracy przedstawiono wyniki zastosowania modelu SWMM do obliczenia przepływów o prawdopodobieństwach 50, 10, 2 i 1% w 8. przekrojach Potoku Służewieckiego na odcinku od km 0+000 do 6+576 oraz w 2. przekrojach Rowu Wolica. Zlewnia Potoku Służewieckiego jest zlokalizowana w południowej części Warszawy. Największe zagrożenie powodziowe występuje na odcinku Potoku Służewieckiego od km 0+000 do 3+875. Przepustowość koryta Potoku na tym odcinku kształtuje się na poziomie przepływu maksymalnego o prawdopodobieństwie 50%. Największe wartości przepływów w Potoku Służewieckim prognozowano w przekroju obliczeniowym numer V (km 4+267: Q50% = 13,863, Q10% = 23,019, Q2% = 28,825 i Q1% = 30,500 m3·s-1. Jedną z przyczyn występowania zagrożenia powodziowego w dolnym biegu Potoku Służewieckiego jest dopływ dużej ilości wód opadowych Rowem Wolica. Wartości przepływów w górnym odcinku Rowu Wolica (w przekroju VI zawierały się w granicach od 8,005 do 12,402 m3·s-1, w zależności od prawdopodobieństwa wystąpienia opadu obliczeniowego. W celu określenia możliwości redukcji przepływów w Rowie Wolica, przeprowadzono obliczenia w których uwzględniono zastosowanie kryzy na odcinku ujściowym kolektora do kanału otwartego. Zastosowanie kryzy w kolektorze pozwoli zredukować przepływy o prawdopodobieństwach 50, 10 i 2% odpowiednio o 61,0; 46,0 i 36,6%. Zastosowanie kryzy o stałej średnicy ϕ1,08 m, ustalonej dla przepływu o prawdopodobieństwie 2%, spowoduje znacznie mniejszą redukcję przepływów maksymalnych o prawdopodobieństwach 50 i 10%.

Scyntygrafia kości w diagnostyce reumatoidalnego zapalenia stawów

Directory of Open Access Journals (Sweden)

Witold Tłustochowicz

2010-04-01

Full Text Available Celem pracy była ocena przydatności trójfazowej dynamicznejscyntygrafii kości w diagnostyce reumatoidalnego zapalenia stawów.Badaniem objęto 39 chorych hospitalizowanych i diagnozowanychz powodu dolegliwości stawowych. Przeprowadzono diagnostykęobejmującą: badanie podmiotowe, przedmiotowe, badania laboratoryjneoraz obrazowe, w tym trójfazową scyntygrafię kości z użyciemtechnetu 99m. Scyntygraficzne cechy zapalenia stawówstwierdzano, gdy obserwowano wzmożone gromadzenie znacznikawe wszystkich trzech fazach badania.Po ukończeniu diagnostyki rozpoznano u 13 chorych wczesne reumatoidalnezapalenie stawów, u 4 reumatoidalne zapalenie stawów(łącznie 17 pacjentów, a u 1 niezróżnicowane zapalenie stawów.Scyntygrafia kości wykazała cechy zapalenia stawów u 13spośród nich (72,2%, u 4 osób (22,2% wzmożone gromadzeniestwierdzono tylko w fazie statycznej, a u 1 pacjenta (5,6% uzyskanoprawidłowy wynik badania. U 21 chorych wykluczono chorobęzapalną stawów (u 19 rozpoznano fibromialgię, u 2 chorobęzwyrodnieniową. W grupie bez zapalenia stawów u 14 pacjentów(66,6% nie stwierdzono istotnych nieprawidłowości w obraziescyntygraficznym, u 6 (28,6% występowało wzmożone gromadzenieznacznika w badaniu statycznym, a u 1 chorego (4,8% opisanoscyntygraficzne cechy zapalenia stawów.Wbadanej grupie czułość scyntygrafii dynamicznej kości w wykrywaniuzapalenia stawów wynosiła 72,2% (95% CI: 57,5–76,8, a swoistość 95,2% (95% CI: 82,8–99,1. Dodatni wynik badaniadynamicznego wskazuje z dużym prawdopodobieństwem naobecność zapalenia stawów [PPV 92,9% (95% CI: 74,2–98,7].Mniej wiarygodny był ujemny wynik badania [NPV 80% (95% CI:69,5–83,3]. Wyniki niniejszej pracy wskazują, że trójfazowa scyntygrafia dynamicznakości może mieć zastosowanie w diagnostyce reumatoidalnegozapalenia stawów.

Sc-W-Si and Sc-W-Ge ternary systems

International Nuclear Information System (INIS)

Kotur, B.Ya.; Voznyak, O.M.; Bodak, O.I.

1989-01-01

Phase equilibria in Sc-W-Si and Sc-W-Ge ternary systems are investigated at 1070 K. Sc 2+x W 3-x Si 4 ternary compound (0≤x≤1) is determined, its crystal structure (Ce 2 Sc 3 Si 4 structural type), as well as, change of elementary cell parameters and microhardness within homogeneity range are determined. Regularities of component interaction within Sc-M-Si(Ge) (M-Cr, Mo, W) ternary system are determined. Ternary systems with Mo and W are more closer to each other according to the phase equilibria character, than to ternary systems with Cr

Yeast Interacting Proteins Database: YKR083C, YDR201W [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available YKR083C DAD2 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...1W SPC19 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force ...on Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by M

Budownictwo sakralne w diecezji łódzkiej w latach 1945-1989

OpenAIRE

Opaliński, Mateusz

2017-01-01

Tematem niniejszej rozprawy jest budownictwo sakralne w diecezji łódzkiej w latach 1945–1989. Omawiana kwestia jest emanacją ogólnego konfliktu między Kościołem rzymskokatolickim a władzami państwowymi w tzw. Polsce Ludowej. Potrzeba wznoszenia nowych miejsc sprawowania kultu religijnego była istotna z punktu widzenia Episkopatu, a także zasadna biorąc pod uwagę zmiany, jakie zaszły po 1945 r. w strukturze demograficznej i wyznaniowej. Wznoszenie obiektów sakralnych było wówczas znakiem zarów...

