WorldWideScience

Sample records for combined infrared 1h

  1. Partial least squares modeling of combined infrared, 1H NMR and 13C NMR spectra to predict long residue properties of crude oils

    NARCIS (Netherlands)

    de Peinder, P.|info:eu-repo/dai/nl/325810818; Visser, T.|info:eu-repo/dai/nl/110288327; Petrauskas, D.D.; Salvatori, F.; Soulimani, F.|info:eu-repo/dai/nl/313889449; Weckhuysen, B.M.|info:eu-repo/dai/nl/285484397

    2009-01-01

    Research has been carried out to determine the potential of partial least squares (PLS) modeling of mid-infrared (IR) spectra of crude oils combined with the corresponding 1H and 13C nuclear magnetic resonance (NMR) data, to predict the long residue (LR) properties of these substances. The study

  2. Phenylalanine and tyrosine methyl ester intramolecular interactions and conformational analysis by (1)H NMR and infrared spectroscopies and theoretical calculations.

    Science.gov (United States)

    Cormanich, Rodrigo A; Ducati, Lucas C; Tormena, Cláudio F; Rittner, Roberto

    2014-04-01

    Amino acid conformational analysis in solution are scarce, since these compounds present a bipolar zwitterionic structure ((+)H3NCHRCOO(-)) in these media. Also, intramolecular hydrogen bonds have been classified as the sole interactions governing amino acid conformational behavior in the literature. In the present work we propose phenylalanine and tyrosine methyl ester conformational studies in different solvents by (1)H NMR and infrared spectroscopies and theoretical calculations. Both experimental and theoretical results are in agreement and suggest that the conformational behavior of the phenylalanine and tyrosine methyl esters are similar and are dictated by the interplay between steric and hyperconjugative interactions.

  3. Classification of Wines Based on Combination of 1H NMR Spectroscopy and Principal Component Analysis

    Institute of Scientific and Technical Information of China (English)

    DU, Yuan-Yuan; BAI, Guo-Yun; ZHANG, Xu; LIU, Mai-Li

    2007-01-01

    A combination of 1H nuclear magnetic resonance (NMR) spectroscopy and principal component analysis (PCA)has shown the potential for being a useful method for classification of type, production origin or geographic origin of wines. In this preliminary study, twenty-one bottled wines were classified/separated for their location of production in Shacheng, Changli and Yantai, and the types of the blended, medium dry, dry white and dry red wines, using the NMR-PCA method. The wines were produced by three subsidiary companies of an enterprise according to the same national standard. The separation was believed to be mainly due to the fermentation process for different wines and environmental variations, such as local climate, soil, underground water, sunlight and rainfall. The major chemicals associated with the separation were identified.

  4. Combined Analysis of Stable Isotope, (1)H NMR, and Fatty Acid To Verify Sesame Oil Authenticity.

    Science.gov (United States)

    Kim, Jeongeun; Jin, Gyungsu; Lee, Yunhee; Chun, Hyang Sook; Ahn, Sangdoo; Kim, Byung Hee

    2015-10-14

    The aim of this study was to verify the authenticity of sesame oils using combined analysis of stable isotope ratio, (1)H NMR spectroscopy, and fatty acid profiles of the oils. Analytical data were obtained from 35 samples of authentic sesame oils and 29 samples of adulterated sesame oils currently distributed in Korea. The orthogonal projection to latent structure discriminant analysis technique was used to select variables that most effectively verify the sesame oil authenticity. The variables include δ(13)C value, integration values of NMR peaks that signify the CH3 of n-3 fatty acids, CH2 between two C═C, protons from sesamin/sesamolin, and 18:1n-9, 18:3n-3, 18:2t, and 18:3t content values. The authenticity of 65 of 70 blind samples was correctly verified by applying the range of the eight variables found in the authentic sesame oil samples, suggesting that triple analysis is a useful approach to verify sesame oil authenticity.

  5. Monitoring bound HA1(H1N1) and HA1(H5N1) on freely suspended graphene over plasmonic platforms with infrared spectroscopy

    Science.gov (United States)

    Banerjee, Amrita; Chakraborty, Sumit; Altan-Bonnet, Nihal; Grebel, Haim

    2013-09-01

    Infrared (IR) spectroscopy provides fingerprinting of the energy and orientation of molecular bonds. The IR signals are generally weak and require amplification. Here we present a new plasmonic platform, made of freely suspended graphene, which was coating periodic metal structures. Only monolayer thick films were needed for a fast signal recording. We demonstrated unique IR absorption signals of bound proteins: these were the hemagglutinin area (HA1) of swine influenza (H1N1) and the avian influenza (H5N1) viruses bound to their respective tri-saccharides ligand receptors. The simplicity and sensitivity of such approach may find applications in fast monitoring of binding events.

  6. Combined chemometric analysis of (1)H NMR, (13)C NMR and stable isotope data to differentiate organic and conventional milk.

    Science.gov (United States)

    Erich, Sarah; Schill, Sandra; Annweiler, Eva; Waiblinger, Hans-Ulrich; Kuballa, Thomas; Lachenmeier, Dirk W; Monakhova, Yulia B

    2015-12-01

    The increased sales of organically produced food create a strong need for analytical methods, which could authenticate organic and conventional products. Combined chemometric analysis of (1)H NMR-, (13)C NMR-spectroscopy data, stable-isotope data (IRMS) and α-linolenic acid content (gas chromatography) was used to differentiate organic and conventional milk. In total 85 raw, pasteurized and ultra-heat treated (UHT) milk samples (52 organic and 33 conventional) were collected between August 2013 and May 2014. The carbon isotope ratios of milk protein and milk fat as well as the α-linolenic acid content of these samples were determined. Additionally, the milk fat was analyzed by (1)H and (13)C NMR spectroscopy. The chemometric analysis of combined data (IRMS, GC, NMR) resulted in more precise authentication of German raw and retail milk with a considerably increased classification rate of 95% compared to 81% for NMR and 90% for IRMS using linear discriminate analysis.

  7. Combination of 1H NMR and chemometrics to discriminate manuka honey from other floral honey types from Oceania.

    Science.gov (United States)

    Spiteri, Marc; Rogers, Karyne M; Jamin, Eric; Thomas, Freddy; Guyader, Sophie; Lees, Michèle; Rutledge, Douglas N

    2017-02-15

    Manuka honey is a product produced essentially in New Zealand, and has been widely recognised for its antibacterial properties and specific taste. In this study, 264 honeys from New Zealand and Australia were analysed using proton NMR spectroscopy coupled with chemometrics. Known manuka markers, methylglyoxal and dihydroxyacetone, have been characterised and quantified, together with a new NMR marker, identified as being leptosperin. Manuka honey profiling using 1H NMR is shown to be a possible alternative to chromatography with the added advantage that it can measure methylglyoxal (MGO), dihydroxyacetone (DHA) and leptosperin simultaneously. By combining the information from these three markers, we established a model to estimate the proportion of manuka in a given honey. Markers of other botanical origins were also identified, which makes 1H NMR a convenient and efficient tool, complementary to pollen analysis, to control the botanical origin of Oceania honeys.

  8. 联合应用ESI MS和1H NMR分析含笑属植物种子磷脂%Application of ESI-MS combined with 1 H NMR in analyzing seed phospolipids of six species of Michelia

    Institute of Scientific and Technical Information of China (English)

    唐安军; Naomichi BAbA

    2012-01-01

    To date,there was no example to authenticate seed phospholipids based on their fingerprinting.By means of electrospray ionization mass spectrometry(ESI MS)and proton nuclear magnetic resonance(1 H NMR)spectroscopy,phospholipids fraction extracted from seeds of six species from the genus Michelia were detected.It was firstly found that distinct difference in spectral fingerprinting region between m/z 895-910 in ESI MS and 5.30-5.40 mg/L in 1 H NMR among these six species.Thus,it suggested that the spectral differences shown by ESI MS and 1 H NMR among seeds of these six species could be applied to identify them.And in a wider sense,for analyzing seed phospholipids of other plant species,a combination of ESI MS AND NMR was an effective tool.%首次尝试利用电喷雾电离质谱(ESI MS)和氢原子核磁共振(1 H NMR)技术分析了含笑属六种植物种子的磷脂特性,发现在两个指纹图谱区发现明显的差异,即在质荷比(m/z)895-910(ESI MS)和5.30~5.40mg/L(1 H NMR)两个特异的区域存在显著差异.这些源于种子磷脂ESI/MS和1 H NMR的谱带差异可以被用来分析不同植物的种子的磷脂特征.而且,相似地,在更广的层面上,特异性的谱带差异可用于分析其他植物种子的磷脂组成和特性,辅助鉴定种子.

  9. Near-infrared observations of galaxies in Pisces-Perseus; 1, H-band surface photometry of 174 spirals

    CERN Document Server

    Moriondo, G; Casertano, S; Chincarini, G L; Gavazzi, G; Giovanardi, C; Hunt, L K; Pierini, D; Sperandio, M; Trinchieri, G

    1999-01-01

    We present near-infrared, H-band (1.65 um), surface photometry of 174 spiral galaxies in the area of the Pisces-Perseus supercluster. The images, acquired with the ARNICA camera mounted on various telescopes, are used to derive radial profiles of surface brightness, ellipticities, and position angles, together with global parameters such as H-band magnitudes and diameters. The mean relation between H-band isophotal diameter D_{21.5} and the B-band D_{25} implies a B-H color of the outer disk bluer than 3.5; moreover, D_{21.5}/D_{25} depends on (global) color and absolute luminosity. The correlations among the various photometric parameters suggest a ratio between isophotal radius D_{21.5}/2 and disk scale length of about 3.5 and a mean disk central brightness of 17.5 H-mag arcsec^{-2}. We confirm the trend of the concentration index C_{31} with absolute luminosity and, to a lesser degree, with morphological type. We also assess the influence of non-axisymmetric structures on the radial profiles and on the der...

  10. p-Si(1 1 1):H/ionic liquid interface investigated through a combination of electrochemical measurements and reflection high energy electron diffraction surface analysis in vacuum

    Science.gov (United States)

    Watanabe, Ko; Maruyama, Shingo; Matsumoto, Yuji

    2016-07-01

    A combination study of electrochemical measurements and reflection high energy electron diffraction (RHEED) surface analysis experiments in a vacuum was first demonstrated to characterize a p-Si(1 1 1):H/ionic liquid interface. Mott-Schottky plot analysis was made to successfully not only evaluate the acceptor density and flat band potential of the p-Si(1 1 1):H, but also get some insight into its surface states. Furthermore, the electric double layer capacitance and specific adsorption properties at the IL/Si(1 1 1):H interface as well as the electrochemical interface stability will be discussed in this paper.

  11. Study the chemical composition and biological outcomes resulting from the interaction of the hormone adrenaline with heavy elements: Infrared, Raman, electronic, 1H NMR, XRD and SEM studies

    Science.gov (United States)

    Ibrahim, Omar B.; Mohamed, Mahmoud A.; Refat, Moamen S.

    2014-01-01

    Heavy metal adrenaline complexes formed from the reaction of adrenaline with Al3+, Zn2+, Sn2+, Sb3+, Pb2+and Bi3+ ions in methanolic solvent at 60 °C. The final reaction products have been isolated and characterization using elemental analyses (% of carbon, hydrogen and nitrogen), conductivity measurements, mid infrared, Raman laser, UV-Vis, 1H NMR spectra, X-ray powder diffraction, scanning electron microscopy and energy-dispersive X-ray spectroscopy (EDX). Upon the spectroscopic, conductivity and elemental analyses, the stoichiometric reactions indicated that the data obtained refer to 1:2 (M:L) for Zn2+, Sn2+, Pb2+and Bi3+ complexes [Zn(Adr)2(Cl)2], [Sn(Adr)2]Cl2, [Pb(Adr)2](NO3)2 and [Bi(Adr)2(Cl)2]Cl, while the molar ratio 1:3 (M:L) for Al3+ and Sb3+ with formulas [Al(Adr)3](NO3)3 and [Sb(Adr)3]Cl3. The infrared and Raman laser spectra interpreted the mode of interactions which associated through the two phenolic groups of catechol moiety. The adrenaline chelates have been screened for their in vitro antibacterial activity against four bacteria, Gram-positive (Bacillus subtilis and Staphylococcus aureus) and Gram-negative (Escherichia coli and Pseudomonas aeruginosa) and two strains of fungus (Aspergillus flavus and Candida albicans). The metal chelates were shown to possess more antibacterial and antifungal activities than the free adrenaline chelate.

  12. Exergetic simulation of a combined infrared-convective drying process

    Science.gov (United States)

    Aghbashlo, Mortaza

    2016-04-01

    Optimal design and performance of a combined infrared-convective drying system with respect to the energy issue is extremely put through the application of advanced engineering analyses. This article proposes a theoretical approach for exergy analysis of the combined infrared-convective drying process using a simple heat and mass transfer model. The applicability of the developed model to actual drying processes was proved using an illustrative example for a typical food.

  13. Infrared, Raman and NMR spectra, conformational stability, normal coordinate analysis and B3LYP calculations of 5-amino-4-cyano-3-(methylthio)-1H-pyrazole-1-carbothioamide

    Science.gov (United States)

    Mohamed, Tarek A.; Hassan, Ali M.; Soliman, Usama A.; Zoghaib, Wajdi M.; Husband, John; Abdelall, Mahmoud M.

    2011-01-01

    The Raman and infrared spectra of solid 5-amino-4-cyano-3-(methylthio)-1H-pyrazole-1-carbothioamide (AMPC, C 6H 7N 5S 2) were measured in the spectral range of 3700-100 cm -1 and 4000-200 cm -1 with a resolution of 4 and 0.5 cm -1, respectively. Aided by normal coordinate analysis and potential energy distributions, a confident vibrational assignment of all fundamentals is proposed herein. As a result of internal rotation around C sbnd N and/or C sbnd S bonds, 32 rotational isomers are suggested for AMPC (C s symmetry). RHF and DFT/B3LYP quantum mechanical calculations including polarization and diffusion functions up to 6-311++G(d,p) basis sets, predict that after complete relaxation of the 32 possible isomers, four structures lie within 1500 cm -1 of the lowest energy conformer. However, vibrational analysis reveals the lowest energy conformer to be the only structure giving all real frequencies. Thus, the only stable conformer of AMPC is shown to have a fully planar skeleton with the NH 2 groups trans to one another. The recorded IR and Raman spectral measurements favor the calculated structural parameters which are further supported by spectral simulation. Additional support is given by 1H and 13C NMR spectra recorded with the sample dissolved in DMSO-d 6 and by predicted chemical shifts at the B3LYP/6-311+G(2d,p) level obtained using the Gauge-Invariant Atomic Orbitals (GIAO) method with and without inclusion of solvent using the Polarizable Continuum Model (PCM). Finally, CH 3, CH 3S, and NH 2 torsional barriers to internal rotation have been investigated using the optimized structural parameters from the B3LYP method with the 6-31G(d) basis set. The results are discussed herein and compared with similar molecules whenever appropriate.

  14. Infrared spectrum, structural and optical properties and molecular docking study of 3-(4-fluorophenyl)-5-phenyl-4,5-dihydro-1H-pyrazole-1-carbaldehyde

    Science.gov (United States)

    Mary, Y. Sheena; Panicker, C. Yohannan; Sapnakumari, M.; Narayana, B.; Sarojini, B. K.; Al-Saadi, Abdulaziz A.; Van Alsenoy, C.; War, Javeed Ahmad; Fun, H. K.

    2015-03-01

    The optimized molecular structure, vibrational frequencies, corresponding vibrational assignments of 3-(4-fluorophenyl)-5-phenyl-4,5-dihydro-1H-pyrazole-1-carbaldehyde have been investigated experimentally and theoretically. The title compound was optimized using at HF and DFT levels of calculations. The B3LYP/6-311++G(d,p) (5D,7F) results and in agreement with experimental infrared bands. The normal modes are assigned using potential energy distribution. The stability of the molecule arising from hyper-conjugative interaction and charge delocalization has been analyzed using natural bonding orbital analysis. The frontier molecular orbital analysis is used to determine the charge transfer within the molecule. From molecular electrostatic potential map, it is evident that the negative electrostatic potential regions are mainly localized over the carbonyl group and mono substituted phenyl ring and are possible sites for electrophilic attack and, positive regions are localized around all para substituted phenyl and pyrazole ring, indicating possible sites for nucleophilic attack. First hyperpolarizability is calculated in order to find its role in nonlinear optics. The geometrical parameters are in agreement with experimental data. From the molecular docking studies, it is evident that the fluorine atom attached to phenyl ring and the carbonyl group attached to pyrazole ring are crucial for binding and the results draw us to the conclusion that the compound might exhibit phosphodiesterase inhibitory activity.

  15. Attachment of Pseudomonas putida onto differently structured kaolinite minerals: a combined ATR-FTIR and 1H NMR study.

    Science.gov (United States)

    Vasiliadou, Ioanna A; Papoulis, Dimitris; Chrysikopoulos, Constantinos V; Panagiotaras, Dionisios; Karakosta, Eleni; Fardis, Michael; Papavassiliou, Georgios

    2011-06-01

    The attachment of Pseudomonas (P.) putida onto well (KGa-1) and poorly (KGa-2) crystallized kaolinite was investigated in this study. Batch experiments were carried out to determine the attachment isotherms of P. putida onto both types of kaolinite particles. The attachment process of P. putida onto KGa-1 and KGa-2 was adequately described by a Langmuir isotherm. Attenuated Total Reflection Fourier Transform Infrared Spectroscopy and Nuclear Magnetic Resonance were employed to study the attachment mechanisms of P. putida. Experimental results indicated that KGa-2 presented higher affinity and attachment capacity than KGa-1. It was shown that electrostatic interactions and clay mineral structural disorders can influence the attachment capacity of clay mineral particles.

  16. Combining 1H NMR spectroscopy and multivariate regression techniques to quantitatively determine falsification of porcine heparin with bovine species.

    Science.gov (United States)

    Monakhova, Yulia B; Diehl, Bernd W K

    2015-11-10

    (1)H NMR spectroscopy was used to distinguish pure porcine heparin and porcine heparin blended with bovine species and to quantify the degree of such adulteration. For multivariate modelling several statistical methods such as partial least squares regression (PLS), ridge regression (RR), stepwise regression with variable selection (SR), stepwise principal component regression (SPCR) were utilized for modeling NMR data of in-house prepared blends (n=80). The models were exhaustively validated using independent test and prediction sets. PLS and RR showed the best performance for estimating heparin falsification regarding its animal origin with the limit of detection (LOD) and root mean square error of validation (RMSEV) below 2% w/w and 1% w/w, respectively. Reproducibility expressed in coefficients of variation was estimated to be below 10% starting from approximately 5% w/w of bovine adulteration. Acceptable calibration model was obtained by SPCR, by its application range was limited, whereas SR is least recommended for heparin matrix. The developed method was found to be applicable also to heparinoid matrix (not purified heparin). In this case root mean square of prediction (RMSEP) and LOD were approximately 7% w/w and 8% w/w, respectively. The simple and cheap NMR method is recommended for screening of heparin animal origin in parallel with official NMR test of heparin authenticity and purity.

  17. Influence of pyridoxal 5'-phosphate alone and in combination with vigabatrin on brain GABA measured by 1H-NMR-spectroscopy.

    Science.gov (United States)

    Mueller, S G; Weber, O M; Boesiger, P; Wieser, H G

    2001-07-01

    Both iso-forms of the gamma-aminobutyric acid (GABA) synthesising enzyme and also the GABA degrading enzyme need pyridoxal 5'-phosphate (PP) as co-enzyme. The aim of the study was to investigate the influence of PP alone and in combination with various doses of vigabatrin (VGB) on brain GABA levels. In eight healthy subjects 300 mg/d PP and various doses of VGB (range, 1000 mg/d to 4000 mg/d) were given alone or in combination. The GABA+/creatine (Cr) signals in both occipital lobes were measured before treatment, during monotherapy with PP or VGB, and during combination of both using 1H-NMR-spectroscopy (1H-NMRS). PP alone did not change the GABA+/Cr signals. VGB alone increased the GABA+/Cr signals in both hemispheres. The combination PP and low-medium dosed VGB (1000-2000 mg/d) did not increase the GABA+/Cr signals. The effects of the combination of PP and high dosed (3000-4000 mg/d) VGB on the GABA+/Cr signals varied depending on the sequence of the drugs and dose of VGB. PP alone has no effect on the GABA+/Cr signals in healthy volunteers. The combination of PP and low-high dosed VGB had inconsistent effects on the GABA+/Cr signals compared to a VGB monotherapy because PP activates also the GABA-degrading enzyme GABA-transaminase.

  18. Combined histamine H1/H2 receptor antagonists: part I. Pharmacological hybrids with pheniramine- and roxatidine-like substructures.

    Science.gov (United States)

    Schulze, F R; Buschauer, A; Schunack, W

    1998-07-01

    A series of hybrid compounds combining the pharmacophores of both pheniramine-type histamine H1 receptor antagonists and roxatidine-type H2 receptor antagonists have been synthesized and tested for histamine antagonism at the isolated ileum (H1) and the spontaneously beating right atrium (H2) of the guinea pig. The 'polar group' of the H2 antagonist moiety (cyanoguanidine, nitroethenediamine or urea) and the side chain amino group of the H1 antagonist portion have been linked by a polymethylene spacer or by a piperazine system. The incorporation of a flexible spacer (2-7 methylene groups) resulted in H1 antagonists achieving up to 2.4 times the activity of pheniramine. Depending on the nature of the polar group the highest H2 antagonist potency resides in compounds with spacers ?2 methylene groups. Nitroethenediamine 24c with a seven-membered chain and a chlorpheniramine substructure proved to be approximately equipotent with pheniramine at the H1 and with ranitidine at the H2 receptor (pKB values 7.82 and 7.1, respectively).

  19. Distinguishing Benign from Malignant Pancreatic and Periampullary Lesions Using Combined Use of 1H-NMR Spectroscopy and Gas Chromatography–Mass Spectrometry

    Science.gov (United States)

    McConnell, Yarrow J.; Farshidfar, Farshad; Weljie, Aalim M.; Kopciuk, Karen A.; Dixon, Elijah; Ball, Chad G.; Sutherland, Francis R.; Vogel, Hans J.; Bathe, Oliver F.

    2017-01-01

    Previous work demonstrated that serum metabolomics can distinguish pancreatic cancer from benign disease. However, in the clinic, non-pancreatic periampullary cancers are difficult to distinguish from pancreatic cancer. Therefore, to test the clinical utility of this technology, we determined whether any pancreatic and periampullary adenocarcinoma could be distinguished from benign masses and biliary strictures. Sera from 157 patients with malignant and benign pancreatic and periampullary lesions were analyzed using proton nuclear magnetic resonance (1H-NMR) spectroscopy and gas chromatography–mass spectrometry (GC-MS). Multivariate projection modeling using SIMCA-P+ software in training datasets (n = 80) was used to generate the best models to differentiate disease states. Models were validated in test datasets (n = 77). The final 1H-NMR spectroscopy and GC-MS metabolomic profiles consisted of 14 and 18 compounds, with AUROC values of 0.74 (SE 0.06) and 0.62 (SE 0.08), respectively. The combination of 1H-NMR spectroscopy and GC-MS metabolites did not substantially improve this performance (AUROC 0.66, SE 0.08). In patients with adenocarcinoma, glutamate levels were consistently higher, while glutamine and alanine levels were consistently lower. Pancreatic and periampullary adenocarcinomas can be distinguished from benign lesions. To further enhance the discriminatory power of metabolomics in this setting, it will be important to identify the metabolomic changes that characterize each of the subclasses of this heterogeneous group of cancers. PMID:28098776

  20. Performance of a convective, infrared and combined infrared- convective heated conveyor-belt dryer.

    Science.gov (United States)

    El-Mesery, Hany S; Mwithiga, Gikuru

    2015-05-01

    A conveyor-belt dryer was developed using a combined infrared and hot air heating system that can be used in the drying of fruits and vegetables. The drying system having two chambers was fitted with infrared radiation heaters and through-flow hot air was provided from a convective heating system. The system was designed to operate under either infrared radiation and cold air (IR-CA) settings of 2000 W/m(2) with forced ambient air at 30 °C and air flow of 0.6 m/s or combined infrared and hot air convection (IR-HA) dryer setting with infrared intensity set at 2000 W/m(2) and hot at 60 °C being blown through the dryer at a velocity of 0.6 m/s or hot air convection (HA) at an air temperature of 60 °C and air flow velocity 0.6 m/s but without infrared heating. Apple slices dried under the different dryer settings were evaluated for quality and energy requirements. It was found that drying of apple (Golden Delicious) slices took place in the falling rate drying period and no constant rate period of drying was observed under any of the test conditions. The IR-HA setting was 57.5 and 39.1 % faster than IR-CA and HA setting, respectively. Specific energy consumption was lower and thermal efficiency was higher for the IR-HA setting when compared to both IR-CA and HA settings. The rehydration ratio, shrinkage and colour properties of apples dried under IR-HA conditions were better than for either IR-CA or HA.

  1. Brain morphological alterations and cellular metabolic changes in patients with generalized anxiety disorder: A combined DARTEL-based VBM and (1)H-MRS study.

    Science.gov (United States)

    Moon, Chung-Man; Jeong, Gwang-Woo

    2016-05-01

    Generalized anxiety disorder (GAD) is characterized by emotional dysregulation and cognitive deficit in conjunction with brain morphometric and metabolic alterations. This study assessed the combined neural morphological deficits and metabolic abnormality in patients with GAD. Thirteen patients with GAD and 13 healthy controls matched for age, sex, and education level underwent high-resolution T1-weighted MRI and proton magnetic resonance spectroscopy ((1)H-MRS) at 3Tesla. In this study, the combination of voxel-based morphometry (VBM) and (1)H-MRS was used to assess the brain morphometric and metabolic alterations in GAD. The patients showed significantly reduced white matter (WM) volumes in the midbrain (MB), precentral gyrus (PrG), dorsolateral prefrontal cortex (DLPFC) and anterior limb of the internal capsule (ALIC) compared to the controls. In MRS study, the choline/creatine (Cho/Cr) and choline/N-acetylaspartate (Cho/NAA) ratios in the DLPFC were significantly lower in the patients. Particularly, the WM volume variation of the DLPFC was positively correlated with both of the Cho/Cr and Cho/NAA ratios in patients with GAD. This study provides an evidence for the association between the morphometric deficit and metabolic changes in GAD. This finding would be helpful to understand the neural dysfunction and pathogenesis in connection with cognitive impairments in GAD.

  2. Combined infrared-vacuum drying of pumpkin slices.

    Science.gov (United States)

    Ghaboos, Seyyed Hossein Hosseini; Ardabili, Seyed Mahdi Seyedain; Kashaninejad, Mahdi; Asadi, Gholamhassan; Aalami, Mehran

    2016-05-01

    Infrared-vacuum dehydration characteristics of pumpkin (Cucurbita moschata) were evaluated in a combined dryer system. The effects of drying parameters, infrared radiation power (204-272 W), system pressure (5-15 kPa), slice thickness (5 and 7 mm) and time (0-220 min) on the drying kinetics and characteristics of pumpkin slices were investigated. The vacuum pressure, lamp power and slice had significant effect on the drying kinetics and various qualities of the dried pumpkin. Moisture ratios were fitted to 10 different mathematical equations using nonlinear regression analysis. The quadratic equation satisfactorily described the drying behavior of pumpkin slices with the highest r value and the lowest SE values. The effective moisture diffusivity increased with power and ranged between 0.71 and 2.86 × 10(-9) m(2)/s. With increasing in infrared radiation power from 204 to 272 W, β-carotene content of dried pumpkins decreased from 30.04 to 24.55 mg/100 g. The rise in infrared power has a negative effect on the color changes (ΔE). The optimum condition was determined as power, 238W, pressure, 5 kPa and slice thickness, 5mm. These conditions resulted into dried pumpkin slices with maximum B-carotene retention.

  3. Combined use of visible, reflected infrared, and thermal infrared images for mapping Hawaiian lava flows

    Science.gov (United States)

    Abrams, Michael; Abbott, Elsa; Kahle, Anne

    1991-01-01

    The weathering of Hawaiian basalts is accompanied by chemical and physical changes of the surfaces. These changes have been mapped using remote sensing data from the visible and reflected infrared and thermal infrared wavelength regions. They are related to the physical breakdown of surface chill coats, the development and erosion of silica coatings, the oxidation of mafic minerals, and the development of vegetation cover. These effects show systematic behavior with age and can be mapped using the image data and related to relative ages of pahoehoe and aa flows. The thermal data are sensitive to silica rind development and fine structure of the scene; the reflectance data show the degree of oxidation and differentiate vegetation from aa and cinders. Together, data from the two wavelength regions show more than either separately. The combined data potentially provide a powerful tool for mapping basalt flows in arid to semiarid volcanic environments.

  4. Infrared, Raman and NMR spectra, conformational stability, normal coordinate analysis and B3LYP calculations of 5-Amino-3-methyl-1-phenyl-1H-pyrazole-4-carbaldehyde

    Science.gov (United States)

    Bahgat, Khaled; EL-Emary, Talaat

    2013-02-01

    FT Raman and IR spectra of the crystallized biologically active molecule, 5-Amino-3-methyl-1-phenyl-1H-pyrazole-4-carbaldehyde (5-APHC, C11H11N3O) have been recorded and analyzed. The equilibrium geometry, bonding features and harmonic vibrational frequencies of 5-APHC have been investigated with the help of B3LYP density functional theory (DFT) method with 6-31G(d) and 6-311+G(d,p) as basis set. The calculated molecular geometry has been compared with the experimental data. The assignments of the vibrational spectra have been carried out with the help of normal coordinate analysis (NCA) following the scaled quantum mechanical force field (SQM) technique. The optimized geometry shows the co-planarity of the aldehyde group with pyrazole ring. Potential energy surface (PES) scan studies has also been carried out by ab initio calculations with B3LYP/6-311+G(d,p) basis set. The red shifting of NH2 stretching wavenumber indicates the formation of N-H⋯O hydrogen bonding. 1H and 13C NMR spectra were recorded and 1H and 13C nuclear magnetic resonance chemical shifts of the molecule were calculated using the gauge independent atomic orbital (GIAO) method. UV-Vis spectrum of the compound was recorded in the region 200-400 nm and the electronic properties HOMO and LUMO energies were calculated by time-dependent TD-DFT approach. Mulliken charges of the 5-APHC molecule was also calculated and interpreted.

  5. Combined Approach for Nonuniformity Correction in Infrared Focal Plane Array

    Institute of Scientific and Technical Information of China (English)

    XUE Hui

    2009-01-01

    A new algorithm of nonuniformity correction for infrared focal plane array(IRFPA) is reported,which is a combined algorithm based on both the two-point correction and artificial neural networks correction.The combined algorithm is calibrated by two-point correction,and the calibrated correction coefficients are automatically modified by BP algorithm.So it is not only calibrated,but also real-time processed.In adaptive nonuniformity correction algorithm,the phenomena ghost artifact and target fade-out are avoided by edge extraction.In order to get intensified image,the modified median filters are adopted.The simulated data indicates the proposed scheme is an effective algorithm.

  6. Electronic, infrared, mass, 1H NMR spectral studies of the charge-transfer complexes of sulphonamide drugs with π-acceptors in acetonitrile

    Science.gov (United States)

    Frag, Eman Y.; Mohamed, Gehad G.

    2010-08-01

    The rapid interaction between sulphonamides (sulphamethoxazole (SMZ), sulphaguanidine (SGD), sulphaquinoxaline sodium (SQX) and sulphadimidine sodium (SDD)) as n-electron donors with the 2,3-dichloro-5,6-dicyano-1,4-benzoquinone (DDQ) and 2,5-dichloro-3,6-dihydroxy-1,4-benzoquinone (chloranilic acid, p-CLA) as π-acceptors resulted in the formation of 1:1 charge-transfer complexes as the final products with the formula [(drug) (acceptor)]. The final products of the reactions have been isolated and characterized using FT-IR, 1H NMR, mass spectroscopy and elemental analyses as well as photometric measurements and thermogravimetric analysis (TG). The stoichiometry and apparent formation constants of the complexes formed were determined by applying the conventional spectrophotometric molar ratio method.

  7. Biological aerosol detection with combined passive-active infrared measurements

    Science.gov (United States)

    Ifarraguerri, Agustin I.; Vanderbeek, Richard G.; Ben-David, Avishai

    2004-12-01

    A data collection experiment was performed in November of 2003 to measure aerosol signatures using multiple sensors, all operating in the long-wave infrared. The purpose of this data collection experiment was to determine whether combining passive hyperspectral and LIDAR measurements can substantially improve biological aerosol detection performance. Controlled releases of dry aerosols, including road dust, egg albumin and two strains of Bacillus Subtilis var. Niger (BG) spores were performed using the ECBC/ARTEMIS open-path aerosol test chamber located in the Edgewood Area of Aberdeen Proving Grounds, MD. The chamber provides a ~ 20' path without optical windows. Ground truth devices included 3 aerodynamic particle sizers, an optical particle size spectrometer, 6 nephelometers and a high-volume particle sampler. Two sensors were used to make measurements during the test: the AIRIS long-wave infrared imaging spectrometer and the FAL CO2 LIDAR. The AIRIS and FAL data sets were analyzed for detection performance relative to the ground truth. In this paper we present experimental results from the individual sensors as well as results from passive-active sensor fusion. The sensor performance is presented in the form of receiver operating characteristic curves.

  8. Targeted and nontargeted wine analysis by (1)h NMR spectroscopy combined with multivariate statistical analysis. Differentiation of important parameters: grape variety, geographical origin, year of vintage.

    Science.gov (United States)

    Godelmann, Rolf; Fang, Fang; Humpfer, Eberhard; Schütz, Birk; Bansbach, Melanie; Schäfer, Hartmut; Spraul, Manfred

    2013-06-12

    The authenticity, the grape variety, the geographical origin, and the year of vintage of wines produced in Germany were investigated by (1)H NMR spectroscopy in combination with several steps of multivariate data analysis including principal component analysis (PCA), linear discrimination analysis (LDA), and multivariate analysis of variance (MANOVA) together with cross-validation (CV) embedded in a Monte Carlo resampling approach (MC) and others. A total of about 600 wines were selected and carefully collected from five wine-growing areas in the southern and southwestern parts of Germany. Simultaneous saturation of the resonances of water and ethanol by application of a low-power eight-frequency band irradiation using shaped pulses allowed for high receiver gain settings and hence optimized signal-to-noise ratios. Correct prediction of classification of the grape varieties of Pinot noir, Lemberger, Pinot blanc/Pinot gris, Müller-Thurgau, Riesling, and Gewürztraminer of 95% in the wine panel was achieved. The classification of the vintage of all analyzed wines resulted in correct predictions of 97 and 96%, respectively, for vintage 2008 (n = 318) and 2009 (n = 265). The geographic origin of all wines from the largest German wine-producing regions, Rheinpfalz, Rheinhessen, Mosel, Baden, and Württemberg, could be predicted 89% correctly on average. Each NMR spectrum could be regarded as the individual "fingerprint" of a wine sample, which includes information about variety, origin, vintage, physiological state, technological treatment, and others.

  9. Conformational analysis of the Sda determinant-containing tetrasaccharide and two mimics in aqueous solution by using 1H NMR ROESY spectroscopy in combination with MD simulations

    Energy Technology Data Exchange (ETDEWEB)

    Blanco, Jose L. Jimenez; Rooijen, Johannes J.M. van; Erbel, Paul J.A.; Leeflang, Bas R.; Kamerling, Johannis P.; Vliegenthart, Johannes F.G. [Utrecht University, Department of Bio-Organic Chemistry, Bijvoet Center (Netherlands)

    2000-01-15

    The conformational behaviour of the spacer-linked synthetic Sd{sup a} tetrasaccharide {beta}-d-GalpNAc-(1{sup {yields}}4)-[{alpha}-Neu5Ac-(2{sup {yields}}3)]-{beta}-d-Galp-(1{sup {yields}}4)-{beta}-d-GlcpNAc-(1{sup {yields}}O) (CH{sub 2}){sub 5}NH{sub 2} (1) and the two mimics {beta}-d-Galp-(1{sup {yields}}4)-[{alpha}-Neu5Ac-(2{sup {yields}}3)]-{beta}-d-Galp-(1{sup {yields}}4)-{beta}-d-GlcpNAc-(1{sup {yields}}O)(CH{sub 2}){sub 5}NH{sub 2} (2) and {beta}-d-GlcpNAc-(1{sup {yields}}4)-[{alpha}-Neu5Ac-(2{sup {yields}}3)]-{beta}-d-Galp-(1{sup {yields}}4)-{beta}-d-GlcpNAc-(1{sup {yields}}O) (CH{sub 2}){sub 5}NH{sub 2} (3) were investigated by {sup 1}H NMR spectroscopy in combination with molecular dynamics (MD) simulations in water. Experimental 2D {sup 1}H ROESY cross-peak intensities (ROEs) of the tetrasaccharides were compared with calculated ROEs derived from MD trajectories using the CROSREL program. Analysis of these data indicated that the oligosaccharidic skeletons of the compounds 1-3 are rather rigid, especially the {beta}-d-Hex(NAc)-(1{sup {yields}}4)-[{alpha}-Neu5Ac-(2{sup {yields}}3)]-{beta}-d-Galp fragments. The {alpha}- Neu5-Ac-(2{sup {yields}}3)-{beta}-d-Galp linkage occurred in two different energy minima in the three-dimensional structure of the compounds 1-3 in aqueous solution. Experimental data and dynamics simulations supported the finding that the higher energy rotamer (CHEAT forcefield) was abundant in compounds 1 and 3 due to the existence of a hydrogen bond between the carboxyl group of the sialic acid and the acetamido group of the terminal monosaccharide (GalNAc or GlcNAc) unit. The conformational similarity between 1 and 3 leads to the suggestion that also their activities will be alike.

  10. Solid-state structures of (R sub 3 P) sub 2 PtX sub 2 complexes as determined by a combination of sup 13 C( sup 1 H) and sup 31 P( sup 1 H) NMR spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Rahn, J.A.; Nelson, J.H. (Univ. of Nevada, Reno (USA)); Baltusis, L. (Varian Instrument Div., Palo Alto, CA (USA))

    1990-02-21

    Cross-polarization, combined with magic-angle spinning, has been employed to obtain high-resolution solid-state {sup 13}C and {sup 31}P NMR spectra of a series of 31 (R{sub 3}P){sub 2}PtX{sub 2} complexes. These data together with spectra obtained in solution were used to compare the solid-state structures with those in solution. It was found that most of these complexes, which have regular square-planar structures in solution, are distorted in the solid state. The extent of the solid-state distortion is a function of the bulk of the coordinated ligands and increases as the ligand size increases. The solid-state distortions appear to result from intramolecular steric effects for cis-(R{sub 3}P){sub 2}PtX{sub 2} and probably from intermolecular crystal packing forces for trans-(R{sub 3}P){sub 2}PtX{sub 2}. 37 refs., 6 figs., 3 tabs.

  11. Insights into the mechanisms underlying mercury-induced oxidative stress in gills of wild fish (Liza aurata) combining {sup 1}H NMR metabolomics and conventional biochemical assays

    Energy Technology Data Exchange (ETDEWEB)

    Cappello, Tiziana, E-mail: tcappello@unime.it [Department of Biological and Environmental Sciences, University of Messina, 98166 Messina (Italy); Brandão, Fátima, E-mail: fatimabrandao@ua.pt [Department of Biology and CESAM, University of Aveiro, 3810-193 Aveiro (Portugal); Guilherme, Sofia; Santos, Maria Ana [Department of Biology and CESAM, University of Aveiro, 3810-193 Aveiro (Portugal); Maisano, Maria; Mauceri, Angela [Department of Biological and Environmental Sciences, University of Messina, 98166 Messina (Italy); Canário, João [Centro de Química Estrutural, Instítuto Superíor Técnico, Universidade de Lisboa, 1049-001 Lisbon (Portugal); Pacheco, Mário; Pereira, Patrícia [Department of Biology and CESAM, University of Aveiro, 3810-193 Aveiro (Portugal)

    2016-04-01

    be sensitive and effective towards a mechanistically based assessment of Hg toxicity in gills of wild fish, providing new insights into the toxicological pathways underlying the oxidative stress. - Highlights: • Mercury-induced oxidative stress was investigated in gills of wild fish Liza aurata. • {sup 1}H NMR-based metabolomics and oxidative stress biomarkers were applied. • Hg interfered with the antioxidant protection but lipid peroxidation was prevented. • Activation of membrane repair processes suggested cell membrane ability to recover. • The combined approach is a sensitive and effective tool in ecotoxicological studies.

  12. A method for combining passive microwave and infrared rainfall observations

    Science.gov (United States)

    Kummerow, Christian; Giglio, Louis

    1995-01-01

    Because passive microwave instruments are confined to polar-orbiting satellites, rainfall estimates must interpolate across long time periods, during which no measurements are available. In this paper the authors discuss a technique that allows one to partially overcome the sampling limitations by using frequent infrared observations from geosynchronous platforms. To accomplish this, the technique compares all coincident microwave and infrared observations. From each coincident pair, the infrared temperature threshold is selected that corresponds to an area equal to the raining area observed in the microwave image. The mean conditional rainfall rate as determined from the microwave image is then assigned to pixels in the infrared image that are colder than the selected threshold. The calibration is also applied to a fixed threshold of 235 K for comparison with established infrared techniques. Once a calibration is determined, it is applied to all infrared images. Monthly accumulations for both methods are then obtained by summing rainfall from all available infrared images. Two examples are used to evaluate the performance of the technique. The first consists of a one-month period (February 1988) over Darwin, Australia, where good validation data are available from radar and rain gauges. For this case it was found that the technique approximately doubled the rain inferred by the microwave method alone and produced exceptional agreement with the validation data. The second example involved comparisons with atoll rain gauges in the western Pacific for June 1989. Results here are overshadowed by the fact that the hourly infrared estimates from established techniques, by themselves, produced very good correlations with the rain gauges. The calibration technique was not able to improve upon these results.

  13. Dual-band infrared remote sensing system with combined long-wave infrared imaging and mid-wave infrared spectral analysis.

    Science.gov (United States)

    Fang, Zheng; Yi, Xinjian; Liu, Xiangyan; Zhang, Wei; Zhang, Tianxu

    2013-08-01

    We present a new optical system for infrared (IR) image-spectrum integration remote sensing. The purpose to develop this instrument is to find the key spectral characteristics of typical hot target and to explore a new intelligence fusion method for the recognition. When mounted on a two-dimensional rotation stage, it can track the suspected target by image processing, and then get its spectrum to do recognition. It is a dual-band system with long-wave infrared (LWIR) imaging and mid-wave infrared (MWIR) spectrum. An IR dichroic beamsplitter is used to divide wideband incident infrared into LWIR and MWIR. Compared to traditional infrared combined imaging and spectral-analysis instruments, it yields higher sensitivity for measuring the IR spectrum. The sensors for imaging and spectrum detection are separate, so high spatial resolution, frame rate, and spectrum resolution can all be obtained simultaneously.

  14. 1H NMR spectra of N-methyl-4-tolyl-1-(4-bromonaphthylamine and N-phenyl-1-(4-bromonaphthylamine: a combined experimental and theoretical study

    Directory of Open Access Journals (Sweden)

    Sergiy I. Okovytyy

    2014-03-01

    Full Text Available Theoretical investigations of the conformational properties and 1H NMR chemical shifts for N-methyl-4-tolyl-1-(4-bromonaphthylamine and N-phenyl-1-(4-bromonaphthylamine are reported. The calculations were performed at the DFT level (PBE1PBE functional using magnetically consistent 6-31G## and STO##-3Gmag basis sets. Conformational properties of the amines were studied using potential energy surface scanning. Chemical shifts were calculated using the GIAO and CSGT methods and averaged in proportion to the population of the corresponding conformations. Solvent effects (CDCl3 were accounted via PCM method. The obtained results allowed to assign the 1H NMR signals for the naphthalene moiety, which could not be done based on the experimental data alone.

  15. Structural and spectroscopic characterization of 2-mesityl-1H-benzo[d]imidazol-3-ium chloride: a combined experimental and theoretical analysis.

    Science.gov (United States)

    Özdemir, Namık

    2012-06-01

    The title molecular salt, 2-mesityl-1H-benzo[d]imidazol-3-ium chloride (C(16)H(17)N(2)(+)·Cl-), was synthesized unexpectedly from the reaction of N-[(1E)-mesitylmethylene]benzene-1,2-diamine and CoCl(2)·6H(2)O, and characterized by elemental analysis, (1)H NMR and FT-IR spectroscopies, and single-crystal X-ray diffraction technique. In addition, quantum chemical calculations employing density functional theory (DFT) method with the 6-311++G(d,p) basis set were performed to study the molecular, spectroscopic and some electronic structure properties of the title compound, and the results were compared with the experimental findings. The computational result shows that the optimized geometry can well reproduce the crystal structural parameters. The intermolecular proton transfer process between the ionic (C(16)H(17)N(2)(+)·Cl-) and nonionic forms (C(16)H(16)N(2)·HCl) of the title salt is investigated and found to be almost barierless with an energy value of 0.20 kcal mol(-1). The NLO properties of the compound are bigger than those of urea. Copyright © 2012 Elsevier B.V. All rights reserved.

  16. Combined infrared and Raman study of solid CO

    Science.gov (United States)

    Urso, R. G.; Scirè, C.; Baratta, G. A.; Compagnini, G.; Palumbo, M. E.

    2016-10-01

    Context. Knowledge about the composition and structure of interstellar ices is mainly based on the comparison between astronomical and laboratory spectra of astrophysical ice analogues. Carbon monoxide is one of the main components of the icy mantles of dust grains in the interstellar medium. Because of its relevance, several authors have studied the spectral properties of solid CO both pure and in mixtures. Aims: The aim of this work is to study the profile (shape, width, peak position) of the solid CO band centered at about 2140 cm-1 at low temperature, during warm up, and after ion irradiation to search for a structural variation of the ice sample. We also report on the appearance of the longitudinal optical-transverse optical (LO-TO) splitting in the infrared spectra of CO films to understand if this phenomenon can be related to a phase change. Methods: We studied the profile of the 2140 cm-1 band of solid CO by means of infrared and Raman spectroscopy. We used a free web interface that we developed that allows us to calculate the refractive index of the sample to measure the thickness of the film. Results: The profile of the fundamental band of solid CO obtained with infrared and Raman spectroscopy does not show any relevant modification after warm up or ion bombardment in the dose range investigated. We explain that the LO-TO splitting is not connected to a structural variation of the film. Ion irradiation causes the formation of new molecular species. Raman spectroscopy allowed us to detect, among other bands, a band centered at 1817 cm-1 that has been attributed to the infrared inactive species C2 and a band centered at 1767 cm-1 that remains unidentified.

  17. UV Written Integrated Optical Beam Combiner for Near Infrared Astronomical Interferometry

    DEFF Research Database (Denmark)

    Svalgaard, Mikael; Olivero, Massimo; Jocou, Laurent;

    2006-01-01

    A near infrared integrated optical beam combiner for astronomical interferometry is demonstrated for the first time by direct UV writing. High fringe contrast >95%, low total loss (0.7 dB), low crosstalk and broadband performance is demonstrated.......A near infrared integrated optical beam combiner for astronomical interferometry is demonstrated for the first time by direct UV writing. High fringe contrast >95%, low total loss (0.7 dB), low crosstalk and broadband performance is demonstrated....

  18. Myowater dynamics and protein secondary structural changes as affected by heating rate in three pork qualities: a combined FT-IR microspectroscopic and 1H NMR relaxometry study.

    Science.gov (United States)

    Wu, Zhiyun; Bertram, Hanne Christine; Böcker, Ulrike; Ofstad, Ragni; Kohler, Achim

    2007-05-16

    The objective of this study was to investigate the influence of heating rate on myowater dynamics and protein secondary structures in three pork qualities by proton NMR T2 relaxation and Fourier transform infrared (FT-IR) microspectroscopy measurements. Two oven temperatures at 100 degrees C and 200 degrees C corresponding to slow and fast heating rates were applied on three pork qualities (DFD, PSE, and normal) to an internal center temperature of 65 degrees C. The fast heating induced a higher cooking loss, particularly for PSE meat. The water proton T21 distribution representing water entrapped within the myofibrillar network was influenced by heating rate and meat quality. Fast heating broadened the T21 distribution and decreased the relaxation times of the T21 peak position for three meat qualities. The changes in T21 relaxation times in meat can be interpreted in terms of chemical and diffusive exchange. FT-IR showed that fast heating caused a higher gain of random structures and aggregated beta-sheets at the expense of native alpha-helixes, and these changes dominate the fast-heating-induced broadening of T21 distribution and reduction in T21 times. Furthermore, of the three meat qualities, PSE meat had the broadest T21 distribution and the lowest T21 times for both heating rates, reflecting that the protein aggregation of PSE caused by heating is more extensive than those of DFD and normal, which is consistent with the IR data. The present study demonstrated that the changes in T2 relaxation times of water protons affected by heating rate and raw meat quality are well related to the protein secondary structural changes as probed by FT-IR microspectroscopy.

  19. Accuracy of 1H magnetic resonance spectroscopy for quantification of 2-hydroxyglutarate using linear combination and J-difference editing at 9.4T.

    Science.gov (United States)

    Neuberger, Ulf; Kickingereder, Philipp; Helluy, Xavier; Fischer, Manuel; Bendszus, Martin; Heiland, Sabine

    2017-05-12

    Non-invasive detection of 2-hydroxyglutarate (2HG) by magnetic resonance spectroscopy is attractive since it is related to tumor metabolism. Here, we compare the detection accuracy of 2HG in a controlled phantom setting via widely used localized spectroscopy sequences quantified by linear combination of metabolite signals vs. a more complex approach applying a J-difference editing technique at 9.4T. Different phantoms, comprised out of a concentration series of 2HG and overlapping brain metabolites, were measured with an optimized point-resolved-spectroscopy sequence (PRESS) and an in-house developed J-difference editing sequence. The acquired spectra were post-processed with LCModel and a simulated metabolite set (PRESS) or with a quantification formula for J-difference editing. Linear regression analysis demonstrated a high correlation of real 2HG values with those measured with the PRESS method (adjusted R-squared: 0.700, p<0.001) as well as with those measured with the J-difference editing method (adjusted R-squared: 0.908, p<0.001). The regression model with the J-difference editing method however had a significantly higher explanatory value over the regression model with the PRESS method (p<0.0001). Moreover, with J-difference editing 2HG was discernible down to 1mM, whereas with the PRESS method 2HG values were not discernable below 2mM and with higher systematic errors, particularly in phantoms with high concentrations of N-acetyl-asparate (NAA) and glutamate (Glu). In summary, quantification of 2HG with linear combination of metabolite signals shows high systematic errors particularly at low 2HG concentration and high concentration of confounding metabolites such as NAA and Glu. In contrast, J-difference editing offers a more accurate quantification even at low 2HG concentrations, which outweighs the downsides of longer measurement time and more complex postprocessing. Copyright © 2017. Published by Elsevier GmbH.

  20. Insights into the mechanisms underlying mercury-induced oxidative stress in gills of wild fish (Liza aurata) combining (1)H NMR metabolomics and conventional biochemical assays.

    Science.gov (United States)

    Cappello, Tiziana; Brandão, Fátima; Guilherme, Sofia; Santos, Maria Ana; Maisano, Maria; Mauceri, Angela; Canário, João; Pacheco, Mário; Pereira, Patrícia

    2016-04-01

    Oxidative stress has been described as a key pathway to initiate mercury (Hg) toxicity in fish. However, the mechanisms underlying Hg-induced oxidative stress in fish still need to be clarified. To this aim, environmental metabolomics in combination with a battery of conventional oxidative stress biomarkers were applied to the gills of golden grey mullet (Liza aurata) collected from Largo do Laranjo (LAR), a confined Hg contaminated area, and São Jacinto (SJ), selected as reference site (Aveiro Lagoon, Portugal). Higher accumulation of inorganic Hg and methylmercury was found in gills of fish from LAR relative to SJ. Nuclear magnetic resonance (NMR)-based metabolomics revealed changes in metabolites related to antioxidant protection, namely depletion of reduced glutathione (GSH) and its constituent amino acids, glutamate and glycine. The interference of Hg with the antioxidant protection of gills was corroborated through oxidative stress endpoints, namely the depletion of glutathione peroxidase and superoxide dismutase activities at LAR. The increase of total glutathione content (reduced glutathione+oxidized glutathione) at LAR, in parallel with GSH depletion aforementioned, indicates the occurrence of massive GSH oxidation under Hg stress, and an inability to carry out its regeneration (glutathione reductase activity was unaltered) or de novo synthesis. Nevertheless, the results suggest the occurrence of alternative mechanisms for preventing lipid peroxidative damage, which may be associated with the enhancement of membrane stabilization/repair processes resulting from depletion in the precursors of phosphatidylcholine (phosphocholine and glycerophosphocholine), as highlighted by NMR spectroscopy. However, the observed decrease in taurine may be attributable to alterations in the structure of cell membranes or interference in osmoregulatory processes. Overall, the novel concurrent use of metabolomics and conventional oxidative stress endpoints demonstrated to be

  1. Robust pedestrian detection by combining visible and thermal infrared cameras.

    Science.gov (United States)

    Lee, Ji Hoon; Choi, Jong-Suk; Jeon, Eun Som; Kim, Yeong Gon; Le, Toan Thanh; Shin, Kwang Yong; Lee, Hyeon Chang; Park, Kang Ryoung

    2015-05-05

    With the development of intelligent surveillance systems, the need for accurate detection of pedestrians by cameras has increased. However, most of the previous studies use a single camera system, either a visible light or thermal camera, and their performances are affected by various factors such as shadow, illumination change, occlusion, and higher background temperatures. To overcome these problems, we propose a new method of detecting pedestrians using a dual camera system that combines visible light and thermal cameras, which are robust in various outdoor environments such as mornings, afternoons, night and rainy days. Our research is novel, compared to previous works, in the following four ways: First, we implement the dual camera system where the axes of visible light and thermal cameras are parallel in the horizontal direction. We obtain a geometric transform matrix that represents the relationship between these two camera axes. Second, two background images for visible light and thermal cameras are adaptively updated based on the pixel difference between an input thermal and pre-stored thermal background images. Third, by background subtraction of thermal image considering the temperature characteristics of background and size filtering with morphological operation, the candidates from whole image (CWI) in the thermal image is obtained. The positions of CWI (obtained by background subtraction and the procedures of shadow removal, morphological operation, size filtering, and filtering of the ratio of height to width) in the visible light image are projected on those in the thermal image by using the geometric transform matrix, and the searching regions for pedestrians are defined in the thermal image. Fourth, within these searching regions, the candidates from the searching image region (CSI) of pedestrians in the thermal image are detected. The final areas of pedestrians are located by combining the detected positions of the CWI and CSI of the thermal

  2. Combined autofluorescence and Raman spectroscopy method for skin tumor detection in visible and near infrared regions

    Science.gov (United States)

    Zakharov, V. P.; Bratchenko, I. A.; Artemyev, D. N.; Myakinin, O. O.; Khristoforova, Y. A.; Kozlov, S. V.; Moryatov, A. A.

    2015-07-01

    The combined application of Raman and autofluorescence spectroscopy in visible and near infrared regions for the analysis of malignant neoplasms of human skin was demonstrated. Ex vivo experiments were performed for 130 skin tissue samples: 28 malignant melanomas, 19 basal cell carcinomas, 15 benign tumors, 9 nevi and 59 normal tissues. Proposed method of Raman spectra analysis allows for malignant melanoma differentiating from other skin tissues with accuracy of 84% (sensitivity of 97%, specificity of 72%). Autofluorescence analysis in near infrared and visible regions helped us to increase the diagnostic accuracy by 5-10%. Registration of autofluorescence in near infrared region is realized in one optical unit with Raman spectroscopy. Thus, the proposed method of combined skin tissues study makes possible simultaneous large skin area study with autofluorescence spectra analysis and precise neoplasm type determination with Raman spectroscopy.

  3. Metabolic profiling of ob/ob mouse fatty liver using HR-MAS (1)H-NMR combined with gene expression analysis reveals alterations in betaine metabolism and the transsulfuration pathway.