Wykorzystanie efficiency matrix w analizie zysku na pracownika (na przykładzie MŚP w sektorze informatycznym w Estonii

Directory of Open Access Journals (Sweden)

Paavo Siimann

2015-10-01

Full Text Available Przedsiębiorstwa usługowe osiągają zyski dzięki wykorzystaniu zdolności i wiedzy pracowników. Stąd miara taka jak zysk na pracownika może być użyta w celu maksymalizacji wyników finansowych i wartości firmy. Artykuł obejmuje badanie z wykorzystaniem zmiennych: liczba pracowników, wysokość kapitału własnego, kapitału obcego, kosztów operacyjnych, przychodów netto ze sprzedaży oraz zysku przed opodatkowaniem w celu oszacowania ich wpływu na zmianę zysku na pracownika. Do próby badawczej wybrano małe i średnie przedsiębiorstwa z sektora informatycznego łącznie i jako osobne grupy. Badanie objęło lata 2009–2013. Co więcej, artykuł wskazuje, że metoda efficiency matrix rozwijana od początku lat 60. w Rosji i Estonii do lat 90. ubiegłego wieku może być stosowana także obecnie. Badania wykazały, że marża brutto oraz wartość kapitału własnego wzrastały gwałtownie w analizowanym okresie. Zysk na pracownika był mniejszy w średnich firmach, a większy w przedsiębiorstwach małych, podczas gdy kapitał własny na pracownika, przychody netto ze sprzedaży w stosunku do kosztów operacyjnych oraz marża brutto były mniejsze w małych firmach.

I. Redox chemistry of bimetallic fulvalene complexes II. Oligocyclopentadienyl complexes

Energy Technology Data Exchange (ETDEWEB)

Brown, David Stephen [Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Lawrence Berkeley Lab., CA (United States). Chemical Sciences Div.

1993-11-01

The electrochemistry of the heterobimetallic complexes (fulvalene)WFe(CO)₅ (30) and (fulvalene)WRu(CO)₅ (31) has been investigated. Compound 30 is reduced in two one-electron processes, and this behavior was exploited synthetically to prepare a tetranuclear dimer by selective metal reduction. Complex 31 displayed a distinction between the metals upon reoxidation of the dianion, allowing the formation of a dimer by selective metal anion oxidation. The redox behavior of 30 led to an investigation of the use of electrocatalysis to effect metal-specific ligand substitution. It was found that reduction of 30 with a catalytic amount of CpFe(C₆Me₆) (97) in the presence of excess P(OMe)₃ or PMe₅ led to the formation of the zwitterions (fulvalene)[W(CO)₃^-][Fe(CO)PR₃⁺] (107, R = P(OMe)₃; 108, R = PMe₃). Compound 31 also displayed unique behavior with different reducing agents, as the monosubstituted zwitterion (fulvalene)[W(CO)₃^-][Ru(CO)₂(PMe₃⁺] was obtained when 97 was used while the disubstituted complex (fulvalene) [W(CO)₃^-] [Ru(CO)(PMe₃)₂⁺] was produced when Cp*Fe(C₆Me₆) was the catalyst. Potential synthetic routes to quatercyclopentadienyl complexes were also explored. Various attempts to couple heterobimetallic fulvalene compounds proved to be unsuccessful. 138 refs.

Two Instances of Mundus Inversus in Psalm 113

Directory of Open Access Journals (Sweden)

A. Basson

2009-07-01

Full Text Available The psalms often praise Yahweh for his transformative and restorative interventions both in the past and in all times. They portray the deity as the one who offers protection to the weak and defenceless members of society. He uplifts the downtrodden and affords them a place in structure where they gain a new status. In Psalm 113:7-9, Yahweh changes the circumstances of the poor and needy and the childless woman. Social outcasts have their dignity and honour restored. This article explicates these divine acts in terms of the topos of mundus inversus (world-upside down. This cultural phenomenon, which finds expression in artistic, socio-political and religious spheres, accentuates the possibility of another reality by inverting the status quo. Psalm 113 praises Yahweh as the incomparable God who inverts the situation of those condemned to a life of suffering. His incomparability is linked with his power to create a mundus inversus in which the poor and needy have a banquet with nobles and a barren woman takes pleasure in motherhood.

Upwelling Index, 24N 113W, 6-hourly

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Upwelling index computed from 1-degree FNMOC sea level pressure for 15 locations off the North American West Coast at each 3 degrees of latitude from 21N to 60N. The...

Przestrzeń liturgiczna w kaplicach krzyżackich domów zakonnych w Prusach - zarys problematyki

OpenAIRE

Rozynkowski, Waldemar

2018-01-01

Z założenia każdy krzyżacki dom zakonny pełnił przede wszystkim funkcje klasztorne. Chociaż w historiografii dominuje akcentowanie cech warownych tych miejsc, to jednak nie możemy mieć wątpliwości, że krzyżacki zamek tworzył wybraną przestrzeń, która miała ułatwić zakonnikom, zarówno kapłanom jak i braciom rycerzom, spełnianie obowiązków zakonnych oraz służyć organizacji życia wspólnotowego. W konsekwencji krzyżacki dom zakonny miał pomóc każdemu z jego mieszkańców w osiągnięciu zbawienia. ...

Hydrophilic Surface Modification of PDMS Microchannel for O/W and W/O/W Emulsions

Directory of Open Access Journals (Sweden)

Shazia Bashir

2015-09-01

Full Text Available A surface modification method for bonded polydimethylsiloxane (PDMS microchannels is presented herein. Polymerization of acrylic acid was performed on the surface of a microchannel using an inline atmospheric pressure dielectric barrier microplasma technique. The surface treatment changes the wettability of the microchannel from hydrophobic to hydrophilic. This is a challenging task due to the fast hydrophobic recovery of the PDMS surface after modification. This modification allows the formation of highly monodisperse oil-in-water (O/W droplets. The generation of water-in-oil-in-water (W/O/W double emulsions was successfully achieved by connecting in series a hydrophobic microchip with a modified hydrophilic microchip. An original channel blocking technique to pattern the surface wettability of a specific section of a microchip using a viscous liquid comprising a mixture of honey and glycerol, is also presented for generating W/O/W emulsions on a single chip.

ATLAS Event Display: a W boson decays into one muon and one neutrino

CERN Multimedia

ATLAS Collaboration

2017-01-01

Display of a candidate event for a W boson decaying into one muon and one neutrino from proton-proton collisions recorded by ATLAS with LHC stable beams at a collision energy of 7 TeV. The muon (red line) has a transverse momentum of 32.8 GeV and the missing transverse energy is 52.4 GeV (cyan blue line), resulting in a transverse mass of 82.9 GeV of the di-lepton system. Little hadronic activity is measured, indicating a small transverse momentum of the W boson candidate. The event was recorded in June 2011 and was used for the measurement of the W boson mass. Event details: Run Number 183081, Event Number 101291517

Improved prediction for the mass of the W boson in the NMSSM

International Nuclear Information System (INIS)

Staal, O.; Zeune, L.

2015-10-01

Electroweak precision observables, being highly sensitive to loop contributions of new physics, provide a powerful tool to test the theory and to discriminate between different models of the underlying physics. In that context, the W boson mass, M W , plays a crucial role. The accuracy of the M W measurement has been significantly improved over the last years, and further improvement of the experimental accuracy is expected from future LHC measurements. In order to fully exploit the precise experimental determination, an accurate theoretical prediction for M W in the Standard Model (SM) and extensions of it is of central importance. We present the currently most accurate prediction for the W boson mass in the Next-to-Minimal Supersymmetric extension of the Standard Model (NMSSM), including the full one-loop result and all available higher-order corrections of SM and SUSY type. The evaluation of M W is performed in a flexible framework, which facilitates the extension to other models beyond the SM. We show numerical results for the W boson mass in the NMSSM, focussing on phenomenologically interesting scenarios, in which the Higgs signal can be interpreted as the lightest or second lightest CP-even Higgs boson of the NMSSM. We find that, for both Higgs signal interpretations, the NMSSM M W prediction is well compatible with the measurement. We study the SUSY contributions to M W in detail and investigate in particular the genuine NMSSM effects from the Higgs and neutralino sectors.

Flow film boiling heat transfer in water and Freon-113

International Nuclear Information System (INIS)

Liu, Qiusheng; Shiotsu, Masahiro; Sakurai, Akira

2002-01-01

Experimental apparatus and method for film boiling heat transfer measurement on a horizontal cylinder in forced flow of water and Freon-113 under pressurized and subcooled conditions were developed. The experiments of film boiling heat transfer from single horizontal cylinders with diameters ranging from 0.7 to 5 mm in saturated and subcooled water and Freon-113 flowing upward perpendicular to the cylinders were carried out for the flow velocities ranging from 0 to 1 m/s under system pressures ranging from 100 to 500 kPa. Liquid subcoolings ranged from 0 to 50 K, and the cylinder surface superheats were raised up to 800 K for water and 400 K for Freon-113. The film boiling heat transfer coefficients obtained were depended on surface superheats, flow velocities, liquid subcoolings, system pressures and cylinder diameters. The effects of these parameters were systematically investigated under wider ranges of experimental conditions. It was found that the heat transfer coefficients are higher for higher flow velocities, subcoolings, system pressures, and for smaller cylinder diameters. The observation results of film boiling phenomena were obtained by a high-speed video camera. A new correlation for subcooled flow film boiling heat transfer was derived by modifying authors' correlation for saturated flow film boiling heat transfer with authors' experimental data under wide subcooled conditions. (author)

Raport z badania 2016. Specjalne Strefy Ekonomiczne w Polsce w oczach przedsiębiorców i pracowników samorządów

OpenAIRE

Pastusiak, Radosław; Jasiniak, Magdalena; Keller, Jakub; Krzeczewski, Bartłomiej

2016-01-01

Niniejszy raport prezentuje wyniki projektu realizowanego w ramach projektu badawczego nr UMO-2013/09/B/HS4/, pt. Efektywność Specjalnych Stref Ekonomicznych, przez zespół Katedry Finansów Korporacji, Wydział Ekonomiczno-Socjologiczny Uniwersytetu Łódzkiego, pod kierownictwem dr hab. Radosława Pastusiaka, prof. nadzw. UŁ. w składzie: dr Magdalena Jasiniak, mgr Jakub Keller, mgr Bartłomiej Krzeczewski. Zasadniczym celem badania było określenie efektywności funkcjonowania Specjalnych Stref Ekon...

Lenin w Anglii

Directory of Open Access Journals (Sweden)

Mario Tronti

2016-06-01

Full Text Available Lenin w Anglii to słynny tekst Trontiego otwierający pierwszy numer czasopisma Classe operaia, założonego po tym, jak Tronti wraz ze współpracownikami zerwał ze środowiskiem pierwszego operaizmu skupionego wokół Quaderni Rossi. To właśnie w tym tekście Tronti sformułował słynny „kopernikański zwrot w marksizmie”, zgodnie z którym punktem wyjścia analizy rzeczywistości społecznej i historii kapitalizmu powinna być walka klasy robotniczej, a nie prawa rozwoju kapitału. Do zdefiniowania zwrotu popchnęła Trontiego przedstawiona w tekście diagnoza sytuacji włoskiej klasy robotniczej w latach 60. Kontrowersyjne tezy Trontiego i jego radykalna postawa wpłynęły znacząco na dyskusje prowadzone na radykalnej włoskiej lewicy i na działania wielu aktywistów w latach 60. i 70.

Signatures of Parton Exogamy in e+ e- -> W+ W- -> hadrons

OpenAIRE

Ellis, John; Geiger, Klaus

1997-01-01

We propose possible signatures of `exogamous' combinations between partons in the different W+ and W- hadron showers in e+e- -> W+W- events with purely hadronic final states. Within the space-time model for hadronic shower development that we have proposed previously, we find a possible difference of about 10 % between the mean hadronic multiplicity in such purely hadronic final states and twice the hadronic multiplicity in events in which one W decays hadronically and the other leptonically,...

Physical states and scaling properties of W gravities and W strings

International Nuclear Information System (INIS)

Das, S.R.; Dhar, A.; Rama, S.K.

1992-01-01

In this paper the authors discuss some physical aspects of W gravities and W strings. The authors identify global characteristics in W gravities (in addition to the usual Euler characteristic) and show how the dependence of the partition function on the various chemical potentials involves these quantities. The authors find the operators which create physical states in W 3 and W 4 gravities and discuss their relationship with screening operators. W strings are discussed in the framework of a natural way of coupling matter to W gravity, and the issues of extra dimensions and critical dimensions are clarified. The authors find a remarkable relationship between pure W gravities and ordinary gravity coupled to c < 1 unitary minimal models

Etyka w zawodzie specjalisty rachunkowości zarządczej w podręcznikach i kształceniu w Polsce

Directory of Open Access Journals (Sweden)

Irena Sobańska

2016-07-01

Full Text Available Celem artykułu jest poznanie, jak środowisko naukowe rachunkowości wspiera zawód specjalisty ra- chunkowości zarządczej w uświadamianiu wysokich wymagań etycznych oczekiwanych od tego zawo- du. W artykule zostały przedstawione zagadnienia dotyczące etyki w zawodzie specjalisty rachunkowości zarządczej w świetle badań i standardów międzynarodowych oraz wyniki i wnioski z badań treści pol- skich podręczników akademickich i programów kształcenia. Przeprowadzone badania pozwoliły pozy- tywnie zweryfikować postawioną hipotezę, mówiącą, że w procesie kształcenia akademickiego zagad- nienia etyki zawodu specjalisty rachunkowości zarządczej nie są w ogóle lub w minimalnym zakresie objaśniane. Stanowi to wskazówkę do udoskonalenia programów kształcenia w badanym zakresie na uczelniach wyższych w Polsce.