    Science.gov (United States)

    Gogiashvili, Mikheil; Edlund, Karolina; Gianmoena, Kathrin; Marchan, Rosemarie; Brik, Alexander; Andersson, Jan T; Lambert, Jörg; Madjar, Katrin; Hellwig, Birte; Rahnenführer, Jörg; Hengstler, Jan G; Hergenröder, Roland; Cadenas, Cristina

    2017-02-01

    Metabolic perturbations resulting from excessive hepatic fat accumulation are poorly understood. Thus, in this study, leptin-deficient ob/ob mice, a mouse model of fatty liver disease, were used to investigate metabolic alterations in more detail. Metabolites were quantified in intact liver tissues of ob/ob (n = 8) and control (n = 8) mice using high-resolution magic angle spinning (HR-MAS) (1)H-NMR. In addition, after demonstrating that HR-MAS (1)H-NMR does not affect RNA integrity, transcriptional changes were measured by quantitative real-time PCR on RNA extracted from the same specimens after HR-MAS (1)H-NMR measurements. Importantly, the gene expression changes obtained agreed with those observed by Affymetrix microarray analysis performed on RNA isolated directly from fresh-frozen tissue. In total, 40 metabolites could be assigned in the spectra and subsequently quantified. Quantification of lactate was also possible after applying a lactate-editing pulse sequence that suppresses the lipid signal, which superimposes the lactate methyl resonance at 1.3 ppm. Significant differences were detected for creatinine, glutamate, glycine, glycolate, trimethylamine-N-oxide, dimethylglycine, ADP, AMP, betaine, phenylalanine, and uridine. Furthermore, alterations in one-carbon metabolism, supported by both metabolic and transcriptional changes, were observed. These included reduced demethylation of betaine to dimethylglycine and the reduced expression of genes coding for transsulfuration pathway enzymes, which appears to preserve methionine levels, but may limit glutathione synthesis. Overall, the combined approach is advantageous as it identifies changes not only at the single gene or metabolite level but also deregulated pathways, thus providing critical insight into changes accompanying fatty liver disease. Graphical abstract A Evaluation of RNA integrity before and after HR-MAS (1)H-NMR of intact mouse liver tissue. B Metabolite concentrations and gene

  4. Drying kinetics and characteristics of combined infrared-vacuum drying of button mushroom slices

    Science.gov (United States)

    Salehi, Fakhreddin; Kashaninejad, Mahdi; Jafarianlari, Ali

    2016-10-01

    Infrared-vacuum drying characteristics of button mushroom (Agaricus bisporus) were evaluated in a combined dryer system. The effects of drying parameters, including infrared radiation power (150-375 W), system pressure (5-15 kPa) and time (0-160 min) on the drying kinetics and characteristics of button mushroom slices were investigated. Both the infrared lamp power and vacuum pressure influenced the drying time of button mushroom slices. The rate constants of the nine different kinetic's models for thin layer drying were established by nonlinear regression analysis of the experimental data which were found to be affected mainly by the infrared power level while system pressure had a little effect on the moisture ratios. The regression results showed that the Page model satisfactorily described the drying behavior of button mushroom slices with highest R value and lowest SE values. The effective moisture diffusivity increases as power increases and range between 0.83 and 2.33 × 10-9 m2/s. The rise in infrared power has a negative effect on the ΔE and with increasing in infrared radiation power it was increased.

  5. Drying kinetics and characteristics of combined infrared-vacuum drying of button mushroom slices

    Science.gov (United States)

    Salehi, Fakhreddin; Kashaninejad, Mahdi; Jafarianlari, Ali

    2017-05-01

    Infrared-vacuum drying characteristics of button mushroom ( Agaricus bisporus) were evaluated in a combined dryer system. The effects of drying parameters, including infrared radiation power (150-375 W), system pressure (5-15 kPa) and time (0-160 min) on the drying kinetics and characteristics of button mushroom slices were investigated. Both the infrared lamp power and vacuum pressure influenced the drying time of button mushroom slices. The rate constants of the nine different kinetic's models for thin layer drying were established by nonlinear regression analysis of the experimental data which were found to be affected mainly by the infrared power level while system pressure had a little effect on the moisture ratios. The regression results showed that the Page model satisfactorily described the drying behavior of button mushroom slices with highest R value and lowest SE values. The effective moisture diffusivity increases as power increases and range between 0.83 and 2.33 × 10-9 m2/s. The rise in infrared power has a negative effect on the ΔE and with increasing in infrared radiation power it was increased.

  6. Quantitative produced water analysis using mobile 1H NMR

    Science.gov (United States)

    Wagner, Lisabeth; Kalli, Chris; Fridjonsson, Einar O.; May, Eric F.; Stanwix, Paul L.; Graham, Brendan F.; Carroll, Matthew R. J.; Johns, Michael L.

    2016-10-01

    Measurement of oil contamination of produced water is required in the oil and gas industry to the (ppm) level prior to discharge in order to meet typical environmental legislative requirements. Here we present the use of compact, mobile 1H nuclear magnetic resonance (NMR) spectroscopy, in combination with solid phase extraction (SPE), to meet this metrology need. The NMR hardware employed featured a sufficiently homogeneous magnetic field, such that chemical shift differences could be used to unambiguously differentiate, and hence quantitatively detect, the required oil and solvent NMR signals. A solvent system consisting of 1% v/v chloroform in tetrachloroethylene was deployed, this provided a comparable 1H NMR signal intensity for the oil and the solvent (chloroform) and hence an internal reference 1H signal from the chloroform resulting in the measurement being effectively self-calibrating. The measurement process was applied to water contaminated with hexane or crude oil over the range 1-30 ppm. The results were validated against known solubility limits as well as infrared analysis and gas chromatography.

  7. Enhanced infrared detectors using resonant structures combined with thin type-II superlattice absorbers

    Science.gov (United States)

    Goldflam, M. D.; Kadlec, E. A.; Olson, B. V.; Klem, J. F.; Hawkins, S. D.; Parameswaran, S.; Coon, W. T.; Keeler, G. A.; Fortune, T. R.; Tauke-Pedretti, A.; Wendt, J. R.; Shaner, E. A.; Davids, P. S.; Kim, J. K.; Peters, D. W.

    2016-12-01

    We examined the spectral responsivity of a 1.77 μm thick type-II superlattice based long-wave infrared detector in combination with metallic nanoantennas. Coupling between the Fabry-Pérot cavity formed by the semiconductor layer and the resonant nanoantennas on its surface enables spectral selectivity, while also increasing peak quantum efficiency to over 50%. Electromagnetic simulations reveal that this high responsivity is a direct result of field-enhancement in the absorber layer, enabling significant absorption in spite of the absorber's subwavelength thickness. Notably, thinning of the absorbing material could ultimately yield lower photodetector noise through a reduction in dark current while improving photocarrier collection efficiency. The temperature- and incident-angle-independent spectral response observed in these devices allows for operation over a wide range of temperatures and optical systems. This detector paradigm demonstrates potential benefits to device performance with applications throughout the infrared.

  8. A Combined PMHT and IMM Approach to Multiple-Point Target Tracking in Infrared Image Sequence

    Directory of Open Access Journals (Sweden)

    Mukesh A. Zaveri

    2007-09-01

    Full Text Available Data association and model selection are important factors for tracking multiple targets in a dense clutter environment. In this paper, we provide an effective solution to the tracking of multiple single-pixel maneuvering targets in a sequence of infrared images by developing an algorithm that combines a sequential probabilistic multiple hypothesis tracking (PMHT and interacting multiple model (IMM. We explicitly model maneuver as a change in the target's motion model and demonstrate its effectiveness in our tracking application discussed in this paper. We show that inclusion of IMM enables tracking of any arbitrary trajectory in a sequence of infrared images without any a priori special information about the target dynamics. IMM allows us to incorporate different dynamic models for the targets and PMHT helps to avoid the uncertainty about the observation origin. It operates in an iterative mode using expectation-maximization (EM algorithm. The proposed algorithm uses observation association as missing data.

  9. A Combined PMHT and IMM Approach to Multiple-Point Target Tracking in Infrared Image Sequence

    Directory of Open Access Journals (Sweden)

    Merchant SN

    2007-01-01

    Full Text Available Data association and model selection are important factors for tracking multiple targets in a dense clutter environment. In this paper, we provide an effective solution to the tracking of multiple single-pixel maneuvering targets in a sequence of infrared images by developing an algorithm that combines a sequential probabilistic multiple hypothesis tracking (PMHT and interacting multiple model (IMM. We explicitly model maneuver as a change in the target's motion model and demonstrate its effectiveness in our tracking application discussed in this paper. We show that inclusion of IMM enables tracking of any arbitrary trajectory in a sequence of infrared images without any a priori special information about the target dynamics. IMM allows us to incorporate different dynamic models for the targets and PMHT helps to avoid the uncertainty about the observation origin. It operates in an iterative mode using expectation-maximization (EM algorithm. The proposed algorithm uses observation association as missing data.

  10. Infrared

    Science.gov (United States)

    Vollmer, M.

    2013-11-01

    'Infrared' is a very wide field in physics and the natural sciences which has evolved enormously in recent decades. It all started in 1800 with Friedrich Wilhelm Herschel's discovery of infrared (IR) radiation within the spectrum of the Sun. Thereafter a few important milestones towards widespread use of IR were the quantitative description of the laws of blackbody radiation by Max Planck in 1900; the application of quantum mechanics to understand the rotational-vibrational spectra of molecules starting in the first half of the 20th century; and the revolution in source and detector technologies due to micro-technological breakthroughs towards the end of the 20th century. This has led to much high-quality and sophisticated equipment in terms of detectors, sources and instruments in the IR spectral range, with a multitude of different applications in science and technology. This special issue tries to focus on a few aspects of the astonishing variety of different disciplines, techniques and applications concerning the general topic of infrared radiation. Part of the content is based upon an interdisciplinary international conference on the topic held in 2012 in Bad Honnef, Germany. It is hoped that the information provided here may be useful for teaching the general topic of electromagnetic radiation in the IR spectral range in advanced university courses for postgraduate students. In the most general terms, the infrared spectral range is defined to extend from wavelengths of 780 nm (upper range of the VIS spectral range) up to wavelengths of 1 mm (lower end of the microwave range). Various definitions of near, middle and far infrared or thermal infrared, and lately terahertz frequencies, are used, which all fall in this range. These special definitions often depend on the scientific field of research. Unfortunately, many of these fields seem to have developed independently from neighbouring disciplines, although they deal with very similar topics in respect of the

  11. Observation of 1H-13C and 1H-1H proximities in a paramagnetic solid by NMR at high magnetic field under ultra-fast MAS

    Science.gov (United States)

    Li, Shenhui; Trébosc, Julien; Lafon, Olivier; Zhou, Lei; Shen, Ming; Pourpoint, Frédérique; Amoureux, Jean-Paul; Deng, Feng

    2015-02-01

    The assignment of NMR signals in paramagnetic solids is often challenging since: (i) the large paramagnetic shifts often mask the diamagnetic shifts specific to the local chemical environment, and (ii) the hyperfine interactions with unpaired electrons broaden the NMR spectra and decrease the coherence lifetime, thus reducing the efficiency of usual homo- and hetero-nuclear NMR correlation experiments. Here we show that the assignment of 1H and 13C signals in isotopically unmodified paramagnetic compounds with moderate hyperfine interactions can be facilitated by the use of two two-dimensional (2D) experiments: (i) 1H-13C correlations with 1H detection and (ii) 1H-1H double-quantum ↔ single-quantum correlations. These methods are experimentally demonstrated on isotopically unmodified copper (II) complex of L-alanine at high magnetic field (18.8 T) and ultra-fast Magic Angle Spinning (MAS) frequency of 62.5 kHz. Compared to 13C detection, we show that 1H detection leads to a 3-fold enhancement in sensitivity for 1H-13C 2D correlation experiments. By combining 1H-13C and 1H-1H 2D correlation experiments with the analysis of 13C longitudinal relaxation times, we have been able to assign the 1H and 13C signals of each L-alanine ligand.

  12. Authentication of Whey Protein Powders by Portable Mid-Infrared Spectrometers Combined with Pattern Recognition Analysis.

    Science.gov (United States)

    Wang, Ting; Tan, Siow Ying; Mutilangi, William; Aykas, Didem P; Rodriguez-Saona, Luis E

    2015-10-01

    The objective of this study was to develop a simple and rapid method to differentiate whey protein types (WPC, WPI, and WPH) used for beverage manufacturing by combining the spectral signature collected from portable mid-infrared spectrometers and pattern recognition analysis. Whey protein powders from different suppliers are produced using a large number of processing and compositional variables, resulting in variation in composition, concentration, protein structure, and thus functionality. Whey protein powders including whey protein isolates, whey protein concentrates and whey protein hydrolysates were obtained from different suppliers and their spectra collected using portable mid-infrared spectrometers (single and triple reflection) by pressing the powder onto an Attenuated Total Reflectance (ATR) diamond crystal with a pressure clamp. Spectra were analyzed by soft independent modeling of class analogy (SIMCA) generating a classification model showing the ability to differentiate whey protein types by forming tight clusters with interclass distance values of >3, considered to be significantly different from each other. The major bands centered at 1640 and 1580 cm(-1) were responsible for separation and were associated with differences in amide I and amide II vibrations of proteins, respectively. Another important band in whey protein clustering was associated with carboxylate vibrations of acidic amino acids (∼1570 cm(-1)). The use of a portable mid-IR spectrometer combined with pattern recognition analysis showed potential for discriminating whey protein ingredients that can help to streamline the analytical procedure so that it is more applicable for field-based screening of ingredients. A rapid, simple and accurate method was developed to authenticate commercial whey protein products by using portable mid-infrared spectrometers combined with chemometrics, which could help ensure the functionality of whey protein ingredients in food applications. © 2015

  13. Nondestructive Inspection of Thin Basalt Fiber Reinforced Composites Using Combined Terahertz Imaging and Infrared Thermography

    Directory of Open Access Journals (Sweden)

    Przemyslaw Lopato

    2016-01-01

    Full Text Available The inspection of thin basalt fiber reinforced composite materials was carried out using two nondestructive methods: terahertz time domain imaging and infrared thermography. In order to combine the information about the defects arising in examined materials the inspection results were parametrized. In order to acquire more information content, new approximation based features are proposed. Then, a knowledge extraction based multivariate analysis of preselected features’ vector was carried out. Finally, in order to integrate features distributions of representing different dynamic level of information, a multiresolution wavelet based data fusion algorithm was applied. The results are presented and discussed.

  14. MATERIAL PARAMETER OF RUBBER GLOVE VULCANIZED USING COMBINED INFRARED AND HOT-AIR HEATING

    Directory of Open Access Journals (Sweden)

    Tipapon Khamdaeng

    2014-01-01

    Full Text Available Vulcanization is an important chemical-thermal process in production of rubber products resulting in change of material properties, increased elasticity and strength. In general, Young’s modulus is used as an indicator of elastic deformation at loading configuration. However, rubber is not truly elastic and a single parameter is insufficient to describe the whole deformation contributed by microstructure of rubber network. Therefore, we present the material parameters concerning the mechanical interaction of rubber constituents. In this study, tensile force and elongation were measured to analyze the rubber deformation. In order to describe the deformation behavior of the combined infrared and hot-air vulcanized rubber glove, the material properties, stress and stretch, were therefore presented. The stress-stretch relationships of the vulcanized rubber gloves were established based on previously well-known hyperelastic material model and their material parameters were determined using a parameter estimation technique. In conclusion, the stress-stretch relationships of the combined infrared and hot-air vulcanized rubber glove can be successfully established with our optimized material parameters; the magnitudes of rubber modulus (CR and locking stretch (λL were in a range of 0.041-0.079 MPa and 10.27-70.12, respectively. Furthermore, the resulting material parameters can be properly used to indicate the micro structural deformation.

  15. Mathematical Modeling on Combined Mid-infrared and Hot Air Drying of Beef Meat

    Directory of Open Access Journals (Sweden)

    Xiao-Lei Xie

    2015-05-01

    Full Text Available To investigate the drying models and characteristics of Combined Mid-Infrared and Hot Air (CMIHA drying BEEF MEAT (BM, a laboratory scale CMIHA dryer was applied to the treatment of BM samples in a temperature range from 40-70°C, with air velocity of 1m/s and mid-infrared of 2.8-3.1 m. Microsoft visual C sharp (C# was used to develop a Moisture Prediction System (MPS to digitize the prediction process. The results indicated that the Modified Henderson and Pabis model could present better predictions for the moisture transfer than others and the MPS could predict the moisture ratio through the whole drying process conveniently. Besides, higher temperature could accelerate effective diffusivities to increase drying rate, thus shorten the drying time. The activation energy of BM dried with CMIHA was 32.83 kJ/mol. All of these could be used in the design and operation of the combination drying beef meat.

  16. Water-filtered infrared a irradiation in combination with visible light inhibits acute chlamydial infection.

    Directory of Open Access Journals (Sweden)

    Hanna Marti

    Full Text Available New therapeutic strategies are needed to overcome drawbacks in treatment of infections with intracellular bacteria. Chlamydiaceae are Gram-negative bacteria implicated in acute and chronic diseases such as abortion in animals and trachoma in humans. Water-filtered infrared A (wIRA is short wavelength infrared radiation with a spectrum ranging from 780 to 1400 nm. In clinical settings, wIRA alone and in combination with visible light (VIS has proven its efficacy in acute and chronic wound healing processes. This is the first study to demonstrate that wIRA irradiation combined with VIS (wIRA/VIS diminishes recovery of infectious elementary bodies (EBs of both intra- and extracellular Chlamydia (C. in two different cell lines (Vero, HeLa regardless of the chlamydial strain (C. pecorum, C. trachomatis serovar E as shown by indirect immunofluorescence and titration by subpassage. Moreover, a single exposure to wIRA/VIS at 40 hours post infection (hpi led to a significant reduction of C. pecorum inclusion frequency in Vero cells and C. trachomatis in HeLa cells, respectively. A triple dose of irradiation (24, 36, 40 hpi during the course of C. trachomatis infection further reduced chlamydial inclusion frequency in HeLa cells without inducing the chlamydial persistence/stress response, as ascertained by electron microscopy. Irradiation of host cells (HeLa, Vero neither affected cell viability nor induced any molecular markers of cytotoxicity as investigated by Alamar blue assay and Western blot analysis. Chlamydial infection, irradiation, and the combination of both showed a similar release pattern of a subset of pro-inflammatory cytokines (MIF/GIF, Serpin E1, RANTES, IL-6, IL-8 and chemokines (IL-16, IP-10, ENA-78, MIG, MIP-1α/β from host cells. Initial investigation into the mechanism indicated possible thermal effects on Chlamydia due to irradiation. In summary, we demonstrate a non-chemical reduction of chlamydial infection using the combination

  17. Water-Filtered Infrared A Irradiation in Combination with Visible Light Inhibits Acute Chlamydial Infection

    Science.gov (United States)

    Marti, Hanna; Koschwanez, Maria; Pesch, Theresa; Blenn, Christian; Borel, Nicole

    2014-01-01

    New therapeutic strategies are needed to overcome drawbacks in treatment of infections with intracellular bacteria. Chlamydiaceae are Gram-negative bacteria implicated in acute and chronic diseases such as abortion in animals and trachoma in humans. Water-filtered infrared A (wIRA) is short wavelength infrared radiation with a spectrum ranging from 780 to 1400 nm. In clinical settings, wIRA alone and in combination with visible light (VIS) has proven its efficacy in acute and chronic wound healing processes. This is the first study to demonstrate that wIRA irradiation combined with VIS (wIRA/VIS) diminishes recovery of infectious elementary bodies (EBs) of both intra- and extracellular Chlamydia (C.) in two different cell lines (Vero, HeLa) regardless of the chlamydial strain (C. pecorum, C. trachomatis serovar E) as shown by indirect immunofluorescence and titration by subpassage. Moreover, a single exposure to wIRA/VIS at 40 hours post infection (hpi) led to a significant reduction of C. pecorum inclusion frequency in Vero cells and C. trachomatis in HeLa cells, respectively. A triple dose of irradiation (24, 36, 40 hpi) during the course of C. trachomatis infection further reduced chlamydial inclusion frequency in HeLa cells without inducing the chlamydial persistence/stress response, as ascertained by electron microscopy. Irradiation of host cells (HeLa, Vero) neither affected cell viability nor induced any molecular markers of cytotoxicity as investigated by Alamar blue assay and Western blot analysis. Chlamydial infection, irradiation, and the combination of both showed a similar release pattern of a subset of pro-inflammatory cytokines (MIF/GIF, Serpin E1, RANTES, IL-6, IL-8) and chemokines (IL-16, IP-10, ENA-78, MIG, MIP-1α/β) from host cells. Initial investigation into the mechanism indicated possible thermal effects on Chlamydia due to irradiation. In summary, we demonstrate a non-chemical reduction of chlamydial infection using the combination of water

  18. Model study of combined electrical and near-infrared neural stimulation on the bullfrog sciatic nerve.

    Science.gov (United States)

    You, Mengxian; Mou, Zongxia

    2017-07-01

    This paper implemented a model study of combined electrical and near-infrared (808 nm) neural stimulation (NINS) on the bullfrog sciatic nerve. The model includes a COMSOL model to calculate the electric-field distribution of the surrounding area of the nerve, a Monte Carlo model to simulate light transport and absorption in the bullfrog sciatic nerve during NINS, and a NEURON model to simulate the neural electrophysiology changes under electrical stimulus and laser irradiation. The optical thermal effect is considered the main mechanism during NINS. Therefore, thermal change during laser irradiation was calculated by the Monte Carlo method, and the temperature distribution was then transferred to the NEURON model to stimulate the sciatic nerve. The effects on thermal response by adjusting the laser spot size, energy of the beam, and the absorption coefficient of the nerve are analyzed. The effect of the ambient temperature on the electrical stimulation or laser stimulation and the interaction between laser irradiation and electrical stimulation are also studied. The results indicate that the needed stimulus threshold for neural activation or inhibition is reduced by laser irradiation. Additionally, the needed laser energy for blocking the action potential is reduced by electrical stimulus. Both electrical and laser stimulation are affected by the ambient temperature. These results provide references for subsequent animal experiments and could be of great help to future basic and applied studies of infrared neural stimulation (INS).

  19. Vehicle Classification and Speed Estimation Using Combined Passive Infrared/Ultrasonic Sensors

    KAUST Repository

    Odat, Enas

    2017-09-18

    In this paper, a new sensing device that can simultaneously monitor traffic congestion and urban flash floods is presented. This sensing device is based on the combination of passive infrared sensors (PIRs) and ultrasonic rangefinder, and is used for real-time vehicle detection, classification, and speed estimation in the context of wireless sensor networks. This framework relies on dynamic Bayesian Networks to fuse heterogeneous data both spatially and temporally for vehicle detection. To estimate the speed of the incoming vehicles, we first use cross correlation and wavelet transform-based methods to estimate the time delay between the signals of different sensors. We then propose a calibration and self-correction model based on Bayesian Networks to make a joint inference by all sensors about the speed and the length of the detected vehicle. Furthermore, we use the measurements of the ultrasonic and the PIR sensors to perform vehicle classification. Validation data (using an experimental dual infrared and ultrasonic traffic sensor) show a 99% accuracy in vehicle detection, a mean error of 5 kph in vehicle speed estimation, a mean error of 0.7m in vehicle length estimation, and a high accuracy in vehicle classification. Finally, we discuss the computational performance of the algorithm, and show that this framework can be implemented on low-power computational devices within a wireless sensor network setting. Such decentralized processing greatly improves the energy consumption of the system and minimizes bandwidth usage.

  20. A Hierarchical Framework Combining Motion and Feature Information for Infrared-Visible Video Registration

    Science.gov (United States)

    Sun, Xinglong; Xu, Tingfa; Zhang, Jizhou; Li, Xiangmin

    2017-01-01

    In this paper, we propose a novel hierarchical framework that combines motion and feature information to implement infrared-visible video registration on nearly planar scenes. In contrast to previous approaches, which involve the direct use of feature matching to find the global homography, the framework adds coarse registration based on the motion vectors of targets to estimate scale and rotation prior to matching. In precise registration based on keypoint matching, the scale and rotation are used in re-location to eliminate their impact on targets and keypoints. To strictly match the keypoints, first, we improve the quality of keypoint matching by using normalized location descriptors and descriptors generated by the histogram of edge orientation. Second, we remove most mismatches by counting the matching directions of correspondences. We tested our framework on a public dataset, where our proposed framework outperformed two recently-proposed state-of-the-art global registration methods in almost all tested videos. PMID:28212350

  1. Near-infrared spectral reflectance of mineral mixtures - Systematic combinations of pyroxenes, olivine, and iron oxides

    Science.gov (United States)

    Singer, R. B.

    1981-01-01

    Near-infrared spectral reflectance data are presented for systematic variations in weight percent of two component mixtures of ferromagnesium and iron oxide minerals used to study the dark materials on Mars. Olivine spectral features are greatly reduced in contrast by admixture of other phases but remain distinctive even for low olivine contents. Clinopyroxene and orthopyroxene mixtures show resolved pyroxene absorptions near 2 microns. Limonite greatly modifies pyroxene and olivine reflectance, but does not fully eliminate distinctive spectral characteristics. Using only spectral data in the 1 micron region, it is difficult to differentiate orthopyroxene and limonite in a mixture. All composite mineral absorptions were either weaker than or intermediate in strength to the end-member absorptions and have bandwidths greater than or equal to those for the end members. In general, spectral properties in an intimate mixture combine in a complex, nonadditive manner, with features demonstrating a regular but usually nonlinear variation as a function of end-member phase proportions.

  2. Investigation of dielectric properties of different cake formulations during microwave and infrared-microwave combination baking.

    Science.gov (United States)

    Sakiyan, Ozge; Sumnu, Gulum; Sahin, Serpil; Meda, Venkatesh

    2007-05-01

    Dielectric properties can be used to understand the behavior of food materials during microwave processing. Dielectric properties influence the level of interaction between food and high frequency electromagnetic energy. Dielectric properties are, therefore, important in the design of foods intended for microwave preparation. In this study, it was aimed to determine the variation of dielectric properties of different cake formulations during baking in microwave and infrared-microwave combination oven. In addition, the effects of formulation and temperature on dielectric properties of cake batter were examined. Dielectric constant and loss factor of cake samples were shown to be dependent on formulation, baking time, and temperature. The increase in baking time and temperature decreased dielectric constant and loss factor of all formulations. Fat content was shown to increase dielectric constant and loss factor of cakes.

  3. Infrared/microwave (IR/MW) micromirror array beam combiner design and analysis.

    Science.gov (United States)

    Tian, Yi; Lv, Lijun; Jiang, Liwei; Wang, Xin; Li, Yanhong; Yu, Haiming; Feng, Xiaochen; Li, Qi; Zhang, Li; Li, Zhuo

    2013-08-01

    We investigated the design method of an infrared (IR)/microwave (MW) micromirror array type of beam combiner. The size of micromirror is in microscopic levels and comparable to MW wavelengths, so that the MW will not react in these dimensions, whereas the much shorter optical wavelengths will be reflected by them. Hence, the MW multilayered substrate was simplified and designed using transmission line theory. The beam combiner used an IR wavefront-division imaging technique to reflect the IR radiation image to the unit under test (UUT)'s pupil in a parallel light path. In addition, the boresight error detected by phase monopulse radar was analyzed using a moment-of method (MoM) and multilevel fast multipole method (MLFMM) acceleration technique. The boresight error introduced by the finite size of the beam combiner was less than 1°. Finally, in order to verify the wavefront-division imaging technique, a prototype of a micromirror array was fabricated, and IR images were tested. The IR images obtained by the thermal imager verified the correctness of the wavefront-division imaging technique.

  4. [Traceability of Wine Varieties Using Near Infrared Spectroscopy Combined with Cyclic Voltammetry].

    Science.gov (United States)

    Li, Meng-hua; Li, Jing-ming; Li, Jun-hui; Zhang, Lu-da; Zhao, Long-lian

    2015-06-01

    To achieve the traceability of wine varieties, a method was proposed to fuse Near-infrared (NIR) spectra and cyclic voltammograms (CV) which contain different information using D-S evidence theory. NIR spectra and CV curves of three different varieties of wines (cabernet sauvignon, merlot, cabernet gernischt) which come from seven different geographical origins were collected separately. The discriminant models were built using PLS-DA method. Based on this, D-S evidence theory was then applied to achieve the integration of the two kinds of discrimination results. After integrated by D-S evidence theory, the accuracy rate of cross-validation is 95.69% and validation set is 94.12% for wine variety identification. When only considering the wine that come from Yantai, the accuracy rate of cross-validation is 99.46% and validation set is 100%. All the traceability models after fusion achieved better results on classification than individual method. These results suggest that the proposed method combining electrochemical information with spectral information using the D-S evidence combination formula is benefit to the improvement of model discrimination effect, and is a promising tool for discriminating different kinds of wines.

  5. Five intermolecular vibrations of the CO2 dimer observed via infrared combination bands

    Science.gov (United States)

    Norooz Oliaee, J.; Dehghany, M.; Rezaei, Mojtaba; McKellar, A. R. W.; Moazzen-Ahmadi, N.

    2016-11-01

    The weakly bound van der Waals dimer (CO2)2 has long been of considerable theoretical and experimental interest. Here, we study its low frequency intermolecular vibrations by means of combination bands in the region of the CO2 monomer ν3 fundamental (≈2350 cm-1), which are observed using a tunable infrared laser to probe a pulsed supersonic slit jet expansion. With the help of a recent high level ab initio calculation by Wang, Carrington, and Dawes, four intermolecular frequencies are assigned: the in-plane disrotatory bend (22.26 cm-1); the out-of-plane torsion (23.24 cm-1); twice the disrotatory bend (31.51 cm-1); and the in-plane conrotatory bend (92.25 cm-1). The disrotatory bend and torsion, separated by only 0.98 cm-1, are strongly mixed by Coriolis interactions. The disrotatory bend overtone is well behaved, but the conrotatory bend is highly perturbed and could not be well fitted. The latter perturbations could be due to tunneling effects, which have not previously been observed experimentally for CO2 dimer. A fifth combination band, located 1.3 cm-1 below the conrotatory bend, remains unassigned.

  6. Analysis of Chuanxiong Rhizoma and its active components by Fourier transform infrared spectroscopy combined with two-dimensional correlation infrared spectroscopy

    Science.gov (United States)

    Guo, Yizhen; Lv, Beiran; Wang, Jingjuan; Liu, Yang; Sun, Suqin; Xiao, Yao; Lu, Lina; Xiang, Li; Yang, Yanfang; Qu, Lei; Meng, Qinghong

    2016-01-01

    As complicated mixture systems, active components of Chuanxiong Rhizoma are very difficult to identify and discriminate. In this paper, the macroscopic IR fingerprint method including Fourier transform infrared spectroscopy (FT-IR), the second derivative infrared spectroscopy (SD-IR) and two-dimensional correlation infrared spectroscopy (2DCOS-IR), was applied to study and identify Chuanxiong raw materials and its different segmented production of HPD-100 macroporous resin. Chuanxiong Rhizoma is rich in sucrose. In the FT-IR spectra, water eluate is more similar to sucrose than the powder and the decoction. Their second derivative spectra amplified the differences and revealed the potentially characteristic IR absorption bands and combined with the correlation coefficient, concluding that 50% ethanol eluate had more ligustilide than other eluates. Finally, it can be found from 2DCOS-IR spectra that proteins were extracted by ethanol from Chuanxiong decoction by HPD-100 macroporous resin. It was demonstrated that the above three-step infrared spectroscopy could be applicable for quick, non-destructive and effective analysis and identification of very complicated and similar mixture systems of traditional Chinese medicines.

  7. Functional Magnetic Resonance Imaging and Functional Near-Infrared Spectroscopy: Insights from Combined Recording Studies

    Directory of Open Access Journals (Sweden)

    Vanessa Scarapicchia

    2017-08-01

    Full Text Available Although blood oxygen level dependent (BOLD functional magnetic resonance imaging (fMRI is a widely available, non-invasive technique that offers excellent spatial resolution, it remains limited by practical constraints imposed by the scanner environment. More recently, functional near infrared spectroscopy (fNIRS has emerged as an alternative hemodynamic-based approach that possesses a number of strengths where fMRI is limited, most notably in portability and higher tolerance for motion. To date, fNIRS has shown promise in its ability to shed light on the functioning of the human brain in populations and contexts previously inaccessible to fMRI. Notable contributions include infant neuroimaging studies and studies examining full-body behaviors, such as exercise. However, much like fMRI, fNIRS has technical constraints that have limited its application to clinical settings, including a lower spatial resolution and limited depth of recording. Thus, by combining fMRI and fNIRS in such a way that the two methods complement each other, a multimodal imaging approach may allow for more complex research paradigms than is feasible with either technique alone. In light of these issues, the purpose of the current review is to: (1 provide an overview of fMRI and fNIRS and their associated strengths and limitations; (2 review existing combined fMRI-fNIRS recording studies; and (3 discuss how their combined use in future research practices may aid in advancing modern investigations of human brain function.

  8. CO2 Dimer: Four Intermolecular Modes Observed via Infrared Combination Bands

    Science.gov (United States)

    Norooz Oliaee, Jalal; Dehghany, Mehdi; Rezaei, Mojtaba; McKellar, Bob; Moazzen-Ahmadi, Nasser

    2016-06-01

    Study of the carbon dioxide dimer has a long history, but there is only one previous observation of an intermolecular vibration [1]. Here we analyze four new combination bands of (CO2)2 in the CO2 νb{3} region (˜2350 wn), observed using tunable infrared lasers and a pulsed slit-jet supersonic expansion. The previous combination band at 2382.2 wn was simple to assign [1]. A much more complicated band (˜2370 wn) turns out to involve two upper states, one at 2369.0 wn (Bu symmetry), and the other at 2370.0 wn (Au). The spectrum can be nicely fit by including the Coriolis interactions between these states. Another complicated band around 2443 wn also involves two nearby upper states which are highly perturbed in so-far unexplained ways (possibly related to tunneling shifts). With the help of new ab initio calculations [2], we assign the results as follows. The 2369.0 wn band is the combination of the forbidden Ag intramolecular fundamental (probably [1] at about 2346.76 wn) and the intermolecular geared bend (Bu). The 2370.0 wn band is the combination of the same Ag fundamental and the intermolecular torsion (Au). This gives about 22.3 and 23.2 wn for the geared bend and torsion. The previous 2382.2 wn band [1] is the allowed Bu fundamental (2350.771 wn) plus two quanta of the geared bend (Bu), giving 31.509 wn for this overtone. The highly perturbed 2442.7 wn band is the Bu fundamental plus the antigeared bend (Ag), giving about 91.9 wn for the antigeared bend. Finally, the perturbed 2442.1 wn band is due to an unknown combination of modes which gains intensity from the antigeared bend by a Fermi-type interaction. Calculated values [2] are: 20.64 (geared bend), 24.44 (torsion), 32.34 (geared bend overtone), and 92.30 wn (antigeared bend), in good agreement with experiment. \\vskip 0.2 truecm [1] M. Dehghany, A.R.W. McKellar, Mahin Afshari, and N. Moazzen-Ahmadi, Mol. Phys. 108, 2195 (2010). [2] X.-G. Wang, T. Carrington, Jr., and R. Dawes, private communication.

  9. 布地奈德混悬液联合纤支镜用于儿童甲型H1N1/H3N2感染合并塑型性支气管炎的病例分析%Case Analysis of Budesonide Suspension Combined with Fiber Bronchoscope for Influenza A(H1N1/H3N2) Infection Complicated with Plastic Bronchitis in Children

    Institute of Scientific and Technical Information of China (English)

    耿刚; 罗健; 罗征秀; 刘恩梅; 符州

    2015-01-01

    目的:探讨甲型H1N1/H3N2感染合并塑型性支气管炎(PB)的病理特征及诊治方法.方法:报告3例我院收治的甲型H1N1/H3N2感染合并PB儿童的病例资料,总结布地奈德混悬液雾化吸入联合纤支镜灌洗的治疗经验,并结合文献内容对该少见病种进行分析.结果:3例患儿中有2例甲型H1N1、1例甲型H3N2感染合并PB,其中2例有基础疾病,分别为支气管哮喘与原发性肾病综合征.3例患儿均诊断为重症肺炎、呼吸衰竭、肺不张,其中2例伴有纵膈气肿、皮下气肿.经纤支镜检查均取出树枝状异物,病理检查均为纤维素性渗出,伴有中性粒细胞、嗜酸性粒细胞及淋巴细胞浸润,确诊为PB.3例患儿经过辅助呼吸、呼吸道管理、抗感染等对症支持治疗,并采用布地奈德混悬液雾化吸入联合纤支镜灌洗后均痊愈出院.结论:PB是甲型流感的合并症之一,病情危重.临床上一旦考虑该病,应在布地奈德混悬液雾化治疗基础上尽快行纤支镜检查,以明确诊断并及时治疗.%OBJECTIVE:To analyze the pathological characteristics and therapy method for influenza A(H1N1/H3N2)in-fection complicated with plastic bronchitis (PB). METHODS:Clinical information of 3 children with influenza A (H1N1/H3N2) infection complicated with PB were reported to summarize the experience of aerosol inhalation of Budesonide suspen-sion combined with fiber bronchoscope lavage. Based on literatures,this rare disease were analyzed. RESULTS:Among 3 chil-dren,2 children suffered from influenza A H1N1 infection and one child influenza A H3N2 infection complicated with PB;2 of them got basic disease,i.e. bronchial asthma and primary renal syndrome. 3 children were diagnosed as severe pneumonia,re-spiratory failure and pulmonary atelectasis;2 of them suffered from mediastinal emphesema and subcutaneous emphysema. The branchlike foreign bodies,removed by fiber bronchoscope,were fibrin complicated with neutrophile

  10. Recipes for stellar jets: results of combined optical/infrared diagnostics

    CERN Document Server

    Podio, L; Nisini, B; Eislöffel, J; Massi, F; Giannini, T; Ray, T P; Podio, Linda; Bacciotti, Francesca; Nisini, Brunella; Eisl\\"offel, Jochen; Massi, Fabrizio; Giannini, Teresa; Ray, Thomas P.

    2006-01-01

    We examine the conditions of the plasma along a sample of 'classical' Herbig-Haro jets located in the Orion and Vela star forming regions, through combined optical-infrared spectral diagnostics. Our sample includes HH 111, HH 34, HH 83, HH 73, HH 24 C/E, HH 24 J, observed at moderate spatial/spectral resolution. The obtained spectra cover a wide wavelength range from 0.6-2.5 um, including many transitions from regions of different excitation conditions. This allows us to probe the density and temperature stratification which characterises the cooling zones behind the shock fronts along the jet. The derived physical parameters (such as the extinction, the electron density and temperature, the ionisation fraction, and the total density) are used to estimate the depletion onto dust grains of Calcium and Iron with respect to solar abundances. This turns out to be between 70% and 0% for Ca and ~90% for Fe, suggesting that the weak shocks present in the beams are not capable of completely destroying the dust grains...

  11. Aerial ungulate surveys with a combination of infrared and high–resolution natural colour images

    Directory of Open Access Journals (Sweden)

    Franke, U.

    2012-01-01

    Full Text Available Information on animal population sizes is crucial for wildlife management. In aerial surveys, we used a silent light aircraft (microlight and a combination of a computer–linked thermal infrared camera (640 x 480 pixels to detect ungulates and high–resolution visual images (5,616 x 3,744 pixels to identify specific species. From winter 2008/2009 to winter 2010/2011, we flew 48 missions over three German national parks and a German/ French biosphere reserve. Within each study area, we followed non–overlapping linear transects with a flying altitude ~450 m above ground level and scanned 1,500–2,000 ha every two hours of flight time. Animals best detected and identified were red deer and fallow deer. Detection rates with respect to the type and density of vegetation cover ranged from 0% (young spruce to 75% (young defoliated beech to 100% (open land. This non–invasive method is cost–effective and suitable for many landscapes.

  12. Connecting caddisworm silk structure and mechanical properties: combined infrared spectroscopy and mechanical analysis

    Science.gov (United States)

    Ashton, Nicholas N.; Pan, Huaizhong; Stewart, Russell J.

    2016-01-01

    The underwater silk of an aquatic casemaking caddisfly larvae (Hesperophylax occidentalis) is viscoelastic, and displays distinct yield behaviour, large strain cycle hysteresis and near complete recovery of its initial strength and stiffness when unloaded. Yield followed by a stress plateau has been attributed to sequential rupture of serial Ca2+-cross-linked phosphoserine (pS) β-domains. Spontaneous recovery has been attributed to refolding of the Ca2+/pS domains powered by an elastic network. In this study, native Ca2+ ions were exchanged with other metal ions, followed by combined mechanical and FTIR analysis to probe the contribution of pS/metal ion complexes to silk mechanical properties. After exchange of Ca2+ with Na+, the fibres are soft elastomers and the infrared spectra are consistent with Cv3 symmetry of the – groups. Multivalent metal ions decreased the – symmetry and the symmetric stretching modes (vs) split in a manner characteristic of ordered phosphate compounds, such as phosphate minerals and lamellar bilayers of phosphatidic acid lipids. Integrated intensities of the vs bands, indicative of the metal ion's effect on transition dipole moment of the P–O bonds, and thereby the strength of the phosphate metal complex, increased in the order: Na+ ion-exchanged fibres increased in the same order: establishing the link between phosphate transition dipole moments and silk fibre strength. PMID:27278649

  13. Identification of Plant-Pathogenic Fungi Using Fourier Transform Infrared Spectroscopy Combined with Chemometric Analyses

    Institute of Scientific and Technical Information of China (English)

    CHAI A-li; WANG Yi-kai; ZHU Fa-di; SHI Yan-xia; XIE Xue-wen; LI Bao-ju

    2016-01-01

    Identification of plant-pathogenic fungi is time-consuming due to cultivation and microscopic exami-nation and can be influenced by the interpretation of the micro-morphological characters observed.The present investigation aimed to create a simple but sophisticated method for the identification of plant-pathogenic fungi by Fourier transform infrared (FTIR)spectroscopy.In this study,FTIR-attenuated total reflectance (ATR) spectroscopy was used in combination with chemometric analysis for identification of important pathogenic fun-gi of horticultural plants.Mixtures of mycelia and spores from 27 fungal strains belonging to nine different families were collected from liquid PD or solid PDA media cultures and subj ected to FTIR-ATR spectroscopy measurements.The FTIR-ATR spectra ranging from 4 000 to 400 cm-1 were obtained.To classify the FTIR-ATR spectra,cluster analysis was compared with canonical vitiate analysis (CVA)in the spectral regions of 3 050~2 800 and 1 800~900 cm-1 .Results showed that the identification accuracies achieved 97.53% and 9 9.1 8% for the cluster analysis and CVA analysis,respectively,demonstrating the high potential of this tech-nique for fungal strain identification.

  14. A four-pole power-combiner design for far-infrared and submillimeter spectroscopy

    CERN Document Server

    Cataldo, Giuseppe; Wollack, Edward J

    2015-01-01

    The far-infrared and submillimeter portions of the electromagnetic spectrum provide a unique view of the astrophysical processes present in the early universe. Micro-Spec ($\\mu$-Spec), a high-efficiency direct-detection spectrometer concept working in the 450-1000-$\\mu$m wavelength range, will enable a wide range of spaceflight missions that would otherwise be challenging due to the large size of current instruments and the required spectral resolution and sensitivity. This paper focuses on the $\\mu$-Spec two-dimensional multimode region, where the light of different wavelengths diffracts and converges onto a set of detectors. A two-step optimization process is used to generate geometrical configurations given specific requirements on spectrometer size, operating spectral range, and performance. The canonically employed focal-plane constraints for the power combiner were removed to probe the design space in its entirety. A new four-stigmatic-point optical design solution is identified and explored for use in ...

  15. Corrosion inhibition of copper in aqueous chloride solution by 1H-1,2,3-triazole and 1,2,4-triazole and their combinations: electrochemical, Raman and theoretical studies.

    Science.gov (United States)

    Ofoegbu, Stanley Udochukwu; Galvão, Tiago L P; Gomes, José R B; Tedim, João; Nogueira, Helena I S; Ferreira, M G S; Zheludkevich, M L

    2017-02-22

    Triazoles are well-known organic corrosion inhibitors of copper. 1H-1,2,3-Triazole and 1,2,4-triazole, two very simple molecules with the only difference being the positions of the nitrogen atoms in the triazole ring, were studied in this work as corrosion inhibitors of copper in 50 mM NaCl solution using a set of electrochemical and analytical techniques. The results of electrochemical tests indicate that 1H-1,2,3-triazole exhibited superior inhibitor properties but could not suppress anodic copper dissolution at moderate anodic potentials (>+300 mV SCE), while 1,2,4-triazole, although it exhibited higher anodic currents, suppressed anodic copper dissolution at very anodic potentials. Density functional theory calculations were also performed to interpret the measured data and trends observed in the electrochemical studies. The computational studies considered either the inhibitors isolated in the gaseous phase or adsorbed onto Cu(111) surface models. From the calculations, the mechanisms of the inhibitive effects of both triazoles were established and plausible mechanisms of formation of the protective films on the Cu surface were proposed. The results of this study hold positive implications for research in the areas of catalysis, and copper content control in water purification systems.

  16. Main: 1H49 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H49 トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...NPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1H49.jpg ...

  17. Main: 1H81 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H81 トウモロコシ Corn Zea mays L. Polyamine Oxidase Precursor Name=Pao; Zea Mays Molecul...PEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQGKYD corn_1H81.jpg ...

  18. Main: 1H86 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H86 トウモロコシ Corn Zea mays L. Polyamine Oxidase Precursor Name=Pao; Zea Mays Molecul...PEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQGKYD corn_1H86.jpg ...

  19. Main: 1H84 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H84 トウモロコシ Corn Zea mays L. Polyamine Oxidase Precursor Name=Pao; Zea Mays Molecul...GYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQGKYD corn_1H84.jpg ...

  20. Main: 1H83 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H83 トウモロコシ Corn Zea mays L. Polyamine Oxidase Precursor Name=Pao; Zea Mays Molecul...GYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQGKYD corn_1H83.jpg ...

  1. Main: 1H82 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H82 トウモロコシ Corn Zea mays L. Polyamine Oxidase Precursor Name=Pao; Zea Mays Molecul...PEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQGKYD corn_1H82.jpg ...

  2. FT-IR, UV-vis, 1H and 13C NMR spectra and the equilibrium structure of organic dye molecule disperse red 1 acrylate: a combined experimental and theoretical analysis.

    Science.gov (United States)

    Cinar, Mehmet; Coruh, Ali; Karabacak, Mehmet

    2011-12-01

    This study reports the characterization of disperse red 1 acrylate compound by spectral techniques and quantum chemical calculations. The spectroscopic properties were analyzed by FT-IR, UV-vis, (1)H NMR and (13)C NMR techniques. FT-IR spectrum in solid state was recorded in the region 4000-400 cm(-1). The UV-vis absorption spectrum of the compound that dissolved in methanol was recorded in the range of 200-800 nm. The (1)H and (13)C NMR spectra were recorded in CDCl(3) solution. The structural and spectroscopic data of the molecule in the ground state were calculated using density functional theory (DFT) employing B3LYP exchange correlation and the 6-311++G(d,p) basis set. The vibrational wavenumbers were calculated and scaled values were compared with experimental FT-IR spectrum. A satisfactory consistency between the experimental and theoretical spectra was obtained and it shows that the hybrid DFT method is very useful in predicting accurate vibrational structure, especially for high-frequency region. The complete assignments were performed on the basis of the experimental results and total energy distribution (TED) of the vibrational modes, calculated with scaled quantum mechanics (SQM) method. Isotropic chemical shifts were calculated using the gauge-invariant atomic orbital (GIAO) method. A study on the electronic properties were performed by timedependent DFT (TD-DFT) and CIS(D) approach. To investigate non linear optical properties, the electric dipole moment μ, polarizability α, anisotropy of polarizability Δα and molecular first hyperpolarizability β were computed. The linear polarizabilities and first hyperpolarizabilities of the studied molecule indicate that the compound can be a good candidate of nonlinear optical materials.

  3. Mid-infrared spectroscopy combined with chemometrics to detect Sclerotinia stem rot on oilseed rape (Brassica napus L.) leaves.

    Science.gov (United States)

    Zhang, Chu; Feng, Xuping; Wang, Jian; Liu, Fei; He, Yong; Zhou, Weijun

    2017-01-01

    Detection of plant diseases in a fast and simple way is crucial for timely disease control. Conventionally, plant diseases are accurately identified by DNA, RNA or serology based methods which are time consuming, complex and expensive. Mid-infrared spectroscopy is a promising technique that simplifies the detection procedure for the disease. Mid-infrared spectroscopy was used to identify the spectral differences between healthy and infected oilseed rape leaves. Two different sample sets from two experiments were used to explore and validate the feasibility of using mid-infrared spectroscopy in detecting Sclerotinia stem rot (SSR) on oilseed rape leaves. The average mid-infrared spectra showed differences between healthy and infected leaves, and the differences varied among different sample sets. Optimal wavenumbers for the 2 sample sets selected by the second derivative spectra were similar, indicating the efficacy of selecting optimal wavenumbers. Chemometric methods were further used to quantitatively detect the oilseed rape leaves infected by SSR, including the partial least squares-discriminant analysis, support vector machine and extreme learning machine. The discriminant models using the full spectra and the optimal wavenumbers of the 2 sample sets were effective for classification accuracies over 80%. The discriminant results for the 2 sample sets varied due to variations in the samples. The use of two sample sets proved and validated the feasibility of using mid-infrared spectroscopy and chemometric methods for detecting SSR on oilseed rape leaves. The similarities among the selected optimal wavenumbers in different sample sets made it feasible to simplify the models and build practical models. Mid-infrared spectroscopy is a reliable and promising technique for SSR control. This study helps in developing practical application of using mid-infrared spectroscopy combined with chemometrics to detect plant disease.

  4. Numerical Study on Infrared Optical Property of Diffuse Coal Particles in Mine Fully Mechanized Working Combined with CFD Method

    Directory of Open Access Journals (Sweden)

    Wen-Zheng Wang

    2015-01-01

    Full Text Available Coal dust seriously threatens the safety and occupational health of coal mines. Numerical simulation research on the infrared radiation characteristics of diffused coal dust is carried out in fully mechanized working faces based on the optical monitoring problem of dust particles in mine atmospheric environments. The CFD method is applied to obtain the law of dust transport and distribution. Combined with Mie scattering model, the infrared radiation change characteristics and spectral selection of diffused coal dust particles are simulated and analyzed along the working face. The comparison results show the following: the attenuation and scattering characteristics of mine dust particles system are first enhanced, and then they weaken as the distance from dust source increases. The infrared attenuation of mine dust at the center of the vertical cross-section is generally greater than that at the roof and floor in the same location. The dispersion of mine dust directly determines the attenuation contribution of respirable dust to total dust. Moreover, the infrared absorption effect of functional groups in coal causes the infrared attenuation effect of coal dust to have obvious optical selectivity along the roadway, the existing optical “window.”

  5. A practical algorithm for estimating surface soil moisture using combined optical and thermal infrared data

    Science.gov (United States)

    Leng, Pei; Song, Xiaoning; Duan, Si-Bo; Li, Zhao-Liang

    2016-10-01

    Surface soil moisture (SSM) is a critical variable for understanding the energy and water exchange between the land and atmosphere. A multi-linear model was recently developed to determine SSM using ellipse variables, namely, the center horizontal coordinate (x0), center vertical coordinate (y0), semi-major axis (a) and rotation angle (θ), derived from the elliptical relationship between diurnal cycles of land surface temperature (LST) and net surface shortwave radiation (NSSR). However, the multi-linear model has a major disadvantage. The model coefficients are calculated based on simulated data produced by a land surface model simulation that requires sufficient meteorological measurements. This study aims to determine the model coefficients directly using limited meteorological parameters rather than via the complicated simulation process, decreasing the dependence of the model coefficients on meteorological measurements. With the simulated data, a practical algorithm was developed to estimate SSM based on combined optical and thermal infrared data. The results suggest that the proposed approach can be used to determine the coefficients associated with all ellipse variables based on historical meteorological records, whereas the constant term varies daily and can only be determined using the daily maximum solar radiation in a prediction model. Simulated results from three FLUXNET sites over 30 cloud-free days revealed an average root mean square error (RMSE) of 0.042 m3/m3 when historical meteorological records were used to synchronously determine the model coefficients. In addition, estimated SSM values exhibited generally moderate accuracies (coefficient of determination R2 = 0.395, RMSE = 0.061 m3/m3) compared to SSM measurements at the Yucheng Comprehensive Experimental Station.

  6. Early detection of melanoma with the combined use of acoustic microscopy, infrared reflectance and Raman spectroscopy

    Science.gov (United States)

    Karagiannis, Georgios T.; Grivas, Ioannis; Tsingotjidou, Anastasia; Apostolidis, Georgios K.; Grigoriadou, Ifigeneia; Dori, I.; Poulatsidou, Kyriaki-Nefeli; Doumas, Argyrios; Wesarg, Stefan; Georgoulias, Panagiotis

    2015-03-01

    Malignant melanoma is a form of skin cancer, with increasing incidence worldwide. Early diagnosis is crucial for the prognosis and treatment of the disease. The objective of this study is to develop a novel animal model of melanoma and apply a combination of the non-invasive imaging techniques acoustic microscopy, infrared (IR) and Raman spectroscopies, for the detection of developing tumors. Acoustic microscopy provides information about the 3D structure of the tumor, whereas, both spectroscopic modalities give qualitative insight of biochemical changes during melanoma development. In order to efficiently set up the final devices, propagation of ultrasonic and electromagnetic waves in normal skin and melanoma simulated structures was performed. Synthetic and grape-extracted melanin (simulated tumors), endermally injected, were scanned and compared to normal skin. For both cases acoustic microscopy with central operating frequencies of 110MHz and 175MHz were used, resulting to the tomographic imaging of the simulated tumor, while with the spectroscopic modalities IR and Raman differences among spectra of normal and melanin- injected sites were identified in skin depth. Subsequently, growth of actual tumors in an animal melanoma model, with the use of human malignant melanoma cells was achieved. Acoustic microscopy and IR and Raman spectroscopies were also applied. The development of tumors at different time points was displayed using acoustic microscopy. Moreover, the changes of the IR and Raman spectra were studied between the melanoma tumors and adjacent healthy skin. The most significant changes between healthy skin and the melanoma area were observed in the range of 900-1800cm-1 and 350-2000cm-1, respectively.

  7. Adulteration detection in milk using infrared spectroscopy combined with two-dimensional correlation analysis

    Science.gov (United States)

    He, Bin; Liu, Rong; Yang, Renjie; Xu, Kexin

    2010-02-01

    Adulteration of milk and dairy products has brought serious threats to human health as well as enormous economic losses to the food industry. Considering the diversity of adulterants possibly mixed in milk, such as melamine, urea, tetracycline, sugar/salt and so forth, a rapid, widely available, high-throughput, cost-effective method is needed for detecting each of the components in milk at once. In this paper, a method using Fourier Transform Infrared spectroscopy (FTIR) combined with two-dimensional (2D) correlation spectroscopy is established for the discriminative analysis of adulteration in milk. Firstly, the characteristic peaks of the raw milk are found in the 4000-400 cm-1 region by its original spectra. Secondly, the adulterant samples are respectively detected with the same method to establish a spectral database for subsequent comparison. Then, 2D correlation spectra of the samples are obtained which have high time resolution and can provide information about concentration-dependent intensity changes not readily accessible from one-dimensional spectra. And the characteristic peaks in the synchronous 2D correlation spectra of the suspected samples are compared with those of raw milk. The differences among their synchronous spectra imply that the suspected milk sample must contain some kinds of adulterants. Melamine, urea, tetracycline and glucose adulterants in milk are identified respectively. This nondestructive method can be used for a correct discrimination on whether the milk and dairy products are adulterated with deleterious substances and it provides a new simple and cost-effective alternative to test the components of milk.

  8. 3.0T1H-MRS联合梯度回波化学位移技术定量分析评估脂肪肝治疗效果%Quantification of liver fat content by 1H-MR spectroscopy combined with chemical shift gradient-echo MR imaging at 3.0T for therapeutic evaluation of fatty liver—a preliminary study

    Institute of Scientific and Technical Information of China (English)

    张羲娥; 黄子星; 袁放; 宋彬; 刘曦娇; 张威

    2012-01-01

    Objective:To investigate the feasibility of proton magnetic resonance spectroscopy OH-MRS) and chemical shift gradient-echo imaging to quantitatively analyze liver fat content for therapeutic evaluation of fatty liver at 3. OT MR system. Methods:26 patients diagnosed as fatty liver were examined with proton MRS and magnetic resonance chemical shift based fat suppression sequences(Dixon and triple-echo Dixon)at 3. OT MR system before and 3,6 months after treatment respectively to calculate the fat index(FI)of Dixon, the water peak (Pwater), fat peak (Pliptd) and water peak area (Awater),fat peak area (Aliptd) were for MRS to calculate relative lipid content KRLCDand relative lipid content 2(RLC2). Fatty liver index(FLI)was referred to the standard which was calculated from triglycerides (TG),gamma-glutamyl-trans-ferase CGGT) ,waist circumference and body mass index(BMI). Results:Significant positive correlation (r>0,P0,P<0. 05)was demonstrated in MRI measured valuesCFI, RLCl,RLC2)and FLI. Significant difference between groups was demonstrated in FI, RLC1,RLC2 and FLI. Significance in statistics was demonstrated in time* type in the Polynomial test for the comparison of time change trend which point out the significant difference of FI-,RLC1,RLC2 between pre-treatment and pos-treatment. Reliability analysis showed that FI in both pre-treatment and pos-treatment groups and RLC1 ,RLC2 in pre-treatment group got significant repeatability while ICC ≥0. 75. Conclusion:' H-MRS combined with chemical shift gradient-echo techniques can quantitatively measure liver fat content. They can be reliably used for dynamic monitoring the therapeutic effects for fatty liver. Dixon technique is more stable, while 1H-MRS is more accurate. Both 1H-MRS and Dixon technique have good clinical application in dynamically monitoring the progression of fatty liver and evaluating the therapeutic effects of various treatments.%目的:探讨在3.0T MRI上联合运用氢质子波谱成像(1H-MRS

  9. Intramolecular excited proton transfer of 1-(1-phenyl-1H-phenanthro[9,10-d]imidazol-2-yl)naphthalen-2-ol - A combined experimental and quantum chemical studies

    Science.gov (United States)

    Jayabharathi, J.; Thanikachalam, V.; Ramanathan, P.; Arunpandiyan, A.