VizieR Online Data Catalog: SG1120-1202 members HST imaging & 24um fluxes (Monroe+, 2017)

Science.gov (United States)

Monroe, J. T.; Tran, K.-V. H.; Gonzalez, A. H.

2017-09-01

We employ HST imaging of an ~8'x12' mosaic across three filters: F390W (WFC3/UVIS), F606W (ACS/WFC), and F814W (ACS/WFC) for a total of 44 pointings (combined primary and parallels) during cycles 14 (GO 10499) and 19 (GO 12470). We use the Spitzer MIPS 24um fluxes from Saintonge+ (2008ApJ...685L.113S) and Tran+ (2009ApJ...705..809T). The 24um observations were retrieved from the Spitzer archive. For details on spectroscopy from multi-band ground-based observations using Magellan (in 2006), MMT, and VLT/VIMOS (in 2003), we refer the reader to Tran+ (2009ApJ...705..809T). (1 data file).

FERMI LARGE AREA TELESCOPE DISCOVERY OF GeV GAMMA-RAY EMISSION FROM THE VICINITY OF SNR W44

Energy Technology Data Exchange (ETDEWEB)

Uchiyama, Yasunobu; Funk, Stefan; Katsuta, Junichiro [SLAC National Accelerator Laboratory, 2575 Sand Hill Road M/S 29, Menlo Park, CA 94025 (United States); Katagiri, Hideaki [College of Science, Ibaraki University, 2-1-1, Bunkyo, Mito 310-8512 (Japan); Lemoine-Goumard, Marianne [Centre d' Etudes Nucleaires de Bordeaux Gradignan, Universite Bordeaux 1, CNRS/IN2p3, 33175 Gradignan (France); Tajima, Hiroyasu; Tanaka, Takaaki [Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, CA 94305 (United States); Torres, Diego F., E-mail: uchiyama@slac.stanford.edu [Institut de Ciencies de l' Espai (IEEE-CSIC), Campus UAB, 08193 Barcelona (Spain)

2012-04-20

We report the detection of GeV {gamma}-ray emission from the molecular cloud complex that surrounds the supernova remnant (SNR) W44 using the Large Area Telescope on board Fermi. While the previously reported {gamma}-ray emission from SNR W44 is likely to arise from the dense radio-emitting filaments within the remnant, the {gamma}-ray emission that appears to come from the surrounding molecular cloud complex can be ascribed to the cosmic rays (CRs) that have escaped from W44. The non-detection of synchrotron radio emission associated with the molecular cloud complex suggests the decay of {pi}{sup 0} mesons produced in hadronic collisions as the {gamma}-ray emission mechanism. The total kinetic energy channeled into the escaping CRs is estimated to be W{sub esc} {approx} (0.3-3) Multiplication-Sign 10{sup 50} erg, in broad agreement with the conjecture that SNRs are the main sources of Galactic CRs.

Study of Spin and Decay-Plane Correlations of W Bosons in the $e^{+} e^{-} \\to W^{+} W^{-}$ Process at LEP

CERN Document Server

Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kraber, M; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

2005-01-01

Data collected at LEP at centre-of-mass energies \\sqrt(s) = 189 - 209 GeV are used to study correlations of the spin of W bosons using e+e- -> W+W- -> lnqq~ events. Spin correlations are favoured by data, and found to agree with the Standard Model predictions. In addition, correlations between the W-boson decay planes are studied in e+e- -> W+W- -> lnqq~ and e+e- -> W+W- -> qq~qq~ events. Decay-plane correlations, consistent with zero and with the Standard Model predictions, are measured.

Electron Identification Performance and First Measurement of $W \\to e + \

CERN Document Server

Ueno, Rynichi

2010-01-01

The identification of electrons is important for the ATLAS experiment because electrons are present in many interactions of interest produced at the Large Hadron Collider. A deep knowledge of the detector, the electron identification algorithms, and the calibration techniques are crucial in order to accomplish this task. This thesis work presents a Monte Carlo study using electrons from the W —> e + v process to evaluate the performance of the ATLAS electromagnetic calorimeter. A significant number of electrons was produced in the early ATLAS collision runs at centre-of-mass energies of 900 GeV and 7 TeV between November 2009 and April 2010, and their properties are presented. Finally, a first measurement of W —> e + v process with the ATLAS experiment was successfully accomplished with the first C = 1.0 nb_ 1 of data at the 7 TeV collision energy, and the properties of the W candidates are also detailed.

Measurement of the W boson mass with the ATLAS detector

CERN Document Server

Balli, Fabrice; The ATLAS collaboration

2017-01-01

A precise measurement of the mass of the W boson mass represents an important milestone to test the overall consistency of the Standard Model. Since the discovery of a Higgs Boson, the W boson mass is predicted to 7 MeV precision, while the world average of all measurements is 15 MeV, making the improved measurement an important goal. The ATLAS experiment at the LHC represents an ideal laboratory for such a precise measurement. Large samples of many millions of leptonic decays of W and Z bosons were collected with efficient single lepton triggers in the 7 TeV data set corresponding to an integrated luminosity of 4.6/fb. With these samples the detector and physics modelling has been studied in great detail to enable a systematic uncertainty on the measurement that approaches the statistical power of the data of 7 MeV per decay channel as far as possible.

Measurement of the W boson mass with the ATLAS detector

CERN Document Server

Camarda, Stefano; The ATLAS collaboration

2017-01-01

A precise measurement of the mass of the W boson represents an important milestone to test the overall consistency of the Standard Model. Since the discovery of a Higgs Boson, the the W boson mass is predicted to 7 MeV precision, while the world average of all measurements is 15 MeV, making the improved measurement an important goal. The ATLAS experiment at the LHC represents an ideal laboratory for such a precise measurement. Large samples of many millions of leptonic decays of W and Z bosons were collected with efficient single lepton triggers in the 7 TeV data set corresponding to an integrated luminosity of 4.6/fb. With these samples the detector and physics modelling has been studied in great detail to enable a systematic uncertainty on the measurement that approaches the statistical power of the data of 7 MeV per decay channel as far as possible.

Design study of wind turbines 50 kW to 3000 kW for electric utility applications: Analysis and design

Science.gov (United States)

1976-01-01

In the conceptual design task, several feasible wind generator systems (WGS) configurations were evaluated, and the concept offering the lowest energy cost potential and minimum technical risk for utility applications was selected. In the optimization task, the selected concept was optimized utilizing a parametric computer program prepared for this purpose. In the preliminary design task, the optimized selected concept was designed and analyzed in detail. The utility requirements evaluation task examined the economic, operational, and institutional factors affecting the WGS in a utility environment, and provided additional guidance for the preliminary design effort. Results of the conceptual design task indicated that a rotor operating at constant speed, driving an AC generator through a gear transmission is the most cost effective WGS configuration. The optimization task results led to the selection of a 500 kW rating for the low power WGS and a 1500 kW rating for the high power WGS.

Potencjał olejków eterycznych w profilaktyce i terapii grzybic

Directory of Open Access Journals (Sweden)

Monika Sienkiewicz

2008-10-01

Full Text Available Silne właściwości antyseptyczne olejków eterycznych znane są od wielu wieków. Są one produktami metabolizmu wtórnego roślin. Olejki eteryczne i ich składniki wykazują działanie hamujące wzrost wobec bakterii, grzybów, wirusów i pierwotniaków. Ich aktywność przeciwdrobnoustrojowa jest ściśle związana ze składem chemicznym. Do tej pory nie odnotowano doniesień o rosnącej oporności szczepów bakterii i grzybów na składniki olejków. Olejki eteryczne wykazują m.in. właściwości przeciwzapalne, przeciwbólowe i antyoksydacyjne. Do najbardziej skutecznych olejków o najsilniejszych właściwościach przeciwgrzybiczych należą olejki pozyskiwane z drzewa herbacianego, tymianku, oregano, cząbru, bazylii, szałwi, goździkowca i cynamonowca. Największą aktywnością charakteryzują się olejki zawierające fenole – tymol, karwakrol i eugenol. Olejki tymiankowy, oreganowy i cząbrowy zawierają tymol i karwakrol, natomiast pozyskiwane z goździkowca i z liści cynamonowca zawierają eugenol. Jeden z najbardziej efektywnych olejków jest pozyskiwany z drzewa herbacianego (Melaleuca alternifolia. Olejek ten wykazuje wysoką aktywność wobec Candida sp., Trichophyton sp. i Microsporum sp. Olejki tymiankowy, oreganowy i rozmarynowy ze względu na szerokie spektrum aktywności mogą być polecane w leczeniu zakażeń wywoływanych przez Candida albicans, Trichophyton sp., Epidermophyton floccosum i Microsporum canis. Olejek goździkowy i cynamonowy z liści wykazują znaczące działanie hamujące wobec Aspergillus flavus, Aspergillus parasiticus, Candida albicans i Cryptococcus neoformans. Olejki eteryczne oraz ich składniki mogą posiadać silne działanie immunostymulujące, zaliczamy do nich: olejek sosnowy, cytrynowy, geraniowy, a-pinen. Olejki eteryczne znalazły zastosowanie w leczeniu infekcji dermatologicznych pochodzenia grzybiczego. Dobre wyniki przynosi również stosowanie olejków w ginekologii i w terapii

On colour rearrangement in hadronic W+W- events

International Nuclear Information System (INIS)

Sjoestrand, T.; Khoze, V.A.

1994-01-01

We discuss the possibility of colour rearrangement in e + e - →W + W - →q 1 anti q 2 q 3 anti q 4 events, i.e. that the original colour singlets q 1 anti q 2 and q 3 anti q 4 may be transmuted, for instance, into new singlets q 1 anti q 4 and q 3 anti q 2 . The effects on event properties could be quite large if such a rearrangement would occur instantaneously, so that gluon emission would be restricted to each of the new singlets separately. We argue that such a scenario is unlikely for two reasons. Firstly, the W + and W - usually decay at separate times after the W + W - production, which leads to large relative phases for energetic radiation off the two constituents of a rearranged system, and a corresponding dampening of the QCD cascades. Secondly, within the perturbative scenario the colour transmutation appears only in order α s 2 and is colour-suppressed. Colour reconnection at longer time scales is quite feasible, however, and may affect the fragmentation phase. If so, the nature of non-perturbative QCD can be probed in a new way. We formulate several alternative toy models and use these to estimate the colour reconnection probability as a function of the event kinematics. Possible consequences for LEP 2 events are illustrated, with special attention to systematic errors in W mass determinations. (orig.)

Effects of the small molecule HERG activator NS1643 on Kv11.3 channels.

Directory of Open Access Journals (Sweden)

Arne Bilet

Full Text Available NS1643 is one of the small molecule HERG (Kv11.1 channel activators and has also been found to increase erg2 (Kv11.2 currents. We now investigated whether NS1643 is also able to act as an activator of Kv11.3 (erg3 channels expressed in CHO cells. Activation of rat Kv11.3 current occurred in a dose-dependent manner and maximal current increasing effects were obtained with 10 µM NS1643. At this concentration, steady-state outward current increased by about 80% and the current increase was associated with a significant shift in the voltage dependence of activation to more negative potentials by about 15 mV. In addition, activation kinetics were accelerated, whereas deactivation was slowed. There was no significant effect on the kinetics of inactivation and recovery from inactivation. The strong current-activating agonistic effect of NS1643 did not result from a shift in the voltage dependence of Kv11.3 channel inactivation and was independent from external Na(+ or Ca(2+. At the higher concentration of 20 µM, NS1643 induced clearly less current increase. The left shift in the voltage dependence of activation reversed and the voltage sensitivity of activation dramatically decreased along with a slowing of Kv11.3 channel activation. These data show that, in comparison to other Kv11 family members, NS1643 exerts distinct effects on Kv11.3 channels with especially pronounced partial antagonistic effects at higher concentration.

Superconductivity in the W-Tc and W2C-Tc systems

International Nuclear Information System (INIS)

Giorgi, A.L.