    2014-03-01

    Synthesis of the 1-(1-phenyl-1H-phenanthro[9,10-d]imidazol-2-yl)naphthalen-2-ol [PPIN] is reported, spectral and fluorescent properties of the title compound are investigated. The feasibility of excited state intramolecular proton transfer (ESIPT) has been argued from the changeover of relative stability of the enol and the keto forms on photoexcitation from the S0-PES to the S1-PES. Critical evaluation on the modulations of geometrical parameters other than the proton transfer reaction coordinate has also been undertaken. The intramolecular hydrogen bonding (IMHB) interaction in PPIN has been explored by calculation of the hyperconjugative charge transfer interaction from the lone electron pair of ring nitrogen atom to the σ∗ orbital of O-H bond, under the provision of Natural Bond Orbital (NBO) analysis. However, DFT calculations together with the experimental results reveal that the excited species with the intramolecular N⋯HO hydrogen bond type undergoes rapid radiationless deactivation. This leads to a conclusion that the low-intensity dual-band fluorescence of the title compound in solution originates from the traces of the conformation with the -OH bond to azomethine nitrogen atom (ESIPT).

  10. Sensitized chemiluminescence of 2-phenyl-4,5-di(2-furyl)-1H-imidazole/K₃Fe(CN)₆/propyl gallate system combining with solid-phase extraction for the determination of propyl gallate in edible oil.

    Science.gov (United States)

    Kang, Jing; Han, Lu; Chen, Zhonglin; Shen, Jimin; Nan, Jun; Zhang, Yihua

    2014-09-15

    In this paper, a novel chemiluminescence (CL) method has been developed for the determination of propyl gallate (PG). The proposed method was based on the enhancing effect of PG on the CL signal of 2-phenyl-4,5-di(2-furyl)-1H-imidazole (PDFI) and K3Fe(CN)6 reaction in an alkaline solution. Under the optimum conditions, the enhanced CL intensity was linearly related to the concentration of PG. The linear range of the calibration curve was 0.05-8 μg/mL, and the corresponding detection limit (3σ) was 0.036 μg/mL. The relative standard deviation for determining 1.0 μg/mL PG was 2.8% (n=11). The proposed method has been successfully applied to the determination of PG in edible oil. The edible oil samples were prepared by the solid-phase extraction (SPE) with a C18 column served as the stationary phase. Furthermore, the possible CL mechanism was also discussed briefly based on the photoluminescence (PL) and CL spectra.

  11. Combination of high performance refractometry and infrared spectroscopy as a probe for chemically induced gelation and vitrification of epoxies

    OpenAIRE

    Müller, Ulrich; Philipp, Martine; Gervais, P. C.; Possart, Prof Dr Wulff; Wehlack, C.; Kieffer, J.; Sanctuary, Roland; Krüger, Jan-Kristian

    2010-01-01

    A combination of infrared spectroscopy and high performance refractometry was used to investigate the chemically induced sol-gel and glass transition during the polymerization of epoxies. Representations of the refractive index versus chemical conversion reveal an interesting insight in the optical properties accompanying gelation and vitrification. Whereas the electronic polarizability of the liquid state of small average molecular mass and the glassy state is dominated by the mass density, ...

  12. Dust-Corrected Star Formation Rates of Galaxies. I. Combinations of H-alpha and Infrared Tracers

    CERN Document Server

    Kennicutt, Robert C Jr; Calzetti, Daniela; Moustakas, John; Dale, Daniel A; Bendo, George; Engelbracht, Charles W; Johnson, Benjamin D; Lee, Janice C

    2009-01-01

    We combine H-alpha emission-line and infrared continuum measurements of two samples of nearby galaxies to derive dust attenuation-corrected star formation rates (SFRs). We use a simple energy balance based method that has been applied previously to HII regions in the Spitzer Infrared Nearby Galaxies Survey (SINGS), and extend the methodology to integrated measurements of galaxies. We find that our composite H-alpha+IR based SFRs are in excellent agreement with attenuation-corrected SFRs derived from integrated spectrophotometry, over the full range of SFRs (0.01 -- 80 solar mass per year) and attenuations (0 -- 2.5 mag) studied. We find that the combination of H-alpha and total infrared luminosities provides the most robust SFR measurements, but combinations of H-alpha measurements with monochromatic luminosities at 24 micron and 8 micron perform nearly as well. The calibrations differ significantly from those obtained for HII regions (Calzetti et al. 2007), with the difference attributable to a more evolved ...

  13. Human PIV-2 recombinant Sendai virus (rSeV) elicits durable immunity and combines with two additional rSeVs to protect against hPIV-1, hPIV-2, hPIV-3, and RSV.

    Science.gov (United States)

    Jones, Bart; Zhan, Xiaoyan; Mishin, Vasiliy; Slobod, Karen S; Surman, Sherri; Russell, Charles J; Portner, Allen; Hurwitz, Julia L

    2009-03-13

    The human parainfluenza viruses (hPIVs) and respiratory syncytial viruses (RSVs) are the leading causes of hospitalizations due to respiratory viral disease in infants and young children, but no vaccines are yet available. Here we describe the use of recombinant Sendai viruses (rSeVs) as candidate vaccine vectors for these respiratory viruses in a cotton rat model. Two new Sendai virus (SeV)-based hPIV-2 vaccine constructs were generated by inserting the fusion (F) gene or the hemagglutinin-neuraminidase (HN) gene from hPIV-2 into the rSeV genome. The inoculation of either vaccine into cotton rats elicited neutralizing antibodies toward both homologous and heterologous hPIV-2 virus isolates. The vaccines elicited robust and durable antibodies toward hPIV-2, and cotton rats immunized with individual or mixed vaccines were fully protected against hPIV-2 infections of the lower respiratory tract. The immune responses toward a single inoculation with rSeV vaccines were long-lasting and cotton rats were protected against viral challenge for as long as 11 months after vaccination. One inoculation with a mixture of the hPIV-2-HN-expressing construct and two additional rSeVs (expressing the F protein of RSV and the HN protein of hPIV-3) resulted in protection against challenge viruses hPIV-1, hPIV-2, hPIV-3, and RSV. Results identify SeV vectors as promising vaccine candidates for four different paramyxoviruses, each responsible for serious respiratory infections in children.

  14. Combining near infrared spectra of feces and geostatistics to generate forage nutritional quality maps across landscapes.

    Science.gov (United States)

    Pierre-Olivier, Jean; Bradley, Robert L; Tremblay, Jean-Pierre; Côté, Steeve D

    2015-09-01

    An important asset for the management of wild ungulates is recognizing the spatial distribution of forage quality across heterogeneous landscapes. To do so typically requires knowledge of which plant species are eaten, in what abundance they are eaten, and what their nutritional quality might be. Acquiring such data, however, may be difficult and time consuming. Here, we are proposing a rapid and cost-effective forage quality monitoring tool that combines near infrared (NIR) spectra of fecal samples and easily obtained data on plant community composition. Our approach rests on the premise that NIR spectra of fecal samples collected within low population density exclosures reflect the optimal forage quality of a given landscape. Forage quality can thus be based on the Mahalanobis distance of fecal spectral scans across the landscape relative to fecal spectral scans inside exclosures (referred to as DISTEX). The Gi* spatial autocorrelation statistic can then be applied among neighboring DISTEX values to detect and map "hot spots" and "cold spots" of nutritional quality over the landscape. We tested our approach in a heterogeneous boreal landscape on Anticosti Island (Québec, Canada), where white-tailed deer (Odocoileus virginianus) populations over the landscape have ranged from 20 to 50 individuals/km2 for at least 80 years, resulting in a loss of most palatable and nutritious plant species. Our results suggest that hot spots of forage quality occur when old-growth balsam fir stands comprise >39.8% of 300 ha neighborhoods, whereas cold spots occur in laggs (i.e., transition zones from forest to peatland). In terms of ground-level indicator plant species, the presence of Canada bunchberry (Cornus canadensis) was highly correlated with hot spots, whereas tamarack (Larix laricina) was highly correlated with cold spots. Mean DISTEX values were positively and significantly correlated with the neutral detergent fiber and acid detergent lignin contents of feces. While our

  15. Boolean map saliency combined with motion feature used for dim and small target detection in infrared video sequences

    Science.gov (United States)

    Wang, Xiaoyang; Peng, Zhenming; Zhang, Ping

    2016-10-01

    Infrared dim and small target detection plays an important role in infrared search and tracking systems. In this paper, a novel infrared dim and small target detection method based on Boolean map saliency and motion feature is proposed. Infrared targets are the most salient parts in images, with high gray level and continuous moving trajectory. Utilizing this property, we build a feature space containing gray level feature and motion feature. The gray level feature is the intensity of input images, while the motion feature is obtained by motion charge in consecutive frames. In the second step, the Boolean map saliency approach is implemented on the gray level feature and motion feature to obtain the gray saliency map and motion saliency map. In the third step, two saliency maps are combined together to get the final result. Numerical experiments have verified the effectiveness of the proposed method. The final detection result can not only get an accurate detection result, but also with fewer false alarms, which is suitable for practical use.

  16. [Study on the genuineness and producing area of Panax notoginseng based on infrared spectroscopy combined with discriminant analysis].

    Science.gov (United States)

    Liu, Fei; Wang, Yuan-zhong; Yang, Chun-yan; Jin, Hang

    2015-01-01

    The genuineness and producing area of Panax notoginseng were studied based on infrared spectroscopy combined with discriminant analysis. The infrared spectra of 136 taproots of P. notoginseng from 13 planting point in 11 counties were collected and the second derivate spectra were calculated by Omnic 8. 0 software. The infrared spectra and their second derivate spectra in the range 1 800 - 700 cm-1 were used to build model by stepwise discriminant analysis, which was in order to distinguish study on the genuineness of P. notoginseng. The model built based on the second derivate spectra showed the better recognition effect for the genuineness of P. notoginseng. The correct rate of returned classification reached to 100%, and the prediction accuracy was 93. 4%. The stability of model was tested by cross validation and the method was performed extrapolation validation. The second derivate spectra combined with the same discriminant analysis method were used to distinguish the producing area of P. notoginseng. The recognition effect of models built based on different range of spectrum and different numbers of samples were compared and found that when the model was built by collecting 8 samples from each planting point as training sample and the spectrum in the range 1 500 - 1 200 cm-1 , the recognition effect was better, with the correct rate of returned classification reached to 99. 0%, and the prediction accuracy was 76. 5%. The results indicated that infrared spectroscopy combined with discriminant analysis showed good recognition effect for the genuineness of P. notoginseng. The method might be a hopeful new method for identification of genuineness of P. notoginseng in practice. The method could recognize the producing area of P. notoginseng to some extent and could be a new thought for identification of the producing area of P. natoginseng.

  17. Latent evidence detection using a combination of near infrared and high dynamic range photography: an example using bloodstains.

    Science.gov (United States)

    Albanese, John; Montes, Ronald

    2011-11-01

    In this paper, we use bloodstains to illustrate an approach for identifying latent evidence on dark cloth using near infrared (NIR) photography combined with high dynamic range (HDR) photography techniques. NIR photography alone has been used to capture latent evidence that cannot be seen in normal ambient light. HDR techniques combine multiple bracketed photographs of the same image to increase the dynamic range of the photograph which can provide greater contrast. Using NIR photography alone, we were able to detect a bloodstain up to a 1/16 dilution, an improvement over previous studies. Combining NIR photography with the HDR process resulted in a noticeable increase in visibility up to 1/16 dilution when compared to NIR photographs alone. At 1/32 dilution, we were able to detect bloodstains that were not visible using NIR alone. NIR is a useful tool for imaging latent evidence, and combining NIR with HDR consistently provides better results over NIR alone.

  18. Application and possible mechanisms of combining LLLT (low level laser therapy), infrared hyperthermia and ionizing radiation in the treatment of cancer

    Science.gov (United States)

    Abraham, Edward H.; Woo, Van H.; Harlin-Jones, Cheryl; Heselich, Anja; Frohns, Florian

    2014-02-01

    Benefit of concomitant infrared hyperthermia and low level laser therapy and ionizing radiation is evaluated in this study. The purpose/objectives: presentation with locally advanced bulky superficial tumors is clinically challenging. To enhance the efficacy of chemotherapy and IMRT (intensity-modulated radiation therapy) and/or electron beam therapy we have developed an inexpensive and clinically effective infrared hyperthermia approach that combines black-body infrared radiation with halogen spectrum radiation and discrete wave length infrared clinical lasers LLLT. The goal is to produce a composite spectrum extending from the far infrared to near infrared and portions of the visible spectrum with discrete penetrating wavelengths generated by the clinical infrared lasers with frequencies of 810 nm and/or 830 nm. The composite spectrum from these sources is applied before and after radiation therapy. We monitor the surface and in some cases deeper temperatures with thermal probes, but use an array of surface probes as the limiting safe thermal constraint in patient treatment while at the same time maximizing infrared entry to deeper tissue layers. Fever-grade infrared hyperthermia is produced in the first centimeters while non-thermal infrared effects act at deeper tissue layers. The combination of these effects with ionizing radiation leads to improved tumor control in many cancers.

  19. A Combined Infrared and Microwave Technique for Studying the Diurnal Variation of Rainfall Over Amazonia

    Science.gov (United States)

    Negri, Andrew J.; Xu, L.; Adler, R. F.; Anagnostou, E.; Rickenbach, T. M.

    1999-01-01

    In this paper we present results from the application of a satellite infrared (IR) technique for estimating rainfall over northern South America. Our main objectives are to examine the diurnal variability of rainfall and to investigate the relative contributions from the convective and stratiform components. Additional information is contained in the original.

  20. Analysis of crystallized lactose in milk powder by Fourier-transform infrared spectroscopy combined with two-dimensional correlation infrared spectroscopy

    Science.gov (United States)

    Lei, Yu; Zhou, Qun; Zhang, Yan-ling; Chen, Jian-bo; Sun, Su-qin; Noda, Isao

    2010-06-01

    Infrared (IR) spectroscopy is used in combination with two-dimensional (2D) correlation IR spectroscopy to conduct rapid non-destructive quantitative research in milk powder without additional separation steps. The experiments conducted in both FT-IR and 2D FT-IR spectra suggest that characteristic spectroscopic features of milk powder containing different carbohydrate can be detected, and then determine the type of carbohydrate. To predict the approximate content of lactose while the carbohydrate is lactose, different amount of crystallized lactose has been added to the reference milk powder. The correlation coefficient could be used to determine the content of crystallized lactose in milk powder. The method provides a rapid and convenient means for assessing the quality of milk powder.

  1. Assessing honeybee and wasp thermoregulation and energetics-New insights by combination of flow-through respirometry with infrared thermography

    Energy Technology Data Exchange (ETDEWEB)

    Stabentheiner, Anton, E-mail: anton.stabentheiner@uni-graz.at [Institut fuer Zoologie, Karl-Franzens-Universitaet Graz, Universitaetsplatz 2, A-8010 Graz (Austria); Kovac, Helmut, E-mail: he.kovac@uni-graz.at [Institut fuer Zoologie, Karl-Franzens-Universitaet Graz, Universitaetsplatz 2, A-8010 Graz (Austria); Hetz, Stefan K. [Department of Animal Physiology/Systems Neurobiology and Neural Computation, Philippstrasse 13-Leonor Michaelis Haus, Humboldt-Universitaet zu Berlin, 10115 Berlin (Germany); Kaefer, Helmut; Stabentheiner, Gabriel [Institut fuer Zoologie, Karl-Franzens-Universitaet Graz, Universitaetsplatz 2, A-8010 Graz (Austria)

    2012-04-20

    Highlights: Black-Right-Pointing-Pointer We demonstrate the benefits of a combined use of infrared thermography with respiratory measurements in insect ecophysiological research. Black-Right-Pointing-Pointer Infrared thermography enables repeated investigation of behaviour and thermoregulation without behavioural impairment. Black-Right-Pointing-Pointer Comparison with respirometry brings new insights into the mechanisms of energetic optimisation of bee and wasp foraging. Black-Right-Pointing-Pointer Combination of methods improves interpretation of respiratory traces in determinations of insect critical thermal limits. - Abstract: Endothermic insects like honeybees and some wasps have to cope with an enormous heat loss during foraging because of their small body size in comparison to endotherms like mammals and birds. The enormous costs of thermoregulation call for optimisation. Honeybees and wasps differ in their critical thermal maximum, which enables the bees to kill the wasps by heat. We here demonstrate the benefits of a combined use of body temperature measurement with infrared thermography, and respiratory measurements of energy turnover (O{sub 2} consumption or CO{sub 2} production via flow-through respirometry) to answer questions of insect ecophysiological research, and we describe calibrations to receive accurate results. To assess the question of what foraging honeybees optimise, their body temperature was compared with their energy turnover. Honeybees foraging from an artificial flower with unlimited sucrose flow increased body surface temperature and energy turnover with profitability of foraging (sucrose content of the food; 0.5 or 1.5 mol/L). Costs of thermoregulation, however, were rather independent of ambient temperature (13-30 Degree-Sign C). External heat gain by solar radiation was used to increase body temperature. This optimised foraging energetics by increasing suction speed. In determinations of insect respiratory critical thermal limits

  2. Optimization of formulation of soy-cakes baked in infrared-microwave combination oven by response surface methodology.

    Science.gov (United States)

    Şakıyan, Özge

    2015-05-01

    The aim of present work is to optimize the formulation of a functional cake (soy-cake) to be baked in infrared-microwave combination oven. For this optimization process response surface methodology was utilized. It was also aimed to optimize the processing conditions of the combination baking. The independent variables were the baking time (8, 9, 10 min), the soy flour concentration (30, 40, 50 %) and the DATEM (diacetyltartaric acid esters of monoglycerides) concentration (0.4, 0.6 and 0.8 %). The quality parameters that were examined in the study were specific volume, weight loss, total color change and firmness of the cake samples. The results were analyzed by multiple regression; and the significant linear, quadratic, and interaction terms were used in the second order mathematical model. The optimum baking time, soy-flour concentration and DATEM concentration were found as 9.5 min, 30 and 0.72 %, respectively. The corresponding responses of the optimum points were almost comparable with those of conventionally baked soy-cakes. So it may be declared that it is possible to produce high quality soy cakes in a very short time by using infrared-microwave combination oven.

  3. Complete {sup 1}H and {sup 13}C NMR assignments of isojuripidine from Solanum asterophorum Mart

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Tania M.S.; Costa, Rodrigo A.; Oliveira, Eduardo J.; Barbosa-Filho, Jose M.; Agra, Maria F.; Camara, Celso A. [Universidade Federal da Paraiba, Joao Pessoa, PB (Brazil). Lab. de Tecnologia Farmaceutica]. E-mail: sarmento@ltf.ufpb.br

    2005-11-15

    Isojuripidine was isolated from the aerial parts of Solanum astherophorum Mart. Its structure was determined using a combination of homo- (1D {sup 1}H NMR, {sup 13}C NMR-HBBD and {sup 13}C NMRDEPT) and heteronuclear 2D NMR techniques ({sup 1}H-{sup 1}H-COSY, {sup 1}H-{sup 1}H-NOESY, HSQC, HMBC), and HREIMS. The unambiguous assignments of {sup 1}H and {sup 13}C NMR data of derivatives 3-N,6-Odiacetyl- isojuripidine and 3-N-cinnamoyl-isojuripidine are described. (author)

  4. Combination of high-performance refractometry and infrared spectroscopy as a probe for chemically induced gelation and vitrification of epoxies

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, U; Philipp, M; Gervais, P-C; Sanctuary, R; Krueger, J K [Laboratoire de Physique des Materiaux, Universite du Luxembourg, 162A avenue de la faiencerie, L-1511 Luxembourg (Luxembourg); Possart, W; Wehlack, C [Fachbereich Werkstoffwissenschaften, Universitaet des Saarlandes, D-66123 Saarbruecken (Germany); Kieffer, J, E-mail: ulrich.mueller@uni.l [Department of Materials Science and Engineering, University of Michigan, Ann Arbor, MI (United States)

    2010-08-15

    A combination of infrared spectroscopy and high-performance refractometry was used to investigate the chemically induced sol-gel and glass transition during the polymerization of epoxies. Representations of the refractive index versus chemical conversion reveal an interesting insight into the optical properties accompanying gelation and vitrification. Whereas the electronic polarizability of the liquid state of small average molecular mass and the glassy state is dominated by the mass density, an unexpected excess polarizability observed during the gelation is attributed to cooperative dipole-dipole interactions.

  5. Estimation of raw material performance in mammalian cell culture using near infrared spectra combined with chemometrics approaches.

    Science.gov (United States)

    Lee, Hae Woo; Christie, Andrew; Liu, Jun Jay; Yoon, Seongkyu

    2012-01-01

    Understanding variability in raw materials and their impacts on product quality is of critical importance in the biopharmaceutical manufacturing processes. For this purpose, several spectroscopic techniques have been studied for raw material characterization, providing fast and nondestructive ways to measure quality of raw materials. However, investigations of correlation between spectra of raw materials and cell culture performance have been scarce due to their complexity and uncertainty. In this study, near-infrared spectra and bioassays of multiple soy hydrolysate lots manufactured by different vendors were analyzed using chemometrics approaches in order to address variability of raw materials as well as correlation between raw material properties and corresponding cell culture performance. Principal component analysis revealed that near-infrared spectra of different soy lots contain enough physicochemical information about soy hydrolysates to allow identification of lot-to-lot variability as well as vendor-to-vendor differences. The identified compositional variability was further analyzed in order to estimate cell growth and protein production of two mammalian cell lines under the condition of varying soy dosages using partial least square regression combined with optimal variable selection. The performance of the resulting models demonstrates the potential of near-infrared spectroscopy as a robust lot selection tool for raw materials while providing a biological link between chemical composition of raw materials and cell culture performance.

  6. Combined infrared and ultraviolet-visible spectroscopy matrix-isolated carbon vapor

    Science.gov (United States)

    Kurtz, Joe; Huffman, Donald R.

    1990-01-01

    Infrared and UV-visible absorption spectra have been measured on the same sample of matrix-isolated carbon vapor in order to establish correlations between absorption intensities of vibrational and electronic transitions as a function of sample annealing. A high degree of correlation has been found between the IR feature at 1998/cm recently assigned to C8 and a UV absorption feature at about 3100 A. Thus, for the first time, direct evidence is given for the assignment of one of the unknown UV-visible features of the long-studied matrix-isolated carbon vapor spectrum.

  7. Near-infrared confocal micro-Raman spectroscopy combined with PCA-LDA multivariate analysis for detection of esophageal cancer

    Science.gov (United States)

    Chen, Long; Wang, Yue; Liu, Nenrong; Lin, Duo; Weng, Cuncheng; Zhang, Jixue; Zhu, Lihuan; Chen, Weisheng; Chen, Rong; Feng, Shangyuan

    2013-06-01

    The diagnostic capability of using tissue intrinsic micro-Raman signals to obtain biochemical information from human esophageal tissue is presented in this paper. Near-infrared micro-Raman spectroscopy combined with multivariate analysis was applied for discrimination of esophageal cancer tissue from normal tissue samples. Micro-Raman spectroscopy measurements were performed on 54 esophageal cancer tissues and 55 normal tissues in the 400-1750 cm-1 range. The mean Raman spectra showed significant differences between the two groups. Tentative assignments of the Raman bands in the measured tissue spectra suggested some changes in protein structure, a decrease in the relative amount of lactose, and increases in the percentages of tryptophan, collagen and phenylalanine content in esophageal cancer tissue as compared to those of a normal subject. The diagnostic algorithms based on principal component analysis (PCA) and linear discriminate analysis (LDA) achieved a diagnostic sensitivity of 87.0% and specificity of 70.9% for separating cancer from normal esophageal tissue samples. The result demonstrated that near-infrared micro-Raman spectroscopy combined with PCA-LDA analysis could be an effective and sensitive tool for identification of esophageal cancer.

  8. Stability and Determination of Metamizole Sodium by Capillary Electrophoresis Analysis Combined with Infra-red Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    XIANG Qian; NIU Gang; WU Xian-hua; CHEN Gang

    2007-01-01

    Metamizole sodium was chosen as a representative of unstable analytes for investigation by discusing the effects of oxygen and solvent on its degradation reaction using the capillary electrophoresis technique. A possible degradation mechanism was deduced from the observed behavior and was confirmed by infra-red spectroscopic study. The degradation reaction could be inhibited obviously by methanol instead of water as the solvent of analyte. Under the optimized conditions: separation voltage of 20 kV, and 5 mmol/L disodium hydrogen phosphate and 5 mmol/L borax with 10% methanol(pH 9. 12) as the running buffer, the standard curve of metamizole sodium was linear in a range of 3.77-74.07 mg/L. A satisfactory result was achieved when the technique was used to detect metamizole sodium in tablet.

  9. Combining multifractal analyses of digital mammograms and infrared thermograms to assist in early breast cancer diagnosis

    Science.gov (United States)

    Gerasimova-Chechkina, E.; Toner, B.; Marin, Z.; Audit, B.; Roux, S. G.; Argoul, F.; Khalil, A.; Gileva, O.; Naimark, O.; Arneodo, A.

    2016-08-01

    We used a 1D wavelet transform modulus maxima (WTMM) method to analyze the temporal fluctuations of breast skin temperature recorded with an infrared (IR) camera from a panel of patients with breast cancer. This study shows that the multifractal complexity of temperature fluctuations observed in healthy breasts, is lost in the region of the malignant tumor in cancerous breasts. Then, we applied the 2D WTMM method to analyze the spatial fluctuations of breast density in the X-ray mammograms of the same patients. Compared to the correlated roughness fluctuations observed in the healthy areas, some clear loss of correlations is detected in malignant tumor foci. These physiological and architectural changes in the environment of malignant tumors detected in both thermograms and mammograms open new perspectives in computer-aided multifractal methods to assist in early breast cancer diagnosis.

  10. [Molecular mechanisms of combined extremely radiofrequency and infrared therapy in various age patients with chronic parodontitis].

    Science.gov (United States)

    Ianova, O A; Medvedev, D S; Lin'kova, N S; Trifonov, N I; D'iakonov, M M

    2014-01-01

    The influence of extreme radiofrequency millimeter microwave (EHF) and infrared (IR) electromagnetic emanation on the molecular markers of cell renovation (Ki67, p53) and proinflammatory cytokine TNF-α expression in the buccal cells of various age patients with chronic parodontitis was investigated. The results show that EHF- and IR-electromagnetic emanation increased Ki67 proliferative marker expression and decreased expression of proapoptosis protein p53 and proinflammatory cytokine TNF-α in the buccal epithelium of young, middle-aged and elderly people with chronic parodontitis. The data obtained open the new ability for patogenetic treatment of various age patients with chronic parodontitis using the EHF- and IR-electromagnetic emanation method.

  11. An infrared integrated optic astronomical beam combiner for stellar interferometry at 3-4 microns

    CERN Document Server

    Hsiao, Hsien-kai; Monnier, John D; Berger, Jean-Philippe

    2009-01-01

    Integrated-optic, astronomical, two-beam and three-beam, interferometric combiners have been designed and fabricated for operation in the L band (3 - 4 microns) for the first time. The devices have been realized in titanium-indiffused, x-cut lithium niobate substrates, and on-chip electro-optic fringe scanning has been demonstrated. White light fringes were produced in the laboratory using the two-beam combiner integrated with an on-chip Y-splitter.

  12. An infrared integrated optic astronomical beam combiner for stellar interferometry at 3-4 microm.

    Science.gov (United States)

    Hsiao, Hsien-Kai; Winick, K A; Monnier, John D; Berger, Jean-Philippe

    2009-10-12

    Integrated-optic, astronomical, two-beam and three-beam, interferometric combiners have been designed and fabricated for operation in the L band (3 microm--4 microm) for the first time. The devices have been realized in titanium-indiffused, x-cut lithium niobate substrates, and on-chip electro-optic fringe scanning has been demonstrated. White light fringes were produced in the laboratory using the two-beam combiner integrated with an on-chip Y-splitter.

  13. Characterization of heroin samples by 1H NMR and 2D DOSY 1H NMR.

    Science.gov (United States)

    Balayssac, Stéphane; Retailleau, Emmanuel; Bertrand, Geneviève; Escot, Marie-Pierre; Martino, Robert; Malet-Martino, Myriam; Gilard, Véronique

    2014-01-01

    Twenty-four samples of heroin from different illicit drug seizures were analyzed using proton Nuclear Magnetic Resonance ((1)H NMR) and two-dimensional diffusion-ordered spectroscopy (2D DOSY) (1)H NMR. A careful assignment and quantification of (1)H signals enabled a comprehensive characterization of the substances present in the samples investigated: heroin, its main related impurities (6-acetylmorphine, acetylcodeine, morphine, noscapine and papaverine) and cutting agents (caffeine and acetaminophen in nearly all samples as well as lactose, lidocaine, mannitol, piracetam in one sample only), and hence to establish their spectral signatures. The good agreement between the amounts of heroin, noscapine, caffeine and acetaminophen determined by (1)H NMR and gas chromatography, the reference method in forensic laboratories, demonstrates the validity of the (1)H NMR technique. In this paper, 2D DOSY (1)H NMR offers a new approach for a whole characterization of the various components of these complex mixtures.

  14. Determination of the pigments present in a wallpaper of the middle nineteenth century: the combination of mid-diffuse reflectance and far infrared spectroscopies.

    Science.gov (United States)

    Arrizabalaga, Iker; Gómez-Laserna, Olivia; Aramendia, Julene; Arana, Gorka; Madariaga, Juan Manuel

    2014-04-24

    In this work the determination of the pigments present in a decorative wallpaper of the middle nineteenth century from the Santa Isabel factory (Vitoria-Gasteiz, Basque Country, Spain) has been performed by a combination of mid-Diffuse Reflectance Infrared Spectroscopy (DRIFT) and Far Infrared Spectroscopy (FIR) in transmission mode. The DRIFT is a powerful infrared technique that is not widely used in the analyses of artworks in spite of being especially adequate for powdered samples. In this mode, sample pretreatment is not required and the obtained spectra are easier to solve than those obtained in transmittance mode. Those pigments which are not active in the mid-infrared region may be determined easily by FIR. In the last decade, in the field of painted materials very few studies performed by far infrared spectroscopy and mid infrared spectroscopy in diffuse reflectance mode can be found. In most of them the researchers have used one of these techniques, but in no case the combination of both. As we demonstrate in this work, combining these two techniques a complete characterization of the wallpaper can be carried out. Small samples were collected from the wallpaper for the analysis of the rose, brown, yellow and blue colours. In this way, minium (Pb3O4), calcite (CaCO3), barium sulphate (BaSO4), prussian blue (Fe7C18N18), iron oxide yellow (α-FeOOH), vermillion (HgS) and carbon black pigment from organic origen were detected. Finally, the validation was carried out by XRF and Raman spectroscopy getting the same results as with the combination of diffuse reflectance infrared spectroscopy and far infrared spectroscopy.

  15. OSCILLATOR: A system for analysis of diurnal leaf growth using infrared photography combined with wavelet transformation

    Directory of Open Access Journals (Sweden)

    Bours Ralph

    2012-08-01

    Full Text Available Abstract Background Quantification of leaf movement is an important tool for characterising the effects of environmental signals and the circadian clock on plant development. Analysis of leaf movement is currently restricted by the attachment of sensors to the plant or dependent upon visible light for time-lapse photography. The study of leaf growth movement rhythms in mature plants under biological relevant conditions, e.g. diurnal light and dark conditions, is therefore problematic. Results Here we present OSCILLATOR, an affordable system for the analysis of rhythmic leaf growth movement in mature plants. The system contains three modules: (1 Infrared time-lapse imaging of growing mature plants (2 measurement of projected distances between leaf tip and plant apex (leaf tip tracking growth-curves and (3 extraction of phase, period and amplitude of leaf growth oscillations using wavelet analysis. A proof-of-principle is provided by characterising parameters of rhythmic leaf growth movement of different Arabidopsis thaliana accessions as well as of Petunia hybrida and Solanum lycopersicum plants under diurnal conditions. The amplitude of leaf oscillations correlated to published data on leaf angles, while amplitude and leaf length did not correlate, suggesting a distinct leaf growth profile for each accession. Arabidopsis mutant accession Landsberg erecta displayed a late phase (timing of peak oscillation compared to other accessions and this trait appears unrelated to the ERECTA locus. Conclusions OSCILLATOR is a low cost and easy to implement system that can accurately and reproducibly quantify rhythmic growth of mature plants for different species under diurnal light/dark cycling.

  16. Monitoring hemodynamics and oxygenation of the kidney in rats by a combined near-infrared spectroscopy and invasive probe approach

    Science.gov (United States)

    Grosenick, Dirk; Cantow, Kathleen; Arakelyan, Karen; Wabnitz, Heidrun; Flemming, Bert; Skalweit, Angela; Ladwig, Mechthild; Macdonald, Rainer; Niendorf, Thoralf; Seeliger, Erdmann

    2015-07-01

    We have developed a hybrid approach to investigate the dynamics of perfusion and oxygenation in the kidney of rats under pathophysiologically relevant conditions. Our approach combines near-infrared spectroscopy to quantify hemoglobin concentration and oxygen saturation in the renal cortex, and an invasive probe method for measuring total renal blood flow by an ultrasonic probe, perfusion by laser-Doppler fluxmetry, and tissue oxygen tension via fluorescence quenching. Hemoglobin concentration and oxygen saturation were determined from experimental data by a Monte Carlo model. The hybrid approach was applied to investigate and compare temporal changes during several types of interventions such as arterial and venous occlusions, as well as hyperoxia, hypoxia and hypercapnia induced by different mixtures of the inspired gas. The approach was also applied to study the effects of the x-ray contrast medium iodixanol on the kidney.

  17. Carbon dioxide adsorption on a ZnO(101[combining macron]0) substrate studied by infrared reflection absorption spectroscopy.

    Science.gov (United States)

    Buchholz, Maria; Weidler, Peter G; Bebensee, Fabian; Nefedov, Alexei; Wöll, Christof

    2014-01-28

    The adsorption of carbon dioxide on the mixed-terminated ZnO(101[combining macron]0) surface of a bulk single crystal was studied by UHV Infrared Reflection Absorption Spectroscopy (IRRAS). In contrast to metals, the classic surface selection rule for IRRAS does not apply to bulk oxide crystals, and hence vibrational bands can also be observed for s-polarized light. Although this fact substantially complicates data interpretation, a careful analysis allows for a direct determination of the adsorbate geometry. Here, we demonstrate the huge potential of IR-spectroscopy for investigations on oxide single crystal surfaces by considering all three components of the incident polarized light separately. We find that the tridentate (surface) carbonate is aligned along the [0001] direction. A comparison to data reported previously for CO2 adsorbed on the surfaces of ZnO nanoparticles provides important insight into the role of defects in the surface chemistry of powder particles.

  18. Molecular structure, heteronuclear resonance assisted hydrogen bond analysis, chemical reactivity and first hyperpolarizability of a novel ethyl-4-{[(2,4-dinitrophenyl)-hydrazono]-ethyl}-3,5-dimethyl-1H-pyrrole-2-carboxylate: a combined DFT and AIM approach.

    Science.gov (United States)

    Singh, R N; Kumar, Amit; Tiwari, R K; Rawat, Poonam; Baboo, Vikas; Verma, Divya

    2012-06-15

    A new ethyl-4-{[(2,4-dinitrophenyl)-hydrazono]-ethyl}-3,5-dimethyl-1H-pyrrole-2-carboxylate (EDPHEDPC) has been synthesized and characterized by FT-IR, (1)H NMR, UV-vis, DART-Mass spectroscopy and elemental analysis. Quantum chemical calculations have been performed by DFT level of theory using B3LYP functional and 6-31G(d,p) as basis set. The (1)H NMR chemical shifts are calculated using gauge including atomic orbitals (GIAO) approach in DMSO as solvent. The time dependent density functional theory (TD-DFT) is used to find the various electronic transitions and their nature within molecule. A combined theoretical and experimental wavenumber analysis confirms the existence of dimer. Topological parameters such as electron density (ρ(BCP)), Laplacian of electron density (nabla(2)ρ(BCP)), kinetic electron energy density (G(BCP)), potential electron density (V(BCP)) and the total electron energy density (H(BCP)) at bond critical points (BCP) have been analyzed by Bader's 'Atoms in molecules' AIM theory in detail. The intermolecular hydrogen bond energy of dimer is calculated as -12.51 kcal/mol using AIM calculations. AIM ellipticity analysis is carried out to confirm the presence of resonance assisted intra and intermolecular hydrogen bonds in dimer. The calculated thermodynamic parameters show that reaction is exothermic and non-spontaneous at room temperature. The local reactivity descriptors such as Fukui functions (f(k)(+), f(k)(-)), local softnesses (s(k)(-), s(k)(+)) and electrophilicity indices (ω(k)(+), ω(k)(-)) analyses are performed to determine the reactive sites within molecule. Nonlinear optical (NLO) behavior of title compound is investigated by the computed value of first hyperpolarizability (β(0)). Copyright © 2012 Elsevier B.V. All rights reserved.

  19. Combining sequence-based prediction methods and circular dichroism and infrared spectroscopic data to improve protein secondary structure determinations

    Directory of Open Access Journals (Sweden)

    Lees Jonathan G

    2008-01-01

    Full Text Available Abstract Background A number of sequence-based methods exist for protein secondary structure prediction. Protein secondary structures can also be determined experimentally from circular dichroism, and infrared spectroscopic data using empirical analysis methods. It has been proposed that comparable accuracy can be obtained from sequence-based predictions as from these biophysical measurements. Here we have examined the secondary structure determination accuracies of sequence prediction methods with the empirically determined values from the spectroscopic data on datasets of proteins for which both crystal structures and spectroscopic data are available. Results In this study we show that the sequence prediction methods have accuracies nearly comparable to those of spectroscopic methods. However, we also demonstrate that combining the spectroscopic and sequences techniques produces significant overall improvements in secondary structure determinations. In addition, combining the extra information content available from synchrotron radiation circular dichroism data with sequence methods also shows improvements. Conclusion Combining sequence prediction with experimentally determined spectroscopic methods for protein secondary structure content significantly enhances the accuracy of the overall results obtained.

  20. Fourier transform infrared spectroscopy combined with chemometrics for discrimination of Curcuma longa, Curcuma xanthorrhiza and Zingiber cassumunar

    Science.gov (United States)

    Rohaeti, Eti; Rafi, Mohamad; Syafitri, Utami Dyah; Heryanto, Rudi

    2015-02-01

    Turmeric (Curcuma longa), java turmeric (Curcuma xanthorrhiza) and cassumunar ginger (Zingiber cassumunar) are widely used in traditional Indonesian medicines (jamu). They have similar color for their rhizome and possess some similar uses, so it is possible to substitute one for the other. The identification and discrimination of these closely-related plants is a crucial task to ensure the quality of the raw materials. Therefore, an analytical method which is rapid, simple and accurate for discriminating these species using Fourier transform infrared spectroscopy (FTIR) combined with some chemometrics methods was developed. FTIR spectra were acquired in the mid-IR region (4000-400 cm-1). Standard normal variate, first and second order derivative spectra were compared for the spectral data. Principal component analysis (PCA) and canonical variate analysis (CVA) were used for the classification of the three species. Samples could be discriminated by visual analysis of the FTIR spectra by using their marker bands. Discrimination of the three species was also possible through the combination of the pre-processed FTIR spectra with PCA and CVA, in which CVA gave clearer discrimination. Subsequently, the developed method could be used for the identification and discrimination of the three closely-related plant species.

  1. Combination of near infrared spectroscopy and chemometrics for authentication of taro flour from wheat and sago flour

    Science.gov (United States)

    Rachmawati; Rohaeti, E.; Rafi, M.

    2017-05-01

    Taro flour on the market is usually sold at higher price than wheat and sago flour. This situation could be a cause for adulteration of taro flour from wheat and sago flour. For this reason, we will need an identification and authentication. Combination of near infrared (NIR) spectrum with multivariate analysis was used in this study to identify and authenticate taro flour from wheat and sago flour. The authentication model of taro flour was developed by using a mixture of 5%, 25%, and 50% of adulterated taro flour from wheat and sago flour. Before subjected to multivariate analysis, an initial preprocessing signal was used namely normalization and standard normal variate to the NIR spectrum. We used principal component analysis followed by discriminant analysis to make an identification and authentication model of taro flour. From the result obtained, about 90.48% of the taro flour mixed with wheat flour and 85% of taro flour mixed with sago flour were successfully classified into their groups. So the combination of NIR spectrum with chemometrics could be used for identification and authentication of taro flour from wheat and sago flour.

  2. Assessing honeybee and wasp thermoregulation and energetics-New insights by combination of flow-through respirometry with infrared thermography.

    Science.gov (United States)

    Stabentheiner, Anton; Kovac, Helmut; Hetz, Stefan K; Käfer, Helmut; Stabentheiner, Gabriel

    2012-04-20

    Endothermic insects like honeybees and some wasps have to cope with an enormous heat loss during foraging because of their small body size in comparison to endotherms like mammals and birds. The enormous costs of thermoregulation call for optimisation. Honeybees and wasps differ in their critical thermal maximum, which enables the bees to kill the wasps by heat. We here demonstrate the benefits of a combined use of body temperature measurement with infrared thermography, and respiratory measurements of energy turnover (O(2) consumption or CO(2) production via flow-through respirometry) to answer questions of insect ecophysiological research, and we describe calibrations to receive accurate results.To assess the question of what foraging honeybees optimise, their body temperature was compared with their energy turnover. Honeybees foraging from an artificial flower with unlimited sucrose flow increased body surface temperature and energy turnover with profitability of foraging (sucrose content of the food; 0.5 or 1.5 mol/L). Costs of thermoregulation, however, were rather independent of ambient temperature (13-30 °C). External heat gain by solar radiation was used to increase body temperature. This optimised foraging energetics by increasing suction speed.In determinations of insect respiratory critical thermal limits, the combined use of respiratory measurements and thermography made possible a more conclusive interpretation of respiratory traces.

  3. Assessing honeybee and wasp thermoregulation and energetics—New insights by combination of flow-through respirometry with infrared thermography

    Science.gov (United States)

    Stabentheiner, Anton; Kovac, Helmut; Hetz, Stefan K.; Käfer, Helmut; Stabentheiner, Gabriel

    2012-01-01

    Endothermic insects like honeybees and some wasps have to cope with an enormous heat loss during foraging because of their small body size in comparison to endotherms like mammals and birds. The enormous costs of thermoregulation call for optimisation. Honeybees and wasps differ in their critical thermal maximum, which enables the bees to kill the wasps by heat. We here demonstrate the benefits of a combined use of body temperature measurement with infrared thermography, and respiratory measurements of energy turnover (O2 consumption or CO2 production via flow-through respirometry) to answer questions of insect ecophysiological research, and we describe calibrations to receive accurate results. To assess the question of what foraging honeybees optimise, their body temperature was compared with their energy turnover. Honeybees foraging from an artificial flower with unlimited sucrose flow increased body surface temperature and energy turnover with profitability of foraging (sucrose content of the food; 0.5 or 1.5 mol/L). Costs of thermoregulation, however, were rather independent of ambient temperature (13–30 °C). External heat gain by solar radiation was used to increase body temperature. This optimised foraging energetics by increasing suction speed. In determinations of insect respiratory critical thermal limits, the combined use of respiratory measurements and thermography made possible a more conclusive interpretation of respiratory traces. PMID:22723718

  4. Near-infrared light triggered drug delivery system for higher efficacy of combined chemo-photothermal treatment.

    Science.gov (United States)

    Chen, Yi; Li, Haohuan; Deng, Yueyang; Sun, Haifeng; Ke, Xue; Ci, Tianyuan

    2017-01-11

    The combination of chemotherapy and photothermal therapy is a promising strategy for cancer treatment. In the present study, indocyanine green (ICG), a widely used near-infrared (NIR) dye in photothermal therapy, and chemotherapeutic drug-doxorubicin (DOX) were loaded within the nanoparticles of novel designed arylboronic ester and cholesterol modified hyaluronic acid (PPE-Chol1-HA), denoted as PCH-DI. We take advantage of reactive oxygen species (ROS) production capability of ICG and ROS-sensitivity of arylboronic ester to realize controllable drug release. It was confirmed that PCH-DI exhibited remarkable photothermal effect and light-triggered faster release of DOX with NIR laser irradiation. DOX in PCH-DI/Laser group exhibited the most efficient nucleus binding toward HCT-116 colon cells in vitro. Furthermore, enhanced cytotoxicity and promoted tumor growth suppression effect of PCH-DI on HCT-116 tumor xenograft nude mice and AOM-induced murine orthotopic colorectal cancer model was achieved under NIR laser irradiation. Thus, the co-delivery system based on PCH appears to be a promising platform for the combined chemo-photothermal therapy in tumor treatment.

  5. A combined optical/infrared spectral diagnostic analysis of the HH1 jet

    CERN Document Server

    Nisini, B; Giannini, T; Massi, F; Eislöffel, J; Podio, L; Ray, T P; Nisini, Brunella; Bacciotti, Francesca; Giannini, Teresa; Massi, Fabrizio; Eisl\\"offel, Jochen; Podio, Linda; Ray, Thomas P.

    2005-01-01

    Complete flux-calibrated spectra covering the spectral range from 6000 A to 2.5 um have been obtained along the HH1 jet and analysed in order to explore the potential of a combined optical/near-IR diagnostic applied to jets from young stellar objects. Important physical parameters have been derived along the jet using various diagnostic line ratios. This multi-line analysis shows, in each spatially unresolved knot, the presence of zones at different excitation conditions, as expected from the cooling layers behind a shock front. In particular, a density stratification in the jet is evident from ratios of various lines of different critical density. In particular, [FeII] lines originate in a cooling layer located at larger distances from the shock front than that generating the optical lines, where the compression is higher and the temperature is declining. The derived parameters were used to measure the mass flux along the jet, adopting different procedures, the advantages and limitations of which are discuss...

  6. Combined Dust Detection Algorithm by Using MODIS Infrared Channels over East Asia

    Science.gov (United States)

    Park, Sang Seo; Kim, Jhoon; Lee, Jaehwa; Lee, Sukjo; Kim, Jeong Soo; Chang, Lim Seok; Ou, Steve

    2014-01-01

    A new dust detection algorithm is developed by combining the results of multiple dust detectionmethods using IR channels onboard the MODerate resolution Imaging Spectroradiometer (MODIS). Brightness Temperature Difference (BTD) between two wavelength channels has been used widely in previous dust detection methods. However, BTDmethods have limitations in identifying the offset values of the BTDto discriminate clear-sky areas. The current algorithm overcomes the disadvantages of previous dust detection methods by considering the Brightness Temperature Ratio (BTR) values of the dual wavelength channels with 30-day composite, the optical properties of the dust particles, the variability of surface properties, and the cloud contamination. Therefore, the current algorithm shows improvements in detecting the dust loaded region over land during daytime. Finally, the confidence index of the current dust algorithm is shown in 10 × 10 pixels of the MODIS observations. From January to June, 2006, the results of the current algorithm are within 64 to 81% of those found using the fine mode fraction (FMF) and aerosol index (AI) from the MODIS and Ozone Monitoring Instrument (OMI). The agreement between the results of the current algorithm and the OMI AI over the non-polluted land also ranges from 60 to 67% to avoid errors due to the anthropogenic aerosol. In addition, the developed algorithm shows statistically significant results at four AErosol RObotic NETwork (AERONET) sites in East Asia.

  7. The host galaxy of the gamma-ray narrow-line Seyfert 1 galaxy 1H 0323+342

    Energy Technology Data Exchange (ETDEWEB)

    León Tavares, J.; Chavushyan, V.; Puerari, I.; Patiño-Alvarez, V.; Carramiñana, A.; Carrasco, L.; Guichard, J.; Olguín-Iglesias, A.; Valdes, J. [Instituto Nacional de Astrofísica Óptica y Electrónica (INAOE), Apartado Postal 51 y 216, 72000 Puebla (Mexico); Kotilainen, J. [Finnish Centre for Astronomy with ESO (FINCA), University of Turku, Väisäläntie 20, FI-21500 Piikkiö (Finland); Añorve, C. [Facultad de Ciencias de la Tierra y del Espacio (FACITE) de la Universidad Autónoma de Sinaloa, Blvd. de la Americas y Av. Universitarios S/N, Ciudad Universitaria, C.P. 80010, Culiacán Sinaloa (Mexico); Cruz-González, I. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Ap. 70-264, 04510 DF (Mexico); Antón, S. [Instituto de Astrofísica de Andalucía-CSIC, E-18008 Granada (Spain); Karhunen, K.; Sanghvi, J., E-mail: leon.tavares@inaoep.mx [Tuorla Observatory, Department of Physics and Astronomy, University of Turku, FI-20100 Turku (Finland)

    2014-11-01

    We present optical and near-infrared (NIR) imaging data of the radio-loud, narrow-line Seyfert 1 galaxy 1H 0323+342, which shows intense and variable gamma-ray activity discovered by the Fermi satellite with the Large Area Telescope. Near-infrared and optical images are used to investigate the structural properties of the host galaxy of 1H 0323+342; this together with optical spectroscopy allows us to examine its black hole mass. Based on two-dimensional (2D) multiwavelength surface-brightness modeling, we find that statistically, the best model fit is a combination of a nuclear component and a Sérsic profile (n ∼ 2.8). However, the presence of a disk component (with a small bulge n ∼ 1.2) also remains a possibility and cannot be ruled out with the present data. Although at first glance a spiral-arm-like structure is revealed in our images, a 2D Fourier analysis of the imagery suggests that this structure corresponds to an asymmetric ring, likely associated with a recent violent dynamical interaction. We discuss our results in the context of relativistic jet production and galaxy evolution.

  8. Discrimination of different genuine Danshen and their extracts by Fourier transform infrared spectroscopy combined with two-dimensional correlation infrared spectroscopy

    Science.gov (United States)

    Liu, Xin-hu; Xu, Chang-hua; Sun, Su-qin; Huang, Jian; Zhang, Ke; Li, Guo-yu; Zhu, Yun; Zhou, Qun; Zhang, Zhi-cheng; Wang, Jin-hui

    2012-11-01

    In this study, six varieties of Danshen from different populations and genuine ("Daodi" in Chinese transliteration) regions were discriminated and identified by a three-step infrared spectroscopy method (Fourier transform-infrared spectroscopy (FT-IR) coupled with second derivative infrared spectroscopy (SD-IR) and two dimensional correlation infrared spectroscopy (2D-IR)). Though only small differences were found among the FT-IR spectra of the six Danshen samples, the positions and intensities of peaks at 3393, 3371, 1613, 1050, and 1036 cm-1 could be considered as the key factors to discriminate them. More significant differences were exhibited in their SD-IR, particularly for the peaks around 1080, 1144, 695, 665, 800, 1610, 1510, 1450, 1117 and 1077 cm-1. The visual 2D-IR spectra provided dynamic chemical structure information of the six Danshen samples with presenting different particular auto-peak clusters, respectively. Moreover, the contents of salvianolic acid B in all samples were measured quantitatively by a validated ultra performance liquid chromatography (UPLC), which was consistent with the FT-IR findings. This study provides a promising method for characteristics and quality control of the complicated and extremely similar herbal medicine like Danshen, which is more cost effective and time saving.

  9. Combining computer game-based behavioural experiments with high-density EEG and infrared gaze tracking.

    Science.gov (United States)

    Yoder, Keith J; Belmonte, Matthew K

    2010-12-16

    inhibition, a psychophysical motion coherence threshold task, the Embedded Figures Test (Witkin, 1950, 1954) and a theory-of-mind (Wimmer & Perner, 1983) task. The game software automatically registers game stimuli and subjects' actions and responses in a log file, and sends event codes to synchronise with physiological data recorders. Thus the game can be combined with physiological measures such as EEG or fMRI, and with moment-to-moment tracking of gaze. Gaze tracking can verify subjects' compliance with behavioural tasks (e.g. fixation) and overt attention to experimental stimuli, and also physiological arousal as reflected in pupil dilation (Bradley et al., 2008). At great enough sampling frequencies, gaze tracking may also help assess covert attention as reflected in microsaccades - eye movements that are too small to foveate a new object, but are as rapid in onset and have the same relationship between angular distance and peak velocity as do saccades that traverse greater distances. The distribution of directions of microsaccades correlates with the (otherwise) covert direction of attention (Hafed & Clark, 2002).

  10. Analyzing prefrontal cortex hemoglobin concentration exchange spectrum in patients with major depressive disorder combined with anxiety and obsession through near-infrared spectroscopy

    Institute of Scientific and Technical Information of China (English)

    刘晓敏

    2014-01-01

    Objective Exploring the characteristics of prefrontal cortex activation in patients of major depressive disorder(MDD)combined with anxiety and obsession through functional near-infrared spectroscopy(fN IRS).Methods Prefrontal cortex hemoglobin concentration exchange of30 MDD patients combined with anxiety and obsession was detected by fN IRS under voice fluency task(VFT),then psychological assessment was made using Hanmilton Depression Scale(HAMD),Hamilton Anxiety Scale

  11. [Identification of adulterants in adulterated milks by near infrared spectroscopy combined with non-linear pattern recognition methods].

    Science.gov (United States)

    Ni, Li-Jun; Zhong, Lin; Zhang, Xin; Zhang, Li-Guo; Huang, Shi-Xinz

    2014-10-01

    In the present work, two hundred and eighty seven raw milks collected from pastures in Shanghai and surrounding areas of Shanghai were used as true milk samples and divided into three true milk sets. Five hundred and twenty six adulterated milk samples, which contained dextrin (or starch) mixed with melamine (or urea, or ammonium nitrate), were prepared as six different adulterated milk sets. The concentrations of these adulterants in the adulterated milks were designed to be 0.15%~ 0.45% (starch or dextrin), 700-2,100 mg · kg(-1) (ammonium nitrate), 524-1,572 mg · kg(-1) (urea), and 365.5-1,096.5 mg · kg(-1) (melamine) to guarantee the protein content of adulterated milks detected by Kjeldahl method not lower than 3%. All the near infrared spectra (NIR) of the samples should have a pretreatment of normal variable transformation (SNV) before they were used to build discriminating models. The three true milk sets and six adulterated milk sets were combined in different ways in order to build NIR models for discriminating different kinds of adulterants (i. e. , dextrin, starch, melamine, urea and ammonium nitrate) based on simplified K-nearest neighbor classification algorithm (IS-KNN) and an improved and simplified of support vector machine (ν-SVM) method. The relationship between mass concentration of the adulterants and the rate of correct discrimination was also investigated. The results show that the average discrimination accuracy of IS-KNN and ν-SVM for identifying melamine, urea and ammonium nitrate were in the region of 49.55% to 51.01%, 61.78% to 68.79% and 68.25% to 73.51%, respectively. Therefore within the concentration regions designed in this study, it is difficult to distinguish different kinds of pseudo proteins by NIR spectroscopy. However, the average accuracy of IS-KNN and ν-SVM for identifying starch and dextrin are 92.33% and 93.66%, 77.29% and 85.08%, respectively. Most discrimination results of ν-SVM are better than those of IS-KNN. The

  12. Simultaneous blood flow and blood oxygenation measurements using a combination of diffuse speckle contrast analysis and near-infrared spectroscopy

    Science.gov (United States)

    Seong, Myeongsu; Phillips, Zephaniah; Mai, Phuong Minh; Yeo, Chaebeom; Song, Cheol; Lee, Kijoon; Kim, Jae Gwan

    2016-02-01

    A combined diffuse speckle contrast analysis (DSCA)-near-infrared spectroscopy (NIRS) system is proposed to simultaneously measure qualitative blood flow and blood oxygenation changes in human tissue. The system employs an optical switch to alternate two laser sources at two different wavelengths and a CCD camera to capture the speckle image. Therefore, an optical density can be measured from two wavelengths for NIRS measurements and a speckle contrast can be calculated for DSCA measurements. In order to validate the system, a flow phantom test and an arm occlusion protocol for arterial and venous occlusion were performed. Shorter exposure times (<1 ms) show a higher drop (between 50% and 66%) and recovery of 1/KS2 values after occlusion (approximately 150%), but longer exposure time (3 ms) shows more consistent hemodynamic changes. For four subjects, the 1/KS2 values dropped to an average of 82.1±4.0% during the occlusion period and the average recovery of 1/KS2 values after occlusion was 109.1±0.8%. There was also an approximately equivalent amplitude change in oxyhemoglobin (OHb) and deoxyhemoglobin (RHb) during arterial occlusion (max RHb=0.0085±0.0024 mM/DPF, min OHb=-0.0057±0.0044 mM/DPF). The sensitivity of the system makes it a suitable modality to observe qualitative hemodynamic trends during induced physiological changes.