1985-01-01

A series of compositions in the W-Tc, W 2 C-Re and W 2 C-Tc systems were prepared and examined for superconductivity. The crystal structure, lattice parameters and superconducting transition temperatures of the W 2 C-Tc are reported for the first time. Similar measurements were made on the W-Tc and W 2 C-Re systems and the results compared with previous published results for these systems. 7 refs., 2 figs., 2 tabs

Enzymatic in-situ generation of H2O2 for decolorization of Acid Blue 113 by fenton process

Directory of Open Access Journals (Sweden)

Karimi Afzal

2012-01-01

Full Text Available Decolorization of Acid Blue 113 in an aqueous medium by bio-Fenton process has been investigated in this research. Enzymatic oxidation of glucose was performed to in-situ generation of H2O2 which was employed to react with Fe2+ for producing hydroxyl radicals. The effect of various parameters include concentrations of 113, glucose, and FeSO4, activity of glucose oxidase (GOx and the effect of pH were assessed. The highest decolorization of AB 113 were achieved at Fe2+ concentration of 0.2 mmol/L, pH =4.0, glucose concentration of 0.018 mol/L, and glucose oxidase activity of 2500 U/L in the constant temperature (23 ±0.1ºC and constant shaking rate (160 r/min, while the concentration of 113 was 40 mg/L. In these conditions, 113 decolorization efficiency after 60 min was obtained about 95%.

9 CFR 113.204 - Mink Enteritis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mink Enteritis Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.204 Mink Enteritis Vaccine, Killed Virus. Mink Enteritis Vaccine...

9 CFR 113.212 - Bursal Disease Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bursal Disease Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.212 Bursal Disease Vaccine, Killed Virus. Bursal Disease Vaccine...

27 CFR 20.113 - Proprietary solvents general-use formula.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Proprietary solvents... Formulas and Statements of Process General-Use Formulas § 20.113 Proprietary solvents general-use formula. (a) A proprietary solvent is any article made with any other ingredients combined with the...

Preparation and evaluation of a self-nanoemulsifying drug delivery system loaded with Akebia saponin D–phospholipid complex

Directory of Open Access Journals (Sweden)

Shen J

2016-09-01

monooleate [type 40], Cremophor® EL (Polyoxyl 35 castor oil, and Transcutol HP (Diethylene glycol monoethyl ether were selected as oil, surfactant, and cosurfactant, respectively. The optimal formulation was composed of Glyceryl monooleate (type 40, Polyoxyl 35 castor oil, Diethylene glycol monoethyl ether, and APC (1:4.5:4.5:1.74, w/w/w/w, which showed a particle size of 148.0±2.7 nm and a zeta potential of -13.7±0.92 mV after dilution with distilled water at a ratio of 1:100 (w/w and good colloidal stability. Pharmacokinetic studies showed that APC-SNEDDS exhibited a significantly greater Cmax1 (733.4±203.8 ng/mL than ASD (437.2±174.2 ng/mL, and a greater Cmax2 (985.8±366.6 ng/mL than ASD (180.5±75.1 ng/mL and APC (549.7±113.5 ng/mL. Compared with ASD, Tmax1 and Tmax2 were both remarkably shortened by APC-SNEDDS. The oral bioavailability in rats was enhanced significantly to 183.8% and 431.8% by APC and APC-SNEDDS, respectively.Conclusion: These results indicated that APC-SNEDDS was a promising drug delivery system to enhance the oral bioavailability of ASD. Keywords: Akebia saponin D, phospholipid complex, self-nanoemulsifying drug delivery systems, oral bioavailability

Structure characterization of nanocrystalline Ni–W alloys obtained by electrodeposition

Energy Technology Data Exchange (ETDEWEB)

Indyka, P., E-mail: paulina.indyka@uj.edu.pl [Jagiellonian University, Faculty of Chemistry, 3 Ingardena St., 30-059 Krakow (Poland); Beltowska-Lehman, E.; Tarkowski, L.; Bigos, A. [Institute of Metallurgy and Materials Science, Polish Academy of Sciences, 25 Reymonta St., 30-059 Krakow (Poland); García-Lecina, E. [Surface Finishing Department, CIDETEC-IK4 – Centre for Electrochemical Technologies, P° Miramón 196, 20009 Donostia-San Sebastián (Spain)

2014-03-25

Highlights: • Ni–W alloy coatings were electrodeposited from an aqueous electrolyte solutions. • The microstructure was studied with respect to electrodeposition process parameters. • We report optimal plating conditions for crack-free, nanocrystalline Ni–W coatings. • Crystalline Ni–W coatings exhibited the phase structure of an α-Ni(W) solid solution. • Coatings revealed tensile residual stresses and weakly pronounced 〈1 1 0〉 fiber texture. -- Abstract: Ni–W coatings of different tungsten content (2–50 wt%) were electrodeposited on a steel substrates from an aqueous complex sulfate–citrate galvanic baths, under controlled hydrodynamic conditions in a Rotating Disk Electrode (RDE) system. The optimum conditions for the electrodeposition of crack-free, homogeneous nanocrystalline Ni–W coatings were determined on the basis of the microstructure investigation results. The XRD structural characterizations of Ni–W alloy coatings obtained under different experimental conditions were complemented by SEM and TEM analysis. Results of the study revealed that the main factor influencing the microstructure formation of the Ni–W coatings is the chemical composition of an electrolyte solution. X-ray and electron diffraction patterns of all nanocrystalline Ni–W coatings revealed mainly the fcc phase structure of an α-Ni(W) solid solution with a lattice parameter increased along with tungsten content. The use of additives in the plating bath resulted in the formation of equiaxial/quasifibrous, nanocrystalline Ni–W grains of an average size of about 10 nm. The coatings were characterized by relatively high tensile residual stresses (500–1000 MPa), depending on the electrodeposition conditions. Ni–W coatings exhibited weakly pronounced fiber type 〈1 1 0〉 crystallographic texture, consistent with the symmetry of the plating process. Coatings of the highest tungsten content 50 wt% were found to be amorphous.

Detailed Surgical Anatomy of Prostate: Relationship between Urethra and Dorsal Vein Complex with Apex.

Science.gov (United States)

Tunc, Lutfi; Akin, Yigit; Gumustas, Huseyin; Ak, Esat; Peker, Tuncay; Veneziano, Domenico; Guneri, Cagri

2016-01-01

To describe our surgical technique for dissecting the apex of prostate during robotic-assisted laparoscopic radical prostatectomy (RALP) and detailed surgical anatomy of prostate including relationship between urethra and dorsal vein complex with apex. In retrospective view of prospective collected data, 73 patients underwent RALP between December 2012 and September 2014. Surgical anatomy of prostate was revealed in all procedures. Quality of life (QoL) scores were assessed before, immediately after catheter removal, and 1 month after surgery. We divided urinary continence into 3 groups, as very early continence; continence at time of urethral catheter removal, early continent; and continence 1 month after surgery. The rest of the patients were accepted as continence. The mean follow-up was 10.2 ± 5.4 months and mean age was 61.5 ± 6.6. Maximum protection of urethra could be provided in all. Mean catheter removal was 8.9 ± 1.7 days, and all patients were continent at the time of catheter removal. QoL scores before RALP could be protected after surgery (p = 0.2). Neither conversion to open/conventional laparoscopic surgery nor complications related with bladder neck were detected. Our surgical technique can be a strong candidate for being a surgical technique for preserving urethra and very early continence could be provided after surgery. © 2016 S. Karger AG, Basel.