  13. Fabrication of short-wavelength infrared dual-band-pass filter based on combination of Fabry-Perot filters.

    Science.gov (United States)

    Cai, Yuan; Zhou, Sheng; Ma, Xiaofeng; Liu, Dingquan

    2016-11-20

    Dual-band-pass filters are key optical components in dual-spectral detection applications; it is imperative to fabricate them in a relatively simple way for practical use. In this paper, a dual-band-pass filter working in short-wavelength infrared is developed by the combination of two Fabry-Perot (F-P) filters, each having a transparent band. These two filters are designed separately, and deposited at different sides of a substrate. The total layers' number of the dual-band-pass filter is limited to 34; these layers are monitored by the method of direct transmittance level cut monitoring with a single monitor wavelength. The percent of optical extrema monitoring strategy is adopted in the deposition. The spectra of the F-P filters and the dual-band-pass filter are tested. The shorter pass-band's average transmittance is above 84%, the longer one is above 88%, and four of the pass-bands' edge steepness values are 1.4%,2.8%,1.9%, and 1.7%.

  14. Imaging of Osteoarthritic Human Articular Cartilage using Fourier Transform Infrared Microspectroscopy Combined with Multivariate and Univariate Analysis.

    Science.gov (United States)

    Oinas, J; Rieppo, L; Finnilä, M A J; Valkealahti, M; Lehenkari, P; Saarakkala, S

    2016-07-21

    The changes in chemical composition of human articular cartilage (AC) caused by osteoarthritis (OA) were investigated using Fourier transform infrared microspectroscopy (FTIR-MS). We demonstrate the sensitivity of FTIR-MS for monitoring compositional changes that occur with OA progression. Twenty-eight AC samples from tibial plateaus were imaged with FTIR-MS. Hyperspectral images of all samples were combined for K-means clustering. Partial least squares regression (PLSR) analysis was used to compare the spectra with the OARSI grade (histopathological grading of OA). Furthermore, the amide I and the carbohydrate regions were used to estimate collagen and proteoglycan contents, respectively. Spectral peak at 1338 cm(-1) was used to estimate the integrity of the collagen network. The layered structure of AC was revealed using the carbohydrate region for clustering. Statistically significant correlation was observed between the OARSI grade and the collagen integrity in the superficial (r = -0.55) and the deep (r = -0.41) zones. Furthermore, PLSR models predicted the OARSI grade from the superficial (r = 0.94) and the deep (r = 0.77) regions of the AC with high accuracy. Obtained results suggest that quantitative and qualitative changes occur in the AC composition during OA progression, and these can be monitored by the use of FTIR-MS.

  15. Investigating the error budget of tropical rainfall accumulations derived from combined passive microwave and infrared satellite measurements

    Science.gov (United States)

    Roca, R.; Chambon, P.; jobard, I.; Viltard, N.

    2012-04-01

    Measuring rainfall requires a high density of observations, which, over the whole tropical elt, can only be provided from space. For several decades, the availability of satellite observations has greatly increased; thanks to newly implemented missions like the Megha-Tropiques mission and the forthcoming GPM constellation, measurements from space become available from a set of observing systems. In this work, we focus on rainfall error estimations at the 1 °/1-day accumulated scale, key scale of meteorological and hydrological studies. A novel methodology for quantitative precipitation estimation is introduced; its name is TAPEER (Tropical Amount of Precipitation with an Estimate of ERrors) and it aims to provide 1 °/1-day rain accumulations and associated errors over the whole Tropical belt. This approach is based on a combination of infrared imagery from a fleet of geostationary satellites and passive microwave derived rain rates from a constellation of low earth orbiting satellites. A three-stage disaggregation of error into sampling, algorithmic and calibration errors is performed; the magnitudes of the three terms are then estimated separately. A dedicated error model is used to evaluate sampling errors and a forward error propagation approach is used for an estimation of algorithmic and calibration errors. One of the main findings in this study is the large contribution of the sampling errors and the algorithmic errors of BRAIN on medium rain rates (2 mm h-1 to 10 mm h-1) in the total error budget.

  16. Quantifying the cerebral metabolic rate of oxygen by combining diffuse correlation spectroscopy and time-resolved near-infrared spectroscopy.

    Science.gov (United States)

    Verdecchia, Kyle; Diop, Mamadou; Lee, Ting-Yim; St Lawrence, Keith

    2013-02-01

    Preterm infants are highly susceptible to ischemic brain injury; consequently, continuous bedside monitoring to detect ischemia before irreversible damage occurs would improve patient outcome. In addition to monitoring cerebral blood flow (CBF), assessing the cerebral metabolic rate of oxygen (CMRO2) would be beneficial considering that metabolic thresholds can be used to evaluate tissue viability. The purpose of this study was to demonstrate that changes in absolute CMRO2 could be measured by combining diffuse correlation spectroscopy (DCS) with time-resolved near-infrared spectroscopy (TR-NIRS). Absolute CBF was determined using bolus-tracking TR-NIRS to calibrate the DCS measurements. Cerebral venous blood oxygenation (SvO2) was determined by multiwavelength TR-NIRS measurements, the accuracy of which was assessed by directly measuring the oxygenation of sagittal sinus blood. In eight newborn piglets, CMRO2 was manipulated by varying the anesthetics and by injecting sodium cyanide. No significant differences were found between the two sets of SvO2 measurements obtained by TR-NIRS or sagittal sinus blood samples and the corresponding CMRO2 measurements. Bland-Altman analysis showed a mean CMRO2 difference of 0.0268 ± 0.8340 mLO2/100 g/min between the two techniques over a range from 0.3 to 4 mL O2/100 g/min.

  17. Combining Dark Energy Survey Science Verification data with near-infrared data from the ESO VISTA Hemisphere Survey

    Energy Technology Data Exchange (ETDEWEB)

    Banerji, M.; Jouvel, S.; Lin, H.; McMahon, R. G.; Lahav, O.; Castander, F. J.; Abdalla, F. B.; Bertin, E.; Bosman, S. E.; Carnero, A.; Kind, M. C.; da Costa, L. N.; Gerdes, D.; Gschwend, J.; Lima, M.; Maia, M. A. G.; Merson, A.; Miller, C.; Ogando, R.; Pellegrini, P.; Reed, S.; Saglia, R.; Sanchez, C.; Allam, S.; Annis, J.; Bernstein, G.; Bernstein, J.; Bernstein, R.; Capozzi, D.; Childress, M.; Cunha, C. E.; Davis, T. M.; DePoy, D. L.; Desai, S.; Diehl, H. T.; Doel, P.; Findlay, J.; Finley, D. A.; Flaugher, B.; Frieman, J.; Gaztanaga, E.; Glazebrook, K.; Gonzalez-Fernandez, C.; Gonzalez-Solares, E.; Honscheid, K.; Irwin, M. J.; Jarvis, M. J.; Kim, A.; Koposov, S.; Kuehn, K.; Kupcu-Yoldas, A.; Lagattuta, D.; Lewis, J. R.; Lidman, C.; Makler, M.; Marriner, J.; Marshall, J. L.; Miquel, R.; Mohr, J. J.; Neilsen, E.; Peoples, J.; Sako, M.; Sanchez, E.; Scarpine, V.; Schindler, R.; Schubnell, M.; Sevilla, I.; Sharp, R.; Soares-Santos, M.; Swanson, M. E. C.; Tarle, G.; Thaler, J.; Tucker, D.; Uddin, S. A.; Wechsler, R.; Wester, W.; Yuan, F.; Zuntz, J.

    2014-11-25

    We present the combination of optical data from the Science Verification phase of the Dark Energy Survey (DES) with near-infrared (NIR) data from the European Southern Observatory VISTA Hemisphere Survey (VHS). The deep optical detections from DES are used to extract fluxes and associated errors from the shallower VHS data. Joint seven-band (grizYJK) photometric catalogues are produced in a single 3 sq-deg dedicated camera field centred at 02h26m-04d36m where the availability of ancillary multiwavelength photometry and spectroscopy allows us to test the data quality. Dual photometry increases the number of DES galaxies with measured VHS fluxes by a factor of similar to 4.5 relative to a simple catalogue level matching and results in a similar to 1.5 mag increase in the 80 per cent completeness limit of the NIR data. Almost 70 per cent of DES sources have useful NIR flux measurements in this initial catalogue. Photometric redshifts are estimated for a subset of galaxies with spectroscopic redshifts and initial results, although currently limited by small number statistics, indicate that the VHS data can help reduce the photometric redshift scatter at both z < 0.5 and z > 1. We present example DES VHS colour selection criteria for high-redshift luminous red galaxies (LRGs) at z similar to 0.7 as well as luminous quasars. Using spectroscopic observations in this field we show that the additional VHS fluxes enable a cleaner selection of both populations with <10 per cent contamination from galactic stars in the case of spectroscopically confirmed quasars and <0.5 per cent contamination from galactic stars in the case of spectroscopically confirmed LRGs. The combined DES+VHS data set, which will eventually cover almost 5000 sq-deg, will therefore enable a range of new science and be ideally suited for target selection for future wide-field spectroscopic surveys.

  18. Discrimination of wild Paris based on near infrared spectroscopy and high performance liquid chromatography combined with multivariate analysis.

    Directory of Open Access Journals (Sweden)

    Yanli Zhao

    Full Text Available Different geographical origins and species of Paris obtained from southwestern China were discriminated by near infrared (NIR spectroscopy and high performance liquid chromatography (HPLC combined with multivariate analysis. The NIR parameter settings were scanning (64 times, resolution (4 cm(-1, scanning range (10,000 cm(-1∼4000 cm(-1 and parallel collection (3 times. NIR spectrum was optimized by TQ 8.6 software, and the ranges 7455∼6852 cm(-1 and 5973∼4007 cm(-1 were selected according to the spectrum standard deviation. The contents of polyphyllin I, polyphyllin II, polyphyllin VI, and polyphyllin VII and total steroid saponins were detected by HPLC. The contents of chemical components data matrix and spectrum data matrix were integrated and analyzed by partial least squares discriminant analysis (PLS-DA. From the PLS-DA model of NIR spectrum, Paris samples were separated into three groups according to the different geographical origins. The R(2X and Q(2Y described accumulative contribution rates were 99.50% and 94.03% of the total variance, respectively. The PLS-DA model according to 12 species of Paris described 99.62% of the variation in X and predicted 95.23% in Y. The results of the contents of chemical components described differences among collections quantitatively. A multivariate statistical model of PLS-DA showed geographical origins of Paris had a much greater influence on Paris compared with species. NIR and HPLC combined with multivariate analysis could discriminate different geographical origins and different species. The quality of Paris showed regional dependence.

  19. Invasive evaluation of plaque morphology of symptomatic superficial femoral artery stenoses using combined near-infrared spectroscopy and intravascular ultrasound.

    Science.gov (United States)

    Zacharias, Sibin K; Safian, Robert D; Madder, Ryan D; Hanson, Ivan D; Pica, Mark C; Smith, James L; Goldstein, James A; Abbas, Amr E

    2016-08-01

    The purpose of this study is to characterize the plaque morphology of severe stenoses in the superficial femoral artery (SFA) employing combined near-infrared spectroscopy and intravascular ultrasound (NIRS-IVUS). Atherosclerosis is the most common cause of symptomatic peripheral arterial disease. Plaque composition of SFA stenoses has been characterized as primarily fibrous or fibrocalcific by non-invasive and autopsy studies. NIRS has been validated to detect lipid-core plaque (LCP) in the coronary circulation. We imaged severe SFA stenoses with NIRS-IVUS prior to revascularization in 31 patients (46 stenoses) with Rutherford claudication ⩾ class 3. Angiographic parameters included lesion location and stenosis severity. IVUS parameters included plaque burden and presence of calcium. NIRS images were analyzed for LCP and maximum lipid-core burden index in a 4-mm length of artery (maxLCBI4mm). By angiography, 38 (82.6%) lesions were calcified and 9 (19.6%) were chronic total occlusions. Baseline stenosis severity and lesion length were 86.0 ± 11.0% and 36.5 ± 46.5 mm, respectively. NIRS-IVUS identified calcium in 45 (97.8%) lesions and LCP in 17 (37.0%) lesions. MaxLCBI4mm was 433 ± 244. All lesions with LCP also contained calcium; there were no non-calcified lesions with LCP. In conclusion, this is the first study of combined NIRS-IVUS in patients with PAD. NIRS-IVUS demonstrates that nearly all patients with symptomatic severe SFA disease have fibrocalcific plaque, and one-third of such lesions contain LCP. These findings contrast with those in patients with acute coronary syndromes, and may have implications regarding the pathophysiology of atherosclerosis in different vascular beds.

  20. Discrimination of Wild Paris Based on Near Infrared Spectroscopy and High Performance Liquid Chromatography Combined with Multivariate Analysis

    Science.gov (United States)

    Zhao, Yanli; Zhang, Ji; Yuan, Tianjun; Shen, Tao; Li, Wei; Yang, Shihua; Hou, Ying; Wang, Yuanzhong; Jin, Hang

    2014-01-01

    Different geographical origins and species of Paris obtained from southwestern China were discriminated by near infrared (NIR) spectroscopy and high performance liquid chromatography (HPLC) combined with multivariate analysis. The NIR parameter settings were scanning (64 times), resolution (4 cm−1), scanning range (10000 cm−1∼4000 cm−1) and parallel collection (3 times). NIR spectrum was optimized by TQ 8.6 software, and the ranges 7455∼6852 cm−1 and 5973∼4007 cm−1 were selected according to the spectrum standard deviation. The contents of polyphyllin I, polyphyllin II, polyphyllin VI, and polyphyllin VII and total steroid saponins were detected by HPLC. The contents of chemical components data matrix and spectrum data matrix were integrated and analyzed by partial least squares discriminant analysis (PLS-DA). From the PLS-DA model of NIR spectrum, Paris samples were separated into three groups according to the different geographical origins. The R2X and Q2Y described accumulative contribution rates were 99.50% and 94.03% of the total variance, respectively. The PLS-DA model according to 12 species of Paris described 99.62% of the variation in X and predicted 95.23% in Y. The results of the contents of chemical components described differences among collections quantitatively. A multivariate statistical model of PLS-DA showed geographical origins of Paris had a much greater influence on Paris compared with species. NIR and HPLC combined with multivariate analysis could discriminate different geographical origins and different species. The quality of Paris showed regional dependence. PMID:24558477

  1. Discrimination of wild Paris based on near infrared spectroscopy and high performance liquid chromatography combined with multivariate analysis.

    Science.gov (United States)

    Zhao, Yanli; Zhang, Ji; Yuan, Tianjun; Shen, Tao; Li, Wei; Yang, Shihua; Hou, Ying; Wang, Yuanzhong; Jin, Hang

    2014-01-01

    Different geographical origins and species of Paris obtained from southwestern China were discriminated by near infrared (NIR) spectroscopy and high performance liquid chromatography (HPLC) combined with multivariate analysis. The NIR parameter settings were scanning (64 times), resolution (4 cm(-1)), scanning range (10,000 cm(-1)∼4000 cm(-1)) and parallel collection (3 times). NIR spectrum was optimized by TQ 8.6 software, and the ranges 7455∼6852 cm(-1) and 5973∼4007 cm(-1) were selected according to the spectrum standard deviation. The contents of polyphyllin I, polyphyllin II, polyphyllin VI, and polyphyllin VII and total steroid saponins were detected by HPLC. The contents of chemical components data matrix and spectrum data matrix were integrated and analyzed by partial least squares discriminant analysis (PLS-DA). From the PLS-DA model of NIR spectrum, Paris samples were separated into three groups according to the different geographical origins. The R(2)X and Q(2)Y described accumulative contribution rates were 99.50% and 94.03% of the total variance, respectively. The PLS-DA model according to 12 species of Paris described 99.62% of the variation in X and predicted 95.23% in Y. The results of the contents of chemical components described differences among collections quantitatively. A multivariate statistical model of PLS-DA showed geographical origins of Paris had a much greater influence on Paris compared with species. NIR and HPLC combined with multivariate analysis could discriminate different geographical origins and different species. The quality of Paris showed regional dependence.

  2. Use of combined micro extractor SFC interface and micro Fourier transform infrared spectroscopy for characterization of the low molecular weight fractions of asphalt

    Energy Technology Data Exchange (ETDEWEB)

    Sheu, K.; Lavigne, G.; Sandhu, H.; Koenig, M.; Moebus, G.; Johnson, J.F. (Univ. of Connecticut, Storrs (United States))

    1990-07-01

    The combination of supercritical fluid chromatography and infrared spectroscopy for identification of the separated compounds is a well known and obvious idea. There have been two approaches in general to combining the two techniques. One is by use of a flow-thru cell which the authors elected not to try because of the disadvantages of detection as a function of time. The other is the solvent elimination approach which is attractive because at room temperature and pressure the CO{sub 2} readily volatilizes and can be discarded. Additionally it is basically non-toxic and easy to vent to hoods or other methods of eliminating the gas. A number of instruments combining the use of SFC with FTIR have been described. A review of interfacing between supercritical fluid chromatography and infrared spectroscopy has been given.

  3. Combining visible and infrared radiometry and lidar data to test simulations in clear and ice cloud conditions

    OpenAIRE

    Bozzo, A.; T. Maestri; R. Rizzi

    2010-01-01

    Measurements taken during the 2003 Pacific THORPEX Observing System Test (P-TOST) by the MODIS Airborne Simulator (MAS), the Scanning High-resolution Interferometer Sounder (S-HIS) and the Cloud Physics Lidar (CPL) are compared to simulations performed with a line-by-line and multiple scattering modeling methodology (LBLMS). Formerly used for infrared hyper-spectral data analysis, LBLMS has been extended to the visible and near infrared with the inclusion of surface bi-directional reflectance...

  4. Role of Metallothionein1H in Cisplatin Resistance of Non-Small Cell Lung Cancer Cells

    Institute of Scientific and Technical Information of China (English)

    Xin-fang Hou; Qing-xia Fan; Liu-xing Wang; Shi-xin Lu

    2009-01-01

    Objective: Despite platinum-based adjuvant chemotherapy has improved greatly patients' outcomes, drug resistance poses a major impediment to the successful use of such an effective agent. Metallothioneins(MTs) are known to play putative roles in cancer cell proliferation, apoptosis, differentiation, drug resistance and prognosis. The present studiy was to investigte the role of metallethioein1H(MT1H) in cisplatin resistance of human non-small cell lung cancer(NSCLC) cell lines in vitro or its possible molecular mechanisms. Methods: MT1H mRNA expression in A549 and A549/DDP cells was detected by RT-PCR. A recombinant eukaryotic expression plasmid pcDNA3.1(-)-MT1H was constructed and transfected into A549 cells which express no MT1H. MT1H siRNA was transfected into A549/DDP cells which express MT1H highly. MT1H expression was detected by RT-PCR and Immunoblot. The chemosensitivity to cisplatin was assessed by MTT assay. Apoptosis rate was determined by Tunel and FCM. Bcl-2 and Bax were determined by immunohistochemistry. Results: MT1H mRNA was expressed in A549/DDP but not in A549. After transfection of MT1H, MT1H expression was enhanced and the chemosensitivity to cisplatin was decreased in A549 cells. Inversely, after transfection of MT1H siRNA, MT1H expression was decreased and the chemosensitivity to cisplatin was increased in A549/DDP. The apoptosis rate induced by cisplatin was increased and Bcl-2 was down-regulated but Bax showed little change in A549/DDP cells interferred with MT1H siRNA. Conclusion: MT1H overexpression can promote drug resistance in A549 cells . Down-regulation of MT1H interfered with siRNA can effectively reverses the drug resistance in A549/DDP cells by down-regulating the expression of Bcl-2 and increasing cisplatin induced apoptosis. SiRNA targeting MT1H combined with chemotherapy may be a very promising strategy for treatment of lung cancer.

  5. Determination of the Degree of Degradation of Frying Rapeseed Oil Using Fourier-Transform Infrared Spectroscopy Combined with Partial Least-Squares Regression

    OpenAIRE

    Jie Yu Chen; Han Zhang; Jinkui Ma; Tomohiro Tuchiya; Yelian Miao

    2015-01-01

    This rapid method for determining the degree of degradation of frying rapeseed oils uses Fourier-transform infrared (FTIR) spectroscopy combined with partial least-squares (PLS) regression. One hundred and fifty-six frying oil samples that degraded to different degrees by frying potatoes were scanned by an FTIR spectrometer using attenuated total reflectance (ATR). PLS regression with full cross validation was used for the prediction of acid value (AV) and total polar compounds (TPC) based on...

  6. Crystalline 1H-1,2,3-triazol-5-ylidenes

    Energy Technology Data Exchange (ETDEWEB)

    Bertrand, Guy; Gulsado-Barrios, Gregorio; Bouffard, Jean; Donnadieu, Bruno

    2016-08-02

    The present invention provides novel and stable crystalline 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of making 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of using 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes in catalytic reactions.

  7. 7-Chloro-5-(4-hydroxyphenyl)-1-methyl-3-(naphthalen-2-ylmethyl)-4,5-dihydro-1H-benzo[b][1,4]diazepin-2(3H)-one (Bz-423), a benzodiazepine, suppresses keratinocyte proliferation and has antipsoriatic activity in the human skin-severe, combined immunodeficient mouse transplant model.

    Science.gov (United States)

    Bhagavathula, Narasimharao; Nerusu, Kamalakar C; Hanosh, Andrew; Aslam, Muhammad N; Sundberg, Thomas B; Opipari, Anthony W; Johnson, Kent; Kang, Sewon; Glick, Gary D; Varani, James

    2008-03-01

    7-Chloro-5-(4-hydroxyphenyl)-1-methyl-3-(naphthalen-2-ylmethyl)-4,5-dihydro-1H-benzo[b][1,4]diazepin-2(3H)-one (Bz-423) is a benzodiazepine that has cytotoxic and cytostatic activity against a variety of cells in vivo and in vitro. In the present study, we demonstrate that Bz-423 (formulated for topical delivery) reduces epidermal hyperplasia in human psoriatic skin after transplantation to severe, combined immunodeficient (scid) mice. Bz-423 also suppresses the hyperplasia that develops in nonpsoriatic human skin as a consequence of transplantation to scid mice. Proliferation of human epidermal keratinocytes in monolayer culture was suppressed by Bz-423 at concentrations of 0.5 to 2.0 muM (noncytotoxic concentrations). Keratinocyte growth inhibition was accompanied by increased oxidant generation in Bz-423-treated cells, and treatment with vitamin E along with Bz-423 reversed the growth inhibition. Growth inhibition was accompanied by a redistribution of beta-catenin from a cytoplasmic pool to the cell membrane and by reduced levels of c-myc and cyclin D1 (two molecules associated with Wnt pathway signaling). Several analogs of Bz-423 were examined for antiproliferative activity against human epidermal keratinocytes and human dermal fibroblasts in monolayer culture. Each of the analogs tested suppressed growth of both cell types, but in all cases, keratinocytes were more sensitive than fibroblasts. Two of the compounds were found to suppress epidermal hyperplasia induced with all-trans retinoic acid in organ cultures of human skin. Taken together, these data show that Bz-423 and certain analogs produce biological responses in skin cells in vitro and in vivo that are consistent with therapeutic goals for treating psoriasis or epidermal hyperplasia resulting from other causes.

  8. Diagnosis of Breast Cancer using a Combination of Genetic Algorithm and Artificial Neural Network in Medical Infrared Thermal Imaging

    Directory of Open Access Journals (Sweden)

    Hossein Ghayoumi zadeh

    2013-03-01

    Full Text Available Introduction This study is an effort to diagnose breast cancer by processing the quantitative and qualitative information obtained from medical infrared imaging. The medical infrared imaging is free from any harmful radiation and it is one of the best advantages of the proposed method. By analyzing this information, the best diagnostic parameters among the available parameters are selected and its sensitivity and precision in cancer diagnosis is improved by utilizing genetic algorithm and artificial neural network. Materials and Methods In this research, the necessary information is obtained from thermal imaging of 200 people, and 8 diagnostic parameters are extracted from these images by the research team. Then these 8 parameters are used as input of our proposed combinatorial model which is formed using artificial neural network and genetic algorithm. Results Our results have revealed that comparison of the breast areas; thermal pattern and kurtosis are the most important parameters in breast cancer diagnosis from proposed medical infrared imaging. The proposed combinatorial model with a 50% sensitivity, 75% specificity and, 70% accuracy shows good precision in cancer diagnosis. Conclusion The main goal of this article is to describe the capability of infrared imaging in preliminary diagnosis of breast cancer. This method is beneficial to patients with and without symptoms. The results indicate that the proposed combinatorial model produces optimum and efficacious parameters in comparison to other parameters and can improve the capability and power of globalizing the artificial neural network. This will help physicians in more accurate diagnosis of this type of cancer.

  9. Determination of the Vibrational Constants of Some Diatomic Molecules: A Combined Infrared Spectroscopic and Quantum Chemical Third Year Chemistry Project.

    Science.gov (United States)

    Ford, T. A.

    1979-01-01

    In one option for this project, the rotation-vibration infrared spectra of a number of gaseous diatomic molecules were recorded, from which the fundamental vibrational wavenumber, the force constant, the rotation-vibration interaction constant, the equilibrium rotational constant, and the equilibrium internuclear distance were determined.…

  10. All-photonic drying and sintering process via flash white light combined with deep-UV and near-infrared irradiation for highly conductive copper nano-ink

    Science.gov (United States)

    Hwang, Hyun-Jun; Oh, Kyung-Hwan; Kim, Hak-Sung

    2016-01-01

    We developed an ultra-high speed photonic sintering method involving flash white light (FWL) combined with near infrared (NIR) and deep UV light irradiation to produce highly conductive copper nano-ink film. Flash white light irradiation energy and the power of NIR/deep UV were optimized to obtain high conductivity Cu films. Several microscopic and spectroscopic characterization techniques such as scanning electron microscopy (SEM), a x-ray diffraction (XRD), and Fourier-transform infrared (FT-IR) spectroscopy were employed to characterize the Cu nano-films. Optimally sintered Cu nano-ink films produced using a deep UV-assisted flash white light sintering technique had the lowest resistivity (7.62 μΩ·cm), which was only 4.5-fold higher than that of bulk Cu film (1.68 μΩ•cm).

  11. Evaluation of Lignocellulosic Biomass Degradation by Combining Mid- and Near-Infrared Spectra by the Outer Product and Selecting Discriminant Wavenumbers Using a Genetic Algorithm.

    Science.gov (United States)

    Rammal, Abbas; Perrin, Eric; Chabbert, Brigitte; Bertrand, Isabelle; Habrant, Anouck; Lecart, Brieuc; Vrabie, Valeriu

    2015-11-01

    Mid-infrared (MIR) and near-infrared (NIR) spectroscopy provide useful information on the molecular composition of biological systems. Because they are sensitive to organic and mineral components, there is a growing interest in these techniques for the development of biomarkers that reflect intrinsic characteristics of plants and their mode of degradation. Due to their complexity and complementary nature, an important challenge is the combining of MIR and NIR information to identify discriminating wavenumbers in each wavenumber region, with the ultimate goal of assessing the biodegradation process of a lignocellulosic biomass at different time scales. This work investigates the potential of using the outer product to combine MIR and NIR spectra to highlight the connections between fundamental molecular vibrations and their combinations and bonds. Because this operation yields high-dimensional spectra, we propose to use a genetic algorithm to select the most discriminant wavenumbers within the degradation process. The results from two lignocellulosic biomasses with different biodegradation kinetics, miscanthus aerial parts and maize roots, confirm that the outer product combination of MIR and NIR spectral information allows a better discrimination of the biodegradation kinetic compared with the simple concatenation of MIR and NIR spectra or with the use of MIR or MIR spectral information separately. We show that the genetic algorithm selects wavenumbers that correspond to principal vibrations of chemical functional groups of compounds that undergo degradation/conversion during the biodegradation of the lignocellulosic biomass.

  12. Combined Holographic Subsurface Radar and Infrared Thermography for Diagnosis of the Conditions of Historical Structures and Artworks

    Science.gov (United States)

    Capineri, L.; Falorni, P.; Ivashov, S.; Zhuravlev, A.; Vasiliev, I.; Razevig, V.; Bechtel, T.; Stankiewicz, G.

    2009-04-01

    of RASCAN radar and infrared thermography (IRT) as a means of alleviating the non-uniqueness problem. Coincident RASCAN and IRT images have been recorded for laboratory mock-ups of stone, wood and plaster structures and artworks containing subsurface cracks, voids, moisture, insect damage, supports, repairs, and the like. In addition, some initial side-by-side testing has been performed on actual historic structures and artworks. Since both RASCAN and IRT produce real-time, plan-view images, they are easily overlain and compared, and both can be interpreted visually - especially by persons familiar with the particular item under investigation. Because they are sensitive to completely independent physical properties (dielectric constant for RASCAN and thermal conductivity and heat capacity for IRT), this comparison can allow confident identification of target materials and conditions. Our testing confirms that both are exquisitely sensitive to hidden moisture. Finally, instrumentation for both RASCAN and IRT is commercially available, relatively low cost, and easy to use and interpret - making this combination of methods a potentially powerful tool for workers engaged in the preservation and restoration of artworks and architecture.

  13. Analysis list: Nr1h3 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1h3 Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1h3.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1h3.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1h...3.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1h3.Liver.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...

  14. Analysis list: Nr1h2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1h2 Blood + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1h2.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1h2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1h...2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1h2.Blood.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Blood.gml ...

  15. Combined far infrared RAIRS and XPS studies of TiCl 4 adsorption and reaction on Mg films

    Science.gov (United States)

    Pilling, M. J.; Fonseca, A. Amieiro; Cousins, M. J.; Waugh, K. C.; Surman, M.; Gardner, P.

    2005-08-01

    In recent years there has been an increase in interest in the study of model Ziegler-Natta catalysts used for the polymerisation of ethene and propene. Particular attention has focused on catalysts consisting of TiCl 4 on activated MgCl 2 accompanied by a co-catalyst, usually triethylaluminium (AlEt 3). As part of a wider project on the characterisation of model Ziegler-Natta catalysts we have investigated the interaction of TiCl 4 with metallic Mg films grown on a Au surface using X-ray photoelectron spectroscopy (XPS) and far infrared reflection absorption infrared spectroscopy. Somewhat surprisingly, the infrared spectra show little variation as a function of exposure to TiCl 4. A very broad asymmetric vibrational band grows in with maximum intensity at 382 cm -1. Three prominent low frequency shoulders are observed at approximately 360, 320, and 260 cm -1. For monolayer coverages of Mg the main band at 382 cm -1 is narrower, less asymmetric and accompanied by a prominent shoulder at 398 cm -1, which increases with increasing exposure to TiCl 4. TiCl 4 exposure in the presence of 5 × 10 -8 Torr of ethyl benzoate results in a change in line shape with low frequency broadening and a small shift in the frequency of the band. These spectra are discussed in the light of the possible constituent species making up the surface layer.

  16. Identification of Medicinal Mugua Origin by Near Infrared Spectroscopy Combined with Partial Least-squares Discriminant Analysis.

    Science.gov (United States)

    Han, Bangxing; Peng, Huasheng; Yan, Hui

    2016-01-01

    Mugua is a common Chinese herbal medicine. There are three main medicinal origin places in China, Xuancheng City Anhui Province, Qijiang District Chongqing City, Yichang City, Hubei Province, and suitable for food origin places Linyi City Shandong Province. To construct a qualitative analytical method to identify the origin of medicinal Mugua by near infrared spectroscopy (NIRS). Partial least squares discriminant analysis (PLSDA) model was established after the Mugua derived from five different origins were preprocessed by the original spectrum. Moreover, the hierarchical cluster analysis was performed. The result showed that PLSDA model was established. According to the relationship of the origins-related important score and wavenumber, and K-mean cluster analysis, the Muguas derived from different origins were effectively identified. NIRS technology can quickly and accurately identify the origin of Mugua, provide a new method and technology for the identification of Chinese medicinal materials. After preprocessed by D1+autoscale, more peaks were increased in the preprocessed Mugua in the near infrared spectrumFive latent variable scores could reflect the information related to the origin place of MuguaOrigins of Mugua were well-distinguished according to K. mean value clustering analysis. Abbreviations used: TCM: Traditional Chinese Medicine, NIRS: Near infrared spectroscopy, SG: Savitzky-Golay smoothness, D1: First derivative, D2: Second derivative, SNV: Standard normal variable transformation, MSC: Multiplicative scatter correction, PLSDA: Partial least squares discriminant analysis, LV: Latent variable, VIP scores: Important score.

  17. Combining visible and infrared radiometry and lidar data to test simulations in clear and ice cloud conditions

    Directory of Open Access Journals (Sweden)

    A. Bozzo

    2010-08-01

    Full Text Available Measurements taken during the 2003 Pacific THORPEX Observing System Test (P-TOST by the MODIS Airborne Simulator (MAS, the Scanning High-resolution Interferometer Sounder (S-HIS and the Cloud Physics Lidar (CPL are compared to simulations performed with a line-by-line and multiple scattering modeling methodology (LBLMS. Formerly used for infrared hyper-spectral data analysis, LBLMS has been extended to the visible and near infrared with the inclusion of surface bi-directional reflectance properties. A number of scenes are evaluated: two clear scenes, one with nadir geometry and one cross-track encompassing sun glint, and three cloudy scenes, all with nadir geometry.

    CPL data is used to estimate the particulate optical depth at 532 nm for the clear and cloudy scenes and cloud upper and lower boundaries. Cloud optical depth is retrieved from S-HIS infrared window radiances, and it agrees with CPL values, to within natural variability. MAS data are simulated convolving high resolution radiances. The paper discusses the results of the comparisons for the clear and cloudy cases. LBLMS clear simulations agree with MAS data to within 20% in the shortwave (SW and near infrared (NIR spectrum and within 2 K in the infrared (IR range. It is shown that cloudy sky simulations using cloud parameters retrieved from IR radiances systematically underestimate the measured radiance in the SW and NIR by nearly 50%, although the IR retrieved optical thickness agree with same measured by CPL.

    MODIS radiances measured from Terra are also compared to LBLMS simulations in cloudy conditions, using retrieved cloud optical depth and effective radius from MODIS, to understand the origin for the observed discrepancies. It is shown that the simulations agree, to within natural variability, with measurements in selected MODIS SW bands.

    The impact of the assumed particles size distribution and vertical profile of ice content on results is evaluated

  18. Band engineering of amorphous silicon ruthenium thin film and its near-infrared absorption enhancement combined with nano-holes pattern on back surface of silicon substrate

    Science.gov (United States)

    Guo, Anran; Zhong, Hao; Li, Wei; Gu, Deen; Jiang, Xiangdong; Jiang, Yadong

    2016-10-01

    Silicon is widely used in semiconductor industry but has poor performance in near-infrared photoelectronic devices because of its bandgap limit. In this study, a narrow bandgap silicon rich semiconductor is achieved by introducing ruthenium (Ru) into amorphous silicon (a-Si) to form amorphous silicon ruthenium (a-Si1-xRux) thin films through co-sputtering. The increase of Ru concentration leads to an enhancement of light absorption and a narrower bandgap. Meanwhile, a specific light trapping technique is employed to realize high absorption of a-Si1-xRux thin film in a finite thickness to avoid unnecessary carrier recombination. A double-layer absorber comprising of a-Si1-xRux thin film and silicon random nano-holes layer is formed on the back surface of silicon substrates, and significantly improves near-infrared absorption while the leaky light intensity is less than 5%. This novel absorber, combining narrow bandgap thin film with light trapping structure, may have a potential application in near-infrared photoelectronic devices.

  19. Simultaneous determination of amino acid nitrogen and total acid in soy sauce using near infrared spectroscopy combined with characteristic variables selection.

    Science.gov (United States)

    Zhao, Jiewen; Ouyang, Qin; Chen, Quansheng; Lin, Hao

    2013-08-01

    Amino acid nitrogen and total acid are two most important quality indices to assess the quality of soy sauce in China. This work employed near infrared spectroscopy combined with synergy interval partial least square and genetic algorithm to detect amino acid nitrogen and total acid content in soy sauce. First, synergy interval partial least square was used to select efficient spectral regions from the full spectrum region; and then, genetic algorithm was used to selected variables from the efficient spectral regions, to build partial least square model. The optimal genetic algorithm synergy interval partial least square models were obtained as follows: Rc  = 0.9988 and Rp = 0.9988 for amino acid nitrogen content model using 64 variables; Rc = 0.9917 and Rp = 0.9902 for total acid content model using 81 variables. Genetic algorithm synergy interval partial least square models showed superiority over the partial least square and synergy interval partial least square models. The results indicated that amino acid nitrogen and total acid content in soy sauce could be rapidly determined by near infrared spectroscopy technique. Also, the results indicated that genetic algorithm synergy interval partial least square can improve the performance in measurement of amino acid nitrogen and total acid content by near infrared spectroscopy.

  20. On the use of overtone and combination bands for the analysis of the CaSO4-H2O system by mid-infrared reflection spectroscopy.

    Science.gov (United States)

    Rosi, Francesca; Daveri, Alessia; Doherty, Brenda; Nazzareni, Sabrina; Brunetti, Brunetto G; Sgamellotti, Antonio; Miliani, Costanza

    2010-08-01

    With the aim of characterizing ground preparations of paintings by infrared reflection spectroscopy, the CaSO(4)-H(2)O system (gypsum/bassanite/anhydrite) has been re-investigated, evaluating and assigning the SO(4)(2-) and OH overtone and combination bands, respectively, in the ranges 1900-2700 cm(-1) and 5000-6000 cm(-1) resulting from reflection and high concentration transmission spectra. The second-order modes have been proven to be highly specific, reliable, and less affected by overlap with bands of organic binders and can hence be exploited for the identification of the sulfate hydration phase using infrared (IR) reflection spectroscopy. Subsequently, the characterization and identification of hydration phases in unknown sulfate-based ground preparations on authentic artworks have been carried out noninvasively by fiber-optic reflection IR spectroscopy and on cross-sections by infrared reflection micro-spectroscopy. The spectroscopic data collected both on standards and artworks have been cross-validated by X-ray diffraction.

  1. Accelerated reduction of post-skin-resurfacing erythema and discomfort with a combination of non-thermal blue and near infrared light.

    Science.gov (United States)

    Trelles, Mario; Elman, Monica; Slatkine, Michael; Harth, Yoram

    2005-06-01

    The prolonged crusting and erythematic phases following chemical and laser skin resurfacing create discomfort and aggravate patients. Depending on the aggressiveness of the procedure, post-procedure erythema may last from three weeks to several months. iClearXL (CureLight Ltd) is a non-contact, non-thermal blue (405-420 nm)/near infrared (850-900 nm) dual-band light source emitting up to 60 J/cm2 on a 30 cm by 30 cm treatment area. The blue component of the light source has been proven to have a significant anti-inflammatory effect, whereas the near infrared component enhances vascular circulation as well as lymphatic drainage in the thin, necrotized papillary layer. Facial skin laser resurfacing was performed on twelve patients. Starting one day after resurfacing, six patients received a daily 20-minute treatment of blue (405-420 nm)/near infrared (850-900 nm) light for six consecutive days, and six control patients were treated with the usual topical care protocol. Twelve days after the procedure, the treated group had a weighted average erythema score of 0.33 as compared to 1.33 in the control group. Two months after the procedure, the treated group had a weighted average erythema score of 0.16 as compared to 0.83 in the control group. Twelve days after the procedure, the treated group had a weighted average discomfort score of 0.33 as compared to 0.83 in the control group. The tested combination of non-thermal blue (405-420 nm)/near infrared (850-900 nm) dual-band light was found to significantly shorten the duration of post-laser-resurfacing erythema and discomfort with no side effects.

  2. Encapsulation of paclitaxel into a bio-nanocomposite. A study combining inelastic neutron scattering to thermal analysis and infrared spectroscopy

    Directory of Open Access Journals (Sweden)

    Martins Murillo L.

    2015-01-01

    Full Text Available The anticancer drug paclitaxel was encapsulated into a bio-nanocomposite formed by magnetic nanoparticles, chitosan and apatite. The aim of this drug carrier is to provide a new perspective against breast cancer. The dynamics of the pure and encapsulated drug were investigated in order to verify possible molecular changes caused by the encapsulation, as well as to follow which interactions may occur between paclitaxel and the composite. Fourier transformed infrared spectroscopy, thermal analysis, inelastic and quasi-elastic neutron scattering experiments were performed. These very preliminary results suggest the successful encapsulation of the drug.

  3. Analysis list: NR1H3 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NR1H3 Adipocyte,Blood + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target.../NR1H3.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/NR1H3.5.tsv http://dbarchive.bioscienced...bc.jp/kyushu-u/hg19/target/NR1H3.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/NR1H3.Adipocyte....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/NR1H3.Blood.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/Adipocyte.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml ...

  4. A Combined Spitzer and Herschel Infrared Study of Gas and Dust in the Circumbinary Disk Orbiting V4046 Sgr

    CERN Document Server

    Rapson, Valerie A; Sacco, G Germano; Kastner, Joel H; Wilner, David; Rosenfeld, Katherine; Andrews, Sean; Herczeg, Gregory; van der Marel, Nienke

    2015-01-01

    We present results from a spectroscopic Spitzer and Herschel mid-to-far-infrared study of the circumbinary disk orbiting the evolved (age ~12-23 Myr) close binary T Tauri system V4046 Sgr. Spitzer IRS spectra show emission lines of [Ne II], H_2 S(1), CO_2 and HCN, while Herschel PACS and SPIRE spectra reveal emission from [O I], OH, and tentative detections of H_2O and high-J transitions of CO. We measure [Ne III]/[Ne II] < 0.13, which is comparable to other X-ray/EUV luminous T Tauri stars that lack jets. We use the H_2 S(1) line luminosity to estimate the gas mass in the relatively warm surface layers of the inner disk. The presence of [O I] emission suggests that CO, H_2O, and/or OH is being photodissociated, and the lack of [C I] emission suggests any excess C may be locked up in HCN, CN and other organic molecules. Modeling of silicate dust grain emission features in the mid-infrared indicates that the inner disk is composed mainly of large (r~5 um) amorphous pyroxene and olivine grains (~86% by mass)...

  5. Main: 1H1Y [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H1Y イネ Rice Oryza sativa L. D-Ribulose-5-Phosphate 3-Epimerase Oryza Sativa Molecu...V. 326 127 2003 3-Epimerase, Oxidative Pentose Phosphate Pathway, Isomerase SWS:Q9SE42,Q9SE42|EMBL; AF189365; AAF01048.1; -.|PDB; 1H...1Y; X-ray; A/B=1-228.|PDB; 1H1Z; X-ray; A/B=1-228.|Gramene; Q9SE42; -.|GO; GO:001685...ELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS rice_1H1Y.jpg ...

  6. Combination of Raman, infrared, and X-ray energy-dispersion spectroscopies and X-ray d diffraction to study a fossilization process

    Energy Technology Data Exchange (ETDEWEB)

    Sousa Filho, Francisco Eduardo de [Departamento de Fisica, Universidade Regional do Cariri, Crato, CE (Brazil); Joao Herminio da Silva [Universidade Federal do Ceara, Cariri, Juazeiro do Norte, CE (Brazil); Saraiva, Antonio Alamo Feitosa; Brito, Deyvid Dennys S. [Departamento de Ciencias Biologicas, Universidade Regional do Cariri, Crato, CE (Brazil); Viana, Bartolomeu Cruz [Departamento de Fisica, Universidade Federal do Piaui, Teresina, PI, (Brazil); Abagaro, Bruno Tavares de Oliveira; Freire, Paulo de Tarso Cavalcante, E-mail: tarso@fisica.ufc.br [Departamento de Fisica, Universidade Federal do Ceara, Fortaleza, CE (Brazil)

    2011-12-15

    X-ray diffraction was combined with X-ray energy-dispersion, Fourier-transform infrared, and Raman spectroscopies to study the fossilization of a Cretaceous specimen of the plant Brachyphyllum castilhoi, a fossil from the Ipubi Formation, in the Araripe Sedimentary Basin, Northeastern Brazil. Among the possible fossilization processes, which could involve pyrite, silicon oxide, calcium oxide, or other minerals, we were able to single out pyritization as the central mechanism producing the fossil, more than 100 million years ago. In addition to expanding the knowledge of the Ipubi Formation, this study shows that, when combined with other experimental techniques, Raman spectroscopy is a valuable tool at the paleontologist's disposal. (author)

  7. Closure of skin incisions by laser-welding with a combination of two near-infrared diode lasers: preliminary study for determination of optimal parameters.

    Science.gov (United States)

    Hu, Liming; Lu, Zhihua; Wang, Biao; Cao, Junsheng; Ma, Xiaobo; Tian, Zhenhua; Gao, Zhijian; Qin, Li; Wu, Xiaodong; Liu, Yun; Wang, Lijun

    2011-03-01

    Laser welding has the potential to become an effective method for wound closure and healing without sutures. Closure of skin incisions by laser welding with a combination of two near-infrared lasers (980 and 1064 nm), was performed for the first time in this study. One centimeter long, full-thickness incisions were made on the Wistar rat's dorsal skin. The efficiencies of laser-welding with different parameters were investigated. Incision-healing, histology examination, and a tensile strength test of incisions were recorded. Laser welding with the irradiance level of 15.9 W∕cm(2) for both 980 and 1064-nm lasers and exposure time of 5 s per spot in continuous wave mode yielded a more effective closure and healing with minimal thermal damage, faster recovery, and stronger apposition in comparison with a suturing technique. The conclusion is that skin welding with a combination of two near-infrared diode lasers can be a good candidate for incision closure, and further investigations are in progress for clinical use.

  8. Application of near-infrared spectroscopy combined with multivariate analysis in monitoring of crude heparin purification process.

    Science.gov (United States)

    Zang, Hengchang; Wang, Jinfeng; Li, Lian; Zhang, Hui; Jiang, Wei; Wang, Fengshan

    2013-05-15

    Ion-exchange chromatography is a widely used purification technology in the heparin manufacturing process. To improve the efficiency and understand the process directly, a rapid and equally precise method needs to be developed to measure heparin concentration in chromatography process. Here, two robust partial least squares regression (PLS-R) models were established for quantification of heparin based on the near-infrared (NIR) spectroscopy with 80 samples of adsorption process and 76 samples of elution process. Several variables selection algorithms, including correlation coefficient method, successive projection algorithm (SPA) and interval partial least squares (iPLSs), were performed to remove non-informative variables. The results showed that the correlation coefficient of validation (Rp) and the residual predictive deviation (RPD) corresponded to 0.957 and 3.4472 for adsorption process, 0.968 and 3.9849 for elution process, respectively. The approach was found considerable potential for real-time monitoring the heparin concentration of chromatography process.

  9. Near-infrared spectra combined with partial least squares for pH determination of toothpaste of different brands

    Institute of Scientific and Technical Information of China (English)

    Yong Nian Ni; Wei Lin

    2011-01-01

    Near-infrared spectroscopy (NIR), which is generally used for online monitoring of the food analysis and production process, was applied to determine the internal quality of toothpaste samples. It is acknowledged that the spectra can be significantly influenced by non-linearities introduced by light scatter, therefore, four data preprocessing methods, including off-set correction, 1st-derivative, standard normal variate (SNV) and multiplicative scatter correction (MSC), were employed before the date analysis. The multivariate calibration model of partial least squares (PLS) was established and then was used to predict the pH values of the toothpaste samples of different brand. The results showed that the spectral date processed by MSC was the best one for predicting the pH value of the toothpaste samples.

  10. COMBINED USE OF FOURIER TRANSFORM INFRARED AND RAMAN SPECTROSCOPY TO STUDY PLANKTONIC AND BIOFILM CELLS OF CRONOBACTER SAKAZAKII

    Directory of Open Access Journals (Sweden)

    Garima Sharma

    2014-02-01

    Full Text Available Cronobacter sakazakii is an opportunistic pathogen, which causes necrotizing enterocolitis, bacteriaemia and infant meningitis. It has the ability to form biofilm on food contact surfaces, creating food safety risks. In this work, the phenotypic expression of planktonic and biofilm was studied by Fourier transform infrared (FTIR and Raman spectroscopy. FTIR spectra of the biofilm cells exhibited higher intensity in the absorption bands assigned to polysaccharides, amide I, amide II vibrational mode of ester and carboxylate group. Raman spectra of the biofilm cells showed higher intensity in the absorption band assigned to tyrosine, amide III, carbohydrates, carotenoids, DNA and lipids. Understanding the chemical properties of planktonic and biofilm cells employing the two techniques helped to decipher the differences in the chemical composition between planktonic and biofilm cells. This can promote a better understanding of the persistence, survival and resistance of the biofilm cells.

  11. Application of near-infrared spectroscopy combined with multivariate analysis in monitoring of crude heparin purification process

    Science.gov (United States)

    Zang, Hengchang; Wang, Jinfeng; Li, Lian; Zhang, Hui; Jiang, Wei; Wang, Fengshan

    2013-05-01

    Ion-exchange chromatography is a widely used purification technology in the heparin manufacturing process. To improve the efficiency and understand the process directly, a rapid and equally precise method needs to be developed to measure heparin concentration in chromatography process. Here, two robust partial least squares regression (PLS-R) models were established for quantification of heparin based on the near-infrared (NIR) spectroscopy with 80 samples of adsorption process and 76 samples of elution process. Several variables selection algorithms, including correlation coefficient method, successive projection algorithm (SPA) and interval partial least squares (iPLSs), were performed to remove non-informative variables. The results showed that the correlation coefficient of validation (Rp) and the residual predictive deviation (RPD) corresponded to 0.957 and 3.4472 for adsorption process, 0.968 and 3.9849 for elution process, respectively. The approach was found considerable potential for real-time monitoring the heparin concentration of chromatography process.

  12. On-line monitoring of the transesterification reaction between triglycerides and ethanol using near infrared spectroscopy combined with gas chromatography.

    Science.gov (United States)

    Richard, Romain; Li, Ying; Dubreuil, Brigitte; Thiebaud-Roux, Sophie; Prat, Laurent

    2011-06-01

    Many analytical procedures have been developed to determine the composition of reaction mixtures during transesterification of vegetable oils with alcohols. However, despite their accuracy, these methods are time consuming and cannot be easily used for on-line monitoring. In this work, a fast analytical method was developed to on-line monitor the transesterification reaction of high oleic sunflower oil with ethanol using Near InfraRed spectroscopy and a multivariate approach. The reactions were monitored through sequential scans of the reaction medium with a probe in a one-liter batch reactor without collecting and preparing samples. To calibrate the NIR analytical method, gas chromatography-flame ionization detection was used as a reference method. The method was validated by studying the kinetics of the EtONa-catalyzed transesterification reaction. Activation energy (51.0 kJ/mol) was also determined by considering a pseudo second order kinetics model. Copyright © 2011 Elsevier Ltd. All rights reserved.

  13. 4-Bromo-3-methoxy-1-phenyl-1H-pyrazole

    Directory of Open Access Journals (Sweden)

    Algirdas Šačkus

    2009-11-01

    Full Text Available The title compound was prepared by treatment of 4-bromo-1-phenyl-1H-pyrazol-3-ol with sodium hydride/methyl iodide in good yield. Detailed spectroscopic data (1H NMR, 13C NMR, 15N NMR, IR, MS are presented.

  14. Influence of local molecular motions on the determination of 1H-1H internuclear distances measured by 2D 1H spin-exchange experiments.

    Science.gov (United States)

    Brus, J; Petrícková, H; Dybal, J

    2003-06-01

    Analysis of spin-exchange build-up curves obtained by measurement of 2D 1H CRAMPS spectra of alpha-glycine was performed to evaluate the rate of 1H-1H spin-exchange process with respect to the influence of variation in internal molecular motion. Differences in local motions significantly affect spin-exchange constants even in highly rigid organic solids with virtually uniform motion behavior. The polarization transfer between nonequivalent alpha-protons is described by the spin-exchange constant D=0.77 nm(2)ms(-1), while the polarization transfer involving spin exchange between alphaH and NH(3)(+) protons is characterized by D=0.24-0.21 nm(2)ms(-1). This significant decrease corresponds to rotation of hydrogen-bonded amino groups. Neglecting this variation in local spin-exchange constants the resulting calculated 1H-1H distance can be overestimated by up to 100%. Complications following from relayed and back polarization transfer involving the nearest spins within one functional group (e.g., CH(2) and/or NH(3)(+)) and intermolecular spin exchange are discussed. It was shown that 2H quadrupolar splitting determined for selected sites directly correlates with the experimentally observed differences in spin-exchange coefficients. It is also demonstrated that a medium level quantum chemical calculation of molecular dynamics provides relevant data that can be used to estimate differences in molecular motions.

  15. Mapping of prostate cancer by 1H MRSI.

    Science.gov (United States)

    Kobus, Thiele; Wright, Alan J; Scheenen, Tom W J; Heerschap, Arend

    2014-01-01

    In many studies, it has been demonstrated that (1)H MRSI of the human prostate has great potential to aid prostate cancer management, e.g. in the detection and localisation of cancer foci in the prostate or in the assessment of its aggressiveness. It is particularly powerful in combination with T2 -weighted MRI. Nevertheless, the technique is currently mainly used in a research setting. This review provides an overview of the state-of-the-art of three-dimensional MRSI, including the specific hardware required, dedicated data acquisition sequences and information on the spectral content with background on the MR-visible metabolites. In clinical practice, it is important that relevant MRSI results become available rapidly, reliably and in an easy digestible way. However, this functionality is currently not fully available for prostate MRSI, which is a major obstacle for routine use by inexperienced clinicians. Routine use requires more automation in the processing of raw data than is currently available. Therefore, we pay specific attention in this review on the status and prospects of the automated handling of prostate MRSI data, including quality control. The clinical potential of three-dimensional MRSI of the prostate is illustrated with literature examples on prostate cancer detection, its localisation in the prostate, its role in the assessment of cancer aggressiveness and in the selection and monitoring of therapy.

  16. Phosphatation of zeolite H-ZSM-5 : A combined microscopy and spectroscopy study

    NARCIS (Netherlands)

    Van Der Bij, Hendrik E.; Aramburo, Luis R.; Arstad, Bjørnar; Dynes, James J.; Wang, Jian; Weckhuysen, Bert M.

    2014-01-01

    A variety of phosphated zeolite H-ZSM-5 samples are investigated by using a combination of Fourier transfer infrared (FTIR) spectroscopy, single pulse 27Al, 29Si, 31P, 1H-31P cross polarization (CP), 27Al-31P CP, and 27Al 3Q magic angle spinning nuclear magnetic resonance (MAS NMR) spectroscopy, sca

  17. Vicinal 1H-1H NMR coupling constants from density functional theory as reliable tools for stereochemical analysis of highly flexible multichiral center molecules.

    Science.gov (United States)

    López-Vallejo, Fabian; Fragoso-Serrano, Mabel; Suárez-Ortiz, Gloria Alejandra; Hernández-Rojas, Adriana C; Cerda-García-Rojas, Carlos M; Pereda-Miranda, Rogelio

    2011-08-05

    A protocol for stereochemical analysis, based on the systematic comparison between theoretical and experimental vicinal (1)H-(1)H NMR coupling constants, was developed and applied to a series of flexible compounds (1-8) derived from the 6-heptenyl-5,6-dihydro-2H-pyran-2-one framework. The method included a broad conformational search, followed by geometry optimization at the DFT B3LYP/DGDZVP level, calculation of the vibrational frequencies, thermochemical parameters, magnetic shielding tensors, and the total NMR spin-spin coupling constants. Three scaling factors, depending on the carbon atom hybridizations, were found for the (1)H-C-C-(1)H vicinal coupling constants: f((sp3)-(sp3)) = 0.910, f((sp3)-(sp2)) = 0.929, and f((sp2)-(sp2))= 0.977. A remarkable correlation between the theoretical (J(pre)) and experimental (1)H-(1)H NMR (J(exp)) coupling constants for spicigerolide (1), a cytotoxic natural product, and some of its synthetic stereoisomers (2-4) demonstrated the predictive value of this approach for the stereochemical assignment of highly flexible compounds containing multiple chiral centers. The stereochemistry of two natural 6-heptenyl-5,6-dihydro-2H-pyran-2-ones (14 and 15) containing diverse functional groups in the heptenyl side chain was also analyzed by application of this combined theoretical and experimental approach, confirming its reliability. Additionally, a geometrical analysis for the conformations of 1-8 revealed that weak hydrogen bonds substantially guide the conformational behavior of the tetraacyloxy-6-heptenyl-2H-pyran-2-ones.

  18. Determining Optimal Feature-Combination for LDA Classification of Functional Near-Infrared Spectroscopy Signals in Brain-Computer Interface Application.

    Science.gov (United States)

    Naseer, Noman; Noori, Farzan M; Qureshi, Nauman K; Hong, Keum-Shik

    2016-01-01

    In this study, we determine the optimal feature-combination for classification of functional near-infrared spectroscopy (fNIRS) signals with the best accuracies for development of a two-class brain-computer interface (BCI). Using a multi-channel continuous-wave imaging system, mental arithmetic signals are acquired from the prefrontal cortex of seven healthy subjects. After removing physiological noises, six oxygenated and deoxygenated hemoglobin (HbO and HbR) features-mean, slope, variance, peak, skewness and kurtosis-are calculated. All possible 2- and 3-feature combinations of the calculated features are then used to classify mental arithmetic vs. rest using linear discriminant analysis (LDA). It is found that the combinations containing mean and peak values yielded significantly higher (p < 0.05) classification accuracies for both HbO and HbR than did all of the other combinations, across all of the subjects. These results demonstrate the feasibility of achieving high classification accuracies using mean and peak values of HbO and HbR as features for classification of mental arithmetic vs. rest for a two-class BCI.

  19. Determining optimal feature-combination for LDA classification of functional near-infrared spectroscopy signals in brain-computer interface application

    Directory of Open Access Journals (Sweden)

    Noman eNaseer

    2016-05-01

    Full Text Available In this study, we determine the optimal feature-combination for classification of functional near-infrared spectroscopy (fNIRS signals with the best accuracies for development of a two-class brain-computer interface (BCI. Using a multi-channel continuous-wave imaging system, mental arithmetic signals are acquired from the prefrontal cortex of seven healthy subjects. After removing physiological noises, six oxygenated and deoxygenated hemoglobin (HbO and HbR features — mean, slope, variance, peak, skewness and kurtosis — are calculated. All possible 2- and 3-feature combinations of the calculated features are then used to classify mental arithmetic versus rest using linear discriminant analysis (LDA. It is found that the combinations containing mean and peak values yielded significantly higher (p < 0.05 classification accuracies for both HbO and HbR than did all of the other combinations, across all of the subjects. These results demonstrate the feasibility of achieving high classification accuracies using mean and peak values of HbO and HbR as features for classification of mental arithmetic versus rest for a two-class BCI.

  20. Band engineering of amorphous silicon ruthenium thin film and its near-infrared absorption enhancement combined with nano-holes pattern on back surface of silicon substrate

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Anran; Zhong, Hao [State Key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Li, Wei, E-mail: wli@uestc.edu.cn [State Key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Gu, Deen; Jiang, Xiangdong [School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); Jiang, Yadong [State Key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China)

    2016-10-30

    Highlights: • The increase of Ru concentration leads to a narrower bandgap of a-Si{sub 1-x}Ru{sub x} thin film. • The absorption coefficient of a-Si{sub 1-x}Ru{sub x} is higher than that of SiGe. • A double-layer absorber comprising of a-Si{sub 1-x}Ru{sub x} film and Si nano-holes layer is achieved. - Abstract: Silicon is widely used in semiconductor industry but has poor performance in near-infrared photoelectronic devices because of its bandgap limit. In this study, a narrow bandgap silicon rich semiconductor is achieved by introducing ruthenium (Ru) into amorphous silicon (a-Si) to form amorphous silicon ruthenium (a-Si{sub 1-x}Ru{sub x}) thin films through co-sputtering. The increase of Ru concentration leads to an enhancement of light absorption and a narrower bandgap. Meanwhile, a specific light trapping technique is employed to realize high absorption of a-Si{sub 1-x}Ru{sub x} thin film in a finite thickness to avoid unnecessary carrier recombination. A double-layer absorber comprising of a-Si{sub 1-x}Ru{sub x} thin film and silicon random nano-holes layer is formed on the back surface of silicon substrates, and significantly improves near-infrared absorption while the leaky light intensity is less than 5%. This novel absorber, combining narrow bandgap thin film with light trapping structure, may have a potential application in near-infrared photoelectronic devices.

  1. Combined Raman and autofluorescence ex vivo diagnostics of skin cancer in near-infrared and visible regions

    Science.gov (United States)

    Bratchenko, Ivan A.; Artemyev, Dmitry N.; Myakinin, Oleg O.; Khristoforova, Yulia A.; Moryatov, Alexander A.; Kozlov, Sergey V.; Zakharov, Valery P.

    2017-02-01

    The differentiation of skin melanomas and basal cell carcinomas (BCCs) was demonstrated based on combined analysis of Raman and autofluorescence spectra stimulated by visible and NIR lasers. It was ex vivo tested on 39 melanomas and 40 BCCs. Six spectroscopic criteria utilizing information about alteration of melanin, porphyrins, flavins, lipids, and collagen content in tumor with a comparison to healthy skin were proposed. The measured correlation between the proposed criteria makes it possible to define weakly correlated criteria groups for discriminant analysis and principal components analysis application. It was shown that the accuracy of cancerous tissues classification reaches 97.3% for a combined 6-criteria multimodal algorithm, while the accuracy determined separately for each modality does not exceed 79%. The combined 6-D method is a rapid and reliable tool for malignant skin detection and classification.

  2. Potential of visible-near infrared spectroscopy combined with chemometrics for analysis of some constituents of coffee and banana residues.

    Science.gov (United States)

    Rambo, M K D; Amorim, E P; Ferreira, M M C

    2013-05-01

    Banana (stalk, leaf, rhizome, rachis and stem) and coffee (leaf and husks) residues are promising feedstock for fuel and chemical production. In this work we show the potential of near-infrared spectroscopy (NIR) and multivariate analysis to replace reference methods in the characterization of some constituents of coffee and banana residues. The evaluated parameters were Klason lignin (KL), acid soluble lignin (ASL), total lignin (TL), extractives, moisture, ash and acid insoluble residue (AIR) contents of 104 banana residues (B) and 102 coffee (C) residues from Brazil. PLS models were built for banana (B), coffee (C) and pooled samples (B+C). The precision of NIR methodology was better (p0.80. The range error ratios varied from 4.5 to 16.0. Based on the results of external validation, the statistical tests and figures of merit, NIR spectroscopy proved to be useful for chemical prediction of banana and coffee residues and can be used as a faster and more economical alternative to the standard methodologies.

  3. Discrimination and chemical phylogenetic study of seven species of Dendrobium using infrared spectroscopy combined with cluster analysis

    Science.gov (United States)

    Luo, Congpei; He, Tao; Chun, Ze

    2013-04-01

    Dendrobium is a commonly used and precious herb in Traditional Chinese Medicine. The high biodiversity of Dendrobium and the therapeutic needs require tools for the correct and fast discrimination of different Dendrobium species. This study investigates Fourier transform infrared spectroscopy followed by cluster analysis for discrimination and chemical phylogenetic study of seven Dendrobium species. Despite the general pattern of the IR spectra, different intensities, shapes, peak positions were found in the IR spectra of these samples, especially in the range of 1800-800 cm-1. The second derivative transformation and alcoholic extracting procedure obviously enlarged the tiny spectral differences among these samples. The results indicated each Dendrobium species had a characteristic IR spectra profile, which could be used to discriminate them. The similarity coefficients among the samples were analyzed based on their second derivative IR spectra, which ranged from 0.7632 to 0.9700, among the seven Dendrobium species, and from 0.5163 to 0.9615, among the ethanol extracts. A dendrogram was constructed based on cluster analysis the IR spectra for studying the chemical phylogenetic relationships among the samples. The results indicated that D. denneanum and D. crepidatum could be the alternative resources to substitute D. chrysotoxum, D. officinale and D. nobile which were officially recorded in Chinese Pharmacopoeia. In conclusion, with the advantages of high resolution, speediness and convenience, the experimental approach can successfully discriminate and construct the chemical phylogenetic relationships of the seven Dendrobium species.

  4. Combination of micro-dialysis and infrared spectroscopy: a multianalyte assay for accurate biofluid analysis and patient monitoring

    Science.gov (United States)

    Vahlsing, Thorsten; Delbeck, Sven; Budde, Janpeter; Ihrig, Dieter; Heise, H. Michael

    2016-03-01

    Micro-dialysis can be used for continuously harvesting body fluids, while a multi-component analysis of the dialysates by infrared spectrometry offers splendid opportunities for monitoring substrates and metabolites such as glucose, lactate and others small enough to penetrate the semi-permeable dialysis membranes. However, a drawback of this process are variable recovery rates, which can be observed especially for subcutaneously implanted catheters in human subjects. Isotonic perfusates were investigated with acetate and mannitol as recovery markers for the dialysis of human serum at 37°C to mimic in vivo patient monitoring. The latter non-ionic substance has been suggested for application when other ionic substances such as bicarbonate or pH are also to be determined. Simultaneously for acetate and mannitol, the depletion of the marker substances from the perfusates using different micro-dialysis devices was investigated under various flow-rates. Relationships between relative dialysate marker concentrations and glucose recovery rates were determined based on multivariate calibrations. For quantification, classical least squares with reference spectra for modelling the serum dialysates was used, rendering a basis for reliable blood glucose and lactate measurements.

  5. Continuous monitoring of absolute cerebral blood flow by combining diffuse correlation spectroscopy and time-resolved near-infrared technology

    Science.gov (United States)

    Diop, Mamadou; Lee, Ting-Yim; St. Lawrence, Keith

    2011-02-01

    Continuous bedside monitoring of cerebral blood flow (CBF) in patients recovering from brain injury could improve the detection of impaired substrate delivery, which can exacerbate injury and worsen outcome. Diffuse correlation spectroscopy (DCS) provides the ability to monitor perfusion changes continuously, but it is difficult to quantify absolute blood flow - leading to uncertainties as to whether or not CBF has fallen to ischemic levels. To continuously measure CBF, we propose to calibrate DCS data using a single time-point, time-resolved near-infrared (TR-NIR) technique for measuring absolute CBF. Experiments were conducted on newborn piglets in which CBF was increased by raising the arterial tension of CO2 (40-62 mmHg) and decreased by carotid occlusion. For validation, values of CBF measured by TR-NIR were converted into blood flow changes and compared to CBF changes measured by DCS. A strong correlation between perfusion changes from the two techniques was revealed (slope = 0.98 and R2 = 0.96), suggesting that a single time-point CBF measurement by TR-NIR can be used to convert continuous DCS data into units of CBF (ml/100g/min).

  6. Combining infrared- and green-laser stimulation sources in single-grain luminescence measurements of feldspar and quartz

    Energy Technology Data Exchange (ETDEWEB)

    Duller, G.A.T. E-mail: ggd@aber.ac.uk; Boetter-Jensen, L.; Murray, A.S

    2003-10-01

    A system designed for measurement of the optically stimulated luminescence (OSL) from individual sand-sized mineral grains has been constructed. Previously, this system was equipped only with a green laser emitting at 532 nm, but now an infrared (IR) laser at 830 nm has been added. It is now possible to interchangeably use the two laser sources for optical stimulation. This is especially valuable for the measurement of feldspars. The power density using the IR laser at the grain is {approx}500 W cm{sup -2}, and stimulation for 1 s reduces the OSL signal to near background level. Initial results on grains from two feldspar samples are described. These show that the ratio of the OSL signal under green and IR stimulation is similar for all the feldspar grains. As expected, the ratio for quartz grains is very different, with a much weaker signal when using IR stimulation. For the two feldspars, the distribution of OSL between the grains and the saturation of the dose response curve shows much less variability than is typically seen for quartz grains.

  7. A combined FTIR and infrared emission spectroscopy investigation of layered double hydroxide as an effective electron donor

    Science.gov (United States)

    Zhang, Jia; Wei, Feng; Liang, Ying; Zhou, Jizhi; Xi, Yunfei; Qian, Guangren; Frost, Ray

    2016-02-01

    A novel method has been presented to characterize electron transfer in layered double hydroxides (LDHs) utilizing an investigation combing FTIR and infrared emission spectroscopy. At room temperature, electron could transfer to interlayer Fe3 + through monodentate ligand cyanide, and resulted in a reduction of 40% Fe3 + to Fe2 +. When the environmental temperature increased from 25 to 300 °C, reduction of Fe3 + and Ni2 + increased to 94% and 42%. Furthermore, electron also transferred to interlayer cation through multidentate ligand EDTA. As a result, LDHs has been proven to be an effective electron donor, and FTIR was a feasible tool in characterizing this property by monitoring the valence state of cations. It was also concluded that octahedral units with OH- groups in LDH layer functioned as electron donor centers. Driving force for electron transfer is attributed to the charge density difference between cation layer and probe anion. These results could help to explain the mechanism of various applications of LDHs in catalysis and photocatalysis.

  8. First fringes with an integrated-optics beam combiner at 10 μm. A new step towards instrument miniaturization for mid-infrared interferometry

    Science.gov (United States)

    Labadie, L.; Martín, G.; Anheier, N. C.; Arezki, B.; Qiao, H. A.; Bernacki, B.; Kern, P.

    2011-07-01

    Context. Observations of milliarcsecond-resolution scales and high dynamic range hold a central place in the exploration of distant planetary systems in order to achieve, for instance, the spectroscopic characterization of exo-Earths or the detailed mapping of their protoplanetary disc birthplace. Multi-aperture infrared interferometry, either from the ground or from space, is a very powerful technique to tackle these goals. However, significant technical efforts still need to be undertaken to achieve a simplification of these instruments if we wish to recombine the light from a large number of telescopes. Integrated-optics concepts appear to be a suitable alternative to the current conventional designs, especially if their use can be extended to a higher number of astronomical bands. Aims: This article reports, for the first time to our knowledge, the experimental demonstration of the feasibility of an integrated-optics approach to mid-infrared beam combination for single-mode stellar interferometry. Methods: We fabricated a two-telescope beam combiner prototype integrated on a substrate of chalcogenide glass, a material transparent from ~1 μm to ~14 μm. We developed laboratory tools to characterize in the mid-infrared the modal properties and the interferometric capabilities of our device. Results: We obtain interferometric fringes at 10 μm and measure a mean contrast V = 0.981 ± 0.001 with high repeatability over one week and high stability over a time-period of ~5 h. We show experimentally - as well as on the basis of modeling considerations - that the component has a single-mode behavior at this wavelength, which is essential to achieve high-accuracy interferometry. From previous studies, the propagation losses are estimated to be 0.5 dB/cm for this type of component. We also discuss possible issues that may impact the interferometric contrast. Conclusions: The IO beam combiner performs well at the tested wavelength. We also anticipate the requirement of a

  9. Effects of Temperature and Water-Filtered Infrared-A Alone or in Combination on Healthy and Glyoxal-Stressed Fibroblast Cultures

    Directory of Open Access Journals (Sweden)

    Lilla Knels

    2012-01-01

    Full Text Available Water-filtered infrared-A (wIRA radiation has been described as supportive for tissue regeneration. We sought to investigate in detail the wIRA effect at different temperatures in 3T3 fibroblasts that were treated with glyoxal to induce formation of advanced glycation end products (AGEs. Nonirradiated and nonglyoxal-treated cells served as controls. Experiments were carried out over a range of 37∘–45∘C with exact temperature monitoring to distinguish between temperature and wIRA effects. Metabolic activity was assessed by resazurin assay. Mitochondrial membrane potential was assessed by JC-1 vital staining. Apoptotic changes were determined by vital staining with annexin V and YO-PRO-1 and determination of subG1 DNA content. Temperature had a dominant effect overriding effects exerted by wIRA or glyoxal treatment. The number of apoptotic cells was significantly higher at 45∘C, while the percentage of healthy cells was significantly lower at 45∘C. WIRA irradiation itself or in combination with glyoxal treatment exerted no damaging effects on the fibroblasts at physiological (37∘–40∘C or higher (42∘–45∘C temperatures compared to untreated controls. Temperatures of 45∘C, which can occur during inappropriate application of infrared irradiation, damage cells even in the absence of wIRA or glyoxal application.

  10. Wild salmon authenticity can be predicted by 1H-NMR spectroscopy

    NARCIS (Netherlands)

    Capuano, E.; Lommen, A.; Heenan, S.P.; Dura, de la A.; Rozijn, M.; Ruth, van S.M.

    2012-01-01

    The combination of 1H NMR fingerprinting of muscle lipids from fresh and processed (frozen, canned and smoked) Atlantic salmon (Salmo salar) with supervised multivariate analysis was applied to differentiate wild and farmed fish. Soft Independent Modelling of Class Analogy (SIMCA) allowed classifica

  11. Acoustic processing of temporally modulated sounds in infants: evidence from a combined near-infrared spectroscopy and EEG study

    Directory of Open Access Journals (Sweden)

    Silke eTelkemeyer

    2011-04-01

    Full Text Available Speech perception requires rapid extraction of the linguistic content from the acoustic signal. The ability to efficiently process rapid changes in auditory information is important for decoding speech and thereby crucial during language acquisition. Investigating functional networks of speech perception in infancy might elucidate neuronal ensembles supporting perceptual abilities that gate language acquisition. Interhemispheric specializations for language have been demonstrated in infants. How these asymmetries are shaped by basic temporal acoustic properties is under debate. We recently provided evidence that newborns process non-linguistic sounds sharing temporal features with language in a differential and lateralized fashion. The present study used the same material while measuring brain responses of 6 and 3 month old infants using simultaneous recordings of electroencephalography (EEG and near-infrared spectroscopy (NIRS. NIRS reveals that the lateralization observed in newborns remains constant over the first months of life. While fast acoustic modulations elicit bilateral neuronal activations, slow modulations lead to right-lateralized responses. Additionally, auditory evoked potentials and oscillatory EEG responses show differential responses for fast and slow modulations indicating a sensitivity for temporal acoustic variations. Oscillatory responses reveal an effect of development, that is, 6 but not 3 month old infants show stronger theta-band desynchronization for slowly modulated sounds. Whether this developmental effect is due to increasing fine-grained perception for spectrotemporal sounds in general remains speculative. Our findings support the notion that a more general specialization for acoustic properties can be considered the basis for lateralization of speech perception. The results show that concurrent assessment of vascular based imaging and electrophysiological responses have great potential in the research on language

  12. 1-[(1-Methyl-1H-imidazol-5-ylmethyl]-1H-indole-5-carbonitrile

    Directory of Open Access Journals (Sweden)

    Josephus Jacobus de Jager

    2012-12-01

    Full Text Available In the title compound, C14H12N4, the dihedral angle between the indole ring system (r.m.s. deviation = 0.010 Å and the imidazole ring is 77.70 (6°. In the crystal, molecules are linked by C—H...N hydrogen bonds. One set of hydrogen bonds forms an undulating chain running parallel to the b-axis direction, while the other undulating chain is parallel to the c-axis direction. In combination, (100 sheets result.

  13. Effect of different flours on quality of legume cakes to be baked in microwave-infrared combination oven and conventional oven.

    Science.gov (United States)

    Ozkahraman, Betul Canan; Sumnu, Gulum; Sahin, Serpil

    2016-03-01

    The objective of this study was to compare the quality of legume cakes baked in microwave-infrared combination (MW-IR) oven with conventional oven. Legume cake formulations were developed by replacing 10 % wheat flour by lentil, chickpea and pea flour. As a control, wheat flour containing cakes were used. Weight loss, specific volume, texture, color, gelatinization degree, macro and micro-structure of cakes were investigated. MW-IR baked cakes had higher specific volume, weight loss and crust color change and lower hardness values than conventionally baked cakes. Larger pores were observed in MW-IR baked cakes according to scanning electron microscope (SEM) images. Pea flour giving the hardest structure, lowest specific volume and gelatinization degree was determined to be the least acceptable legume flour. On the other hand, lentil and chickpea flour containing cakes had the softest structure and highest specific volume showing that lentil and chickpea flour can be used to produce functional cakes.

  14. Combination of synchrotron radiation-based Fourier transforms infrared microspectroscopy and confocal laser scanning microscopy to understand spatial heterogeneity in aquatic multispecies biofilms.

    Science.gov (United States)

    Reuben, Sheela; Banas, Krzysztof; Banas, Agnieszka; Swarup, Sanjay

    2014-11-01

    Understanding the spatial heterogeneity within environmental biofilms can provide an insight into compartmentalization of different functions in biofilm communities. We used a non-destructive and label-free method by combining Synchrotron Radiation-based Fourier Transform Infrared Microspectroscopy (SR-FTIR) with Confocal Laser Scanning Microscopy (CLSM) to distinguish the spatial chemical changes within multispecies biofilms grown from natural storm waters in flow cells. Among the different surfaces tested for biofilm growth and optimal imaging, mylar membranes were most suited and it enabled successful spatial infrared imaging of natural biofilms for obtaining reliable and interpretable FTIR spectra. Time series analysis of biofilm growth showed that influx of water during biofilm growth, results in significant changes in biofilm formation. Early biofilms showed active nutrient acquisition and desiccation tolerance mechanisms corresponding with accumulation of secreted proteins. Statistical approach used for the evaluation of chemical spectra allowed for clustering and classification of various regions of the biofilm. Microheterogeneity was observed in the polymeric components of the biofilm matrix, including cellulose, glycocalyx and dextran-like molecules. Fructan and glycan-rich regions were distinguishable and glycocalyx was abundant in the strongly adhering peripheral regions of biofilms. Inner core showed coexistence of oxygen dimers and ferrihydrite that will likely support growth of Fe (II)-oxidising bacteria. The combined SR-FTIR microspectroscopy and CSLM approach for complex natural biofilms described here will be useful both in understanding heterogeneity of matrix components and in correlating functions of juxtaposed microbial species in complex natural biofilms with physicochemical microenvironment to which they are exposed.

  15. Rapid Classification of Turmeric Based on DNA Fingerprint by Near-Infrared Spectroscopy Combined with Moving Window Partial Least Squares-Discrimination Analysis.

    Science.gov (United States)

    Kasemsumran, Sumaporn; Suttiwijitpukdee, Nattaporn; Keeratinijakal, Vichein

    2017-01-01

    In this research, near-infrared (NIR) spectroscopy in combination with moving window partial least squares-discrimination analysis (MWPLS-DA) was utilized to discriminate the variety of turmeric based on DNA markers, which correlated to the quantity of curcuminoid. Curcuminoid was used as a marker compound in variety identification due to the most pharmacological properties of turmeric possessed from it. MWPLS-DA optimized informative NIR spectral regions for the fitting and prediction to {-1/1}-coded turmeric varieties, indicating variables in the development of latent variables in discrimination analysis. Consequently, MWPLS-DA benefited in the selection of combined informative NIR spectral regions of 1100 - 1260, 1300 - 1500 and 1880 - 2500 nm for classification modeling of turmeric variety with 148 calibration samples, and yielded the results better than that obtained from a partial least squares-discrimination analysis (PLS-DA) model built by using the whole NIR spectral region. An effective and rapid strategy of using NIR in combination with MWPLS-DA provided the best variety identification results of 100% in both specificity and total accuracy for 48 test samples.

  16. Discrimination of cultivation ages and cultivars of ginseng leaves using Fourier transform infrared spectroscopy combined with multivariate analysis

    Science.gov (United States)

    Kwon, Yong-Kook; Ahn, Myung Suk; Park, Jong Suk; Liu, Jang Ryol; In, Dong Su; Min, Byung Whan; Kim, Suk Weon

    2013-01-01

    To determine whether Fourier transform (FT)-IR spectral analysis combined with multivariate analysis of whole-cell extracts from ginseng leaves can be applied as a high-throughput discrimination system of cultivation ages and cultivars, a total of total 480 leaf samples belonging to 12 categories corresponding to four different cultivars (Yunpung, Kumpung, Chunpung, and an open-pollinated variety) and three different cultivation ages (1 yr, 2 yr, and 3 yr) were subjected to FT-IR. The spectral data were analyzed by principal component analysis and partial least squares-discriminant analysis. A dendrogram based on hierarchical clustering analysis of the FT-IR spectral data on ginseng leaves showed that leaf samples were initially segregated into three groups in a cultivation age-dependent manner. Then, within the same cultivation age group, leaf samples were clustered into four subgroups in a cultivar-dependent manner. The overall prediction accuracy for discrimination of cultivars and cultivation ages was 94.8% in a cross-validation test. These results clearly show that the FT-IR spectra combined with multivariate analysis from ginseng leaves can be applied as an alternative tool for discriminating of ginseng cultivars and cultivation ages. Therefore, we suggest that this result could be used as a rapid and reliable F1 hybrid seed-screening tool for accelerating the conventional breeding of ginseng. PMID:24558311

  17. {sup 1}H MR spectroscopic patterns of normal adult brain

    Energy Technology Data Exchange (ETDEWEB)

    Song, In Chan; Chang, Kee Hyun; Min, Kwan Hong; Kim, Dong Sung; Han, Moon Hee; Kang, Sa Ouk; Min, Byoung Goo; Han, Man Chung [Seoul National Univ. College of Medicine, Seoul (Korea, Republic of)

    1996-10-01

    To evaluate regional differences of {sup 1}H magnetic resonance(MR) spectral patterns in normal adult human brains. A total of 44 {sup 1}H MR spectra in 25 volunteers aged 27-45 were obtained in five regions including the frontal lobe(10), parietal lobe(10), temporal lobe(5), basal ganglia(10) and thalamus(9). {sup 1}H MR spectroscopy(MRS) was performed using a PRESS sequence with a TR of 2000 ms and a TE of 270ms from a volume of cm on a 1.5T clinical MR unit. Relative metabolite ratios of NAA/Cho, NAA/Cr and Cr/Cho in each region were measured and compared. A total of 44 reliable spectra were successfully obtained in all regions. NAA/Cho, NAA/Cr and Cr/Cho ratios varied considerably, ranging from 1.09{+-}0.2 to 2.46{+-}0.25, from 1.72{+-}0.35 to 2.45{+-}0.25 and from 0.64{+-}0.1 to 1.01{+-}0.12, respectively. Significant regional differences in metabolite ratios were observed; higher NAA/Cho and NAA/Cr ratios in the parietal lobe, lower NAA/Cho ratios in the temporal lobe, and lower Cr/Cho ratios in the temporal lobe compared to those of other regions(p<0.05). Differences in metabolite ratios between the right and left frontal lobes, and between the right and left basal ganglias were not significant. {sup 1}H MR spectra of the normal adult human brains using in vivo single voxel {sup 1}H MRS represented significant regional differences in metabolite ratios of NAA/Cho, NAA/Cr and Cr/Cho. Our {sup 1}H MR spectroscopic results are a useful reference for assessing the {sup 1}H MRS pattern of various intracranial diseases.

  18. Following Metabolism in Living Microorganisms by Hyperpolarized (1)H NMR.

    Science.gov (United States)

    Dzien, Piotr; Fages, Anne; Jona, Ghil; Brindle, Kevin M; Schwaiger, Markus; Frydman, Lucio

    2016-09-21

    Dissolution dynamic nuclear polarization (dDNP) is used to enhance the sensitivity of nuclear magnetic resonance (NMR), enabling monitoring of metabolism and specific enzymatic reactions in vivo. dDNP involves rapid sample dissolution and transfer to a spectrometer/scanner for subsequent signal detection. So far, most biologically oriented dDNP studies have relied on hyperpolarizing long-lived nuclear spin species such as (13)C in small molecules. While advantages could also arise from observing hyperpolarized (1)H, short relaxation times limit the utility of prepolarizing this sensitive but fast relaxing nucleus. Recently, it has been reported that (1)H NMR peaks in solution-phase experiments could be hyperpolarized by spontaneous magnetization transfers from bound (13)C nuclei following dDNP. This work demonstrates the potential of this sensitivity-enhancing approach to probe the enzymatic process that could not be suitably resolved by (13)C dDNP MR. Here we measured, in microorganisms, the action of pyruvate decarboxylase (PDC) and pyruvate formate lyase (PFL)-enzymes that catalyze the decarboxylation of pyruvate to form acetaldehyde and formate, respectively. While (13)C NMR did not possess the resolution to distinguish the starting pyruvate precursor from the carbonyl resonances in the resulting products, these processes could be monitored by (1)H NMR at 500 MHz. These observations were possible in both yeast and bacteria in minute-long kinetic measurements where the hyperpolarized (13)C enhanced, via (13)C → (1)H cross-relaxation, the signals of protons binding to the (13)C over the course of enzymatic reactions. In addition to these spontaneous heteronuclear enhancement experiments, single-shot acquisitions based on J-driven (13)C → (1)H polarization transfers were also carried out. These resulted in higher signal enhancements of the (1)H resonances but were not suitable for multishot kinetic studies. The potential of these (1)H-based approaches for

  19. Infrared absorption spectroscopy of the CO2-Ar complex in the 2376 cm - 1 combination band region: The intermolecular bend

    Science.gov (United States)

    Sharpe, S. W.; Reifschneider, D.; Wittig, C.; Beaudet, R. A.

    1991-01-01

    The rovibrational absorption spectrum of CO2-Ar has been recorded in the 2376 cm-1 region by using a pulsed, slit nozzle expansion and tunable IR diode laser. The spectrum is ascribed to the 410510 combination band, where ν4 corresponds to the asymmetric stretch of the CO2 moiety and ν5 is the intermolecular bend. This combination band is ˜102 times less intense and 27.82 cm-1 higher in energy than the 410 fundamental. Effective upper-state rotational constants were determined for this nearly prolate rotor, and the ν4+ν5 moments of inertia show a large inertial defect, Δ=9.48 amu Å2. In planar molecules, this indicates large vibrational amplitude, and reflects inadequacy of the rotational Hamiltonian. From the moments of inertia derived using a Watson Hamiltonian, geometric properties of ν4+ν5 can be calculated. The average O-C-Ar angle is 76.9°, while the center-of-mass separation between CO2 and Ar is 3.60 Å. These values differ from those of the ground state (83.1° and 3.51 Å) and ν4=1 (83.0° and 3.50 Å). Results are compared with previous work, which used different models and approximations to obtain intermolecular frequencies. In addition, inertial defects were calculated for the ground and vibrationally excited states using a simple normal mode model developed by Herschbach and Laurie, and Oka and Morino. With harmonic force fields, it accounts for most of the inertial defect in the ground and excited states, and yields reasonable R and θ values. However, we conclude that the good agreement between experimental and calculated inertial defects may be fortuitous, since several positive and negative contributions cancel.

  20. Combined photothermal-chemotherapy of breast cancer by near infrared light responsive hyaluronic acid-decorated nanostructured lipid carriers

    Science.gov (United States)

    Zheng, Shaohui; Du Nguyen, Van; Song, Seung Yoon; Han, Jiwon; Park, Jong-Oh

    2017-10-01

    In this study, a novel type of hyaluronic acid (HA)-decorated nanostructured lipid carrier (NLC) was prepared and investigated as a light-triggered drug release and combined photothermal-chemotherapy for cancer treatment. Polyhedral gold nanoparticles (Au NPs) with an average size of 10 nm were synthesized and co-encapsulated with doxorubicin (DOX) in the matrix of NLCs with a high drug loading efficiency (above 80%). HA decoration was achieved by the electrostatic interaction between HA and CTAB on the NLC surface. A remarkable temperature increase was observed by exposing the Au NP-loaded NLCs to an NIR laser, which heated the samples sufficiently (above 40 °C) to kill tumor cells. The entrapped DOX exhibited a sustained, stepwise NIR laser-triggered drug release pattern. The biocompatibility of the NLCs was investigated by MTT assay and the cell viability was maintained above 85%, even at high concentrations. The intracellular uptake of free DOX and entrapped DOX, observed by confocal microscopy, revealed two distinct uptake mechanisms, i.e. passive diffusion and endocytosis, respectively. In particular, internalization of the HA-Au-DOX-NLCs was more extensively enhanced than the Au-DOX-NLCs, which was attributed to HA-CD44 receptor-mediated endocytosis. Meanwhile, the internalized NLCs successfully escaped from the lysosomes, increasing the intracellular DOX. The HA-Au-DOX-NLCs IC50 value decreased from 2.3 to 0.6 μg ml‑1 with NIR irradiation at 72 h, indicating the excellent synergistic antitumor effect of photothermal-chemotherapy. The photothermal ablation was further confirmed by a live/dead cell staining assay. Thus, a combined photothermal-chemotherapy approach has been proposed as a promising strategy for cancer treatment.

  1. Combining Lactic Acid Spray with Near-Infrared Radiation Heating To Inactivate Salmonella enterica Serovar Enteritidis on Almond and Pine Nut Kernels.

    Science.gov (United States)

    Ha, Jae-Won; Kang, Dong-Hyun

    2015-07-01

    The aim of this study was to investigate the efficacy of near-infrared radiation (NIR) heating combined with lactic acid (LA) sprays for inactivating Salmonella enterica serovar Enteritidis on almond and pine nut kernels and to elucidate the mechanisms of the lethal effect of the NIR-LA combined treatment. Also, the effect of the combination treatment on product quality was determined. Separately prepared S. Enteritidis phage type (PT) 30 and non-PT 30 S. Enteritidis cocktails were inoculated onto almond and pine nut kernels, respectively, followed by treatments with NIR or 2% LA spray alone, NIR with distilled water spray (NIR-DW), and NIR with 2% LA spray (NIR-LA). Although surface temperatures of nuts treated with NIR were higher than those subjected to NIR-DW or NIR-LA treatment, more S. Enteritidis survived after NIR treatment alone. The effectiveness of NIR-DW and NIR-LA was similar, but significantly more sublethally injured cells were recovered from NIR-DW-treated samples. We confirmed that the enhanced bactericidal effect of the NIR-LA combination may not be attributable to cell membrane damage per se. NIR heat treatment might allow S. Enteritidis cells to become permeable to applied LA solution. The NIR-LA treatment (5 min) did not significantly (P > 0.05) cause changes in the lipid peroxidation parameters, total phenolic contents, color values, moisture contents, and sensory attributes of nut kernels. Given the results of the present study, NIR-LA treatment may be a potential intervention for controlling food-borne pathogens on nut kernel products.

  2. Nontargeted, Rapid Screening of Extra Virgin Olive Oil Products for Authenticity Using Near-Infrared Spectroscopy in Combination with Conformity Index and Multivariate Statistical Analyses.

    Science.gov (United States)

    Karunathilaka, Sanjeewa R; Kia, Ali-Reza Fardin; Srigley, Cynthia; Chung, Jin Kyu; Mossoba, Magdi M

    2016-10-01

    A rapid tool for evaluating authenticity was developed and applied to the screening of extra virgin olive oil (EVOO) retail products by using Fourier-transform near infrared (FT-NIR) spectroscopy in combination with univariate and multivariate data analysis methods. Using disposable glass tubes, spectra for 62 reference EVOO, 10 edible oil adulterants, 20 blends consisting of EVOO spiked with adulterants, 88 retail EVOO products and other test samples were rapidly measured in the transmission mode without any sample preparation. The univariate conformity index (CI) and the multivariate supervised soft independent modeling of class analogy (SIMCA) classification tool were used to analyze the various olive oil products which were tested for authenticity against a library of reference EVOO. Better discrimination between the authentic EVOO and some commercial EVOO products was observed with SIMCA than with CI analysis. Approximately 61% of all EVOO commercial products were flagged by SIMCA analysis, suggesting that further analysis be performed to identify quality issues and/or potential adulterants. Due to its simplicity and speed, FT-NIR spectroscopy in combination with multivariate data analysis can be used as a complementary tool to conventional official methods of analysis to rapidly flag EVOO products that may not belong to the class of authentic EVOO. Published 2016. This article is a U.S. Government work and is in the public domain in the USA.

  3. Determination of alcohol and extract concentration in beer samples using a combined method of near-infrared (NIR) spectroscopy and refractometry.

    Science.gov (United States)

    Castritius, Stefan; Kron, Alexander; Schäfer, Thomas; Rädle, Matthias; Harms, Diedrich

    2010-12-22

    A new approach of combination of near-infrared (NIR) spectroscopy and refractometry was developed in this work to determine the concentration of alcohol and real extract in various beer samples. A partial least-squares (PLS) regression, as multivariate calibration method, was used to evaluate the correlation between the data of spectroscopy/refractometry and alcohol/extract concentration. This multivariate combination of spectroscopy and refractometry enhanced the precision in the determination of alcohol, compared to single spectroscopy measurements, due to the effect of high extract concentration on the spectral data, especially of nonalcoholic beer samples. For NIR calibration, two mathematical pretreatments (first-order derivation and linear baseline correction) were applied to eliminate light scattering effects. A sample grouping of the refractometry data was also applied to increase the accuracy of the determined concentration. The root mean squared errors of validation (RMSEV) of the validation process concerning alcohol and extract concentration were 0.23 Mas% (method A), 0.12 Mas% (method B), and 0.19 Mas% (method C) and 0.11 Mas% (method A), 0.11 Mas% (method B), and 0.11 Mas% (method C), respectively.

  4. Combined effect of using near-infrared spectroscopy for nutritional evaluation of feed ingredients and non-starch polysaccharide carbohydrase complex on performance of broiler chickens.

    Science.gov (United States)

    Montanhini Neto, Roberto; N'Guetta, Eric; Gady, Cecile; Francesch, Maria; Preynat, Aurélie

    2017-07-19

    This study was carried out to evaluate the combined effect of using near-infrared spectroscopy (NIRS) for nutritional evaluation of feed ingredients and the addition of non-starch polysaccharide carbohydrase complex (NSP enzymes) on the growth performance of broilers fed diets produced with low-quality wheat and soybean meal. A 2 × 2 trial design was performed, with seven replicates of 40 male Ross 308 broilers per treatment, evaluating the effect of the addition of NSP enzymes and the ingredients' nutritional matrix based on table values or NIRS values. Diets without added enzymes were formulated to reach nutritional requirements, whereas diets with enzymes were reformulated, reducing the apparent metabolizable energy (AME) by 85 kcal/kg. In the overall period (days 0-35), broilers fed diets formulated using NIRS values had higher (P nutritional approaches are efficient in improving broilers' performances by themselves and even more so when they are combined. © 2017 Japanese Society of Animal Science.

  5. Determination of the degree of degradation of frying rapeseed oil using fourier-transform infrared spectroscopy combined with partial least-squares regression.

    Science.gov (United States)

    Chen, Jie Yu; Zhang, Han; Ma, Jinkui; Tuchiya, Tomohiro; Miao, Yelian

    2015-01-01

    This rapid method for determining the degree of degradation of frying rapeseed oils uses Fourier-transform infrared (FTIR) spectroscopy combined with partial least-squares (PLS) regression. One hundred and fifty-six frying oil samples that degraded to different degrees by frying potatoes were scanned by an FTIR spectrometer using attenuated total reflectance (ATR). PLS regression with full cross validation was used for the prediction of acid value (AV) and total polar compounds (TPC) based on raw, first, and second derivative FTIR spectra (4000-650 cm(-1)). The precise calibration model based on the second derivative FTIR spectra shows that the coefficients of determination for calibration (R (2)) and standard errors of cross validation (SECV) were 0.99 and 0.16 mg KOH/g and 0.98 and 1.17% for AV and TPC, respectively. The accuracy of the calibration model, tested using the validation set, yielded standard errors of prediction (SEP) of 0.16 mg KOH/g and 1.10% for AV and TPC, respectively. Therefore, the degradation of frying oils can be accurately measured using FTIR spectroscopy combined with PLS regression.

  6. Quantifying stream thermal regimes at management-pertinent scales: combining thermal infrared and stationary stream temperature data in a novel modeling framework.

    Science.gov (United States)

    Vatland, Shane J.; Gresswell, Robert E.; Poole, Geoffrey C.

    2015-01-01

    Accurately quantifying stream thermal regimes can be challenging because stream temperatures are often spatially and temporally heterogeneous. In this study, we present a novel modeling framework that combines stream temperature data sets that are continuous in either space or time. Specifically, we merged the fine spatial resolution of thermal infrared (TIR) imagery with hourly data from 10 stationary temperature loggers in a 100 km portion of the Big Hole River, MT, USA. This combination allowed us to estimate summer thermal conditions at a relatively fine spatial resolution (every 100 m of stream length) over a large extent of stream (100 km of stream) during during the warmest part of the summer. Rigorous evaluation, including internal validation, external validation with spatially continuous instream temperature measurements collected from a Langrangian frame of reference, and sensitivity analyses, suggests the model was capable of accurately estimating longitudinal patterns in summer stream temperatures for this system Results revealed considerable spatial and temporal heterogeneity in summer stream temperatures and highlighted the value of assessing thermal regimes at relatively fine spatial and temporal scales. Preserving spatial and temporal variability and structure in abiotic stream data provides a critical foundation for understanding the dynamic, multiscale habitat needs of mobile stream organisms. Similarly, enhanced understanding of spatial and temporal variation in dynamic water quality attributes, including temporal sequence and spatial arrangement, can guide strategic placement of monitoring equipment that will subsequently capture variation in environmental conditions directly pertinent to research and management objectives.

  7. On-line monitoring of extraction process of Flos Lonicerae Japonicae using near infrared spectroscopy combined with synergy interval PLS and genetic algorithm

    Science.gov (United States)

    Yang, Yue; Wang, Lei; Wu, Yongjiang; Liu, Xuesong; Bi, Yuan; Xiao, Wei; Chen, Yong

    2017-07-01

    There is a growing need for the effective on-line process monitoring during the manufacture of traditional Chinese medicine to ensure quality consistency. In this study, the potential of near infrared (NIR) spectroscopy technique to monitor the extraction process of Flos Lonicerae Japonicae was investigated. A new algorithm of synergy interval PLS with genetic algorithm (Si-GA-PLS) was proposed for modeling. Four different PLS models, namely Full-PLS, Si-PLS, GA-PLS, and Si-GA-PLS, were established, and their performances in predicting two quality parameters (viz. total acid and soluble solid contents) were compared. In conclusion, Si-GA-PLS model got the best results due to the combination of superiority of Si-PLS and GA. For Si-GA-PLS, the determination coefficient (Rp2) and root-mean-square error for the prediction set (RMSEP) were 0.9561 and 147.6544 μg/ml for total acid, 0.9062 and 0.1078% for soluble solid contents, correspondingly. The overall results demonstrated that the NIR spectroscopy technique combined with Si-GA-PLS calibration is a reliable and non-destructive alternative method for on-line monitoring of the extraction process of TCM on the production scale.

  8. Combined study of evaporation from liquid surface by background oriented schlieren, infrared thermal imaging and numerical simulation

    Directory of Open Access Journals (Sweden)

    Plaksina Yu.Yu.

    2013-04-01

    Full Text Available Temperature fields in evaporating liquids are measured by simultaneous use of Background Oriented Schlieren (BOS technique for the side view and IR thermal imaging for the surface distribution. Good agreement between the two methods is obtained with typical measurement error less than 0.1 K. Two configurations of surface layer are observed: thermocapillary convection state with moving liquid surface and small thermal cells, associated with Marangoni convection, and “cool skin” with negligible velocity at the surface, larger cells and dramatic increase of velocity within 0.1 mm layer beneath the surface. These configurations are shown to be formed in various liquids (water with various degrees of purification, ethanol, butanol, decane, kerosene, glycerine depending rather on initial conditions and ambient parameters than on the liquid. Water, which has been considered as the liquid without observable Marangoni convection, actually can exhibit both kinds of behavior during the same experimental run. Evaporation is also studied by means of numerical simulations. Separate problemsin air and liquid are considered, with thermal imaging data of surface temperature making the separation possible. It is shown that evaporation rate can be predicted by numerical simulation of the air side with appropriate boundary conditions. Comparison is made with known empirical correlations for Sherwood-Rayleigh relationship. Numerical simulations of water-side problem reveal the issue of velocity boundary conditions at the free surface, determining the structure of surface layer. Flow field similar to observed in the experiments is obtained with special boundary conditions of third kind, presenting a combination of no-slip and surface tension boundary conditions.

  9. Near infrared spectroscopy combined with chemometrics for growth stage classification of cannabis cultivated in a greenhouse from seized seeds

    Science.gov (United States)

    Borille, Bruna Tassi; Marcelo, Marcelo Caetano Alexandre; Ortiz, Rafael Scorsatto; Mariotti, Kristiane de Cássia; Ferrão, Marco Flôres; Limberger, Renata Pereira

    2017-02-01

    Cannabis sativa L. (cannabis, Cannabaceae), popularly called marijuana, is one of the oldest plants known to man and it is the illicit drug most used worldwide. It also has been the subject of increasing discussions from the scientific and political points of view due to its medicinal properties. In recent years in Brazil, the form of cannabis drug trafficking has been changing and the Brazilian Federal Police has exponentially increased the number of seizures of cannabis seeds sent by the mail. This new form of trafficking encouraged the study of cannabis seeds seized germinated in a greenhouse through NIR spectroscopy combined with chemometrics. The plants were cultivated in a homemade greenhouse under controlled conditions. In three different growth periods (5.5 weeks, 7.5 weeks and 10 weeks), they were harvested, dried, ground and directly analyzed. The iPCA was used to select the best NIR spectral range (4000-4375 cm- 1) in order to develop unsupervised and supervised methods. The PCA and HCA showed a good separation between the three groups of cannabis samples at different growth stages. The PLS-DA and SVM-DA classified the samples with good results in terms of sensitivity and specificity. The sensitivity and specificity for SVM-DA classification were equal to unity. This separation may be due to the correlation of cannabinoids and volatile compounds concentration during the growth of the cannabis plant. Therefore, the growth stage of cannabis can be predicted by NIR spectroscopy and chemometric tools in the early stages of indoor cannabis cultivation.

  10. Quantitative analysis of norfloxacin by 1H NMR and HPLC.

    Science.gov (United States)

    Frackowiak, Anita; Kokot, Zenon J

    2012-01-01

    1H NMR and developed previously HPLC methods were applied to quantitative determination of norfloxacin in veterinary solution form for pigeon. Changes in concentration can lead to significant changes in the 1H chemical shifts of non-exchangeable aromatic protons as a result of extensive self-association phenomena. This chemical shift variation of protons was analyzed and applied in the quantitative determination of norfloxacin. The method is simple, rapid, precise and accurate, and can be used for quality control of this drug.

  11. Evaluation of the degree of mixing of combinations of dry syrup, powder, and fine granule products in consideration of particle size distribution using near infrared spectrometry.

    Science.gov (United States)

    Yamamoto, Yoshihisa; Suzuki, Toyofumi; Matsumoto, Mika; Ohtani, Michiteru; Hayano, Shuichi; Fukami, Toshiro; Tomono, Kazuo

    2012-01-01

    We used near infrared (NIR) spectroscopy to evaluate the degree of mixing of blended dry syrup (DS) products whose particle sizes are not specified in the Revised 16th Edition of the Japanese Pharmacopoeia, and also evaluated the degree of mixing when powder products or fine granule products were added to DS products. The data obtained were used to investigate the relationship between the particle size distributions of the products studied and the degree of mixing. We found that the particle size distribution characteristics of the 15 DS products studied can be broadly classified into 5 types. Combinations of frequently prescribed products were selected to represent 4 of the 5 particle size distribution types and were blended with a mortar and pestle. The coefficient of variation (CV) decreased as the percent mass of Asverin® Dry Syrup 2% (Asverin-DS) increased in blends of Periactin® Powder 1% (Periactin) and Asverin-DS, indicating an improved degree of mixing (uniformity). In contrast, in blends of Periactin and Mucodyne® DS 33.3%, mixing a combination at a 1:1 mass ratio 40 times resulted in a CV of 20%. Other mixing frequencies and mass ratios resulted in a CV by 50% to 70%, indicating a very poor degree of mixing (poor uniformity). These results suggest that when combining different DSs, or a DS with a powder or fine granule product, the blending obtained with a mortar and pestle improves as the particle size distributions of the components approach each other and as the ranges of the distributions narrow.

  12. High resolution infrared and Raman spectra of {sup 13}C{sup 12}CD{sub 2}: The CD stretching fundamentals and associated combination and hot bands

    Energy Technology Data Exchange (ETDEWEB)

    Di Lonardo, G.; Fusina, L., E-mail: luciano.fusina@unibo.it; Canè, E.; Tamassia, F. [Dipartimento di Chimica Industriale “Toso Montanari,” Università di Bologna, Viale Risorgimento 4, I-40136 Bologna (Italy); Martínez, R. Z.; Bermejo, D. [Instituto de Estructura de la Materia, IEM-CSIC, Serrano 123, 28006 Madrid (Spain)

    2015-09-07

    Infrared and Raman spectra of mono {sup 13}C fully deuterated acetylene, {sup 13}C{sup 12}CD{sub 2}, have been recorded and analysed to obtain detailed information on the C—D stretching fundamentals and associated combination, overtone, and hot bands. Infrared spectra were recorded at an instrumental resolution ranging between 0.006 and 0.01 cm{sup −1} in the region 1800–7800 cm{sup −1}. Sixty new bands involving the ν{sub 1} and ν{sub 3} C—D stretching modes also associated with the ν{sub 4} and ν{sub 5} bending vibrations have been observed and analysed. In total, 5881 transitions have been assigned in the investigated spectral region. In addition, the Q branch of the ν{sub 1} fundamental was recorded using inverse Raman spectroscopy, with an instrumental resolution of about 0.003 cm{sup −1}. The transitions relative to each stretching mode, i.e., the fundamental band, its first overtone, and associated hot and combination bands involving bending states with υ{sub 4} + υ{sub 5} up to 2 were fitted simultaneously. The usual Hamiltonian appropriate to a linear molecule, including vibration and rotation l-type and the Darling–Dennison interaction between υ{sub 4} = 2 and υ{sub 5} = 2 levels associated with the stretching states, was adopted for the analysis. The standard deviation for each global fit is ≤0.0004 cm{sup −1}, of the same order of magnitude of the measurement precision. Slightly improved parameters for the bending and the ν{sub 2} manifold have been also determined. Precise values of spectroscopic parameters deperturbed from the resonance interactions have been obtained. They provide quantitative information on the anharmonic character of the potential energy surface, which can be useful, in addition to those reported in the literature, for the determination of a general anharmonic force field for the molecule. Finally, the obtained values of the Darling–Dennison constants can be valuable for understanding energy flows

  13. Metabolite Characterization in Peritoneal Dialysis Effluent Using High-resolution 1H and 1H-13C NMR Spectroscopy

    CERN Document Server

    Guleria, Anupam; Rawat, Atul; Khetrapal, C L; Prasad, Narayan; Kumar, Dinesh

    2014-01-01

    Metabolite analysis of peritoneal dialysis (PD) effluent may provide information regarding onset and progression of complications associated with prolonged PD therapy. In this context, the NMR detectable small metabolites of PD effluent samples were characterized using high resolution 1H and 1H-13C NMR spectroscopy. The various spectra were recorded (at 800 MHz proton frequency) on PD effluent samples obtained after 4 hour (intraperitoneal) dwell time from patients with end stage renal failure (ESRF) and continuing normally on PD therapy. Inspite of devastating spectral feature of PD effluent due to the presence of intense resonances from glucose and lactate, we were able to identify about 53 small endogenous metabolites (including many complex coupled spin systems) and more than 90 % of the total CH cross peaks of 1H-13C HSQC spectrum were identified specific to various metabolites of PD effluent. We foresee that the characteristic fingerprints of various metabolites of control PD effluent samples will be us...

  14. Nuclear receptor NR1H3 in familial multiple sclerosis

    Science.gov (United States)

    Wang, Zhe; Sadovnick, A. Dessa; Traboulsee, Anthony L.; Ross, Jay P.; Bernales, Cecily Q.; Encarnacion, Mary; Yee, Irene M.; de Lemos, Madonna; Greenwood, Talitha; Lee, Joshua D.; Wright, Galen; Ross, Colin J.; Zhang, Si; Song, Weihong; Vilariño-Güell, Carles

    2016-01-01

    SUMMARY Multiple sclerosis (MS) is an inflammatory disease characterized by myelin loss and neuronal dysfunction. Despite the aggregation observed in some families, pathogenic mutations have remained elusive. In this study we describe the identification of NR1H3 p.Arg415Gln in seven MS patients from two multi-incident families presenting severe and progressive disease, with an average age at onset of 34 years. Additionally, association analysis of common variants in NR1H3 identified rs2279238 conferring a 1.35-fold increased risk of developing progressive MS. The p.Arg415Gln position is highly conserved in orthologs and paralogs, and disrupts NR1H3 heterodimerization and transcriptional activation of target genes. Protein expression analysis revealed that mutant NR1H3 (LXRA) alters gene expression profiles, suggesting a disruption in transcriptional regulation as one of the mechanisms underlying MS pathogenesis. Our study indicates that pharmacological activation of LXRA or its targets may lead to effective treatments for the highly debilitating and currently untreatable progressive phase of MS. PMID:27253448

  15. 1H and 13C NMR study of perdeuterated pyrazoles

    OpenAIRE

    Jimeno, María Luisa; Jagerovic, Nadine; Elguero, José; Junk, Thomas; Catallo, W. James

    1997-01-01

    The 1H and 13C chemical shifts as well as the 1H–2H and 2H–13C coupling constants of perdeuterated 3,5-dimethylpyrazole and 3,5-diphenylpyrazole have been measured and the values compared with those of the unlabelled compounds.

  16. Characterization of ancient glass excavated in Enez (Ancient Ainos) Turkey by combined Instrumental Neutron Activation Analysis and Fourier Transform Infrared spectrometry techniques

    Energy Technology Data Exchange (ETDEWEB)

    Akyuz, Sevim, E-mail: s.akyuz@iku.edu.tr [Physics Department, Science and Letters Faculty, Istanbul Kultur University, Atakoy Campus, Bakirkoy 34156, Istanbul (Turkey); Akyuz, Tanil [Physics Department, Science and Letters Faculty, Istanbul Kultur University, Atakoy Campus, Bakirkoy 34156, Istanbul (Turkey); Mukhamedshina, Nuranya M.; Mirsagatova, A. Adiba [Institute of Nuclear Physics, Uzbek Academy of Sciences, 702132, Ulugbek, Tashkent (Uzbekistan); Basaran, Sait; Cakan, Banu [Department of Restoration and Conservation of Artefacts, Letters Faculty, Istanbul University, Vezneciler, Istanbul (Turkey)

    2012-05-15

    Ancient glass fragments excavated in the archaeological district Enez (Ancient Ainos)-Turkey were investigated by combined Instrumental Neutron Activation Analysis (INAA) and Fourier Transform Infrared (FTIR) spectrometry techniques. Multi-elemental contents of 15 glass fragments that belong to Hellenistic, Roman, Byzantine, and Ottoman Periods, were determined by INAA. The concentrations of twenty six elements (Na, K, Ca, Sc, Cr, Mn, Fe, Co, Cu, Zn, As, Rb, Sr, Sb, Cs, Ba, Ce, Sm, Eu, Tb, Yb, Lu, Hf, Ta, Au and Th), which might be present in the samples as flux, stabilizers, colorants or opacifiers, and impurities, were examined. Chemometric treatment of the INAA data was performed and principle component analysis revealed presence of 3 distinct groups. The thermal history of the glass samples was determined by FTIR spectrometry. - Highlights: Black-Right-Pointing-Pointer INAA was performed to determine elemental compositions of ancient glass fragments. Black-Right-Pointing-Pointer Basic, coloring/discoloring elements and impurities have been determined. Black-Right-Pointing-Pointer PCA discriminated the glasses depending on their chronological order. Black-Right-Pointing-Pointer The thermal history of the glass samples was determined by FTIR spectrometry.

  17. Detection of melamine in milk powders using near-infrared hyperspectral imaging combined with regression coefficient of partial least square regression model.

    Science.gov (United States)

    Lim, Jongguk; Kim, Giyoung; Mo, Changyeun; Kim, Moon S; Chao, Kuanglin; Qin, Jianwei; Fu, Xiaping; Baek, Insuck; Cho, Byoung-Kwan

    2016-05-01

    Illegal use of nitrogen-rich melamine (C3H6N6) to boost perceived protein content of food products such as milk, infant formula, frozen yogurt, pet food, biscuits, and coffee drinks has caused serious food safety problems. Conventional methods to detect melamine in foods, such as Enzyme-linked immunosorbent assay (ELISA), High-performance liquid chromatography (HPLC), and Gas chromatography-mass spectrometry (GC-MS), are sensitive but they are time-consuming, expensive, and labor-intensive. In this research, near-infrared (NIR) hyperspectral imaging technique combined with regression coefficient of partial least squares regression (PLSR) model was used to detect melamine particles in milk powders easily and quickly. NIR hyperspectral reflectance imaging data in the spectral range of 990-1700nm were acquired from melamine-milk powder mixture samples prepared at various concentrations ranging from 0.02% to 1%. PLSR models were developed to correlate the spectral data (independent variables) with melamine concentration (dependent variables) in melamine-milk powder mixture samples. PLSR models applying various pretreatment methods were used to reconstruct the two-dimensional PLS images. PLS images were converted to the binary images to detect the suspected melamine pixels in milk powder. As the melamine concentration was increased, the numbers of suspected melamine pixels of binary images were also increased. These results suggested that NIR hyperspectral imaging technique and the PLSR model can be regarded as an effective tool to detect melamine particles in milk powders.