Generator 113{sup S}n-113m{sup I}n. Study of the most important characteristics in the evaluate composition for the preparation of clinical labelled compounds; Generador de 113{sup S}n- 113m{sup I}n. Estudio de las caracteristicas mas relevantes en la composicion del eluido con miras a la obtencion de compuestos marcados de aplicacion clinica

Energy Technology Data Exchange (ETDEWEB)

Adan, L; Rebollo, D V

1978-07-01

The design for the construction of a generator 113{sup S}n -113m{sup l}n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs.

Description of new element Z=113 and its α-decay chain

International Nuclear Information System (INIS)

Tai Fei; Chen Dinghan; Xu Chang; Ren Zhongzhou; National Laboratory of Heavy Ion Accelerator, Lanzhou

2005-01-01

RIKEN has produced a new element Z=113 by cold-fusion reaction. Here we systematically study the new nuclide 278 113 and its α-Decay chain using deformed relativistic mean-field theory with three sets of force parameters, TMA, NL-Z2 and NL3. The results are compared with those of the Skyrme-Hartree-Fock model, Moeller et al and also with the new experimental data. The experimental decay energies are well reproduced with RMF. This not only shows the validity of self-consistent field theoretical model in researching the ground state properties of superheavy nuclei, but also shows that prolate deformation is important for the ground state of these nuclei. (authors)

26 CFR 509.113 - Government wages, salaries, and pensions.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Government wages, salaries, and pensions. 509...) REGULATIONS UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.113 Government wages, salaries, and pensions. (a) General. Under Article XI of the convention any wage, salary, or similar compensation, or any...

9 CFR 113.201 - Canine Distemper Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine, Killed Virus... REQUIREMENTS Killed Virus Vaccines § 113.201 Canine Distemper Vaccine, Killed Virus. Canine Distemper Vaccine... canine distemper susceptible dogs (20 vaccinates and 5 controls) shall be used as test animals. Blood...

Przekształcenia przestrzenne i funkcjonalne obszarów przemysłowych w miastach brytyjskich. Przykład Doków w Londynie

OpenAIRE

Kaczmarek, Sylwia

1999-01-01

Materiały wykorzystane w tym opracowaniu autorka zebrała w Londynie podczas wizyty studialnej w Wielkiej Brytanii, finansowanej przez British Council, która odbyła się w październiku 1994 r. Recently the main aspect of British spatial and economic planning was what came to be known as inner city problem. It began around mid 1960s when a lot of traditional industries in cities declined (examples of Glasgow, Manchester, London). The case of London Docklands illustrates the cru...

W. E. B. Du Bois: A Dynamic Communicator and Cultural Iconoclast.

Science.gov (United States)

Reppert, James E.

This paper presents a biographical sketch of the prolific African-American writer and sociologist W.E.B. Du Bois, designed as an instructional unit in an introduction to mass communication course which can help make students aware of the roles played by ethnic minorities in shaping American and world media. The paper provides numerous details of…

A Precision Measurement of the W Boson Mass with 1 Inverse Femtobarn of DZero Run IIa Data

Energy Technology Data Exchange (ETDEWEB)

Osta, Jyotsna [Univ. of Notre Dame, IN (United States)

2009-12-01

This thesis is a detailed presentation of a precision measurement of the mass of the W boson. It has been obtained by analyzing W → ev decays. The data used for this analysis was collected from 2002 to 2006 with the D0 detector, during Run IIa of the Fermilab Tevatron collider. It corresponds to a total integrated luminosity of 1 fb^-1. With a sample of 499,830 W → ev candidate events, we obtain a mass measurement of M_W = 80.401 ± 0.043 GeV. This is the most precise measurement from a single experiment to date.

Study of spin and decay-plane correlations of W bosons in the e+e-→W+ W- process at LEP

International Nuclear Information System (INIS)

Achard, P.; Adriani, O.; Aguillar-Benitez, M.

2005-01-01

Data collected at LEP at centre-of-mass energies √(s)=189-209 GeV are used to study correlations of the spin of W bosons using e + e - →W + W - →lνq anti q events. Spin correlations are favoured by data, and found to agree with the Standard Model predictions. In addition, correlations between the W-boson decay planes are studied in e + e - →W + W - →lνq anti q and e + e - →W + W - →q anti qq anti q events. Decay-plane correlations are measured to be consistent with the Standard Model predictions. (orig.)

RCRA Facility Investigation/Remedial Investigation Report for the Gunsite 113 Access Road Unit (631-24G) - March 1996

Energy Technology Data Exchange (ETDEWEB)

Palmer, E. [Westinghouse Savannah River Company, AIKEN, SC (United States)

1996-03-01

Gunsite 113 Access Road Unit is located in the northeast corner of SRS. In the mid 1980`s, sparse vegetation, dead trees, and small mounds of soil were discovered on a portion of the road leading to Gunsite 113. This area became the Gunsite 113 Access Road Unit (Gunsite 113). The unit appears to have been used as a spoil dirt and / or road construction debris disposal area. There is no documentation or record of any hazardous substance management, disposal, or any type of waste disposal at this unit. Based upon the available evidence, there are no potential contaminants of concern available for evaluation by a CERCLA baseline risk assessment. Therefore, there is no determinable health risk associated with Gunsite 113. In addition, it is also reasonable to conclude that, since contamination is below risk-based levels, the unit presents no significant ecological risk. It is recommended that no further remedial action be performed at this unit.

RCRA Facility Investigation/Remedial Investigation Report for the Gunsite 113 Access Road Unit (631-24G) - March 1996

International Nuclear Information System (INIS)

Palmer, E.

1996-03-01

Gunsite 113 Access Road Unit is located in the northeast corner of SRS. In the mid 1980's, sparse vegetation, dead trees, and small mounds of soil were discovered on a portion of the road leading to Gunsite 113. This area became the Gunsite 113 Access Road Unit (Gunsite 113). The unit appears to have been used as a spoil dirt and / or road construction debris disposal area. There is no documentation or record of any hazardous substance management, disposal, or any type of waste disposal at this unit. Based upon the available evidence, there are no potential contaminants of concern available for evaluation by a CERCLA baseline risk assessment. Therefore, there is no determinable health risk associated with Gunsite 113. In addition, it is also reasonable to conclude that, since contamination is below risk-based levels, the unit presents no significant ecological risk. It is recommended that no further remedial action be performed at this unit

32 CFR Appendix C to Part 113 - Sample DD Form 2653, “Involuntary Allotment Application”

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false Sample DD Form 2653, âInvoluntary Allotment Applicationâ C Appendix C to Part 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE... Part 113—Sample DD Form 2653, “Involuntary Allotment Application” ER05JA95.002 ER05JA95.003 ...