  18. Wine analysis to check quality and authenticity by fully-automated 1H-NMR

    Directory of Open Access Journals (Sweden)

    Spraul Manfred

    2015-01-01

    Full Text Available Fully-automated high resolution 1H-NMR spectroscopy offers unique screening capabilities for food quality and safety by combining non-targeted and targeted screening in one analysis (15–20 min from acquisition to report. The advantage of high resolution 1H-NMR is its absolute reproducibility and transferability from laboratory to laboratory, which is not equaled by any other method currently used in food analysis. NMR reproducibility allows statistical investigations e.g. for detection of variety, geographical origin and adulterations, where smallest changes of many ingredients at the same time must be recorded. Reproducibility and transferability of the solutions shown are user-, instrument- and laboratory-independent. Sample prepara- tion, measurement and processing are based on strict standard operation procedures which are substantial for this fully automated solution. The non-targeted approach to the data allows detecting even unknown deviations, if they are visible in the 1H-NMR spectra of e.g. fruit juice, wine or honey. The same data acquired in high-throughput mode are also subjected to quantification of multiple compounds. This 1H-NMR methodology will shortly be introduced, then results on wine will be presented and the advantages of the solutions shown. The method has been proven on juice, honey and wine, where so far unknown frauds could be detected, while at the same time generating targeted parameters are obtained.

  19. 1H NMR Studies of MgH2

    Science.gov (United States)

    Itoh, Yutaka; Kado, Ryoichi

    We report on 1H NMR studies of commercially available powder MgH2 exposed to air and maybe humidity, which has been believed to be a promising material for hydrogen storage. The Fourier transform of the free-induction decay of the protons indicatesd superposition of broad and narrow components in the NMR spectrum, while the Fourier transform of the 1H nuclear spin-echo reproduced the narrow component. With cooling down below room temperature, the ratio of the narrow peak to the broad spectrum decreased. The broad spectrum is associated with direct dipolar coupled protons on an inhomogeneous rigid lattice. The narrow peak is associated with interstitial protons with more inhomogeneous surroundings.

  20. 5-Pentyl-4-phenylsulfonyl-1H-pyrazol-3-ol

    Directory of Open Access Journals (Sweden)

    Tara Shahani

    2010-06-01

    Full Text Available In the title compound, C14H18N2O3S, the 1H-pyrazole ring is approximately planar, with a maximum deviation of 0.005 (1 Å. The dihedral angle formed between the 1H-pyrazole and phenyl rings is 79.09 (5°. Pairs of intermolecular N—H...O and O...H...N hydrogen bonds form dimers between neighboring molecules, generating R22(10 ring motifs. These dimers are further linked byintermolecular N—H...O and O—H...N hydrogen bonds into a two-dimensional array parallel to the ac plane. The crystal structure is also stabilized by C—H...π interactions.

  1. Therapeutic potential of CAMPATH-1H in skeletal tumours

    OpenAIRE

    Fritsche, Raphaela; Grützkau, Andreas; Noske, Aurelia; Melcher, Ingo; Schaser, Klaus-Dieter; Schlag, Peter M.; Kasper, Hans U; Krenn, Veit Jonas; Sers, Christine

    2010-01-01

    Abstract Aim: CD52 is a GPI-anchored glycoprotein that is expressed abundantly on all lymphocytes, monocytes, macrophages, eosinophils and in the male genital tract. To date, the physiological role of CD52 on lymphocytes has not been elucidated. However, an antibody directed to CD52 called CAMPATH-1H has been shown to be capable of depleting lymphocytes. Tissue and cell lines of non-neoplastic bone, cartilage and skeletal tumours were analysed for CD52 expression. Methods and resul...

  2. 7-Iodo-1H-indole-3-carbonitrile

    Directory of Open Access Journals (Sweden)

    Rosanna Meine

    2015-10-01

    Full Text Available The title compound was prepared by a Friedel–Crafts acylation-oxime synthesis-decarboxylation/dehydration sequence starting from commercially available 7-iodoindole with 2-(7-iodo-1H-indol-3-yl-2-oxoacetic acid as isolated intermediate. The structural identity of the title compound was proven by elemental analysis and spectroscopic methods (IR, NMR, EI-MS, and purity was assessed by two independent HPLC methods.

  3. 1-Propyl-1H-indole-2,3-dione

    Directory of Open Access Journals (Sweden)

    Fatima Zahrae Qachchachi

    2016-04-01

    Full Text Available In the title compound, C11H11NO2, the 1H-indole-2,3-dione unit is essentially planar, with an r.m.s. deviation of 0.0387 (13 Å. This plane makes a dihedral angle of 72.19 (17° with the plane of the propyl substituent. In the crystal, chains propagating along the b axis are formed through C—H...O hydrogen bonds.

  4. Translational diffusion in paramagnetic liquids by 1H NMR relaxometry: nitroxide radicals in solution.

    Science.gov (United States)

    Kruk, D; Korpała, A; Kubica, A; Meier, R; Rössler, E A; Moscicki, J

    2013-01-14

    For nitroxide radicals in solution one can identify three frequency regimes in which (1)H spin-lattice relaxation rate of solvent molecules depend linearly on square root of the (1)H resonance frequency. Combining a recently developed theory of nuclear (proton) spin-lattice relaxation in solutions of nitroxide radicals [D. Kruk et al., J. Chem. Phys. 137, 044512 (2012)] with properties of the spectral density function associated with translational dynamics, relationships between the corresponding linear changes of the relaxation rate (for (14)N spin probes) and relative translational diffusion coefficient of the solvent and solute molecules have been derived (in analogy to (15)N spin probes [E. Belorizky et al., J. Phys. Chem. A 102, 3674 (1998)]). This method allows a simple and straightforward determination of diffusion coefficients in spin-labeled systems, by means of (1)H nuclear magnetic resonance (NMR) relaxometry. The approach has thoroughly been tested by applying to a large set of experimental data-(1)H spin-lattice relaxation dispersion results for solutions of different viscosity (decalin, glycerol, propylene glycol) of (14)N and (15)N spin probes. The experiments have been performed versus temperature (to cover a broad range of translational diffusion coefficients) using field cycling spectrometer which covers three decades in (1)H resonance frequency, 10 kHz-20 MHz. The limitations of NMR relaxometry caused by the time scale of the translational dynamics as well as electron spin relaxation have been discussed. It has been shown that for spin-labeled systems NMR relaxometry gives access to considerably faster diffusion processes than for diamagnetic systems.

  5. Translational diffusion in paramagnetic liquids by 1H NMR relaxometry: Nitroxide radicals in solution

    Science.gov (United States)

    Kruk, D.; Korpała, A.; Kubica, A.; Meier, R.; Rössler, E. A.; Moscicki, J.

    2013-01-01

    For nitroxide radicals in solution one can identify three frequency regimes in which 1H spin-lattice relaxation rate of solvent molecules depend linearly on square root of the 1H resonance frequency. Combining a recently developed theory of nuclear (proton) spin-lattice relaxation in solutions of nitroxide radicals [D. Kruk et al., J. Chem. Phys. 137, 044512 (2012)], 10.1063/1.4736854 with properties of the spectral density function associated with translational dynamics, relationships between the corresponding linear changes of the relaxation rate (for 14N spin probes) and relative translational diffusion coefficient of the solvent and solute molecules have been derived (in analogy to 15N spin probes [E. Belorizky et al., J. Phys. Chem. A 102, 3674 (1998)], 10.1021/jp980397h). This method allows a simple and straightforward determination of diffusion coefficients in spin-labeled systems, by means of 1H nuclear magnetic resonance (NMR) relaxometry. The approach has thoroughly been tested by applying to a large set of experimental data—1H spin-lattice relaxation dispersion results for solutions of different viscosity (decalin, glycerol, propylene glycol) of 14N and 15N spin probes. The experiments have been performed versus temperature (to cover a broad range of translational diffusion coefficients) using field cycling spectrometer which covers three decades in 1H resonance frequency, 10 kHz-20 MHz. The limitations of NMR relaxometry caused by the time scale of the translational dynamics as well as electron spin relaxation have been discussed. It has been shown that for spin-labeled systems NMR relaxometry gives access to considerably faster diffusion processes than for diamagnetic systems.

  6. Bis{μ-1-[(2-ethyl-1H-imidazol-1-ylmethyl]-1H-benzotriazole}bis(iodidocadmium

    Directory of Open Access Journals (Sweden)

    Xia Wang

    2011-07-01

    Full Text Available The dinuclear title complex, [Cd2I4(C12H13N52], lies on a crystallographic center of inversion. The CdII atom is four-coordinated by two N atoms from two 1-[(2-ethyl-1H-imidazol-1-ylmethyl]-1H-benzotriazole (bmei ligands and two terminal I atoms in a distorted tetrahedral coordination environment. The CdII atoms are connected to each other by two bridging bmei ligands. The benzotriazole rings in adjacent molecules are almost parallel, with an average interplanar distance of 3.3400 (2 Å and a centroid–centroid distance of 4.852 (2 Å.

  7. Near infrared spectroscopy combined with multivariate analysis for monitoring the ethanol precipitation process of fraction I+II+III supernatant in human albumin separation.

    Science.gov (United States)

    Li, Can; Wang, Fei; Zang, Lixuan; Zang, Hengchang; Alcalà, Manel; Nie, Lei; Wang, Mingyu; Li, Lian

    2017-03-15

    Nowadays, as a powerful process analytical tool, near infrared spectroscopy (NIRS) has been widely applied in process monitoring. In present work, NIRS combined with multivariate analysis was used to monitor the ethanol precipitation process of fraction I+II+III (FI+II+III) supernatant in human albumin (HA) separation to achieve qualitative and quantitative monitoring at the same time and assure the product's quality. First, a qualitative model was established by using principal component analysis (PCA) with 6 of 8 normal batches samples, and evaluated by the remaining 2 normal batches and 3 abnormal batches. The results showed that the first principal component (PC1) score chart could be successfully used for fault detection and diagnosis. Then, two quantitative models were built with 6 of 8 normal batches to determine the content of the total protein (TP) and HA separately by using partial least squares regression (PLS-R) strategy, and the models were validated by 2 remaining normal batches. The determination coefficient of validation (Rp(2)), root mean square error of cross validation (RMSECV), root mean square error of prediction (RMSEP) and ratio of performance deviation (RPD) were 0.975, 0.501g/L, 0.465g/L and 5.57 for TP, and 0.969, 0.530g/L, 0.341g/L and 5.47 for HA, respectively. The results showed that the established models could give a rapid and accurate measurement of the content of TP and HA. The results of this study indicated that NIRS is an effective tool and could be successfully used for qualitative and quantitative monitoring the ethanol precipitation process of FI+II+III supernatant simultaneously. This research has significant reference value for assuring the quality and improving the recovery ratio of HA in industrialization scale by using NIRS.

  8. Near infrared spectroscopy combined with multivariate analysis for monitoring the ethanol precipitation process of fraction I + II + III supernatant in human albumin separation

    Science.gov (United States)

    Li, Can; Wang, Fei; Zang, Lixuan; Zang, Hengchang; Alcalà, Manel; Nie, Lei; Wang, Mingyu; Li, Lian

    2017-03-01

    Nowadays, as a powerful process analytical tool, near infrared spectroscopy (NIRS) has been widely applied in process monitoring. In present work, NIRS combined with multivariate analysis was used to monitor the ethanol precipitation process of fraction I + II + III (FI + II + III) supernatant in human albumin (HA) separation to achieve qualitative and quantitative monitoring at the same time and assure the product's quality. First, a qualitative model was established by using principal component analysis (PCA) with 6 of 8 normal batches samples, and evaluated by the remaining 2 normal batches and 3 abnormal batches. The results showed that the first principal component (PC1) score chart could be successfully used for fault detection and diagnosis. Then, two quantitative models were built with 6 of 8 normal batches to determine the content of the total protein (TP) and HA separately by using partial least squares regression (PLS-R) strategy, and the models were validated by 2 remaining normal batches. The determination coefficient of validation (Rp2), root mean square error of cross validation (RMSECV), root mean square error of prediction (RMSEP) and ratio of performance deviation (RPD) were 0.975, 0.501 g/L, 0.465 g/L and 5.57 for TP, and 0.969, 0.530 g/L, 0.341 g/L and 5.47 for HA, respectively. The results showed that the established models could give a rapid and accurate measurement of the content of TP and HA. The results of this study indicated that NIRS is an effective tool and could be successfully used for qualitative and quantitative monitoring the ethanol precipitation process of FI + II + III supernatant simultaneously. This research has significant reference value for assuring the quality and improving the recovery ratio of HA in industrialization scale by using NIRS.

  9. Adsorption of acrolein, propanal, and allyl alcohol on Pd(111): a combined infrared reflection-absorption spectroscopy and temperature programmed desorption study.

    Science.gov (United States)

    Dostert, Karl-Heinz; O'Brien, Casey P; Mirabella, Francesca; Ivars-Barceló, Francisco; Schauermann, Swetlana

    2016-05-18

    Atomistic-level understanding of the interaction of α,β-unsaturated aldehydes and their derivatives with late transition metals is of fundamental importance for the rational design of new catalytic materials with the desired selectivity towards C[double bond, length as m-dash]C vs. C[double bond, length as m-dash]O bond partial hydrogenation. In this study, we investigate the interaction of acrolein, and its partial hydrogenation products propanal and allyl alcohol, with Pd(111) as a prototypical system. A combination of infrared reflection-absorption spectroscopy (IRAS) and temperature programmed desorption (TPD) experiments was applied under well-defined ultrahigh vacuum (UHV) conditions to obtain detailed information on the adsorption geometries of acrolein, propanal, and allyl alcohol as a function of coverage. We compare the IR spectra obtained for multilayer coverages, reflecting the molecular structure of unperturbed molecules, with the spectra acquired for sub-monolayer coverages, at which the chemical bonds of the molecules are strongly distorted. Coverage-dependent IR spectra of acrolein on Pd(111) point to the strong changes in the adsorption geometry with increasing acrolein coverage. Acrolein adsorbs with the C[double bond, length as m-dash]C and C[double bond, length as m-dash]O bonds lying parallel to the surface in the low coverage regime and changes its geometry to a more upright orientation with increasing coverage. TPD studies indicate decomposition of the species adsorbed in the sub-monolayer regime upon heating. Similar strong coverage dependence of the IR spectra were found for propanal and allyl alcohol. For all investigated molecules a detailed assignment of vibrational bands is reported.

  10. First-in-human evaluation of a hybrid modality that allows combined radio- and (near-infrared) fluorescence tracing during surgery

    Energy Technology Data Exchange (ETDEWEB)

    Berg, Nynke S. van den [Leiden University Medical Center, Interventional Molecular Imaging Laboratory, Department of Radiology (Netherlands); The Netherlands Cancer Institute - Antoni van Leeuwenhoek Hospital, Department of Urology, Amsterdam (Netherlands); Simon, Herve [Eurorad S.A., Eckbolsheim (France); Kleinjan, Gijs H. [Leiden University Medical Center, Interventional Molecular Imaging Laboratory, Department of Radiology (Netherlands); The Netherlands Cancer Institute - Antoni van Leeuwenhoek Hospital, Department of Nuclear Medicine, Amsterdam (Netherlands); Engelen, Thijs [Leiden University Medical Center, Interventional Molecular Imaging Laboratory, Department of Radiology (Netherlands); The Netherlands Cancer Institute - Antoni van Leeuwenhoek Hospital, Department of Head and Neck Surgery and Oncology, Amsterdam (Netherlands); Bunschoten, Anton; Welling, Mick M. [Leiden University Medical Center, Interventional Molecular Imaging Laboratory, Department of Radiology (Netherlands); Tijink, Bernard M. [The Netherlands Cancer Institute - Antoni van Leeuwenhoek Hospital, Department of Head and Neck Surgery and Oncology, Amsterdam (Netherlands); Horenblas, Simon [The Netherlands Cancer Institute - Antoni van Leeuwenhoek Hospital, Department of Urology, Amsterdam (Netherlands); Chambron, Jacques [The Netherlands Cancer Institute - Antoni van Leeuwenhoek Hospital, Department of Nuclear Medicine, Amsterdam (Netherlands); Leeuwen, Fijs W.B. van [Leiden University Medical Center, Interventional Molecular Imaging Laboratory, Department of Radiology (Netherlands); The Netherlands Cancer Institute - Antoni van Leeuwenhoek Hospital, Department of Urology, Amsterdam (Netherlands); The Netherlands Cancer Institute - Antoni van Leeuwenhoek Hospital, Department of Head and Neck Surgery and Oncology, Amsterdam (Netherlands)

    2015-10-15

    The clinical introduction of the hybrid tracer indocyanine green (ICG)-{sup 99m}Tc-nanocolloid, composed of a radioactive and a near-infrared (NIR) fluorescence component, has created the need for surgical (imaging) modalities that allow for simultaneous detection of both signals. This study describes the first-in-human use of a prototype opto-nuclear probe during sentinel node (SN) biopsy using ICG-{sup 99m}Tc-nanocolloid. To allow for fluorescence tracing, a derivative of the conventional gamma probe technology was generated in which two optical fibers were integrated to allow for excitation (785 nm) and emission signal collection (> 810 nm). The ability of this opto-nuclear probe to detect the fluorescence signal of the hybrid tracer ICG-{sup 99m}Tc-nanocolloid was firstly determined ex vivo in (non)SNs samples obtained from 41 patients who underwent hybrid tracer-based SN biopsy in the head and neck or urogenital area. In an in vivo proof-of-concept study in nine of these 41 patients, SNs were localized using combined gamma and fluorescence tracing with the opto-nuclear probe. Fluorescence tracing was performed in a similar manner as gamma tracing and under ambient light conditions. Ex vivo, the gamma tracing option of the opto-nuclear probe correctly identified the SN in all 150 evaluated (non)SN samples. Ex vivo fluorescence tracing in the low-sensitivity mode correctly identified 71.7 % of the samples. This increased to 98.9 % when fluorescence tracing was performed in the high-sensitivity mode. In vivo fluorescence tracing (high-sensitivity mode) accurately identified the SNs in all nine patients (20 SNs evaluated; 100 %). This study demonstrates the first-in-human evaluation of a hybrid modality capable of detecting both gamma and fluorescence signals during a surgical procedure. Fluorescence tracing could be performed in ambient light. (orig.)

  11. Cross-correlated spin relaxation effects in methyl {sup 1}H CPMG-based relaxation dispersion experiments: Complications and a simple solution

    Energy Technology Data Exchange (ETDEWEB)

    Korzhnev, Dmitry M.; Mittermaier, Anthony K.; Kay, Lewis E. [University of Toronto, Contribution from the Protein Engineering Network Centers of Excellence and the Departments of Medical Genetics, Biochemistry and Chemistry (Canada)], E-mail: kay@pound.med.utoronto.ca

    2005-04-15

    Artifacts associated with the measurement of methyl {sup 1}H single quantum CPMG-based relaxation dispersion profiles are described. These artifacts arise due to the combination of cross-correlated spin relaxation effects involving intra-methyl {sup 1}H-{sup 1}H dipolar interactions and imperfections in {sup 1}H refocusing pulses that are applied during CPMG intervals that quantify the effects of chemical exchange on measured transverse relaxation rates. As a result substantial errors in extracted exchange parameters can be obtained. A simple 'work-around' is presented where the {sup 1}H chemical shift difference between the exchanging states is extracted from a combination of {sup 13}C single quantum and {sup 13}C-{sup 1}H multiple quantum dispersion profiles. The approach is demonstrated with an application to a folding/unfolding reaction involving a G48M mutant Fyn SH3 domain.

  12. Discrimination of sugarcane according to cultivar by 1H NMR and chemometric analyses

    Energy Technology Data Exchange (ETDEWEB)

    Alves Filho, Elenilson G.; Silva, Lorena M.A.; Choze, Rafael; Liao, Luciano M. [Laboratorio de Ressonancia Magnetica Nuclear, Instituto de Quimica, Universidade Federal de Goias (UFG), Goiania, GO (Brazil); Honda, Neli K.; Alcantara, Glaucia B. [Departamento de Quimica, Universidade Federal de Mato Grosso do Sul (UFMS), Campo Grande, MS (Brazil)

    2012-07-01

    Several technologies for the development of new sugarcane cultivars have mainly focused on the increase in productivity and greater disease resistance. Sugarcane cultivars are usually identified by the organography of the leaves and stems, the analysis of peroxidase and esterase isoenzyme activities and the total soluble protein as well as soluble solid content. Nuclear magnetic resonance (NMR) associated with chemometric analysis has proven to be a valuable tool for cultivar assessment. Thus, this article describes the potential of chemometric analysis applied to 1H high resolution magic angle spinning (HRMAS) and NMR in solution for the investigation of sugarcane cultivars. For this purpose, leaves from eight different cultivars of sugarcane were investigated by {sup 1}H NMR spectroscopy in combination with chemometric analysis. The approach shows to be a useful tool for the distinction and classification of different sugarcane cultivars as well as to access the differences on its chemical composition. (author)

  13. Digital NMR Profiles as Building Blocks: Assembling 1H Fingerprints of Steviol Glycosides

    Science.gov (United States)

    Napolitano, José G.; Simmler, Charlotte; McAlpine, James B.; Lankin, David C.; Chen, Shao-Nong; Pauli, Guido F.

    2015-01-01

    This report describes a fragment-based approach to the examination of congeneric organic compounds by NMR spectroscopy. The method combines the classic interpretation of 1D- and 2D-NMR data sets with contemporary computer-assisted NMR analysis. Characteristic NMR profiles of key structural motifs were generated by 1H iterative full spin analysis and then joined together as building blocks to recreate the 1H NMR spectra of increasingly complex molecules. To illustrate the methodology described, a comprehensive analysis of steviol (1), seven steviol glycosides (2–8) and two structurally related isosteviol compounds (9, 10) was carried out. The study also assessed the potential impact of this method on relevant aspects of natural product research including structural verification, chemical dereplication, and mixture analysis. PMID:25714117

  14. Combined Nonuniformity Correction Algorithm of Infrared Focal Plane Arrays%红外焦平面联合非均匀性校正算法

    Institute of Scientific and Technical Information of China (English)

    洪闻青; 杨南生; 王晓东; 苏俊波; 苏兰; 胡志斌

    2011-01-01

    分别分析了红外焦平面阵列(IRFPA)基于定标的非均匀性校正(NUC)算法和基于场景的NUC算法的优势和问题.在此基础上提出了联合NUC算法,其中利用基于定标的两点校正法来初步消除探测器的非均匀性,然后再采用基于场景的时域高通校正法和新型自适应滤波校正法来抑制探测器非均匀性参数漂移的影响,同时减弱系统噪声对成像质量的破坏.实验结果表明,与两点法、时域高通法以及传统自适应滤波法等具有较大工程应用价值的NUC算法相比,联合NUC算法具有稳定而且性能更为优良的校正效果.%The advantages and disadvantages in nonuniformity correction (NUC) algorithms based on calibration and scene of infrared focal plane arrays (IRFPA) are analysed separately. The combined NUC algorithm is presented.Two-point NUC algorithm based on calibration is adopted to remove the nonuniformity of the detector simply. The influences of detectors' NUC parameters which will change with time are weakened by using the scene-based temporal high-pass filter algorithm and new-style adaptive filter algorithm. The disadvantages for image quality introduced by ynoises are weakened too. The experimental results show that the combined NUC algorithm is more stable and better than some NUC algorithms with great value in project applications, such as two point NUC algorithm, temporal highpass filter NUC algorithm and former adaptive filter NUC algorithm.

  15. FE-SEM/EDS and μ-IR combined analysis of HED meteorites in relation to infrared spectra of Vesta-like asteroids

    Science.gov (United States)

    Ferrari, Marco; Dirri, Fabrizio; Palomba, Ernesto; Longobardo, Andrea; Rotundi, Alessandra

    2016-10-01

    Knowing the chemico-mineralogical composition of an extraterrestrial body is key to understanding its geological evolution. For this reason, remote-sensing instruments that can gather compositional data by using infrared spectroscopy are often part of the spacecraft missions. In order to acquire a fuller grasp of these data it is fundamental to compare them to analogue samples analysed by means of spectroscopy techniques.This study is focused on the Howardite-Eucrite-Diogenite meteorites (HEDs) [1] originated from the differentiated asteroid 4 Vesta [2]; this hypothesis was lately reinforced by the data provided by the Dawn mission [3].These meteorites consist of pyroxene basalts either brecciated or not (eucrites), brecciated orthopyroxenites (diogenites) and polymictic breccias of diogenites and eucrites originated by impacts on their parent body's surface (howardites).Here we report a FE-SEM/EDS and μ-IR spectroscopy combined study of three HED meteorite samples: 1) NWA 7159, a monomictic brecciated eucrite consisting of exolved orthopyroxene (Fs56.6-57.1 Wo2.0-1.9) and anorthite with accessory silica polymorph and ilmenite; 2) NWA 7490 a diogenite with a cumulate texture dominated by orthopyroxene (Fs24.1-26 Wo3.4-4.6), with Ca-plagioclase, minor olivine and chromite and troilite as accessory minerals; 3) NWA 2698, an howardite with eucritic pyroxene (Fs45-40 Wo7-20).The FE-SEM backscattered images coupled with the EDS maps gives information on the morphology (e.g. grain size and texture) and chemistry of the three samples. The μ-IR spectrometer provides reflectance spectra of the selected features of interest and spectral maps of larger areas. With the combined analyses we obtained a comprehensive mineralogical framework for the three HED samples. It was proven that the mineralogical heterogeneity of the HED meteorites is consistent with the spectroscopic diversity seen on Vesta [4], thus this study helps in better constraining and characterising the

  16. Identification of fucans from four species of sea cucumber by high temperature 1H NMR

    Science.gov (United States)

    Wu, Nian; Chen, Shiguo; Ye, Xingqian; Li, Guoyun; Yin, Li'ang; Xue, Changhu

    2014-10-01

    Acidic polysaccharide, which has various biological activities, is one of the most important components of sea cucumber. In the present study, crude polysaccharide was extracted from four species of sea cucumber from three different geographical zones, Pearsonothuria graeffei ( Pg) from Indo-Pacific, Holothuria vagabunda ( Hv) from Norwegian Coast, Stichopus tremulu ( St) from Western Indian Ocean, and Isostichopus badionotu ( Ib) from Western Atlantic. The polysaccharide extract was separated and purified with a cellulose DEAE anion-exchange column to obtain corresponding sea cucumber fucans (SC-Fucs). The chemical property of these SC-Fucs, including molecular weight, monosaccharide composition and sulfate content, was determined. Their structure was compared simply with fourier infrared spectrum analyzer and identified with high temperature 1H nuclear magnetic resonance spectrum analyzer (NMR) and room temperature 13C NMR. The results indicated that Fuc- Pg obtained from the torrid zone mainly contained 2,4-O-disulfated and non-sulfated fucose residue, whereas Fuc- Ib from the temperate zone contained non-, 2-O- and 2,4-O-disulfated fucose residue; Fuc- St from the frigid zone and Fuc- Hv from the torrid zone contained mainly non-sulfated fucose residue. The proton of SC-Fucs was better resolved via high temperature 1H NMR than via room temperature 1H NMR. The fingerprint of sea cucumber in different sea regions was established based on the index of anomer hydrogen signal in SC-Fucs. Further work will help to understand whether there exists a close relationship between the geographical area of sea cucumber and the sulfation pattern of SC-Fucs.

  17. Complete assignment of NMR data of 22 phenyl-1H-pyrazoles' derivatives.

    Science.gov (United States)

    de Oliveira, Aline Lima; Alves de Oliveira, Carlos Henrique; Mairink, Laura Maia; Pazini, Francine; Menegatti, Ricardo; Lião, Luciano Morais

    2011-08-01

    Complete assignment of (1)H and (13)C NMR chemical shifts and J((1)H/(1)H and (1)H/(19)F) coupling constants for 22 1-phenyl-1H-pyrazoles' derivates were performed using the concerted application of (1)H 1D and (1)H, (13)C 2D gs-HSQC and gs-HMBC experiments. All 1-phenyl-1H-pyrazoles' derivatives were synthesized as described by Finar and co-workers. The formylated 1-phenyl-1H-pyrazoles' derivatives were performed under Duff's conditions.

  18. Improved Assignments of the Vibrational Fundamental Modes of ortho-, meta-, and para-xylene Using Gas- and Liquid-Phase Infrared and Raman Spectra Combined with ab initio Calculations: Quantitative Gas-Phase Infrared Spectra for Detection

    Energy Technology Data Exchange (ETDEWEB)

    Lindenmaier, Rodica; Scharko, Nicole K.; Tonkyn, Russell G.; Nguyen, Kiet T.; Williams, Stephen D.; Johnson, Timothy J.

    2017-12-05

    Xylenes contain a blend of the ortho-, meta-, and para- isomers, and all are abundant contaminants in the ground, surface waters, and air. To better characterize xylene and to better enable its detection, we report high quality quantitative vapor-phase infrared spectra of all three isomers over the 540˗6500 cm-1 range. All fundamental vibrational modes are assigned based on these vapor-phase infrared spectra, liquid-phase infrared and Raman spectra, along with density functional theory (DFT), ab initio MP2 and high energy-accuracy compound theoretical model (W1BD) calculations. Both MP2 and DFT predict a single conformer with C2v symmetry for ortho-xylene, and two conformers each for meta- and para-xylene, depending on the preferred orientations of the methyl groups. For meta-xylene the two conformers have Cs and C2 symmetry, and for para-xylene these conformers have C2v or C2h symmetry. Since the relative population of the two conformers is approximately 50% for both isomers and predicted frequencies and intensities are very similar for each conformer, we made an arbitrary choice to discuss the Cs conformer for meta-xylene and the C2v conformer for para-xylene. We report integrated band intensities for all isomers. Using the quantitative infrared data, we determine the global warming potential values of each isomer and discuss potential bands for atmospheric monitoring.

  19. Topographical and Chemical Imaging of a Phase Separated Polymer Using a Combined Atomic Force Microscopy/Infrared Spectroscopy/Mass Spectrometry Platform.

    Science.gov (United States)

    Tai, Tamin; Karácsony, Orsolya; Bocharova, Vera; Van Berkel, Gary J; Kertesz, Vilmos

    2016-03-01

    In this paper, the use of a hybrid atomic force microscopy/infrared spectroscopy/mass spectrometry imaging platform was demonstrated for the acquisition and correlation of nanoscale sample surface topography and chemical images based on infrared spectroscopy and mass spectrometry. The infrared chemical imaging component of the system utilized photothermal expansion of the sample at the tip of the atomic force microscopy probe recorded at infrared wave numbers specific to the different surface constituents. The mass spectrometry-based chemical imaging component of the system utilized nanothermal analysis probes for thermolytic surface sampling followed by atmospheric pressure chemical ionization of the gas phase species produced with subsequent mass analysis. The basic instrumental setup, operation, and image correlation procedures are discussed, and the multimodal imaging capability and utility are demonstrated using a phase separated poly(2-vinylpyridine)/poly(methyl methacrylate) polymer thin film. The topography and both the infrared and mass spectral chemical images showed that the valley regions of the thin film surface were comprised primarily of poly(2-vinylpyridine) and hill or plateau regions were primarily poly(methyl methacrylate). The spatial resolution of the mass spectral chemical images was estimated to be 1.6 μm based on the ability to distinguish surface features in those images that were also observed in the topography and infrared images of the same surface.

  20. 2-Methyl-1H-benzimidazol-3-ium hydrogen phthalate

    Directory of Open Access Journals (Sweden)

    YuanQi Yu

    2011-10-01

    Full Text Available The asymmetric unit of the title compound, C8H9N2+·C8H5O4−, contains two independent ion pairs. In each 2-methyl-1H-benzimidazolium ion, an intramolecular O—H...O bond forms an S(7 graph-set motif. In the crystal, the components are linked by N—H...O hydrogen bonds, forming chains along [210]. Further stabilization is provided by weak C—H...O hydrogen bonds.

  1. Decaying Neutralino Dark Matter in Anomalous $U(1)_H$ Models

    CERN Document Server

    Sierra, D Aristizabal; Zapata, Oscar

    2009-01-01

    In supersymmetric models extended with an anomalous $U(1)_H$ different R-parity violating couplings can yield an unstable neutralino. We show that in this context astrophysical and cosmological constraints on neutralino decaying dark matter forbid bilinear R-parity breaking neutralino decays and lead to a class of purely trilinear R-parity violating scenarios in which the neutralino is stable on cosmological scales. We have found that among the resulting models some of them become suitable to explain the observed anomalies in cosmic-ray electron/positron fluxes.

  2. Profiling formulated monoclonal antibodies by (1)H NMR spectroscopy.

    Science.gov (United States)

    Poppe, Leszek; Jordan, John B; Lawson, Ken; Jerums, Matthew; Apostol, Izydor; Schnier, Paul D

    2013-10-15

    Nuclear magnetic resonance (NMR) is arguably the most direct methodology for characterizing the higher-order structure of proteins in solution. Structural characterization of proteins by NMR typically utilizes heteronuclear experiments. However, for formulated monoclonal antibody (mAb) therapeutics, the use of these approaches is not currently tenable due to the requirements of isotope labeling, the large size of the proteins, and the restraints imposed by various formulations. Here, we present a new strategy to characterize formulated mAbs using (1)H NMR. This method, based on the pulsed field gradient stimulated echo (PGSTE) experiment, facilitates the use of (1)H NMR to generate highly resolved spectra of intact mAbs in their formulation buffers. This method of data acquisition, along with postacquisition signal processing, allows the generation of structural and hydrodynamic profiles of antibodies. We demonstrate how variation of the PGSTE pulse sequence parameters allows proton relaxation rates and relative diffusion coefficients to be obtained in a simple fashion. This new methodology can be used as a robust way to compare and characterize mAb therapeutics.

  3. 23Na and 1H NMR Microimaging of Intact Plants

    Science.gov (United States)

    Olt, Silvia; Krötz, Eva; Komor, Ewald; Rokitta, Markus; Haase, Axel

    2000-06-01

    23Na NMR microimaging is described to map, for the first time, the sodium distribution in living plants. As an example, the response of 6-day-old seedlings of Ricinus communis to exposure to sodium chloride concentrations from 5 to 300 mM was observed in vivo using 23Na as well as 1H NMR microimaging. Experiments were performed at 11.75 T with a double resonant 23Na-1H probehead. The probehead was homebuilt and equipped with a climate chamber. T1 and T2 of 23Na were measured in the cross section of the hypocotyl. Within 85 min 23Na images with an in-plane resolution of 156 × 156 μm were acquired. With this spatial information, the different types of tissue in the hypocotyl can be discerned. The measurement time appears to be short compared to the time scale of sodium uptake and accumulation in the plant so that the kinetics of salt stress can be followed. In conclusion, 23Na NMR microimaging promises great potential for physiological studies of the consequences of salt stress on the macroscopic level and thus may become a unique tool for characterizing plants with respect to salt tolerance and salt sensitivity.

  4. Metabolomic insight into soy sauce through (1)H NMR spectroscopy.

    Science.gov (United States)

    Ko, Bong-Kuk; Ahn, Hyuk-Jin; van den Berg, Frans; Lee, Cherl-Ho; Hong, Young-Shick

    2009-08-12

    Soy sauce, a well-known seasoning in Asia and throughout the world, consists of many metabolites that are produced during fermentation or aging and that have various health benefits. However, their comprehensive assessment has been limited due to targeted or instrumentally specific analysis. This paper presents for the first time a metabolic characterization of soy sauce, especially that aged up to 12 years, to obtain a global understanding of the metabolic variations through (1)H NMR spectroscopy coupled with multivariate pattern recognition techniques. Elevated amino acids and organic acids and the consumption of carbohydrate were associated with continuous involvement of microflora in aging for 12 years. In particular, continuous increases in the levels of betaine were found during aging for up to 12 years, demonstrating that microbial- or enzyme-related metabolites were also coupled with osmotolerant or halophilic bacteria present during aging. This work provides global insights into soy sauce through a (1)H NMR-based metabolomic approach that enhances the current understanding of the holistic metabolome and allows assessment of soy sauce quality.

  5. Adsorption of isophorone and trimethyl-cyclohexanone on Pd(111): A combination of infrared reflection absorption spectroscopy and density functional theory studies

    Science.gov (United States)

    Dostert, Karl-Heinz; O'Brien, Casey P.; Liu, Wei; Riedel, Wiebke; Savara, Aditya; Tkatchenko, Alexandre; Schauermann, Swetlana; Freund, Hans-Joachim

    2016-08-01

    Understanding the interaction of α,β-unsaturated carbonyl compounds with late transition metals is a key prerequisite for rational design of new catalysts with desired selectivity towards C = C or C = O bond hydrogenation. The interaction of the α,β-unsaturated ketone isophorone and the saturated ketone TMCH (3,3,5-trimethylcyclohexanone) with Pd(111) was investigated in this study as a prototypical system. Infrared reflection-absorption spectroscopy (IRAS) and density functional theory calculations including van der Waals interactions (DFT + vdWsurf) were combined to form detailed assignments of IR vibrational modes in the range from 3000 cm- 1 to 1000 cm- 1 in order to obtain information on the binding of isophorone and TMCH to Pd(111) as well as to study the effect of co-adsorbed hydrogen. IRAS measurements were performed with deuterium-labeled (d5-) isophorone, in addition to unlabeled isophorone and unlabeled TMCH. Experimentally observed IR absorption features and calculated vibrational frequencies indicate that isophorone and TMCH molecules in multilayers have a mostly unperturbed structure with random orientation. At sub-monolayer coverages, strong perturbation and preferred orientations of the adsorbates were found. At low coverage, isophorone interacts strongly with Pd(111) and adsorbs in a flat-lying geometry with the C = C and C = O bonds parallel, and a CH3 group perpendicular, to the surface. At intermediate sub-monolayer coverage, the C = C bond is strongly tilted, while the C = O bond remains flat-lying, which indicates a prominent perturbation of the conjugated π system. Pre-adsorbed hydrogen leads to significant changes in the adsorption geometry of isophorone, which suggests a weakening of its binding to Pd(111). At low coverage, the structure of the CH3 groups seems to be mostly unperturbed on the hydrogen pre-covered surface. With increasing coverage, a conservation of the in-plane geometry of the conjugated π system was observed in the

  6. Genetic Variation in Myosin 1H Contributes to Mandibular Prognathism

    Science.gov (United States)

    Tassopoulou-Fishell, Maria; Deeley, Kathleen; Harvey, Erika M.; Sciote, James; Vieira, Alexandre R.

    2013-01-01

    Introduction Several candidate loci have been suggested as influencing mandibular prognathism (1p22.1, 1p22.2, 1p36, 3q26.2, 5p13-p12, 6q25, 11q22.2-q22.3, 12q23, 12q13.13, and 19p13.2). The goal of this study was to replicate these results in a well-characterized homogeneous sample set. Methods Thirty-three single nucleotide polymorphisms spanning all candidate regions were studied in 44 prognathic and 35 Class I subjects from the University of Pittsburgh School of Dental Medicine Dental Registry and DNA Repository. The 44 mandibular prognathism subjects had an average age of 18.4 years, 31 were females and 13 males, and 24 were White, 15 African American, two Hispanic, and three Asian. The 35 Class I subjects had an average age of 17.6 years, 27 were females and 9 males, and 27 were White, six African Americans, one Hispanic, and two Asian. Skeletal mandibular prognathism diagnosis included cephalometric values indicative of Class III such as ANB smaller than two degrees, negative Witts appraisal, and positive A–B plane. Additional mandibular prognathism criteria included negative OJ and visually prognathic (concave) profile as determined by the subject's clinical evaluation. Orthognathic subjects without jaw deformations were used as a comparison group. Mandibular prognathism and orthognathic subjects were matched based on race, sex and age. Genetic markers were tested by polymerase chain reaction using TaqMan chemistry. Chi-square and Fisher exact tests were used to determine overrepresentation of marker allele with alpha of 0.05. Results An association was unveiled between a marker in MYO1H (rs10850110) and the mandibular prognathism phenotype (p=0.03). MYO1H is a Class-I myosin that is in a different protein group than the myosin isoforms of muscle sarcomeres, which are the basis of skeletal muscle fiber typing. Class I myosins are necessary for cell motility, phagocytosis and vesicle transport. Conclusions More strict clinical definitions may increase

  7. A chemometric evaluation of the underlying physical and chemical patterns that support near infrared spectroscopy of barley seeds as a tool for explorative classification of endosperm genes and gene combinations

    DEFF Research Database (Denmark)

    Jacobsen, Susanne; Søndergaard, Ib; Møller, Birthe

    2005-01-01

    Near infrared spectroscopic (NIR; 1100-2500 nm), chemical and genetic data were combined to study the pleiotropic secondary effects of mutant genes on milled samples in a barley seed model. NIR and chemical data were both effective in classifying gene and gene combinations by Principal Component...... revealing pleiotropic gene effects in expression timing that supporting the gene classification. To verify that NIR spectroscopy data represents a physio-chemical fingerprint of the barley seed, physical and chemical spectral components were partially separated by Multiple Scatter Correction...

  8. Crystal structure of 1H,1'H-[2,2'-biimid-azol]-3-ium hydrogen tartrate hemi-hydrate.

    Science.gov (United States)

    Gao, Xiao-Li; Bian, Li-Fang; Guo, Shao-Wei

    2014-11-01

    In the crystal of the title hydrated salt, C6H7N4 (+)·C4H5O6 (-)·0.5H2O, the bi-imidazole monocation, 1H,1'H-[2,2'-biimidazol]-3-ium, is hydrogen bonded, via N-H⋯O, O-H⋯O and O-H⋯N hydrogen bonds, to the hydrogen tartrate anion and the water mol-ecule, which is located on a twofold rotation axis, forming sheets parallel to (001). The sheets are linked via C-H⋯O hydrogen bonds, forming a three-dimensional structure. There are also C=O⋯π inter-actions present [O⋯π distances are 3.00 (9) and 3.21 (7) Å], involving the carbonyl O atoms and the imidazolium ring, which may help to consolidate the structure. In the cation, the dihedral angle between the rings is 11.6 (2)°.

  9. 4-Methyl-5-phenyl-1H-pyrazol-3-ol

    Directory of Open Access Journals (Sweden)

    Tara Shahani

    2010-07-01

    Full Text Available The title compound, C10H10N2O, crystallizes with two independent molecules in the asymmetric unit, having closely comparable geometries. The dihedral angles between the 1H-pyrazole and benzene rings in the two molecules are 39.57 (14 and 41.95 (13°. The two molecules are each connected to neighbouring molecules by pairs of intermolecular O—H...N hydrogen bonds, forming dimers with R22(8 ring motifs. These dimers are further linked into R44(10 ring motifs by intermolecular N—H...O hydrogen bonds, forming chains along [101]. The crystal structure is further stabilized by a C—H...π interaction.

  10. Hydrogen as a Modifier of the Structure and Electronic Properties of Platinum in Acidic Zeolite. LTL: A Combined Infrared and X-ray Absorption Spectroscopy Study.

    NARCIS (Netherlands)

    Koningsberger, D.C.; Vaarkamp, M.; Mojet, B.L.; Kappers, M.J.; Miller, J.T.

    1995-01-01

    The structure and electronic properties of platinum in WH-LTL after reduction at 300 'C and heating in helium to 500 or 690 'C were determined using X-ray absorption and infrared spectroscopy. After reduction at 300 'C, the platinum particles were metallic, consisted of 4 or 5 atoms, and were locate

  11. LC-MS and 1H NMR as an improved dereplication tool to identify antifungal diterpenoids from Sagittaria latifolia

    Science.gov (United States)

    A dereplication strategy using a combination of liquid chromatography-mass spectrometry (LC-MS) and proton nuclear magnetic resonance spectroscopy (1H NMR) to facilitate compound identification towards antifungal natural product discovery is presented. This analytical approach takes advantage of th...

  12. The Conformations and Structures of 1H-NONAFLUOROBUTANE

    Science.gov (United States)

    Fournier, Joseph A.; Bohn, Robert K.; Montgomery, John A.; , Jr.

    2012-06-01

    The all trans conformers of perfluorocarbons, unlike hydrocarbons, are helical with C-C-C-C dihedral angles about 1640. Fluorocarbons with H substitution can replace chlorofluorocarbons as propellants and compressor fluids without the disadvantage of causing ozone depletion in the upper atmosphere. 1H-perfluorobutane, CHF_2CF_2CF_2CF_3, has been studied by pulsed-jet Fourier transform microwave spectroscopy. The spectrum is very rich. Quantum chemical calculations identify five stable conformers with relative energies up to 1.1 kcal/mol. Thus far three conformers have been characterized and many lines remain unassigned. The assigned species have CCCCanti/CCCH gauche as well as the anti/anti and gauche/anti forms. Rotational constant values are 1428.9501(2) MHz, 593.323877(6) MHz, and 546.43578(6) MHz for the anti/gauche species, 1323.664(3) MHz, 617.6051(5) MHz for the ant/anti species, and 1066.9384(4) MHz, 768.4736(4) MHz, and 671.3145(4) MHz for the gauche/anti form.

  13. Tacrine derivatives-acetylcholinesterase interaction: 1H NMR relaxation study.

    Science.gov (United States)

    Delfini, Maurizio; Di Cocco, Maria Enrica; Piccioni, Fabiana; Porcelli, Fernando; Borioni, Anna; Rodomonte, Andrea; Del Giudice, Maria Rosaria

    2007-06-01

    Two acetylcholinesterase (AChE) inhibitors structurally related to Tacrine, 6-methoxytacrine (1a) and 9-heptylamino-6-methoxytacrine (1b), and their interaction with Electrophorus Electricus AChE were investigated. The complete assignment of the 1H and 13C NMR spectra of 1a and 1b was performed by mono-dimensional and homo- and hetero-correlated two-dimensional NMR experiments. This study was undertaken to elucidate the interaction modes between AChE and 1a and 1b in solution, using NMR. The interaction between the two inhibitors and AChE was studied by the analysis of the motional parameters non-selective and selective spin-lattice relaxation times, thereby allowing the motional state of 1a and 1b, both free and bound with AChE, to be defined. The relaxation data pointed out the ligands molecular moiety most involved in the binding with AChE. The relevant ligand/enzyme interaction constants were also evaluated for both compounds and resulted to be 859 and 5412M(-1) for 1a and1b, respectively.

  14. Understanding Reverberation Lags in 1H0707-495

    CERN Document Server

    Zoghbi, A; Fabian, A C

    2010-01-01

    The first reverberation lag from the vicinity of a supermassive black hole was recently detected in the NLS1 galaxy 1H0707-495. We interpreted the lag as being due to reflection from matter close to the black hole, within a few gravitational radii of the event horizon (an inner reflector). It has since been claimed by Miller et al that the lag can be produced by more distant matter, at hundreds of gravitational radii (an outer reflector). Here, we critically explore their interpretation of the lag. The detailed energy dependence of the time lags between soft and hard energy bands is well modelled by an inner reflector using our previously published spectral model. A contrary claim by Miller et al was obtained by neglecting the blackbody component in the soft band. Soft lags can be produced by a large-scale outer reflector if several, implausible, conditions are met. An additional transfer function is required in the soft band corresponding to a region that is physically close to the continuum source, or lies ...

  15. The influence of sulfur configuration in (1) H NMR chemical shifts of diasteromeric five-membered cyclic sulfites.

    Science.gov (United States)

    Obregón-Mendoza, Marco A; Sánchez-Castellanos, Mariano; Cuevas, Gabriel; Gnecco, Dino; Cassani, Julia; Poveda-Jaramillo, Juan C; Reynolds, William F; Enríquez, Raúl G

    2017-03-01

    The effect of the stereochemistry of the sulfur atom on (1) H chemical shifts of the diasteromeric pair of cyclic sulfites of 4-[methoxy(4-nitrophenyl)methyl]-5-phenyl-1,3,2-dioxathiolan-2-oxide was investigated. The complete (1) H and (13) C NMR spectral assignment was achieved by the use of one-dimensional and two-dimensional NMR techniques in combination with X-ray data. A correlation of experimental data with theoretical calculations of chemical shift tensors using density functional theory and topological theory of atoms in molecules was made. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  16. Infrared thermography

    CERN Document Server

    Meola, Carosena

    2012-01-01

    This e-book conveys information about basic IRT theory, infrared detectors, signal digitalization and applications of infrared thermography in many fields such as medicine, foodstuff conservation, fluid-dynamics, architecture, anthropology, condition monitoring, non destructive testing and evaluation of materials and structures.

  17. Structural, electronic and vibrational properties of N,N'-1H,1H-perfluorobutyl dicyanoperylenecarboxydiimide (PDI-FCN2) crystal

    Science.gov (United States)

    Colle, Renato; Grosso, Giuseppe; Cassinese, Antonio; Centore, Roberto

    2013-09-01

    We present a theoretical and experimental investigation of the crystalline structure of N,N'-1H,1H-perfluorobutyl dicyanoperylenecarboxydiimide (PDI-FCN2) that has been deduced combining experimental XRD data, obtained from powders, with global-optimization algorithms which allow to identify Bravais lattice, primitive cell parameters, and space group of the crystal. The XRD spectrum calculated for the proposed crystalline structure very well reproduces the measured XRD data. Our results suggest the triclinic lattice structure of spatial groups Poverline{1} and P1, respectively, for the crystalline PDI-FCN2-1,7 and PDI-FCN2-1,6 isomers. In both cases, the primitive cell contains a single molecule. On the proposed crystalline structures, KS-DFT cell energy calculations, including van der Waals interactions, have been performed to assign the minimum energy geometrical structure and orientation of the molecule inside the corresponding primitive cell. These calculations evidence the molecular packing that characterizes the strong anisotropy of the PDI-FCN2 crystal. Electronic band-structures calculated for both isomers within the Kohn-Sham density-functional theory indicate that the crystalline Poverline{1} structure is an indirect gap semiconductor, while the P1 structure is a direct gap semiconductor. The electronic band structure calculations on the optimized crystal geometries highlight strong anisotropy in the dispersion curves E(k), which roots at the molecular packing in the crystal. Finally, the vibrational spectrum of both crystalline isomers has been calculated in the harmonic approximation and the dominant vibrational frequencies have been associated to collective motions of selected atoms in the molecules.

  18. Structural, electronic and vibrational properties of N,N'-1H,1H-perfluorobutyl dicyanoperylenecarboxydiimide (PDI-FCN2) crystal.

    Science.gov (United States)

    Colle, Renato; Grosso, Giuseppe; Cassinese, Antonio; Centore, Roberto

    2013-09-21

    We present a theoretical and experimental investigation of the crystalline structure of N,N'-1H,1H-perfluorobutyl dicyanoperylenecarboxydiimide (PDI-FCN2) that has been deduced combining experimental XRD data, obtained from powders, with global-optimization algorithms which allow to identify Bravais lattice, primitive cell parameters, and space group of the crystal. The XRD spectrum calculated for the proposed crystalline structure very well reproduces the measured XRD data. Our results suggest the triclinic lattice structure of spatial groups P1 and P1, respectively, for the crystalline PDI-FCN2-1,7 and PDI-FCN2-1,6 isomers. In both cases, the primitive cell contains a single molecule. On the proposed crystalline structures, KS-DFT cell energy calculations, including van der Waals interactions, have been performed to assign the minimum energy geometrical structure and orientation of the molecule inside the corresponding primitive cell. These calculations evidence the molecular packing that characterizes the strong anisotropy of the PDI-FCN2 crystal. Electronic band-structures calculated for both isomers within the Kohn-Sham density-functional theory indicate that the crystalline P1 structure is an indirect gap semiconductor, while the P1 structure is a direct gap semiconductor. The electronic band structure calculations on the optimized crystal geometries highlight strong anisotropy in the dispersion curves E(k), which roots at the molecular packing in the crystal. Finally, the vibrational spectrum of both crystalline isomers has been calculated in the harmonic approximation and the dominant vibrational frequencies have been associated to collective motions of selected atoms in the molecules.

  19. Application of 1H NMR for the characterisation of cocoa beans of different geographical origins and fermentation levels.

    Science.gov (United States)

    Caligiani, Augusta; Palla, Luigi; Acquotti, Domenico; Marseglia, Angela; Palla, Gerardo

    2014-08-15

    This study reports for the first time the use of (1)H NMR technique combined with chemometrics to study the metabolic profile of cocoa (Theobroma cacao L.) beans of different varieties, origin and fermentation levels. Results of PCA applied to cocoa bean (1)H NMR dataset showed that the main factor influencing the cocoa bean metabolic profile is the fermentation level. In fact well fermented brown beans form a group clearly separated from unfermented, slaty, and underfermented, violet, beans, independently of the variety or geographical origin. Considering only well fermented beans, the metabolic profile obtained by (1)H NMR permitted to discriminate between some classes of samples. The National cocoa of Ecuador, known as Arriba, showed the most peculiar characteristics, while the samples coming from the African region showed some similar traits. The dataset obtained, representative of all the classes of soluble compounds of cocoa, was therefore useful to characterise fermented cocoa beans as a function of their origin and fermentation level.

  20. 1H MAS and 1H --> 31P CP/MAS NMR study of human bone mineral.

    Science.gov (United States)

    Kaflak-Hachulska, A; Samoson, A; Kolodziejski, W

    2003-11-01

    Chemical structure of human bone mineral was studied by solid-state nuclear magnetic resonance (NMR) with magic-angle spinning (MAS). Trabecular and cortical bone samples from adult subjects were compared with mineral standards: hydroxyapatite (HA), hydrated and calcined, carbonatoapatite of type B with 9 wt% of CO3(2-) (CHA-B), brushite (BRU) and mixtures of HA with BRU. Proton spectra were acquired with excellent spectral resolution provided by ultra-high speed MAS at 40 kHz. 2D 1H-31P NMR heteronuclear correlation was achieved by cross-polarization (CP) under fast MAS at 12 kHz. 31P NMR was applied with CP from protons under slow MAS at 1 kHz. Appearance of 31P rotational sidebands together with their CP kinetics were analyzed. It was suggested that the sidebands of CP spectra are particularly suitable for monitoring the state of apatite crystal surfaces. The bone samples appeared to be deficient in structural hydroxyl groups analogous to those in HA. We found no direct evidence that the HPO4(2-) brushite-like ions are present in bone mineral. The latter problem is extensively discussed in the literature. The study proves there is a similarity between CHA-B and bone mineral expressed by their similar NMR behavior.

  1. Infrared upconversion hyperspectral imaging

    DEFF Research Database (Denmark)

    Kehlet, Louis Martinus; Tidemand-Lichtenberg, Peter; Dam, Jeppe Seidelin

    2015-01-01

    conversion process. From this, a sequence of monochromatic images in the 3.2-3.4 mu m range is generated. The imaged object consists of a standard United States Air Force resolution target combined with a polystyrene film, resulting in the presence of both spatial and spectral information in the infrared...

  2. Refined structure of a flexible heptasaccharide using {sup 1}H-{sup 13}C and {sup 1}H-{sup 1}H NMR residual dipolar couplings in concert with NOE and long range scalar coupling constants

    Energy Technology Data Exchange (ETDEWEB)

    Martin-Pastor, Manuel; Bush, C. Allen [University of Maryland-Baltimore County, Department of Chemistry and Biochemistry (United States)

    2001-02-15

    The heptasaccharide isolated from the cell wall polysaccharide of Streptococcus mitis J22 serves as an important model for the dynamics and conformation of complex polysaccharides, illustrating the nature of flexibility with rigid epitopes joined by flexible hinges. One-bond C-H residual dipolar couplings ({sup 1}D{sub CH}) and long-range H-H residual dipolar couplings ({sup n}D{sub HH}) were measured for the heptasaccharide in a cetylpyridinium chloride/hexanol/brine lamellar liquid crystal medium. A method is proposed to determine the {sup n}D{sub HH} in natural abundance based on a {sup 13}C resolved {sup 1}H TOCSY pulse sequence previously published to determine the homonuclear scalar couplings. Different methods for interpretation of the {sup 1}D{sub CH} and the {sup n}D{sub HH} residual dipolar coupling data obtained were compared and combined with the NOE and long-range H,C and C,C scalar couplings available for this heptasaccharide. A flexible model of the heptasaccharide was determined in which two structurally well-defined regions involving four and two sugar residues, respectively are joined by a flexible hinge which involves two 1{sup {yields}}6 glycosidic linkages.

  3. Refined structure of a flexible heptasaccharide using 1H-13C and 1H-1H NMR residual dipolar couplings in concert with NOE and long range scalar coupling constants.

    Science.gov (United States)

    Martin-Pastor, M; Bush, C A

    2001-02-01

    The heptasaccharide isolated from the cell wall polysaccharide of Streptococcus mitis J22 serves as an important model for the dynamics and conformation of complex polysaccharides, illustrating the nature of flexibility with rigid epitopes joined by flexible hinges. One-bond C-H residual dipolar couplings (1D(CH)) and long-range H-H residual dipolar couplings (nD(HH)) were measured for the heptasaccharide in a cetylpyridinium chloride/hexanol/brine lamellar liquid crystal medium. A method is proposed to determine the nD(HH) in natural abundance based on a 13C resolved 1H TOCSY pulse sequence previously published to determine the homonuclear scalar couplings. Different methods for interpretation of the 1D(CH) and the nD(HH) residual dipolar coupling data obtained were compared and combined with the NOE and long-range H,C and C,C scalar couplings available for this heptasaccharide. A flexible model of the heptasaccharide was determined in which two structurally well-defined regions involving four and two sugar residues, respectively are joined by a flexible hinge which involves two 1-->6 glycosidic linkages.

  4. Infrared Fiber Optic Sensors

    Science.gov (United States)

    1997-01-01

    Successive years of Small Business Innovation Research (SBIR) contracts from Langley Research Center to Sensiv Inc., a joint venture between Foster-Miller Inc. and Isorad, Ltd., assisted in the creation of remote fiber optic sensing systems. NASA's SBIR interest in infrared, fiber optic sensor technology was geared to monitoring the curing cycles of advanced composite materials. These funds helped in the fabrication of an infrared, fiber optic sensor to track the molecular vibrational characteristics of a composite part while it is being cured. Foster-Miller ingenuity allowed infrared transmitting optical fibers to combine with Fourier Transform Infrared spectroscopy to enable remote sensing. Sensiv probes operate in the mid-infrared range of the spectrum, although modifications to the instrument also permits its use in the near-infrared region. The Sensiv needle-probe is built to be placed in a liquid or powder and analyze the chemicals in the mixture. Other applications of the probe system include food processing control; combustion control in furnaces; and maintenance problem solving.

  5. Self-assembled 1-octadecyl-1H-benzimidazole film on copper surface for corrosion protection

    Indian Academy of Sciences (India)

    B V Appa Rao; M Marsihma Reddy

    2013-11-01

    Films of 1-octadecyl-1H-benzimidazole (OBI) have been formed on copper surface by selfassembly method. Optimum conditions viz. the solvent, concentration of OBI, immersion period and temperature for the formation of a protective film on copper have been established using impedance studies. The OBI film has been characterized by X-ray photoelectron spectroscopy, reflection absorption Fourier transform infrared (FTIR) spectroscopy, contact angle measurements and atomic force microscopy. Efficiency of the OBI film to protect copper from corrosion has been investigated in aq. HCl solution using electrochemical impedance spectroscopy, potentiodynamic polarization method, cyclic voltammetry, scanning electron microscopy and gravimetry. Results of these studies inferred that the OBI film has an inhibition efficiency in the range of 97-99% under different conditions. Polarization studies inferred that the OBI film functions as a cathodic inhibitor. Cyclic voltammetric studies showed that the film is stable even after 15 cycles, when the copper electrode is polarized to an anodic potential of 0.35V vs. Ag/AgCl electrode.

  6. Measurement of {sup 1}H-{sup 15}N and {sup 1}H-{sup 13}C residual dipolar couplings in nucleic acids from TROSY intensities

    Energy Technology Data Exchange (ETDEWEB)

    Ying Jinfa [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States); Wang Jinbu [National Cancer Institute, National Institutes of Health, Structural Biophysics Laboratory (United States); Grishaev, Alex [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States); Yu Ping; Wang Yunxing [National Cancer Institute, National Institutes of Health, Structural Biophysics Laboratory (United States); Bax, Ad, E-mail: bax@nih.gov [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States)

    2011-09-15

    Analogous to the recently introduced ARTSY method for measurement of one-bond {sup 1}H-{sup 15}N residual dipolar couplings (RDCs) in large perdeuterated proteins, we introduce methods for measurement of base {sup 13}C-{sup 1}H and {sup 15}N-{sup 1}H RDCs in protonated nucleic acids. Measurements are based on quantitative analysis of intensities in {sup 1}H-{sup 15}N and {sup 13}C-{sup 1}H TROSY-HSQC spectra, and are illustrated for a 71-nucleotide adenine riboswitch. Results compare favorably with those of conventional frequency-based measurements in terms of completeness and convenience of use. The ARTSY method derives the size of the coupling from the ratio of intensities observed in two TROSY-HSQC spectra recorded with different dephasing delays, thereby minimizing potential resonance overlap problems. Precision of the RDC measurements is limited by the signal-to-noise ratio, S/N, achievable in the 2D TROSY-HSQC reference spectrum, and is approximately given by 30/(S/N) Hz for {sup 15}N-{sup 1}H and 65/(S/N) Hz for {sup 13}C-{sup 1}H. The signal-to-noise ratio of both {sup 1}H-{sup 15}N and {sup 1}H-{sup 13}C spectra greatly benefits when water magnetization during the experiments is not perturbed, such that rapid magnetization transfer from bulk water to the nucleic acid, mediated by rapid amino and hydroxyl hydrogen exchange coupled with {sup 1}H-{sup 1}H NOE transfer, allows for fast repetition of the experiment. RDCs in the mutated helix 1 of the riboswitch are compatible with nucleotide-specifically modeled, idealized A-form geometry and a static orientation relative to the helix 2/3 pair, which differs by ca 6 Degree-Sign relative to the X-ray structure of the native riboswitch.

  7. Magnetic resonance imaging and {sup 1}H-magnetic resonance spectroscopy in amyotrophic lateral sclerosis

    Energy Technology Data Exchange (ETDEWEB)

    Sarchielli, P.; Gallai, V. [Neurological Clinic, Policlinico Monte Luce, Perugia (Italy); Pelliccioli, G.P.; Chiarini, P. [Dept. of Neuroradiology, Azienda Ospedaliera, Perugia (Italy); Tarducci, R.; Presciutti, O.; Gobbi, G. [Dept. of Medical Physics, Azienda Ospedaliera, Perugia (Italy)

    2001-03-01

    We aimed to increase confidence in the combined use of MRI and proton MR spectroscopy ({sup 1}H-MRS) in diagnosis of amyotrophic lateral sclerosis (ALS). We investigated 12 patients with ALS, seven definite and five probable, taking into account clinical measures of motor neuron function. On T2-weighted images we found high signal in the corticospinal tract in six and low signal in the primary motor cortex in seven of the 12 patients. Atrophy of the precentral gyrus was apparent in all the patients apart from one with probable ALS. Absolute quantification of cerebral metabolites using {sup 1}H-MRS demonstrated a significantly lower mean concentration of N-acetylaspartate (NAA) in the precentral gyrus of patients with probable and definite ALS (8.5 {+-} 0.62) than in control subjects (10.4 {+-} 0.71; P < 0.001). NAA concentration in primary motor cortex correlated with Norris scale scores (r = 0.30; P < 0.0001) but not with the ALS Functional Rating Scale score or disease duration. Significantly lower levels of NAA were detected in patients with low signal in the motor cortex than in those without (P < 0.01). Mean choline (Cho) and creatine (Cr) values did not differ between patients with ALS and controls. (orig.)

  8. Sterols associated with small unilamellar vesicles (SUVs): intrinsic mobility role for 1H NMR detection.

    Science.gov (United States)

    Mouret, Liza; Da Costa, Grégory; Bondon, Arnaud

    2014-07-01

    Small unilamellar vesicles (SUVs) of phospholipids are often used as a membrane model system for studying the interaction of molecules. When using NMR under the standard liquid-state conditions, SUV phospholipid proton spectra can be recorded, exhibiting sharp signals. This is not only because of the fast vesicular tumbling but also because of the combination of this tumbling with the individual motion of the lipids inside the bilayer. This appears evident because addition of cholesterol is responsible of broader resonances because of the slowing down of the lipid motion. On the other hand, no (1)H signal is detected for cholesterol in the bilayer. This lack of detection of the inserted molecules explains why generally SUVs are not considered as a good model for NMR studies under the standard liquid-state conditions. Here, we use two other sterols in order to demonstrate that an increase of the molecular mobility inside the bilayer could allow the detection of their proton resonances. For desmosterol and lanosterol, which show higher mobility inside the bilayer, with increasing lateral diffusion rates, (1)H sterol signals are detected in contrast to cholesterol. For the fast diffusing lanosterol, no significant improvement in detection is observed using deuterated lipids, demonstrating that homonuclear dipolar coupling is fully averaged out. Furthermore, in the case of low mobility such as for cholesterol, the use of a fast magic angle spinning probe is shown to be efficient to recover the full proton spectrum. Copyright © 2014 John Wiley & Sons, Ltd.

  9. Quantification of organic and amino acids in beer by 1H NMR spectroscopy.

    Science.gov (United States)

    Nord, Lars I; Vaag, Pia; Duus, Jens Ø

    2004-08-15

    The quantification of organic and amino acids in beer using 1H NMR spectroscopy is demonstrated. Quantification was made both by integration of signals in the spectra together with use of calibration references and by use of partial least-squares (PLS) regression. Results from the NMR quantifications were compared with those obtained from determinations by amino acid analysis on HPLC and organic acid analysis by capillary electrophoresis. The described NMR-based methods could satisfactorily be used for quantification of several of the investigated metabolites in beer down to approximately 10 mg/L and for most with a good to high accuracy compared to results obtained by HPLC and capillary electrophoresis (R2 0.90-0.99). This was achieved with a simple sample preparation and one-dimensional 1H NMR spectra obtained in a few minutes. The use of PLS clearly improves the accuracy of the quantifications, based on comparison to results obtained by HPLC and capillary electrophoresis, and furthermore permits the determination of components with partially overlapped signals in the spectrum. NMR spectroscopy in combination with PLS will be a useful tool for the quantification of metabolites, not only in beer but also in other beverages and biofluids.

  10. 1H NMR-based serum metabolic profiling in compensated and decompensated cirrhosis

    Institute of Scientific and Technical Information of China (English)

    Su-Wen Qi; Zhi-Guang Tu; Wu-Jian Peng; Lin-Xian Wang; Xin Ou-Yang; An-Ji Cai; Yong Dai

    2012-01-01

    AIM: To study the metabolic profiling of serum samples from compensated and decompensated cirrhosis patients.METHODS: A pilot metabolic profiling study was conducted using three groups: compensated cirrhosis patients (n = 30), decompensated cirrhosis patients (n = 30) and healthy controls (n = 30). A 1H nuclear magnetic resonance (NMR)-based metabonomics approach was used to obtain the serum metabolic profiles of the samples. The acquired data were processed by multivariate principal component analysis and orthogonal partial least-squares discriminant analysis (OPLS-DA). RESULTS: The OPLS-DA model was capable of distinguishing between decompensated and compensated cirrhosis patients, with an R2Y of 0.784 and a Q2Y of 0.598. Twelve metabolites, such as pyruvate, phenylalanine and succinate, were identified as the most influential factors for the difference between the two groups. The validation of the diagnosis prediction showed that the accuracy of the OPLSDA model was 85% (17/20). CONCLUSION: 1H NMR spectra combined with pattern recognition analysis techniques offer a new way to diagnose compensated and decompensated cirrhosis in the future.

  11. 1H NMR metabolite fingerprinting as a new tool for body fluid identification in forensic science.

    Science.gov (United States)

    Scano, Paola; Locci, Emanuela; Noto, Antonio; Navarra, Gabriele; Murgia, Federica; Lussu, Milena; Barberini, Luigi; Atzori, Luigi; De Giorgio, Fabio; Rosa, Maria Francesca; d'Aloja, Ernesto

    2013-08-01

    In this feasibility study, we propose, for the first time, (1)H NMR spectroscopy coupled with mathematical strategies as a valid tool for body fluid (BF) trace identification in forensic science. In order to assess the ability of this approach to identify traces composed either by a single or by two different BFs, samples of blood, urine, saliva, and semen were collected from different donors, and binary mixtures were prepared. (1)H NMR analyses were carried out for all samples. Spectral data of the whole set were firstly submitted to unsupervised principal component analysis (PCA); it showed that samples of the same BF cluster well on the basis of their characterizing molecular components and that mixtures exhibit intermediate characteristics among BF typologies. Furthermore, samples were divided into a training set and a test set. An average NMR spectral profile for each typology of BF was obtained from the training set and validated as representative of each BF class. Finally, a fitting procedure, based on a system of linear equations with the four obtained average spectral profiles, was applied to the test set and the mixture samples; it showed that BFs can be unambiguously identified, even as components of a mixture. The successful use of this mathematical procedure has the advantage, in forensics, of overcoming bias due to the analyst's personal judgment. We therefore propose this combined approach as a valid, fast, and non-destructive tool for addressing the challenges in the identification of composite traces in forensics.

  12. Infrared Imaging

    Science.gov (United States)

    Danchi, W.; Lawson, P.; Absil, O.; Akeson, R.; Bally, J.; Barry, R.; Beichman, C.; Belu, A.; Boyce, M.; Breckinridge, J.; Burrows, A.; Chen, C.; Cole, D.; Crisp, D.; Danner, R.; Deroo, P.; Coudé du Foresto, V.; Defrère, D.; Ebbets, D.; Falkowski, P.; Gappinger, R.; Haugabook, I.; Hanot, C.; Henning, T.; Hinz, P.; Hollis, J.; Hunyadi, S.; Hyland, D.; Johnston, K.; Kaltenegger, L.; Kasting, J.; Kenworthy, M.; Ksendzov, A.; Lane, B.; Laughlin, G.; Lay, O.; Liseau, R.; Lopez, B.; Millan-Gabet, R.; Martin, S.; Mawet, D.; Mennesson, B.; Monnier, J.; Murakami, N.; Noecker, C.; Nishikawa, J.; Pesesen, M.; Peters, R.; Quillen, A.; Ragland, S.; Rinehart, S.; Rottgering, H.; Scharf, D.; Serabyn, G.; Tamura, M.; Tehrani, M.; Traub, W.; Unwin, S.; Wilner, D.; Woilliez, J.; Woolf, N.; Zhao, M.

    2009-03-01

    A mid-infrared mission would enable the detection of biosignatures of Earth-like exoplanets around more than 150 nearby stars. The mid-infrared spectral region is attractive for characterizing exoplanets because contrast with the parent star brightness is more favorable than in the visible (10 million vs. 10 billion), and because mid-infrared light probes deep into a planet's troposphere. Furthermore, the mid-infrared offers access to several strong molecular features that are key signs of life, and also provides a measure of the effective temperature and size of a planet. Taken together, an infrared mission plus a visible one would provide a nearly full picture of a planet, including signs of life; with a measure of mass from an astrometric mission, we would have a virtually complete picture. A small infrared mission would have several telescopes that are rigidly connected, with a science return from the detection and characterization of super-Earth sized to larger planets near the HZ, plus a direct measure of the exozodi brightness in the HZ. In a large infrared mission, with formation-flying telescopes, planets from an Earth-twin and upwards in mass could be detected and characterized, as well as the exozodi. If proceeded by an astrometric mission, the detection phase could be skipped and the mission devoted to characterization, as in the visible case; lacking an astrometric mission, an infrared one could proceed alone, as was discussed for a visible coronograph, and with similar caveats. The technology needed for a large formation-flying mission is similar to that for a small connected-element one (e.g., cryogenics and detectors), with the addition of formationflying technology. The technology is now in hand to implement a probe-scale mission; starlight suppression has even been demonstrated to meet the requirements of a flagship mission. However, additional development of formation-flying technology is needed, particularly in-space testing of sensors and

  13. Simultaneous 19F-1H medium resolution NMR spectroscopy for online reaction monitoring

    Science.gov (United States)

    Zientek, Nicolai; Laurain, Clément; Meyer, Klas; Kraume, Matthias; Guthausen, Gisela; Maiwald, Michael

    2014-12-01

    Medium resolution nuclear magnetic resonance (MR-NMR) spectroscopy is currently a fast developing field, which has an enormous potential to become an important analytical tool for reaction monitoring, in hyphenated techniques, and for systematic investigations of complex mixtures. The recent developments of innovative MR-NMR spectrometers are therefore remarkable due to their possible applications in quality control, education, and process monitoring. MR-NMR spectroscopy can beneficially be applied for fast, non-invasive, and volume integrating analyses under rough environmental conditions. Within this study, a simple 1/16″ fluorinated ethylene propylene (FEP) tube with an ID of 0.04″ (1.02 mm) was used as a flow cell in combination with a 5 mm glass Dewar tube inserted into a benchtop MR-NMR spectrometer with a 1H Larmor frequency of 43.32 MHz and 40.68 MHz for 19F. For the first time, quasi-simultaneous proton and fluorine NMR spectra were recorded with a series of alternating 19F and 1H single scan spectra along the reaction time coordinate of a homogeneously catalysed esterification model reaction containing fluorinated compounds. The results were compared to quantitative NMR spectra from a hyphenated 500 MHz online NMR instrument for validation. Automation of handling, pre-processing, and analysis of NMR data becomes increasingly important for process monitoring applications of online NMR spectroscopy and for its technical and practical acceptance. Thus, NMR spectra were automatically baseline corrected and phased using the minimum entropy method. Data analysis schemes were designed such that they are based on simple direct integration or first principle line fitting, with the aim that the analysis directly revealed molar concentrations from the spectra. Finally, the performance of 1/16″ FEP tube set-up with an ID of 1.02 mm was characterised regarding the limit of detection (LOQ (1H) = 0.335 mol L-1 and LOQ (19F) = 0.130 mol L-1 for trifluoroethanol in

  14. Synthesis of 1H-indazoles and 1H-pyrazoles via FeBr3/O2 mediated intramolecular C-H amination.

    Science.gov (United States)

    Zhang, Tianshui; Bao, Weiliang

    2013-02-01

    A new synthesis of substituted 1H-indazoles and 1H-pyrazoles from arylhydrazones via FeBr(3)/O(2) mediated C-H activation/C-N bond formation reactions is reported. The corresponding 1,3-diaryl-substituted indazoles and trisubstituted pyrazoles were obtained in moderate to excellent yields under mild conditions.

  15. A novel high-temperature furnace for combined in situ synchrotron X-ray diffraction and infrared thermal imaging to investigate the effects of thermal gradients upon the structure of ceramic materials

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, James B.; Brown, Leon D.; Jervis, Rhodri; Taiwo, Oluwadamilola O.; Millichamp, Jason; Mason, Thomas J.; Neville, Tobias P. [UCL, London WC1E 7JE (United Kingdom); Eastwood, David S. [Rutherford Appleton Laboratory, Didcot, Oxfordshire OX11 0FA (United Kingdom); University of Manchester, Oxford Road, Manchester M13 9PL (United Kingdom); Reinhard, Christina [Diamond Light Source, Harwell Science and Innovation Campus, Didcot, Oxfordshire OX11 0DE (United Kingdom); Lee, Peter D. [Rutherford Appleton Laboratory, Didcot, Oxfordshire OX11 0FA (United Kingdom); University of Manchester, Oxford Road, Manchester M13 9PL (United Kingdom); Brett, Daniel J. L.; Shearing, Paul R., E-mail: p.shearing@ucl.ac.uk [UCL, London WC1E 7JE (United Kingdom)

    2014-08-15

    A combined X-ray diffraction and thermal imaging technique is described to investigate the effect of thermal gradients on high-temperature composite materials. A new technique combining in situ X-ray diffraction using synchrotron radiation and infrared thermal imaging is reported. The technique enables the application, generation and measurement of significant thermal gradients, and furthermore allows the direct spatial correlation of thermal and crystallographic measurements. The design and implementation of a novel furnace enabling the simultaneous thermal and X-ray measurements is described. The technique is expected to have wide applicability in material science and engineering; here it has been applied to the study of solid oxide fuel cells at high temperature.

  16. A Combined Synchrotron-Based High Resolution FTIR and Diode Laser Jet Infrared Spectroscopy Study of the Chiral Molecule CDBrClF

    Science.gov (United States)

    Albert, S.; Albert, K. Keppler; Quack, M.; Lerch, Ph.; Boudon, V.

    2013-06-01

    The experimental detection of molecular parity violation Δ_{PV}E is of great interest because of its importance in the understanding of fundamental aspects of molecular dynamics and symmetries. One possible method for this is measuring rovibrational or rotational frequency shifts in the infrared or microwave spectra of enantiomers. For that reason we have measured and analysed the rotationally resolved infrared spectrum of CDBrClF as a prototype spectrum for a chiral molecule using three different techniques. The spectrum has been recorded at room temperature with the Zurich Bruker IFS spectrometer ZP 2001 and with the Bruker interferometer 2009 connected to the Swiss synchrotron using a resolution of 0.0007 cm^{-1}. In addition, the IR spectrum of CDBrClF has been measured at low temperature with our diode laser jet setup in the ν_5 region. The spectra of the two major isotopomers CD^{81}Br^{35}ClF and CD^{79}Br^{35}ClF have been analysed within the ν_5 (CCl-stretch), ν_4 (CF-stretch) and ν_3 (CDF-bend) regions. A detailed rovibrational analysis of these bands is presented. The role for possible experiments in the experimental detection of molecular parity violation shall be discussed. M. Quack, Fundamental symmetries and symmetry violations in Handbook of High Resolution Spectroscopy, Vol. 1(Eds. M. Quack and F. Merkt), Wiley, Chichester, New York 2011, 659-722, M. Quack, J. Stohner and M. Willeke, Annu. Rev. Phys. Chem. 2008, 59, 741, A. Bakasov, T.K. Ha, and M. Quack, J. Chem. Phys. 1998, 109, 7263, R. Berger and M. Quack, J. Chem. Phys, 2000, 112, 3148. M. Quack and J. Stohner, Phys. Rev. Lett. 2000, 84, 3807, M. Quack and J. Stohner. J. Chem. Phys., 2003, 119, 11228. S. Albert, K. Keppler Albert and M. Quack, High Resolution Fourier Transform Infrared Spectroscopy in Handbook of High Resolution Spectroscopy, Vol. 2 (Eds. M. Quack and F. Merkt), Wiley, Chichester, New York 2011, 965-1019, S. Albert and M. Quack, ChemPhysChem, 2007, 8, 1271-1281. S. Albert

  17. High-resolution /sup 1/H NMR study of the solution structure of delta-hemolysin

    Energy Technology Data Exchange (ETDEWEB)

    Tappin, M.J.; Pastore, A.; Norton, R.S.; Freer, J.H.; Campbell, I.D.

    1988-03-08

    The 26-residue toxin from Staphylococcus aureus delta-hemolysin, is thought to act by traversing the plasma membrane. The structure of this peptide, in methanol solution, has been investigated by using high-resolution NMR in combination with molecular dynamics calculations. The /sup 1/H NMR spectrum has been completely assigned, and it is shown that residues 2-20 form a relatively stable helix while the residues at the C-terminal end appear to be more flexible. The structures were calculated only from nuclear Overhauser effect data and standard bond lengths. It is shown that the results are consistent with /sup 3/J/sub NH-..cap alpha..CH/ coupling constants and amide hydrogen exchange rates.

  18. 1H and 15N Dynamic Nuclear Polarization Studies of Carbazole

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Jian Zhi; Solum, Mark S.; Wind, Robert A.; Nilsson, Brad L.; Peterson, Matt A.; Pugmire, Ronald J.; Grant, David M.

    2000-01-01

    15N NMR experiments, combined with dynamic nuclear polarization (DNP), are reported on carbazole doped with the stable free radical 1,3 bisdiphenylene-2 phenylally1 (BDPA). Doping shortens the nuclear relaxation times and provides paramagnetic centers that can be used to enhance the nuclear signal by means of DNP so that 15 N NMR experiments can be done in minutes. The factors were measured in a 1.4 T external field, using both unlabeled and 98% 15N labeled carbazole with doping levels varying between 0.65 and 5.0 wt % BDPA. A doping level of approximately 1 wt % produced optimal results. DNP enhancement factors of 35 and 930 were obtained for 1H and 15N, respectively making it possible to perform 15N DNP NMR experiments at the natural abundance level.

  19. Experimental and theoretical investigation of optical nonlinearities in (nitrovinyl)-1H-pyrazole derivative

    Science.gov (United States)

    Dwivedi, Y.; de Boni, L.; Gonçalves, P. J.; Mairink, L. M.; Menegatti, R.; Fonseca, T. L.; Zilio, S. C.

    2013-03-01

    This work reports on the optical nonlinearities of a newly synthesized pyrazole derivative, namely (E)-1-(4-chlorophenyl)-4-(2-nitrovinyl)-1H-pyrazole. The Z-scan technique with femtosecond laser pulses was used to determine the two-photon absorption (2PA) cross-section spectrum, which presents a maximum of 67 GM at 690 nm. We have combined hyper-Rayleigh scattering (HRS) experiments and second-order Møller-Plesset perturbation theory (MP2) calculations to study the first hyperpolarizability (βHRS). It was found that the MP2/6-311+G(d) model, taking into account solvent and dispersion effects, provides the βHRS value of 40 × 10-30 cm5/esu for the compound, in good agreement with the experimental result of 45 ± 2 × 10-30 cm5/esu.

  20. Infrared source test

    Energy Technology Data Exchange (ETDEWEB)

    Ott, L.

    1994-11-15

    The purpose of the Infrared Source Test (IRST) is to demonstrate the ability to track a ground target with an infrared sensor from an airplane. The system is being developed within the Advance Technology Program`s Theater Missile Defense/Unmanned Aerial Vehicle (UAV) section. The IRST payload consists of an Amber Radiance 1 infrared camera system, a computer, a gimbaled mirror, and a hard disk. The processor is a custom R3000 CPU board made by Risq Modular Systems, Inc. for LLNL. The board has ethernet, SCSI, parallel I/O, and serial ports, a DMA channel, a video (frame buffer) interface, and eight MBytes of main memory. The real-time operating system VxWorks has been ported to the processor. The application code is written in C on a host SUN 4 UNIX workstation. The IRST is the result of a combined effort by physicists, electrical and mechanical engineers, and computer scientists.

  1. 2-(1H-Indol-3-yl)acetohydrazide.

    Science.gov (United States)

    Sidra, Lala Rukh; Khan, Islam Ullah; Yar, Muhammad; Simpson, Jim

    2012-11-01

    In the title compound C(10)H(11)N(3)O, the mean plane of the indole ring system (r.m.s. deviation 0.0131 Å) subtends a dihedral angle of 87.27 (5)° to the almost planar acetohydrazide substituent (r.m.s. deviation 0.0291 Å). In the crystal, bifurcated N-H⋯(O,N) and N-H⋯N hydrogen bonds involving the pyrrole N-H grouping combine to form zigzag chains along a. Additional N-H⋯O contacts from the hydrazide N-H group augmented by C-H⋯π inter-actions link the mol-ecules into chains along the a axis. The overall effect of these contacts is a three-dimensional network structure with mol-ecules stacked along the b-axis direction.

  2. Diagnosis of glioma by multivoxel 1H-MRSI

    Institute of Scientific and Technical Information of China (English)

    QUAN Hong; LIU Yue; BAO Shanglian; LI Shaowu; XIE Yaoqin; MIAO Binghe; WANG Huiliang

    2004-01-01

    Glioma is one of the most malignant tumors due to its special construction of the glia cells and its character of infiltration. The usual procedure of the treatment is the surgical resection followed by radiotherapy with or without chemotherapy. This combined treatment needs the precise information on the extent of the tumor's infiltration and tumor grading, and then the determination can be made as to when, where and what kind of treatment should be used. Functional imaging modalities display advantages in defining the heterogeneous characters and histological grade. This paper describes how the ratios of Cho/NAA and Lac/NAA measured by magnetic resonance spectroscopy imaging (MRSI) could be used to define the cancer cell distribution in tissues, tumor burden and malignancy, and the results are proved to be consistent with the histological observation.

  3. Combining microdialysis and near-infrared spectroscopy for studying effects of low-load repetitive work on the intramuscular chemistry in trapezius myalgia.

    Science.gov (United States)

    Flodgren, Gerd M; Crenshaw, Albert G; Hellström, Fredrik; Fahlström, Martin

    2010-01-01

    Epidemiological research provides strong evidence for a link between repetitive work (RW) and the development of chronic trapezius myalgia (TM). The aims were to further elucidate if an accumulation of sensitising substances or impaired oxygenation is evident in painful muscles during RW. Females with TM (n = 14) were studied during rest, 30 minutes RW and 60 minutes recovery. Microdialysate samples were obtained to determine changes in intramuscular microdialysate (IMMD) [glutamate], [PGE(2)], [lactate], and [pyruvate] (i.e., [concentration]) relative to work. Muscle oxygenation (%StO(2)) was assessed using near-infrared spectroscopy. During work, all investigated substances, except PGE(2), increased significantly: [glutamate] (54%, P work indicate normal increase in metabolism but no ongoing inflammation in subjects with TM.

  4. Combination of temporal phase unwrapping and long-wave infrared digital holographic interferometry for metrology of mosaic detector under space simulated conditions

    Science.gov (United States)

    Vandenrijt, Jean-François; Thizy, Cédric; Beaumont, Florent; Garcia, José; Martin, Laurent; Fabron, Christophe; Prieto, Eric; Maciaszek, Thierry; Georges, Marc P.

    2015-08-01

    We present digital holographic interferometry (DHI) in the long-wave infrared for monitoring the deformation under cryogenic conditions of a segmented focal plane array to be used in a space mission. The long wavelength was chosen for its ability to allow measurement of displacements 20 times larger than DHI in the visible and which were foreseen with the test object under such temperature changes. The specimen consists of 4x4 mosaic of detectors assembled on a frame. It was required to assess the global deformation of the ensemble, the deformation of each detector, and piston movements of each of them with respect to their neighbors. For that reason we incorporated the temporal phase unwrapping by capturing a sufficiently high number of holograms between which the phase does not suffer strong variations. At last since the specimen exhibit specular reflectivity at that wavelength, it is illuminated through a reflective diffuser.

  5. Kinetics of the addition reaction of methyl radicals with nitric oxide studied by pulse radiolysis combined with infrared diode laser spectroscopy

    DEFF Research Database (Denmark)

    Jodkowski, J.T.; Ratajczak, E.; Sillesen, A.

    1993-01-01

    The reaction CH3 + NO (+ M) --> CH3NO ( + M) was initiated by pulse radiolysis of acetone/nitric oxide mixtures and the kinetics of methyl radicals was studied by time-resolved infrared absorption spectroscopy. The rate constant was found to be strongly pressure dependent in the range of p (M) = 6.......5-150 mbar at 298 K with M = acetone as the third body. The experimental results are represented in terms of a fall-off curve centered at 37 mbar with limiting high- and low-pressure rate constants of k(rec,infinity) = (6.6 +/- 0.9) x 10(9) x (T/300)0.6 M-1 s-1 and k(rec,0)/[M] = (4.4 +/- 0.4) x 10(12) x (T...

  6. Experience of 654-2 Hydrochloride Needle Combined with Infrared Irradiation in Treating Diabetic Foot Care%盐酸654-2针联合红外线照射治疗糖尿病足的护理

    Institute of Scientific and Technical Information of China (English)

    张文芳

    2014-01-01

    目的通过观察盐酸654-2针联合红外线照射治疗糖尿病足,探讨糖尿病足的护理方法,从而降低致残率。方法选择20例糖尿病足患者,通过外敷盐酸654-2针及红外线照射治疗,观察不同程度糖尿病足患者治疗效果。结果应用盐酸654-2针及红外线照射治疗后,糖尿病足得到了控制或治愈。如痛觉迟钝、足背动脉搏动减弱者全部治愈;足部水泡者全部治愈;足部溃疡达真皮者全部治愈,达骨关节者治愈率80豫。结论用盐酸654-2针联合红外线照射治疗糖尿病足是行之有效的治疗方法。%Objective Through the observation of hydrochloric acid 654-2 needle combined with infrared irradiation treatment of diabetic foot, diabetic foot care, so as to reduce the rate of disability. Methods 20 patients with diabetic foot, through the topical hydrochloric acid 654-2 needle and infra-red radiation treatment, to observe the degree of ef ect of treatment of diabetic foot patients. Results The application of 654-2 needle and infrared radiation therapy, diabetic foot under control or cure. If the dull pain, dorsalis pedis artery decreased were al cured; foot blisters were al cured; foot ulcer of dermis were al cured, the cure rate was 80% of bone joint. Conclusion The treatment with hydrochloric acid 654-2 needle combined with infrared irradiation is an ef ective method for treatment of diabetic foot.

  7. Determination of the Degree of Degradation of Frying Rapeseed Oil Using Fourier-Transform Infrared Spectroscopy Combined with Partial Least-Squares Regression

    National Research Council Canada - National Science Library

    Chen, Jie Yu; Zhang, Han; Ma, Jinkui; Tuchiya, Tomohiro; Miao, Yelian

    2015-01-01

    ...) spectroscopy combined with partial least-squares (PLS) regression. One hundred and fifty-six frying oil samples that degraded to different degrees by frying potatoes were scanned by an FTIR spectrometer using attenuated total reflectance (ATR...

  8. Synthesis and Characterization of Novel 1H-Indazole Derivatives%1H-吲唑类中间体的合成及表征

    Institute of Scientific and Technical Information of China (English)

    周淑晶; 李长胜; 关文碧; 武晓丽; 刘雪; 马永强

    2013-01-01

    以取代邻甲苯胺为原料经乙酰化、溴化、环合及胺解反应得到1H-吲唑类化合物,再与酸酐、碘乙烷或硝酸反应以较高收率合成了15个1H-吲唑衍生物,其中12个未见文献报道.其结构经1H NMR、IR表征确认.

  9. Quality evaluation and prediction of Citrullus lanatus by 1H NMR-based metabolomics and multivariate analysis.

    Science.gov (United States)

    Tarachiwin, Lucksanaporn; Masako, Osawa; Fukusaki, Eiichiro

    2008-07-23

    (1)H NMR spectrometry in combination with multivariate analysis was considered to provide greater information on quality assessment over an ordinary sensory testing method due to its high reliability and high accuracy. The sensory quality evaluation of watermelon (Citrullus lanatus (Thunb.) Matsum. & Nakai) was carried out by means of (1)H NMR-based metabolomics. Multivariate analyses by partial least-squares projections to latent structures-discrimination analysis (PLS-DA) and PLS-regression offered extensive information for quality differentiation and quality evaluation, respectively. The impact of watermelon and rootstock cultivars on the sensory qualities of watermelon was determined on the basis of (1)H NMR metabolic fingerprinting and profiling. The significant metabolites contributing to the discrimination were also identified. A multivariate calibration model was successfully constructed by PLS-regression with extremely high reliability and accuracy. Thus, (1)H NMR-based metabolomics with multivariate analysis was considered to be one of the most suitable complementary techniques that could be applied to assess and predict the sensory quality of watermelons and other horticultural plants.

  10. Structural, vibrational and NMR spectroscopic investigations of newly synthesized 3-((ethylthio)(4-nitrophenyl)methyl)-1H-indole

    Science.gov (United States)

    Bhat, Sheeraz Ahmad; Dar, Ajaz A.; Ahmad, Shabbir; Khan, Abu T.

    2017-10-01

    The compound 3-((ethylthio)(4-nitrophenyl)methyl)-1H-indole was synthesized at room temperature through one-pot three-component reaction from 1H-indole, 4-nitrobenzaldehyde, and ethanethiol using hydrated ferric sulfate as a Lewis acid catalyst. The structure was characterised by single crystal XRD, FTIR (4000-400 cm-1), FT-Raman (4000-50 cm-1) and 1H and 13C NMR analysis. The compound crystallizes in the monoclinic with volume 3238.3(9) Å3. The experimental vibrational data find the theoretical support through anharmonic frequency calculations using DFT/B3LYP level of theory in combination with 6-31G(d,p) basis set. It is observed that the predicted geometry well reproduces the XRD structural parameters. The experimental 1H and 13C NMR spectra in CDCl3 solvent and the simulated spectra predicted using gauge independent atomic orbital (GIAO) approach are also found in agreement with each other. HOMO-LUMO, MEP, atomic charges and various other thermodynamic and NLO properties of the title molecule are also reported in this paper.

  11. Application of cryoprobe 1H nuclear magnetic resonance spectroscopy and multivariate analysis for the verification of corsican honey.

    Science.gov (United States)

    Donarski, James A; Jones, Stephen A; Charlton, Adrian J

    2008-07-23

    Proton nuclear magnetic resonance spectroscopy ((1)H NMR) and multivariate analysis techniques have been used to classify honey into two groups by geographical origin. Honey from Corsica (Miel de Corse) was used as an example of a protected designation of origin product. Mathematical models were constructed to determine the feasibility of distinguishing between honey from Corsica and that from other geographical locations in Europe, using (1)H NMR spectroscopy. Honey from 10 different regions within five countries was analyzed. (1)H NMR spectra were used as input variables for projection to latent structures (PLS) followed by linear discriminant analysis (LDA) and genetic programming (GP). Models were generated using three methods, PLS-LDA, two-stage GP, and a combination of PLS and GP (PLS-GP). The PLS-GP model used variables selected by PLS for subsequent GP calculations. All models were generated using Venetian blind cross-validation. Overall classification rates for the discrimination of Corsican and non-Corsican honey of 75.8, 94.5, and 96.2% were determined using PLS-LDA, two-stage GP, and PLS-GP, respectively. The variables utilized by PLS-GP were related to their (1)H NMR chemical shifts, and this led to the identification of trigonelline in honey for the first time.

  12. Innovative analytical methodology combining micro-x-ray diffraction, scanning electron microscopy-based mineral maps, and diffuse reflectance infrared fourier transform spectroscopy to characterize archeological artifacts.

    Science.gov (United States)

    Cardell, Carolina; Guerra, Isabel; Romero-Pastor, Julia; Cultrone, Giuseppe; Rodriguez-Navarro, Alejandro

    2009-01-15

    Excavations at the 14th century Moorish rampart (Granada, Spain) unearthed a brick oven alongside black ash and bone stratigraphic layers. In situ evidence suggests the oven served to fabricate a wall coating including powdered burnt bones. Original ad hoc analyses improved on conventional methods were used to confirm this hypothesis. These methods enable (i) nondestructive micro-X-ray diffraction (mu-XRD) for fast mineralogical data acquisition (approximately 10 s) and moderately high spatial (approximately 500 microm) resolution and (ii) identification and imaging of crystalline components in sample cross-sections via mineral maps, yielding outstanding visualization of grain distribution and morphology in composite samples based on scanning electron microscopy-energy dispersion X-ray spectrometry (SEM-EDX) elemental maps. Benefits are shown for applying diffuse reflectance infrared Fourier transform spectroscopy (DRIFTS) vs transmittance-FT-IR (T-FT-IR) to analyze organic and inorganic components in single samples. Complementary techniques to fully characterize artifacts were gas chromatography/mass spectroscopy (GC/MS), optical microscopy (OM), conventional powder XRD, and (14)C dating. Bone-hydroxyapatite was detected in the coating. Mineralogical transformations in the bricks indicate oven temperatures well above 1000 degrees C, supporting the hypothesis.

  13. Near-Infrared Spectroscopy Combined with Multivariate Calibration to Predict the Yield of Sesame Oil Produced by Traditional Aqueous Extraction Process

    Directory of Open Access Journals (Sweden)

    Yong-Dong Xu

    2017-01-01

    Full Text Available Sesame oil produced by the traditional aqueous extraction process (TAEP has been recognized by its pleasant flavor and high nutrition value. This paper developed a rapid and nondestructive method to predict the sesame oil yield by TAEP using near-infrared (NIR spectroscopy. A collection of 145 sesame seed samples was measured by NIR spectroscopy and the relationship between the TAEP oil yield and the spectra was modeled by least-squares support vector machine (LS-SVM. Smoothing, taking second derivatives (D2, and standard normal variate (SNV transformation were performed to remove the unwanted variations in the raw spectra. The results indicated that D2-LS-SVM (4000–9000 cm−1 obtained the most accurate calibration model with root mean square error of prediction (RMSEP of 1.15 (%, w/w. Moreover, the RMSEP was not significantly influenced by different initial values of LS-SVM parameters. The calibration model could be helpful to search for sesame seeds with higher TAEP oil yields.

  14. [Application of near infrared spectroscopy combined with particle swarm optimization based least square support vactor machine to rapid quantitative analysis of Corni Fructus].

    Science.gov (United States)

    Liu, Xue-song; Sun, Fen-fang; Jin, Ye; Wu, Yong-jiang; Gu, Zhi-xin; Zhu, Li; Yan, Dong-lan

    2015-12-01

    A novel method was developed for the rapid determination of multi-indicators in corni fructus by means of near infrared (NIR) spectroscopy. Particle swarm optimization (PSO) based least squares support vector machine was investigated to increase the levels of quality control. The calibration models of moisture, extractum, morroniside and loganin were established using the PSO-LS-SVM algorithm. The performance of PSO-LS-SVM models was compared with partial least squares regression (PLSR) and back propagation artificial neural network (BP-ANN). The calibration and validation results of PSO-LS-SVM were superior to both PLS and BP-ANN. For PSO-LS-SVM models, the correlation coefficients (r) of calibrations were all above 0.942. The optimal prediction results were also achieved by PSO-LS-SVM models with the RMSEP (root mean square error of prediction) and RSEP (relative standard errors of prediction) less than 1.176 and 15.5% respectively. The results suggest that PSO-LS-SVM algorithm has a good model performance and high prediction accuracy. NIR has a potential value for rapid determination of multi-indicators in Corni Fructus.

  15. Shedding new light on the molecular architecture of oocytes using a combination of synchrotron Fourier transform-infrared and Raman spectroscopic mapping.

    Science.gov (United States)

    Wood, Bayden R; Chernenko, Tatyana; Matthäus, Christian; Diem, Max; Chong, Connie; Bernhard, Uditha; Jene, Cassandra; Brandli, Alice A; McNaughton, Don; Tobin, Mark J; Trounson, Alan; Lacham-Kaplan, Orly

    2008-12-01

    Synchrotron Fourier transform-infrared (FT-IR) and Raman microspectroscopy were applied to investigate changes in the molecular architecture of mouse oocytes and demonstrate the overall morphology of the maturing oocyte. Here we show that differences were identified between immature mouse oocytes at the germinal vesicle (GV) and mature metaphase II (MII) stage when using this technology, without the introduction of any extrinsic markers, labels, or dyes. GV mouse oocytes were found to have a small, centrally located lipid deposit and another larger polar deposit of similar composition. MII oocytes have very large, centrally located lipid deposits. Each lipid deposit for both cell types contains an inner and outer lipid environment that differs in composition. To assess interoocyte variability, line scans were recorded across the diameter of the oocytes and compared from three independent trials (GV, n = 91; MII, n = 172), and the data were analyzed with principal component analysis (PCA). The average spectra and PCA loading plots show distinct and reproducible changes in the CH stretching region that can be used as molecular maturation markers. The method paves the way for developing an independent assay to assess oocyte status during maturation providing new insights into lipid distribution at the single cell level.

  16. Multivariate Curve Resolution Combined with On-line Infrared Spectroscopy for Researching the Synthesis Mechanism of 3,4-Bis(4'-aminofurazano-3')furoxan

    Institute of Scientific and Technical Information of China (English)

    WU Nan; SUN Kun-lun; LIU Yu; YANG Xiao-feng; LI Hua

    2013-01-01

    3,4-Bis(4'-aminofurazano-3')furoxan(DATF),one of a new generation of high energy density materials,shows lots of interesting properties such as lower sensitivity,excellent thermal stability and superior detonation performance in chemistry and physics.In this paper,on-line infrared(IR) spectroscopy was used to monitor the synthesis process of DATF.The concentration profiles and IR spectra of the components were determined by analyzing the IR data via principal component analysis(PCA),evolving factor analysis(EFA) and multivariate curve resolution-alternating least squares(MCR-ALS).The geometric configurations of reactant,intermediates and product were optimized with the density functional theory(DFT) at B3LYP/6-3 1+G(d,p) level.Their vibrational frequencies and IR spectra were obtained on the basis of vibrational analysis.The result obtained by the chemometric resolution methods agreed well with that obtained by quantum chemical calculation method,which demonstrated the reliability of the proposed chemometric resolution methods.The unstable intermediate 3-amino-4-oxycyanofurazan(AOF) was confirmed via comparing the IR spectra resloved by chemometric resolution methods with those calculated by B3LYP/6-31+G(d,p) and analyzed by MCR-ALS.Finally,the possible synthesis mechanism of DATF was deduced by analyzing the above 1R spectra.

  17. The effect of hydrogen bonding on torsional dynamics: A combined far-infrared jet and matrix isolation study of methanol dimer

    Energy Technology Data Exchange (ETDEWEB)

    Kollipost, F.; Heger, M.; Suhm, M. A. [Institut für Physikalische Chemie, Universität Göttingen, Tammannstr. 6, D-37077 Göttingen (Germany); Andersen, J.; Mahler, D. W.; Wugt Larsen, R., E-mail: rewl@kemi.dtu.dk [Department of Chemistry, Technical University of Denmark, Kemitorvet 206, DK-2800 Kgs. Lyngby (Denmark); Heimdal, J. [MAX-IV Laboratory, Lund University, P. O. Box 118, SE-22100 Lund (Sweden)

    2014-11-07

    The effect of strong intermolecular hydrogen bonding on torsional degrees of freedom is investigated by far-infrared absorption spectroscopy for different methanol dimer isotopologues isolated in supersonic jet expansions or embedded in inert neon matrices at low temperatures. For the vacuum-isolated and Ne-embedded methanol dimer, the hydrogen bond OH librational mode of the donor subunit is finally observed at ∼560 cm{sup −1}, blue-shifted by more than 300 cm{sup −1} relative to the OH torsional fundamental of the free methanol monomer. The OH torsional mode of the acceptor embedded in neon is observed at ∼286 cm{sup −1}. The experimental findings are held against harmonic predictions from local coupled-cluster methods with single and double excitations and a perturbative treatment of triple excitations [LCCSD(T)] and anharmonic. VPT2 corrections at canonical MP2 and density functional theory (DFT) levels in order to quantify the contribution of vibrational anharmonicity for this important class of intermolecular hydrogen bond vibrational motion.

  18. Carcinogenic damage to deoxyribonucleic acid is induced by near-infrared laser pulses in multiphoton microscopy via combination of two- and three-photon absorption

    Science.gov (United States)

    Nadiarnykh, Oleg; Thomas, Giju; Van Voskuilen, Johan; Sterenborg, Henricus J. C. M.; Gerritsen, Hans C.

    2012-11-01

    Nonlinear optical imaging modalities (multiphoton excited fluorescence, second and third harmonic generation) applied in vivo are increasingly promising for clinical diagnostics and the monitoring of cancer and other disorders, as they can probe tissue with high diffraction-limited resolution at near-infrared (IR) wavelengths. However, high peak intensity of femtosecond laser pulses required for two-photon processes causes formation of cyclobutane-pyrimidine-dimers (CPDs) in cellular deoxyribonucleic acid (DNA) similar to damage from exposure to solar ultraviolet (UV) light. Inaccurate repair of subsequent mutations increases the risk of carcinogenesis. In this study, we investigate CPD damage that results in Chinese hamster ovary cells in vitro from imaging them with two-photon excited autofluorescence. The CPD levels are quantified by immunofluorescent staining. We further evaluate the extent of CPD damage with respect to varied wavelength, pulse width at focal plane, and pixel dwell time as compared with more pronounced damage from UV sources. While CPD damage has been expected to result from three-photon absorption, our results reveal that CPDs are induced by competing two- and three-photon absorption processes, where the former accesses UVA absorption band. This finding is independently confirmed by nonlinear dependencies of damage on laser power, wavelength, and pulse width.

  19. THE CHARACTERIZATION OF EPOXY VALUE BY INFRARED SPECTROSCOPY METHOD COMBINED WITH CHEMICAL ANALYSIS%红外与化学法联用表征环氧树脂环氧值

    Institute of Scientific and Technical Information of China (English)

    马楠楠; 赵娟; 陈福花

    2013-01-01

    Two separation methods for bisphenol-A epoxy resin' s epoxy value were investigated:infrared spectroscopy method combined with chemical analysis.Through this paper,epoxy value was determined through chemical analysis,and epoxy index was analyzed by infrared spectroscopy.The relation of epoxy index and epoxy value was given by a standard curve.The standard curve can be used to determine the unknown epoxy resin's epoxy value,and supporting data for performance testing and curing mechanism research could also be provided.%研究了双酚A型环氧树脂环氧值的两种表征方法.通过化学分析法测定环氧值,采用红外光谱法分析环氧指数,得到环氧指数-环氧值的标准曲线.此标准曲线可以用于测定未知牌号环氧树脂的环氧值,继而为环氧树脂性能检测和固化机理研究提供数据支持.

  20. Evidence for Intramolecular Antiparallel Beta-Sheet Structure in Alpha-Synuclein Fibrils from a Combination of Two-Dimensional Infrared Spectroscopy and Atomic Force Microscopy

    NARCIS (Netherlands)

    Roeters, Steven J.; Iyer, Aditya; Pletikapic, Galja; Kogan, Vladimir; Subramaniam, Vinod; Woutersen, Sander

    2017-01-01

    The aggregation of the intrinsically disordered protein alpha-synuclein (αS) into amyloid fibrils is thought to play a central role in the pathology of Parkinson’s disease. Using a combination of techniques (AFM, UV-CD, XRD, and amide-I 1D- and 2D-IR spectroscopy) we show that the structure of αS fi

  1. Potential and limitations of 2D sup 1 H- sup 1 H spin-exchange CRAMPS experiments to characterize structures of organic solids

    CERN Document Server

    Brus, J; Petrickova, H

    2002-01-01

    A brief overview of our recent results concerning the application of 2D CRAMPS experiments to investigate a wide range of materials is presented. The abilities of the 2D sup 1 H- sup 1 H spin-exchange technique to characterize the structure of organic solids as well as the limitations resulting from segmental mobility and from undesired coherence transfer are discussed. Basic principles of sup 1 H NMR line-narrowing and procedures for analysis of the spin-exchange process are introduced. We focused to the qualitative and quantitative analysis of complex spin-exchange process leading to the determination of domain sizes and morphology in heterogeneous multicomponent systems as well as the characterization of clustering of surface hydroxyl groups in polysiloxane networks. Particular attention is devoted to the determination of the sup 1 H- sup 1 H interatomic distances in the presence of local molecular motion. Finally we discuss limitations of the sup 1 sup 3 C- sup 1 sup 3 C correlation mediated by sup 1 H- s...

  2. Proton-detected 3D (15)N/(1)H/(1)H isotropic/anisotropic/isotropic chemical shift correlation solid-state NMR at 70kHz MAS.

    Science.gov (United States)

    Pandey, Manoj Kumar; Yarava, Jayasubba Reddy; Zhang, Rongchun; Ramamoorthy, Ayyalusamy; Nishiyama, Yusuke

    2016-01-01

    Chemical shift anisotropy (CSA) tensors offer a wealth of information for structural and dynamics studies of a variety of chemical and biological systems. In particular, CSA of amide protons can provide piercing insights into hydrogen-bonding interactions that vary with the backbone conformation of a protein and dynamics. However, the narrow span of amide proton resonances makes it very difficult to measure (1)H CSAs of proteins even by using the recently proposed 2D (1)H/(1)H anisotropic/isotropic chemical shift (CSA/CS) correlation technique. Such difficulties due to overlapping proton resonances can in general be overcome by utilizing the broad span of isotropic chemical shifts of low-gamma nuclei like (15)N. In this context, we demonstrate a proton-detected 3D (15)N/(1)H/(1)H CS/CSA/CS correlation experiment at fast MAS frequency (70kHz) to measure (1)H CSA values of unresolved amide protons of N-acetyl-(15)N-l-valyl-(15)N-l-leucine (NAVL).

  3. Synthesis and anti-TMV activity of novel N-(3-alkyl-1H-pyrazol-4-yl)-3-alkyl-4-substituted- 1H-pyrazole-5-carboxamides

    Institute of Scientific and Technical Information of China (English)

    Da Qiang Zhang; Gao Fei Xu; Zhi Jin Fan; Dao Quan Wang; Xin Ling Yang; De Kai Yuan

    2012-01-01

    In oraer to investigate the biological activity of novel bis-pyrazole compounds,a series of N-(3-alkyl-5-(N-methylcarbamyl)-1H-pyrazol-4-yl)-3-alkyl-4-substituted-1H-pyrazole-5-carboxamides were designed and synthesized with ethyl 3-alkyl-1H-pyrazole-5-carboxylate 1 as starting materials.N-Methyl-3-alkyl-4-amino-1H-pyrazole-5-carboxamides 6 were obtained from 1 via 5 steps.3-Alkyl-4-substitued-1H-pyrazole-5-carboxyl chlorides 4a,4b,11a,11b,11c or 12 were also obtained from 1 via several steps.Target compounds 7a-7g were obtained after the reaction of 6 with the above 1H-pyrazole-5-carboxyl chlorides.Preliminary bioassay showed some compounds possessing good inactivation effect against TMV (tobacco mosaic virus).Compound 7a showed higher activity superior to ningnanmycin at a concentration of 5.0 × 10-4 g/mL and equal acdvity at 1.0 × 10-4 g/nL; 7b and 7c showed equal activity to virazole both at concentrations of 5.0 × 10-4 g/mL and 1.0 × 10-4 g/mL.

  4. BEBEtr and BUBI: J-compensated concurrent shaped pulses for 1H-13C experiments

    Science.gov (United States)

    Ehni, Sebastian; Luy, Burkhard

    2013-07-01

    Shaped pulses designed for broadband excitation, inversion and refocusing are important tools in modern NMR spectroscopy to achieve robust pulse sequences especially in heteronuclear correlation experiments. A large variety of mostly computer-optimized pulse shapes exist for different desired bandwidths, available rf-field strengths, and tolerance to B1-inhomogeneity. They are usually derived for a single spin 1/2, neglecting evolution due to J-couplings. While pulses with constant resulting phase are selfcompensated for heteronuclear coupling evolution as long as they are applied exclusively on a single nucleus, the situation changes for concurrently applied pulse shapes. Using the example of a 1H,13C two spin system, two J-compensated pulse pairs for the application in INEPT-type transfer elements were optimized: a point-to-point pulse sandwich called BEBEtr, consisting of a broadband excitation and time-reversed excitation pulse, and a combined universal rotation and point-to-point pulse pair called BUBI, which acts as a refocusing pulse on 1H and a corresponding inversion pulse on 13C. After a derivation of quality factors and optimization protocols, a theoretical and experimental comparison with conventionally derived BEBOP, BIBOP, and BURBOP-180° pulses is given. While the overall transfer efficiency of a single pulse pair is only reduced by approximately 0.1%, resulting transfer to undesired coherences is reduced by several percent. In experiments this can lead to undesired phase distortions for pairs of uncompensated pulse shapes and even differences in signal intensities of 5-10% in HSQC and up to 68% in more complex COB-HSQC experiments.

  5. Decreased insulin clearance in individuals with elevated 1-h post-load plasma glucose levels.

    Directory of Open Access Journals (Sweden)

    Maria Adelaide Marini

    Full Text Available Reduced insulin clearance has been shown to predict the development of type 2 diabetes. Recently, it has been suggested that plasma glucose concentrations ≥ 8.6 mmol/l (155 mg/dl at 1 h during an oral glucose tolerance test (OGTT can identify individuals at high risk for type 2 diabetes among those who have normal glucose tolerance (NGT 1 h-high. The aim of this study was to examine whether NGT 1 h-high have a decrease in insulin clearance, as compared with NGT individuals with 1-h post-load glucose <8.6 mmol/l (l (155 mg/dl, NGT 1 h-low. To this end, 438 non-diabetic White individuals were subjected to OGTT and euglycemic-hyperinsulinemic clamp to evaluate insulin clearance and insulin sensitivity. As compared with NGT 1 h-low individuals, NGT 1 h-high had significantly higher 1-h and 2-h post-load plasma glucose and 2-h insulin levels as well as higher fasting glucose and insulin levels. NGT 1 h-high exhibited also a significant decrease in both insulin sensitivity (P<0.0001 and insulin clearance (P = 0.006 after adjusting for age, gender, adiposity measures, and insulin sensitivity. The differences in insulin clearance remained significant after adjustment for fasting glucose (P = 0.02 in addition to gender, age, and BMI. In univariate analyses adjusted for gender and age, insulin clearance was inversely correlated with body weight, body mass index, waist, fat mass, 1-h and 2-h post-load glucose levels, fasting, 1-h and 2-h post-load insulin levels, and insulin-stimulated glucose disposal. In conclusion, our data show that NGT 1 h-high have a reduction in insulin clearance as compared with NGT 1 h-low individuals; this suggests that impaired insulin clearance may contribute to sustained fasting and post-meal hyperinsulinemia.

  6. Differentiation of Salmonella enterica serovars and strains in cultures and food using infrared spectroscopic and microspectroscopic techniques combined with soft independent modeling of class analogy pattern recognition analysis.