Can T1 w/T2 w ratio be used as a myelin-specific measure in subcortical structures? Comparisons between FSE-based T1 w/T2 w ratios, GRASE-based T1 w/T2 w ratios and multi-echo GRASE-based myelin water fractions.

Science.gov (United States)

Uddin, Md Nasir; Figley, Teresa D; Marrie, Ruth Ann; Figley, Chase R

2018-03-01

Given the growing popularity of T 1 -weighted/T 2 -weighted (T 1 w/T 2 w) ratio measurements, the objective of the current study was to evaluate the concordance between T 1 w/T 2 w ratios obtained using conventional fast spin echo (FSE) versus combined gradient and spin echo (GRASE) sequences for T 2 w image acquisition, and to compare the resulting T 1 w/T 2 w ratios with histologically validated myelin water fraction (MWF) measurements in several subcortical brain structures. In order to compare these measurements across a relatively wide range of myelin concentrations, whole-brain T 1 w magnetization prepared rapid acquisition gradient echo (MPRAGE), T 2 w FSE and three-dimensional multi-echo GRASE data were acquired from 10 participants with multiple sclerosis at 3 T. Then, after high-dimensional, non-linear warping, region of interest (ROI) analyses were performed to compare T 1 w/T 2 w ratios and MWF estimates (across participants and brain regions) in 11 bilateral white matter (WM) and four bilateral subcortical grey matter (SGM) structures extracted from the JHU_MNI_SS 'Eve' atlas. Although the GRASE sequence systematically underestimated T 1 w/T 2 w values compared to the FSE sequence (revealed by Bland-Altman and mountain plots), linear regressions across participants and ROIs revealed consistently high correlations between the two methods (r 2 = 0.62 for all ROIs, r 2 = 0.62 for WM structures and r 2 = 0.73 for SGM structures). However, correlations between either FSE-based or GRASE-based T 1 w/T 2 w ratios and MWFs were extremely low in WM structures (FSE-based, r 2 = 0.000020; GRASE-based, r 2 = 0.0014), low across all ROIs (FSE-based, r 2 = 0.053; GRASE-based, r 2 = 0.029) and moderate in SGM structures (FSE-based, r 2 = 0.20; GRASE-based, r 2 = 0.17). Overall, our findings indicated a high degree of correlation (but not equivalence) between FSE-based and GRASE-based T 1 w/T 2 w ratios, and low correlations between T 1 w/T 2 w ratios and MWFs. This

Characterization and biological activity of Solidago canadensis complex.

Science.gov (United States)

Šutovská, M; Capek, P; Kocmálová, M; Fraňová, S; Pawlaczyk, I; Gancarz, R

2013-01-01

Polyphenolic-polysaccharide-protein complex has been isolated from flowers of Solidago canadensis L. by hot alkaline extraction procedure. Compositional analyses of S canadensis complex revealed the presence of carbohydrates (43 wt%), protein (27 wt%), phenolics (12 wt%), uronic acids (10 wt%) and inorganic material (8 wt%). The carbohydrate part was rich in neutral sugars (81 wt%) while uronids were determined in lower amount (19 wt%). Monosaccharide analysis of carbohydrate part revealed the presence of five main sugar components, i.e. rhamnose (~23 wt%), arabinose (~20 wt%), uronic acids (~19 wt%), galactose (~17 wt%) and glucose (~14 wt%), and indicated thus the presence of rhamnogalacturonan and arabinogalactan in S. canadensis complex. HPLC analysis of complex showed one single peak of molecule mass at 11.2 kDa. Antitussive activity tests, performed in three doses of Solidago complex, showed the reduction of the number of cough efforts in the dose-dependent manner. Higher doses (50 and 75 mg/kg b.w.) were shown to be by 15 and 20% more effective than that of lower one (25mg/kg b.w.). However, the antitussive effect of the highest dose (75 mg/kg b.w.) was by 10% lower in comparison with that of codeine, the strongest antitussive agent. Besides, the highest dose of the complex (75 mg/kg b.w.) significantly decreased values of specific airways resistance and their effect remained longer as that of salbutamol, a representative of classic antiasthmatic drugs. Copyright © 2012 Elsevier B.V. All rights reserved.

Energy transfer ultraviolet photodetector with 8-hydroxyquinoline derivative-metal complexes as acceptors

International Nuclear Information System (INIS)

Wu Shuang-Hong; Chen Zhi; Li Shi-Bin; Wang Xiao-Hui; Wei Xiong-Bang; Li Wen-Lian

2015-01-01

We choose 8-hydroxyquinoline derivative-metal complexes (Beq, Mgq, and Znq) as the acceptors (A) and 4,4',4”-tri-(2-methylphenyl phenylamino) triphenylaine (m-MTDATA) as the donor (D) respectively to study the existing energy transfer process in the organic ultraviolet (UV) photodetector (PD), which has an important influence on the sensitivity of PDs. The energy transfer process from D to A without exciplex formation is discussed, differing from the working mechanism of previous PDs with Gaq [Zisheng Su, Wenlian Li, Bei Chu, Tianle Li, Jianzhuo Zhu, Guang Zhang, Fei Yan, Xiao Li, Yiren Chen and Chun-Sing Lee 2008 Appl. Phys. Lett. 93 103309)] and REq [J. B. Wang, W. L. Li, B. Chu, L. L. Chen, G. Zhang, Z. S. Su, Y. R. Chen, D. F. Yang, J. Z. Zhu, S. H. Wu, F. Yan, H. H. Liu, C. S. Lee 2010 Org. Electron. 11 1301] used as an A material. Under 365-nm UV irradiation with an intensity of 1.2 mW/cm 2 , the m-MTDATA:Beq blend device with a weight ratio of 1:1 shows a response of 192 mA/W with a detectivity of 6.5× 10 11 Jones, which exceeds those of PDs based on Mgq (146 mA/W) and Znq (182 mA/W) due to better energy level alignment between m-MTDATA/Beq and lower radiative decay. More photophysics processes of the PDs involved are discussed in detail. (paper)

Optimized implementations of rational approximations for the Voigt and complex error function