    Science.gov (United States)

    Männig, Annegret; Baldauf, Nathan A; Rodriguez-Romo, Luis A; Yousef, Ahmed E; Rodríguez-Saona, Luis E

    2008-11-01

    Detection of pathogenic microorganisms in food is often a tedious and time-consuming exercise. Developing rapid and cost-effective techniques for identifying pathogens to subspecies is critical for tracking causes of foodborne disease outbreaks. The objective of this study was to develop a method for rapid identification and differentiation of Salmonella serovars and strains within these serovars through isolation on hydrophobic grid membrane filters (HGMFs), examination by infrared (IR) spectroscopy and microspectroscopy, and data analysis by multivariate statistical techniques. Salmonella serovars (Anatum, Enteritidis, Heidelberg, Kentucky, Muenchen, and Typhimurium), most of which were represented by multiple strains, were grown in tryptic soy broth (24 h at 42 degrees C), diluted to 10(2) to 10(3) CFU/ml, and filtered using HGMFs. The membranes were incubated on Miller-Mallinson agar (24 h at 42 degrees C), and typical Salmonella colonies were sonicated in 50% acetonitrile and centrifuged. Resulting pellets were vacuum dried on a ZnSe crystal and analyzed using IR spectroscopy. Alternatively, the membranes containing Salmonella growth were removed from the agar, vacuum dried, and colonies were analyzed directly by IR microspectroscopy. Soft independent modeling of class analogy (SIMCA) models were developed from spectra. The method was validated by analyzing Salmonella-inoculated tomato juice, eggs, milk, and chicken. Salmonella serovars exhibited distinctive and reproducible spectra in the fingerprint region (1,200 to 900 cm(-1)) of the IR spectrum. SIMCA permitted distinguishing Salmonella strains from each other through differences in bacterial lipopolysaccharides and other membrane components. The model correctly predicted Salmonella in foods at serovar (100%) and strain (90%) levels. Isolation of Salmonella on HGMF and selective agar followed by IR spectroscopic analysis resulted in rapid and efficient isolation, identification, and differentiation of

  7. At-line determination of pharmaceuticals small molecule's blending end point using chemometric modeling combined with Fourier transform near infrared spectroscopy

    Science.gov (United States)

    Tewari, Jagdish; Strong, Richard; Boulas, Pierre

    2017-02-01

    This article summarizes the development and validation of a Fourier transform near infrared spectroscopy (FT-NIR) method for the rapid at-line prediction of active pharmaceutical ingredient (API) in a powder blend to optimize small molecule formulations. The method was used to determine the blend uniformity end-point for a pharmaceutical solid dosage formulation containing a range of API concentrations. A set of calibration spectra from samples with concentrations ranging from 1% to 15% of API (w/w) were collected at-line from 4000 to 12,500 cm- 1. The ability of the FT-NIR method to predict API concentration in the blend samples was validated against a reference high performance liquid chromatography (HPLC) method. The prediction efficiency of four different types of multivariate data modeling methods such as partial least-squares 1 (PLS1), partial least-squares 2 (PLS2), principal component regression (PCR) and artificial neural network (ANN), were compared using relevant multivariate figures of merit. The prediction ability of the regression models were cross validated against results generated with the reference HPLC method. PLS1 and ANN showed excellent and superior prediction abilities when compared to PLS2 and PCR. Based upon these results and because of its decreased complexity compared to ANN, PLS1 was selected as the best chemometric method to predict blend uniformity at-line. The FT-NIR measurement and the associated chemometric analysis were implemented in the production environment for rapid at-line determination of the end-point of the small molecule blending operation.

  8. Evidence of Polymorphism on the Antitrypanosomal Naphthoquinone (4E)-2-(1H-Pyrazol-3-ylamino)-4-(1H-pyrazol-3-ylimino)naphthalen-1(4H)-one

    Science.gov (United States)

    Sperandeo, Norma R.; Faudone, Sonia N.

    2013-01-01

    The aim of this study was to characterize the solid state properties of (4E)-2-(1H-pyrazol-3-ylamino)-4-(1H-pyrazol-3-ylimino)naphthalen-1(4H)-one (BiPNQ), a compound with a significant inhibitory activity against Trypanosoma cruzi, the etiological agent of Chagas disease (American trypanosomiasis). Methods used included Differential Scanning Calorimetry (DSC), Thermogravimetry (TG), Fourier Transform Infrared Spectroscopy (FTIR), Powder X-Ray Diffraction (PXRD), Hot Stage, and Confocal Microscopy. Two BiPNQ samples were obtained by crystallization from absolute methanol and 2-propanol-water that exhibited different thermal behaviours, PXRD patterns, and FTIR spectra, indicating the existence of an anhydrous form (BiPNQ-I) and a solvate (BIPNQ-s), which on heating desolvated leading to the anhydrous modification BiPNQ-I. It was determined that FTIR, DSC, and PXRD are useful techniques for the characterization and identification of the crystalline modifications of BiPNQ. PMID:24106678

  9. Activity of processes of a lipoperoksidation at patients with a long postoperative pain syndrome against the combined application of application of low-intensive infrared laser therapy at impact on thymus area and pantovegin electrophoresis

    Directory of Open Access Journals (Sweden)

    Dugieva M.Z.

    2013-12-01

    Full Text Available The aim of the study was to optimize the treatment of postoperative gynecological patients using physiotherapy method. Material and methods. It was examined 220 patients in postoperative period. It was investigated antioxidant status and lipid peroxidation. Results. It is demonstrated that patients with prolonged postoperative pain disorders are more pronounced as compared with the control group. The article presents data on the effectiveness of the impact on the antioxidant system and lipid peroxidation in postoperative period of combined use of low-intensity infrared laser therapy when exposed area of the thymus and in pantovegin electrophoresis in patients sustained postoperative pain after gynecological laparotomy. Conclusion. It is shown that this method helps to reduce pain in the postoperative wound.

  10. Component analyses of urinary nanocrystallites of uric acid stone formers by combination of high-resolution transmission electron microscopy, fast Fourier transformation, energy dispersive X-ray spectroscopy, X-ray diffraction and Fourier transform infrared spectroscopy.

    Science.gov (United States)

    Sun, Xin-Yuan; Xue, Jun-Fa; Xia, Zhi-Yue; Ouyang, Jian-Ming

    2015-06-01

    This study aimed to analyse the components of nanocrystallites in urines of patients with uric acid (UA) stones. X-ray diffraction (XRD), Fourier transform infrared spectroscopy, high-resolution transmission electron microscopy (HRTEM), fast Fourier transformation (FFT) of HRTEM, and energy dispersive X-ray spectroscopy (EDS) were performed to analyse the components of these nanocrystallites. XRD and FFT showed that the main component of urinary nanocrystallites was UA, which contains a small amount of calcium oxalate monohydrate and phosphates. EDS showed the characteristic absorption peaks of C, O, Ca and P. The formation of UA stones was closely related to a large number of UA nanocrystallites in urine. A combination of HRTEM, FFT, EDS and XRD analyses could be performed accurately to analyse the components of urinary nanocrystallites.

  11. SOCl2 catalyzed cyclization of chalcones: Synthesis and spectral studies of some bio-potent 1H pyrazoles

    Directory of Open Access Journals (Sweden)

    K. Ranganathan

    2014-05-01

    Full Text Available Some aryl-aryl 1H pyrazoles have been synthesised by cyclization of aryl chalcones and hydrazine hydrate in the presence of SOCl2. The yields of the pyrazoles are more than 85%. These pyrazoles are characterized by their physical constants and spectral data. The infrared, NMR spectral group frequencies of these pyrazolines have been correlated with Hammett substituent constants, F and R parameters. From the results of statistical analyses the effects of substituent on the spectral frequencies have been studied. The antimicrobial activities of all synthesised pyrazolines have been studied using Bauer-Kirby method. DOI: http://dx.doi.org/10.4314/bcse.v28i2.11

  12. Assignments of 1H and 13C NMR Signals of Mogroside IVa

    Institute of Scientific and Technical Information of China (English)

    ZHANGJian-ye; YANGXiu-wei

    2003-01-01

    Aim To investigate the structure of mogroside IVa isolated from traditional Chinese medicine fructus momordicae [fruits of Siraitia grosvenori (Swingle) C. Jeffery] and summarize the NMR characteristics of the structure. Methods Cormnon extraction, separafion and purification methods were used. Various NMR techniques including 1H NMR,13C NMR, DEPT, 1H-1H COSY, HSQC, HMBC, NOESY and molecular model simulated by comtmter were used to elucidate the structure. Results 1H and 13C NMR signals of mogroside IVa were assigned, and spectroscopic basis was obtained for identification of such type of compounds. Conclusion 1D and 2D NMR techniques including 1H-1H COSY, HSQC, HMBC, NOESY spectra are powerful tools for structure analysis. The structure determined by NMR methods is identical with energy minimized conformation simulated by computer.

  13. a Combined Gigahertz and Terahertz Synchrotron-Based Fourier Transform Infrared (terahertz) Spectroscopic Investigation of - and Ortho-D Observation of Tunneling Switching

    Science.gov (United States)

    Chen, Ziqiu; Albert, Sieghard; Fábri, Csaba; Prentner, Robert; Quack, Martin

    2016-06-01

    Tunneling switching is of fundamental interest for certain experiments aiming at detecting parity violation in chiral molecules. A particularly intriguing recent development is the theoretical prediction of prototypical tunneling switching in meta- and ortho-D-phenol (C_6H_4DOH) as opposed to phenol (C_6H_5OH) where only tunneling dominates the dynamics: For meta and ortho-D-phenol at low energy, tunneling is completely suppressed due to isotopic substitution, which introduces an asymmetry in the effective potential including zero point vibrational energy in the lowest quasiadiabatic channel. This effectively localizes the molecular wavefunction at either the syn or anti structure of meta- and ortho-D-phenol. At higher torsional states of meta- and ortho-D-phenol, tunneling becomes dominant, thus switching the dynamics to a delocalized quantum wavefunction.The pure rotational spectra of the meta- and ortho-D-phenol were recorded between 60 and 110 GHz using an experimental setup which we have improved somewhat whereas the rotationally resolved vibrational spectra in the THz and infrared region were collected in the range of 200 to 1000 wn using synchrotron-based FTIR spectroscopy. The detailed assignment of the new GHz spectra including excited vibrational states, whereas previously only microwave spectra of the ground state were known, shall be discussed, in terms of the experimental evidence demonstrating tunneling switching in the first overtone of the torsional vibration of meta-D-phenol. M. Quack and M. Willeke, J. Phys .Chem. A 110, 3338-3348 (2006) M. Quack, Adv. Chem. Phys 157, 247-291 (2014) S. Albert, Ph. Lerch, R. Prentner and M. Quack, Angew. Chem. Int. Ed. 52, 346-349 (2013) M. Suter and M. Quack, Appl. Opt 54, 4417-4431 (2015). S. Albert, Ph. Lerch, R. Prentner and M. Quack, 68th International Symposium on Molecular Spectroscopy, Columbus, Ohio, USA, June 17-21, paper TG09 (2013). T. Pedersen, N. W. Larsen and L. Nygaard, J. Mol. Struc. 4, 59-77 (1969).

  14. Metabolite profiling of Clinacanthus nutans leaves extracts obtained from different drying methods by 1H NMR-based metabolomics

    Science.gov (United States)

    Hashim, Noor Haslinda Noor; Latip, Jalifah; Khatib, Alfi

    2016-11-01

    The metabolites of Clinacanthus nutans leaves extracts and their dependence on drying process were systematically characterized using 1H nuclear magnetic resonance spectroscopy (NMR) multivariate data analysis. Principal component analysis (PCA) and partial least square-discriminant analysis (PLS-DA) were able to distinguish the leaves extracts obtained from different drying methods. The identified metabolites were carbohydrates, amino acid, flavonoids and sulfur glucoside compounds. The major metabolites responsible for the separation in PLS-DA loading plots were lupeol, cycloclinacosides, betulin, cerebrosides and choline. The results showed that the combination of 1H NMR spectroscopy and multivariate data analyses could act as an efficient technique to understand the C. nutans composition and its variation.

  15. Structural and spectroscopic studies of bis(2-amino-6-methylpyrimidinium-4-(1H)-one) aquapentachloridoindate(III) monohydrate

    Science.gov (United States)

    Nbili, W.; Kaabi, K.; Ferretti, V.; Lefebvre, F.; Ben Nasr, C.

    2015-11-01

    Physico-chemical properties of a new organic indate(III) (C5H8N3O)2[InCl5(H2O)].H2O are discussed on the basis of its X-ray crystal structure investigation. The asymmetric unit includes two independent 2-amino-6-methylpyrimidinium-4-(1H)-one cations, one aquapentachloridoindate dianion, and one crystallization water molecule. The InIII ion is in a slightly distorted octahedral coordination geometry. In the crystal structure, the dimeric species formed by two metal complexes and two water molecules are connected to the 2-amino-6-methylpyrimidin-4-1H)-one cations through N-H⋯Cl hydrogen bonds to build 2D sheets parallel to the (b, a + c) plane. The 13C and 15N CP-MAS NMR spectra are in agreement with the X-ray structure. The vibrational absorption bands were identified by infrared spectroscopy. DFT calculations allowed attributions of NMR signals and of the IR bands.

  16. [Study on derivatives of 5-amino-4-acylamino-1H-pyrazole as inhibitors of furin].

    Science.gov (United States)

    Kibirev, V K; Osadchuk, T V; Vadziuk, O B; Shablykin, O V; Kozachenko, A P; Chumachenko, S A; Popil'nichenko, S V; Brovarets, V S

    2011-01-01

    A series of 5-amino-1H-pyrazoles was synthesized and studied as inhibitors of furin. The most potent compound, 5-amino-4-acetylamino-3-(4-methylphenylamino)1H-pyrazole, was found to retard the activity of furin by mixed-type inhibition with K = 288 microM. These findings permit to plan new ways for chemical modifications of the 5-amino-1H-pyrazole structure and design more potent furin inhibitors of non-peptide nature.

  17. Diagnosis of breast tumors with 1H-MRS and dynamic contrast-enhanced magnetic resonance imaging%联合应用1H-MRS与MR动态增强成像诊断乳腺肿瘤

    Institute of Scientific and Technical Information of China (English)

    周欣; 张婷婷; 胡国清

    2012-01-01

    Objective To compare the value of dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI) alone and combined with 1 H-MRS in diagnosis of breast tumors. Methods ' H-MRS and DCE-MRI of 50 patients with breast tumors including 33 malignant lesions and 17 benign lesions were retrospectively analyzed. The diagnostic results of ' H-MRS and DCE-MRI were compared with pathological and clinical follow-up results. All patients underwent pre-enhanced conventional scanning, 1 H-MRS scanning and DCE-MR scanning after injection of contrast agent. The type of time-intensity curves (TIC) and display of choline (Cho) peak for all lesions were calculated. Results The diagnostic sensitivity, specificity and accuracy rate for TIC alone was 100% (33/33), 58. 82% (10/17) and 66. 00% (33/50), respectively, while was 100% (33/33), 88.24% (15/17) and 96.00% (48/50) respectively for combined application of 1H-MRS and DCE-MRI. There was statistical difference in diagnostic specificity and accuracy rate between the two methods (both P<0. 02). Conclusion DCE-MRI has lower specificity and accuracy rate for diagnosis of breast tumors. Combination of ' H-MRS and DCE-MRI can improve the diagnostic accuracy rate of breast tumors.%目的 比较应用MR动态增强成像(DCE-MRI)与联合应用1H-MRS及DCE-MRI对乳腺肿瘤的诊断价值.方法 回顾性分析50例乳腺肿瘤患者的1H-MRS及DCE-MRI表现,包括恶性肿瘤33例,良性肿瘤17例,并与病理及临床随诊结果进行对比.对所有患者分别行常规扫描、1H-MRS扫描及注射对比剂后动态增强扫描,分析时间-信号曲线(TIC)类型和胆碱(Cho)峰的显示情况.结果 以TIC类型判断肿瘤的良恶性,诊断的敏感度为100%(33/33),特异度为58.82%(10/17),准确率为66.00%(33/50);应用1H-MRS联合DCE-MRI诊断的敏感度为100%(33/33),特异度为88.24%(15/17),准确率为96.00%(48/50),与单纯DCE-MRI诊断的特异度和准确率差异有统计学意义(P均<0.02).结论 DCE

  18. Infrared retina

    Science.gov (United States)

    Krishna, Sanjay; Hayat, Majeed M.; Tyo, J. Scott; Jang, Woo-Yong

    2011-12-06

    Exemplary embodiments provide an infrared (IR) retinal system and method for making and using the IR retinal system. The IR retinal system can include adaptive sensor elements, whose properties including, e.g., spectral response, signal-to-noise ratio, polarization, or amplitude can be tailored at pixel level by changing the applied bias voltage across the detector. "Color" imagery can be obtained from the IR retinal system by using a single focal plane array. The IR sensor elements can be spectrally, spatially and temporally adaptive using quantum-confined transitions in nanoscale quantum dots. The IR sensor elements can be used as building blocks of an infrared retina, similar to cones of human retina, and can be designed to work in the long-wave infrared portion of the electromagnetic spectrum ranging from about 8 .mu.m to about 12 .mu.m as well as the mid-wave portion ranging from about 3 .mu.m to about 5 .mu.m.

  19. Investigation of NO interaction on Rh/doped TiO2-based automotive catalyst using combined transient diffuse reflectance Fourier transform infrared and mass spectrometry

    Science.gov (United States)

    Chafik, T.; Ouassini, A.; Verykios, X. E.

    1998-07-01

    The interaction of NO with Rh supported on W+6 doped TiO2 has been investigated by coupling transient diffuse reflectance Fourier transform Infrared spectroscopy and mass spectrometry. The experiments were carried out in dynamic conditions (under reactant flow and at temperature reaction) at atmospheric pressure. By comparing the results obtained with undoped Rh/TiO2 and Rh/TiO2(W6+) catalysts, the analytical approach used permitted to emphasis the effect of carrier doping, with respect to the elementary steps and surface intermediates involved in NO interaction process. It was found that W6+-doping of TiO2 promotes significantly the formation of Rh-NO- species and enhances the thermal stability of Rh-NO+ on Rh/TiO2 (W6+) surfaces. This leads to a drastic increase in the selectivity of NO decomposition reaction towards N2 formation, whereas the N2O yield decreases significantly. L'intéraction de NO sur un catalyseur à base de rhodium supporté sur TiO2 dopé par le tungstène W6+ a été étudiée en régime transitoire par couplage de la spectroscopie Infrarouge Diffuse à Transformée de Fourier (DRIFT) et la spectrométrie de masse. Ces études ont été effectuées dans des conditions dynamiques (sous flux de réactifs gazeux et à la température de la réaction) à la pression atmosphérique. La comparaison des études menées avec des catalyseurs non dopé (Rh/TiO2) et dopé (Rh/TiO2(W6+)) a permis de mettre en évidence l'influence du dopage du support catalytique sur la nature des intermédiaires superficiels et les étapes élémentaires intervenant dans le processus d'interaction de NO avec ces solides. Il a été montré que le dopage de TiO2 par W6+ accroît la formation des espèces Rh-NO- et la stabilité thermique des espèces Rh-NO+ sur Rh/TiO2(W6+). Ceci est à l'origine de l'augmentation de la sélectivité de la conversion de NO en N2 suite à la diminution considérable de la quantité N2O formée.

  20. Improved synthesis of 1H-indazole-3-carboxylic acid%1H-吲唑-3-羧酸的合成工艺改进

    Institute of Scientific and Technical Information of China (English)

    张东峰; 王燕; 林紫云; 黄海洪; 饶尔昌

    2006-01-01

    目的 改进1H-吲唑-3-羧酸的合成工艺.方法 以苯甲醛苯腙与草酰氯为原料得到N-亚苄基氨基-N-苯基-草氨酰氯,后者与三氯化铝反应得到关键中间体N-亚苄基氨基靛红,再经水解得到1H-吲唑-3-羧酸.结果与结论 该方法以55.3%的收率简单方便地制备了1H-吲唑-3-羧酸,所用起始原料及试剂的成本低、反应条件温和、易于操作,适合工业化生产.

  1. Stereospecificity of (1) H, (13) C and (15) N shielding constants in the isomers of methylglyoxal bisdimethylhydrazone: problem with configurational assignment based on (1) H chemical shifts.

    Science.gov (United States)

    Afonin, Andrei V; Pavlov, Dmitry V; Ushakov, Igor A; Keiko, Natalia A

    2012-07-01

    In the (13) C NMR spectra of methylglyoxal bisdimethylhydrazone, the (13) C-5 signal is shifted to higher frequencies, while the (13) C-6 signal is shifted to lower frequencies on going from the EE to ZE isomer following the trend found previously. Surprisingly, the (1) H-6 chemical shift and (1) J(C-6,H-6) coupling constant are noticeably larger in the ZE isomer than in the EE isomer, although the configuration around the -CH═N- bond does not change. This paradox can be rationalized by the C-H⋯N intramolecular hydrogen bond in the ZE isomer, which is found from the quantum-chemical calculations including Bader's quantum theory of atoms in molecules analysis. This hydrogen bond results in the increase of δ((1) H-6) and (1) J(C-6,H-6) parameters. The effect of the C-H⋯N hydrogen bond on the (1) H shielding and one-bond (13) C-(1) H coupling complicates the configurational assignment of the considered compound because of these spectral parameters. The (1) H, (13) C and (15) N chemical shifts of the 2- and 8-(CH(3) )(2) N groups attached to the -C(CH(3) )═N- and -CH═N- moieties, respectively, reveal pronounced difference. The ab initio calculations show that the 8-(CH(3) )(2) N group conjugate effectively with the π-framework, and the 2-(CH(3) )(2) N group twisted out from the plane of the backbone and loses conjugation. As a result, the degree of charge transfer from the N-2- and N-8- nitrogen lone pairs to the π-framework varies, which affects the (1) H, (13) C and (15) N shieldings. Copyright © 2012 John Wiley & Sons, Ltd.

  2. A Classical Approach in Simple Nuclear Fusion Reaction 1H2 + 1H3 using Two-Dimension Granular Molecular Dynamics Model

    CERN Document Server

    Viridi, Sparisoma; Waris, Abdul; Perkasa, Yudha Satya

    2011-01-01

    Molecular dynamics in 2-D accompanied by granular model provides an opportunity to investigate binding between nuclei particles and its properties that arises during collision in a fusion reaction. A fully classical approach is used to observe the influence of initial angle of nucleus orientation to the product yielded by the reaction. As an example, a simplest fusion reaction between 1H2 and 1H3 is observed. Several products of the fusion reaction have been obtained, even the unreported ones, including temporary 2He4 nucleus.

  3. Rovibrational and dynamical properties of the hydrogen bonded complex (CH2)2S-HF: a combined free jet, cell, and neon matrix-Fourier transform infrared study.

    Science.gov (United States)

    Asselin, P; Goubet, M; Lewerenz, M; Soulard, P; Perchard, J P

    2004-09-15

    Fourier transform infrared spectra of the nu(s) (HF stretching) band of the (CH(2))(2)S-HF complex have been recorded at 0.1-0.5 cm(-1) resolution in a cooled cell, in a supersonic jet expansion seeded with argon and in a neon matrix at 4.5 K. The combination of controlled temperature effects over a range of 40-250 K and a sophisticated band contour simulation program allows the separation of homogeneous and inhomogeneous contributions and reveals significant anharmonic couplings between intramolecular and intermolecular vibrational modes similar to our previous work on (CH(2))(2)S-DF. The sign of the coupling constants is consistent with the expected strengthening of the hydrogen bond upon vibrational excitation of HF which also explains the observed small variations of the geometrical parameters in the excited state. The analysis of sum and difference combination bands involving nu(s) provides accurate values of intermolecular harmonic frequencies and anharmonicities and a good estimate of the dissociation energy of the complex. Frequencies and coupling parameters derived from gas phase spectra compare well with results from neon matrix experiments. The effective linewidth provides a lower bound for the predissociation lifetime of 10 ps. The comparison between effective linewidths and vibrational densities of states for (CH(2))(2)S-HF and -DF complexes highlights the important role of intramolecular vibrational redistribution in the vibrational dynamics of medium strength hydrogen bonds.

  4. Evaluation of CACNA1H in European patients with childhood absence epilepsy

    NARCIS (Netherlands)

    Chioza, Barry; Everett, Kate; Aschauer, Harald; Brouwer, Oebele; Callenbach, Petra; Covanis, Athanasios; Dulac, Olivier; Durner, Martina; Eeg-Olofsson, Orvar; Feucht, Martha; Friis, Mogens; Heils, Armin; Kjeldsen, Marianne; Larsson, Katrin; Lehesjoki, Anna-Elina; Nabbout, Rima; Olsson, Ingrid; Sander, Thomas; Siren, Auli; Robinson, Robert; Rees, Michele; Gardiner, R. Mark

    2006-01-01

    CACNA1H was evaluated in a resource of Caucasian European patients with childhood absence epilepsy by linkage analysis and typing of sequence variants previously identified in Chinese patients. Linkage analysis of 44 pedigrees provided no evidence for a locus in the CACNA1H region and none of the Ch

  5. An oxazolo[3,2-b]indazole route to 1H-indazolones.

    Science.gov (United States)

    Oakdale, James S; Solano, Danielle M; Fettinger, James C; Haddadin, Makhluf J; Kurth, Mark J

    2009-07-02

    The novel heterocycle 2,3-dihydrooxazolo[3,2-b]indazole has been synthesized and utilized to provide easy access to 1H-indazolones, particularly the previously unreported 2-(2-alkoxyethyl)-1H-indazol-3(2H)-ones. Mechanistic as well as optimization and reaction scope studies are reported.

  6. Reliability of ^1^H NMR analysis for assessment of lipid oxidation at frying temperatures

    Science.gov (United States)

    The reliability of a method using ^1^H NMR analysis for assessment of oil oxidation at a frying temperature was examined. During heating and frying at 180 °C, changes of soybean oil signals in the ^1^H NMR spectrum including olefinic (5.16-5.30 ppm), bisallylic (2.70-2.88 ppm), and allylic (1.94-2.1...

  7. 5-Dimethylamino-1-phenylchromeno[2,3-c]pyrazol-4(1H-one

    Directory of Open Access Journals (Sweden)

    Wolfgang Holzer

    2010-11-01

    Full Text Available The title compound was prepared by treatment of 5-fluoro-1-phenylchromeno [2,3-c]pyrazol-4(1H-one with aqueous dimethylamine. Detailed spectroscopic data (1H NMR, 13C NMR, 15N NMR, IR, MS are presented.

  8. (2E-3-(3-Methoxy-1-phenyl-1H-pyrazol-4-yl-2-propenal

    Directory of Open Access Journals (Sweden)

    Algirdas Šačkus

    2009-12-01

    Full Text Available The palladium-catalyzed reaction of 4-bromo-3-methoxy-1-phenyl-1H-pyrazole with acrolein diethyl acetal gives the title compound in good yield. Detailed spectroscopic data (1H NMR, 13C NMR, 15N NMR, IR, MS are presented.

  9. Complete Genome Sequence of a Bovine Viral Diarrhea Virus Subgenotype 1h Strain Isolated in Italy

    Science.gov (United States)

    Bazzucchi, Moira; Bertolotti, Luigi; Casciari, Cristina; Rossi, Elisabetta; Rosati, Sergio; De Mia, Gian Mario

    2017-01-01

    ABSTRACT We sequenced the complete genome of bovine viral diarrhea virus (BVDV) strain UM/126/07. It belongs to subgenotype 1h. The complete genome is composed of 12,196 nucleotides organized as one open reading frame encoding 3,898 amino acids. This is the first report of a full-length sequence of BVDV-1h. PMID:28232427

  10. Complete Genome Sequence of a Bovine Viral Diarrhea Virus Subgenotype 1h Strain Isolated in Italy.

    Science.gov (United States)

    Bazzucchi, Moira; Bertolotti, Luigi; Giammarioli, Monica; Casciari, Cristina; Rossi, Elisabetta; Rosati, Sergio; De Mia, Gian Mario

    2017-02-23

    We sequenced the complete genome of bovine viral diarrhea virus (BVDV) strain UM/126/07. It belongs to subgenotype 1h. The complete genome is composed of 12,196 nucleotides organized as one open reading frame encoding 3,898 amino acids. This is the first report of a full-length sequence of BVDV-1h.

  11. The complete genome sequence of the Arcobacter butzleri cattle isolate 7h1h

    Science.gov (United States)

    Arcobacter butzleri strain 7h1h was isolated in the UK from a clinically healthy dairy cow. The genome of this isolate was sequenced to completion. Here we present the annotation and analysis of the completed 7h1h genome, as well as comparison of this genome to the existing A. butzleri RM4018 and ED...

  12. Tris{4-[(1,3-diphenyl-1H-pyrazol-4-ylmethylene]-41-aminobiphenyl}amine

    Directory of Open Access Journals (Sweden)

    Sandhya P. Veettil

    2010-04-01

    Full Text Available Tris{4-[(1,3-diphenyl-1H-pyrazol-4-ylmethylene]-41-aminobiphenyl}amine was synthesized from N-(4-bromophenyl-N-[(1,3-diphenyl-1H-pyrazol-4-ylmethylene]amine and tris(4-bromophenylamine based on Ullmann coupling reaction. The synthesized compound was characterized by NMR, IR, MS and elemental analysis.

  13. Determination Active Ingredients of Fudosteine Using Near Infrared Diffuse Reflectance Spectroscopy Combined with Partial Least Squares%近红外光谱结合偏最小二乘法测定福多斯坦成分含量

    Institute of Scientific and Technical Information of China (English)

    张卫民; 何文; 吴拥军

    2012-01-01

    采用近红外漫反射光谱分析技术和偏最小二乘法对福多斯坦药物的有效成分进行定量分析测定,采集48个不同比例的福多斯坦样品近红外漫反射光谱,用一阶导数的光谱预处理方法,结合偏最小二乘法建立福多斯坦的定量分析模型.结果显示:交互验证均方根误差为0.003 57,相关系数R为0.994 77,预测均方根误差为0.003 89,平均回收率为99.63% (n=8),结果表明,用近红外光谱分析技术联合偏最小二乘法对福多斯坦进行定量分析结果准确可靠,方法简便快速.%Near infrared reflectance spectroscopy (NIRS) and partial least squares (PLS) method were applied for the fast, non-destructive, quantitative analysis of fudosteine. The fudosteine quantitative analysis model was established by 48 different series near-infrared reflectance spectroscopy of fudosteine samples, combined with a derivative of the spectral pretreatment method and partial least squares. The cross-validation root mean square error was 0.003 57 and correlation coefficient R was 0.994 77; root mean square error of prediction was 0.003 89. The average recovery was 99.63% (n=8). It is shown that near-infrared spectroscopy technology for fudosteine quantitative analysis is accurate and reliable. The method is simple and rapid,and it may be extended to industrial on-line analysis of such samples.

  14. Rapid metabolic discrimination and prediction of dioscin content from African yam tubers using Fourier transform-infrared spectroscopy combined with multivariate analysis.

    Science.gov (United States)

    Kwon, Yong-Kook; Jie, Eun Yee; Sartie, Alieu; Kim, Dong Jin; Liu, Jang Ryol; Min, Byung Whan; Kim, Suk Weon

    2015-01-01

    To determine whether or not FT-IR spectroscopy could be used for taxonomic and metabolic discrimination of African yam lines, tuber samples from African and Asian yam species were subjected to FT-IR. Most remarkable spectral differences between African and Asian yams were found in the 1750-1700 cm(-1) region, polysaccharide (1200-900 cm(-1)) and protein/amide I and II (1700-1500 cm(-1)) regions of FT-IR spectra. A hierarchical dendrogram based on partial least square-discriminant analysis (PLS-DA) of FT-IR data from 7 African yam species show phylogenetic relationship. In addition, the content of dioscin, a steroidal saponin found in yam tuber, was predicted using a PLS regression model with regression coefficient R(2)=0.7208 indicated that prediction model had average accuracy. Thus, considering these results we suggest that FT-IR combined with multivariate analysis could be applied as a novel tool for metabolic evaluation and high-throughput screening of African yam lines with higher content of dioscin.

  15. Polypharmacotherapy in rheumatology: 1H NMR analysis of binding of phenylbutazone and methotrexate to serum albumin

    Science.gov (United States)

    Maciążek-Jurczyk, M.; Sułkowska, A.; Równicka-Zubik, J.; Bojko, B.; Szkudlarek-Haśnik, A.; Knopik, M.; Sułkowski, W. W.

    2011-05-01

    The influence of phenylbutazone (Phe) and methotrexate (MTX) on binding of MTX and Phe to human (HSA) and bovine (BSA) serum albumin in the low-affinity binding sites is investigated. The strength and kind of interactions between serum albumin (SA) and drugs used in combination therapy were found using 1H NMR spectroscopy. A stoichiometric molar ratios for Phe-SA and MTX-SA complexes are 36:1 and 31:1, respectively. It appeared these molar ratios are higher for the ternary systems than it were in the binary ones. The presence of the additional drug (MTX or Phe) causes the increase of an affinity of albumin towards Phe and MTX. It was found that the aliphatic groups of MTX are more resistant to the influence of Phe on the MTX-SA complex than the aromatic rings. The results showed the important impact of another drug (MTX or Phe) on the affinity of SA towards Phe and MTX in the low-affinity binding sites. This work is a subsequent part of the spectroscopic study on Phe-MTX-SA interactions (Maciążek-Jurczyk, 2009 [1]).

  16. Study of Conformation and Dynamics of Molecules Adsorbed in Zeolites by 1H NMR

    Science.gov (United States)

    Michel, Dieter; Bohlmann, Winfried; Roland, Jorg; Mulla-Osman, Samir

    The chapter Study of Conformation and Dynamics of Molecules Adsorbed in Zeolites by 1H NMR is concerned with the application of high-resolution (HR) solid-state NMR techniques to study the behavior of molecules adsorbed on surfaces of nanoporous solids, such as zeolitic molecular sieves. This includes a combined or alternative application of conventional high-resolution NMR methods and of high-resolution solid-state NMR techniques, including magic-angle sample spinning (MAS), cross-polarization (CP), high-power decoupling and appropriate multiple-pulse sequences for two- or higher dimensional NMR and multiple-quantum spectroscopy. The interaction of adsorbed molecules with adsorption centers in the internal surfaces of porous solids does not only lead to changes in the reorientational and translational mobility of the molecular species but influences also the molecular conformation. Examples will be given for simple olefins in interaction with inner zeolite surfaces. Conclusions about the correlation times of the internal reorientational and translational dynamics are derived in complete agreement with the conclusion obtained from diffusion coefficients by means of PFG NMR (second chapter). Since the methodical approach of HR MAS NMR in heterogeneous systems presented here is also valuable for the investigation of lyotropic crystalline phases using HR MAS NMR (in Chap. 12) And for the NMR studies of cartilage (in Chap. 13) it was also the aim of this chapter to elucidate also the methodical background of these measurements in some more detail.

  17. Psychophysical determination of load carrying capacity for a 1-h work period by Chinese males.

    Science.gov (United States)

    Wu, S P; Chen, C C

    2001-09-15

    This study used the psychophysical approach to examine the effects of container width, the presence or absence of container handles, and different load-carrying frequencies and distances on the maximum acceptable weight carried and the resulting response (heart rate and rating of perceived exertion) by well-conditioned males for a 1-h work period. After training, 12 male subjects performed a load-carrying task at knuckle height. Each subject performed 30 different carrying combinations. The conditions examined were container width, from 15.2 to 55.9 cm; carrying frequency, from 1 carry to 5 carries/min; and carrying distance from 1 to 6 m. The results were compared with prior studies and led to the following conclusions: (1) the use of container handles leads to the subjects carrying a significantly higher maximum acceptable weight than when containers do not have handles, which differs from the results of a previous study by Morrissey and Liou; (2) there were significant reductions in the maximum acceptable carrying weight with increases in container width, frequency and distance; (3) the presence or absence of container handles, different frequencies and load-carrying distances had significant effects on heart rate, although the effect of container width was not significant. In addition, the various frequencies and distances for load carrying had significant interaction effects on heart rate; (4) the effects of various frequencies and load-carrying distances on the rating of perceived exertion were statistically significant. The most stressed body parts were the wrists and arms.

  18. 1H NMR-based metabolic profiling for evaluating poppy seed rancidity and brewing.

    Science.gov (United States)

    Jawień, Ewa; Ząbek, Adam; Deja, Stanisław; Łukaszewicz, Marcin; Młynarz, Piotr

    2015-12-01

    Poppy seeds are widely used in household and commercial confectionery. The aim of this study was to demonstrate the application of metabolic profiling for industrial monitoring of the molecular changes which occur during minced poppy seed rancidity and brewing processes performed on raw seeds. Both forms of poppy seeds were obtained from a confectionery company. Proton nuclear magnetic resonance (1H NMR) was applied as the analytical method of choice together with multivariate statistical data analysis. Metabolic fingerprinting was applied as a bioprocess control tool to monitor rancidity with the trajectory of change and brewing progressions. Low molecular weight compounds were found to be statistically significant biomarkers of these bioprocesses. Changes in concentrations of chemical compounds were explained relative to the biochemical processes and external conditions. The obtained results provide valuable and comprehensive information to gain a better understanding of the biology of rancidity and brewing processes, while demonstrating the potential for applying NMR spectroscopy combined with multivariate data analysis tools for quality control in food industries involved in the processing of oilseeds. This precious and versatile information gives a better understanding of the biology of these processes.

  19. [Shortening of the measurement time by 1H-MR turbo spectroscopic imaging of the brain].

    Science.gov (United States)

    Träber, F; Block, W; Lamerichs, R; Keller, E; Schild, H H

    1997-03-01

    Development of a new technique for reduction of measurement time in 1H-MR spectroscopic imaging of the brain. Optimisation of the sequence parameters in volunteer and in patient examinations and comparison to the results obtained with conventional 2 D-SI. Examination of 20 healthy volunteers and 5 patients in a 1.5 T whole-body MR system. In "turbo-spectroscopic imaging" (TSI) sequences, a train of spin-echo signals with different phase encoding is acquired after each 90 degrees excitation. 32 x 32 matrix elements covered a field of view of 20 cm, and additional volume selection was performed by double spin echo excitation. Measurement duration 9 min with acquisition of four phase encoding steps per TR interval, whereas the corresponding 2 D-SI sequence (TR/TE 2000/272 ms) took 30 min. The TSI data sets yielded maps of the regional distribution of metabolite concentrations with a quality comparable to the 2 D-SI results. Signal homogeneity and delineation of brain lesions, however, were superior in conventional spectroscopic imaging. The T2 relaxation of the metabolites required a reduced sampling interval for each phase-encoded echo, and hence the frequency resolution of the corresponding TSI spectra was not always sufficient for separating choline and creatine signals. With measurement durations TSI technique allows in clinical studies a combination with single-voxel MRS for accurate quantification and with a diagnostic MRI within a total examination time of less than one hour.

  20. Development and test of continuous combined mid-infrared with hot air drying equipment%连续式中红外-热风组合干燥设备的研制与试验

    Institute of Scientific and Technical Information of China (English)

    谢小雷; 张春晖; 贾伟; 李侠; 王兆进; 穆国锋

    2015-01-01

    Drying efficiency was always considered to be the most important factor by factories, however, low thermal conductivity and case hardening of the material slowed the moisture migration in hot air drying, and resulted in more time and energy consumption. So to solve the existing problems of present drying equipment, a continuous drying equipment of combined mid-infrared and hot air (CMIHA) was developed in this paper. This drying equipment included feed section, heating sections and cooling section, of which each heating section was made up of four parts, i.e. conveying system, heating system, convective circulation system and control system. As we all know, since infrared energy is converted into heat only when material absorbs the radiation, it was essential to select a heat source emitting radiation with the range in which the material to be processed had maximum absorption. So, the radiation wavelength of infrared was selected by the infrared spectra of meats, and the radiation intensity could be controlled by changing the amount of working lamps to make good use of the radiation energy. At the same time, this equipment was developed by calculating the main technological parameters of convection system, cooling system and heating system, and then the production verification test was also done to compare the difference between CMIHA drying and hot air drying on beef jerky. Results showed that, in the same conditions (heating power 105 kW, heating temperature 70℃, wind velocity 1 m/s, cooling wind velocity 3 m/s, heating distance 8 cm), compared with hot air drying, the continuous CMIHA drying equipment could speed up muscle protein denaturation, reduce activation energy, reduce the energy that jerky needed to accelerate moisture migration, and improve drying efficiency. The time consumption that the beef samples in the first row on the conveyor dehydrated from raw to weight reduction by 50%for CMIHA drying equipment was 120 min, and the production efficiency

  1. Evaluation of a 1-h 75-g oral glucose tolerance test in the diagnosis of gestational diabetes

    Directory of Open Access Journals (Sweden)

    M.A.A. Campos

    2008-08-01

    Full Text Available In order to evaluate the performance of a 1-h 75-g oral glucose tolerance test (OGTT for the diagnosis of gestational diabetes mellitus (GDM, a cohort of 4998 women, 20 years or older, without previous diabetes being treated in prenatal care clinics in Brazil answered a questionnaire and performed a 75-g OGTT including fasting, 1-h and 2-h glucose measurements between their 24th and 28th gestational weeks. Pregnancy outcomes were transcribed from medical registries. GDM was defined according to WHO criteria (fasting: ≥126 mg/dL; 2-h value: ≥140 mg/dL and macrosomia as a birth weight equal to or higher than 4000 g. Areas under the receiver operator characteristic curve (AUC were compared and diagnostic properties of various cut-off points were evaluated. The AUCs for the prediction of macrosomia were 0.606 (0.572-0.637 for the 1-h and 0.589 (0.557-0.622 for the 2-h plasma glucose test. Similar predictability was demonstrable regarding combined adverse outcomes: 0.582 (0.559-0.604 for the 1-h test and 0.572 (0.549-0.595 for the 2-h test. When the 1-h glucose test was evaluated against a diagnosis of GDM defined by the 2-h glucose test, the AUC was 0.903 (0.886-0.919. The cut-off point that maximized sensitivity (83% and specificity (83% was 141 mg/dL, identifying 21% of the women as positive. A cut-off point of 160 mg/dL, with lower sensitivity (62%, had higher specificity (94%, labeling 8.6% as positive. Detection of GDM can be done with a 1-h 75-g OGTT: the value of 160 mg/dL has the same diagnostic performance as the conventional 2-h value (140 mg/dL. The simplification of the test may improve coverage and timing of the diagnosis of GDM.

  2. 1H NMR and Rheological Studies of the Calcium Induced Gelation Process in Aqueous Low Methoxyl Pectin Solutions

    Science.gov (United States)

    Dobies, M.; Kuśmia, S.; Jurga, S.

    2006-07-01

    The 1H NMR relaxometry in combination with water proton spin-spin relaxation time measurements and rheometry have been applied to study the ionic gelation of 1% w/w aqueous low methoxyl pectin solution induced by divalent Ca2+ cations from a calcium chloride solution. The model-free approach to the analysis of 1H NMR relaxometry data has been used to separate the information on the static (β) and dynamic () behaviour of the systems tested. The 1H NMR results confirm that the average mobility of both water and the pectin molecules is largely dependent on the concentration of the cross-linking agent. The character of this dependency (β, and T2 vs. CaCl2 concentration) is consistent with the two-stage gelation process of low methoxyl pectin, in which the formation of strongly linked dimer associations (in the range of 0-2.5 mM CaCl2) is followed by the appearance of weak inter-dimer aggregations (for CaCl2≥ 3.5 mM). The presence of the weak gel structure for the sample with 3.5 mM CaCl2 has been confirmed by rheological measurements. Apart from that, the T1 and T2 relaxation times have been found to be highly sensitive to the syneresis phenomenon, which can be useful to monitor the low methoxyl pectin gel network stability.

  3. Qualitative and quantitative analyses of Compound Danshen extract based on (1)H NMR method and its application for quality control.

    Science.gov (United States)

    Yan, Kai-Jing; Chu, Yang; Huang, Jian-Hua; Jiang, Miao-Miao; Li, Wei; Wang, Yue-Fei; Huang, Hui-Yong; Qin, Yu-Hui; Ma, Xiao-Hui; Zhou, Shui-Ping; Sun, Henry; Wang, Wei

    2016-11-30

    In this study, a new approach using (1)H NMR spectroscopy combined with chemometrics method was developed for qualitative and quantitative analyses of extracts of Compound Danshen Dripping Pills (CDDP). For the qualitative analysis, some metabolites presented in Compound Danshen extract (CDE, extraction intermediate of CDDP) were detected, including phenolic acids, saponins, saccharides, organic acids and amino acids, by the proposed (1)H NMR method, and metabolites profiles were further analyzed by selected chemometrics algorithms to define the threshold values for product quality evaluation. Moreover, three main phenolic acids (danshensu, salvianolic acid B, and procatechuic aldehyde) in CDE were determined simultaneously, and method validation in terms of linearity, precision, repeatability, accuracy, and stability of the dissolved target compounds in solution was performed. The average recoveries varied between 84.20% and 110.75% while the RSDs were below 6.34% for the three phenolic acids. This (1)H NMR method offers an integral view of the extract composition, allows the qualitative and quantitative analysis of CDDP, and has the potential to be a supplementary tool to UPLC/HPLC for quality assessment of Chinese herbal medicines.

  4. Orally bioavailable 6-chloro-7-methoxy-4(1H)-quinolones efficacious against multiple stages of Plasmodium.

    Science.gov (United States)

    Cross, R Matthew; Flanigan, David L; Monastyrskyi, Andrii; LaCrue, Alexis N; Sáenz, Fabián E; Maignan, Jordany R; Mutka, Tina S; White, Karen L; Shackleford, David M; Bathurst, Ian; Fronczek, Frank R; Wojtas, Lukasz; Guida, Wayne C; Charman, Susan A; Burrows, Jeremy N; Kyle, Dennis E; Manetsch, Roman

    2014-11-13

    The continued proliferation of malaria throughout temperate and tropical regions of the world has promoted a push for more efficacious treatments to combat the disease. Unfortunately, more recent remedies such as artemisinin combination therapies have been rendered less effective due to developing parasite resistance, and new drugs are required that target the parasite in the liver to support the disease elimination efforts. Research was initiated to revisit antimalarials developed in the 1940s and 1960s that were deemed unsuitable for use as therapeutic agents as a result of poor understanding of both physicochemical properties and parasitology. Structure-activity and structure-property relationship studies were conducted to generate a set of compounds with the general 6-chloro-7-methoxy-2-methyl-4(1H)-quinolone scaffold which were substituted at the 3-position with a variety of phenyl moieties possessing various properties. Extensive physicochemical evaluation of the quinolone series was carried out to downselect the most promising 4(1H)-quinolones, 7, 62, 66, and 67, which possessed low-nanomolar EC50 values against W2 and TM90-C2B as well as improved microsomal stability. Additionally, in vivo Thompson test results using Plasmodium berghei in mice showed that these 4(1H)-quinolones were efficacious for the reduction of parasitemia at >99% after 6 days.

  5. Vigorous exercise increases brain lactate and Glx (glutamate+glutamine): a dynamic 1H-MRS study.

    Science.gov (United States)

    Maddock, Richard J; Casazza, Gretchen A; Buonocore, Michael H; Tanase, Costin

    2011-08-15

    Vigorous exercise increases lactate and glucose uptake by the brain in excess of the increase in brain oxygen uptake. The metabolic fate of this non-oxidized carbohydrate entering the brain is poorly understood, but accumulation of lactate in the brain and/or increased net synthesis of amino acid neurotransmitters are possible explanations. Previous proton magnetic resonance spectroscopy (1H-MRS) studies using conventional pulse sequences have not detected changes in brain lactate following exercise. This contrasts with 1H-MRS studies showing increased brain lactate when blood lactate levels are raised by an intravenous infusion of sodium lactate. Using a J-editing 1H-MRS technique for measuring lactate, we demonstrated a significant 19% increase in lactate in the visual cortex following graded exercise to approximately 85% of predicted maximum heart rate. However, the magnitude of the increase was insufficient to account for more than a small fraction of the non-oxidized carbohydrate entering the brain with exercise. We also report a significant 18% increase in Glx (combined signal from glutamate and glutamine) in visual cortex following exercise, which may represent an activity-dependent increase in glutamate. Future studies will be necessary to test the hypothesis that non-oxidized carbohydrate entering the brain during vigorous exercise is directed, in part, toward increased net synthesis of amino acid neurotransmitters. The possible relevance of these findings to panic disorder and major depression is discussed.

  6. Evidence for Intramolecular Antiparallel Beta-Sheet Structure in Alpha-Synuclein Fibrils from a Combination of Two-Dimensional Infrared Spectroscopy and Atomic Force Microscopy

    Science.gov (United States)

    Roeters, Steven J.; Iyer, Aditya; Pletikapić, Galja; Kogan, Vladimir; Subramaniam, Vinod; Woutersen, Sander

    2017-01-01

    The aggregation of the intrinsically disordered protein alpha-synuclein (αS) into amyloid fibrils is thought to play a central role in the pathology of Parkinson’s disease. Using a combination of techniques (AFM, UV-CD, XRD, and amide-I 1D- and 2D-IR spectroscopy) we show that the structure of αS fibrils varies as a function of ionic strength: fibrils aggregated in low ionic-strength buffers ([NaCl] ≤ 25 mM) have a significantly different structure than fibrils grown in higher ionic-strength buffers. The observations for fibrils aggregated in low-salt buffers are consistent with an extended conformation of αS molecules, forming hydrogen-bonded intermolecular β-sheets that are loosely packed in a parallel fashion. For fibrils aggregated in high-salt buffers (including those prepared in buffers with a physiological salt concentration) the measurements are consistent with αS molecules in a more tightly-packed, antiparallel intramolecular conformation, and suggest a structure characterized by two twisting stacks of approximately five hydrogen-bonded intermolecular β-sheets each. We find evidence that the high-frequency peak in the amide-I spectrum of αS fibrils involves a normal mode that differs fundamentally from the canonical high-frequency antiparallel β-sheet mode. The high sensitivity of the fibril structure to the ionic strength might form the basis of differences in αS-related pathologies.

  7. Synthesis and Molecular Structure of 1,5,1',5'-Tetraphenyl-1H,1H'-3,3'-dialkylthio-bi-1,2,4-triazole

    Institute of Scientific and Technical Information of China (English)

    JIANG Wen-Qing; LIU Tian-Bao; ZOU Jian-Ping; ZHANG Yong

    2007-01-01

    The title compound 1,5,1',5'-tetraphenyl-1H,1H'-3,3'-dialkylthio-bi-1,2,4-triazole (2, C28H20N6S2, Mr=504.62) was prepared by the reaction of 1-benzoyl-3-phenylaminothiourea 1 and Mn(OAc)3·2H2O in acetic acid under microwave irradiation. The crystal is of monoclinic, space group P21/c with a=11.3931(10), b=16.5787(14), c=26.470(2) (A), β=98.274(2)°, Z=8, V=4947.8(8) (A)3, Dc=1.355 g/cm3, μ(MoKα) (A) 0.245 mm-1, F(000)=2096, the final R=0.0583 and Wr=0.1502 for 8705 observed reflections (Ⅰ > 2σ(Ⅰ)). X-ray analysis reveals that the title compound is 1,5,1',5'-tetraphenyl-1H,1H'-3,3'-dialkylthio-bi-1,2,4-triazole, and its formation mechanism was proposed.

  8. Enhanced inactivation of food-borne pathogens in ready-to-eat sliced ham by near-infrared heating combined with UV-C irradiation and mechanism of the synergistic bactericidal action.

    Science.gov (United States)

    Ha, Jae-Won; Kang, Dong-Hyun

    2015-01-01

    The objective of the study described in this article was, first, to investigate the effect of the simultaneous application of near-infrared (NIR) heating and UV irradiation on inactivation of Escherichia coli O157:H7, Salmonella enterica serovar Typhimurium, and Listeria monocytogenes in ready-to-eat (RTE) sliced ham and as well as its effect on product quality and, second, to elucidate the underlying mechanisms of the synergistic bactericidal action of NIR heating and UV irradiation. With the inoculation amounts used, simultaneous NIR-UV combined treatment for 70 s achieved 3.62, 4.17, and 3.43 log CFU reductions of E. coli O157:H7, S. Typhimurium, and L. monocytogenes, respectively. For all three pathogens, the simultaneous application of both technologies resulted in an additional log unit reduction as a result of their synergism compared to the sum of the reductions obtained after the individual treatments. To investigate the mechanisms of NIR-UV synergistic injury for a particular microorganism in a food base, we evaluated the effect of four types of metabolic inhibitors using the overlay method and confirmed that damage to cellular membranes and the inability of cells to repair these structures due to ribosomal damage were the primary factors related to the synergistic lethal effect. Additionally, NIR-UV combined treatment for a maximum of 70 s did not alter the color values or texture parameters of ham slices significantly (P > 0.05). These results suggest that a NIR-UV combined process could be an innovative antimicrobial intervention for RTE meat products. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  9. A novel Bayesian approach to quantify clinical variables and to determine their spectroscopic counterparts in 1H NMR metabonomic data

    Directory of Open Access Journals (Sweden)

    Kaski Kimmo

    2007-05-01

    Full Text Available Abstract Background A key challenge in metabonomics is to uncover quantitative associations between multidimensional spectroscopic data and biochemical measures used for disease risk assessment and diagnostics. Here we focus on clinically relevant estimation of lipoprotein lipids by 1H NMR spectroscopy of serum. Results A Bayesian methodology, with a biochemical motivation, is presented for a real 1H NMR metabonomics data set of 75 serum samples. Lipoprotein lipid concentrations were independently obtained for these samples via ultracentrifugation and specific biochemical assays. The Bayesian models were constructed by Markov chain Monte Carlo (MCMC and they showed remarkably good quantitative performance, the predictive R-values being 0.985 for the very low density lipoprotein triglycerides (VLDL-TG, 0.787 for the intermediate, 0.943 for the low, and 0.933 for the high density lipoprotein cholesterol (IDL-C, LDL-C and HDL-C, respectively. The modelling produced a kernel-based reformulation of the data, the parameters of which coincided with the well-known biochemical characteristics of the 1H NMR spectra; particularly for VLDL-TG and HDL-C the Bayesian methodology was able to clearly identify the most characteristic resonances within the heavily overlapping information in the spectra. For IDL-C and LDL-C the resulting model kernels were more complex than those for VLDL-TG and HDL-C, probably reflecting the severe overlap of the IDL and LDL resonances in the 1H NMR spectra. Conclusion The systematic use of Bayesian MCMC analysis is computationally demanding. Nevertheless, the combination of high-quality quantification and the biochemical rationale of the resulting models is expected to be useful in the field of metabonomics.

  10. Increasing 14N NQR signal by 1H-14N level crossing with small magnetic fields.

    Science.gov (United States)

    Thurber, Kent R; Sauer, Karen L; Buess, Michael L; Klug, Christopher A; Miller, Joel B

    2005-11-01

    NQR detection of materials, such as TNT, is hindered by the low signal-to-noise ratio at low NQR frequencies. Sweeping small (0-26 mT) magnetic fields to shift the (1)H NMR frequency relative to the (14)N NQR frequencies can provide a significant increase of the (14)N NQR signal-to-noise ratio. Three effects of (1)H-(14)N level crossing are demonstrated in diglycine hydrochloride and TNT. These effects are (1) transferring (1)H polarization to one or more of the (14)N transitions, including the use of an adiabatic flip of the (1)H polarization during the field sweep, (2) shortening the effective (14)N T(1) by the interaction of (1)H with the (14)N transitions, (3) "level transfer" effect where the third (14)N (spin 1) energy level or other (14)N sites with different NQR frequency are used as a reservoir of polarization which is transferred to the measured (14)N transition by the (1)H. The (14)N NQR signal-to-noise ratio can be increased by a factor of 2.5 for one (14)N site in diglycine hydrochloride (and 2.2 in TNT), even though the maximum (1)H frequency used in this work, 111 6 kHz, is only 30% larger than the measured (14)N frequencies (834 kHz for diglycine hydrochloride and 843 kHz for TNT).

  11. A common polymorphism in NR1H2 (LXRbeta is associated with preeclampsia

    Directory of Open Access Journals (Sweden)

    Brouillet Jean-Paul

    2011-10-01

    Full Text Available Abstract Background Preeclampsia is a frequent complication of pregnancy and a leading cause of perinatal mortality. Both genetic and environmental risk factors have been identified. Lipid metabolism, particularly cholesterol metabolism, is associated with this disease. Liver X receptors alpha (NR1H3, also known as LXRalpha and beta (NR1H2, also known as LXRbeta play a key role in lipid metabolism. They belong to the nuclear receptor superfamily and are activated by cholesterol derivatives. They have been implicated in preeclampsia because they modulate trophoblast invasion and regulate the expression of the endoglin (CD105 gene, a marker of preeclampsia. The aim of this study was to investigate associations between the NR1H3 and NR1H2 genes and preeclampsia. Methods We assessed associations between single nucleotide polymorphisms of NR1H3 (rs2279238 and rs7120118 and NR1H2 (rs35463555 and rs2695121 and the disease in 155 individuals with preeclampsia and 305 controls. Genotypes were determined by high-resolution melting analysis. We then used a logistic regression model to analyze the different alleles and genotypes for those polymorphisms as a function of case/control status. Results We found no association between NR1H3 SNPs and the disease, but the NR1H2 polymorphism rs2695121 was found to be strongly associated with preeclampsia (genotype C/C: adjusted odds ratio, 2.05; 95% CI, 1.04-4.05; p = 0.039 and genotype T/C: adjusted odds ratio, 1.85; 95% CI, 1.01-3.42; p = 0.049. Conclusions This study provides the first evidence of an association between the NR1H2 gene and preeclampsia, adding to our understanding of the links between cholesterol metabolism and this disease.

  12. Sensitivity of 1H NMR analysis of rat urine in relation to toxicometabonomics. Part I: Dose-dependent toxic fffects of Bromobenzene and paracetamol

    NARCIS (Netherlands)

    Schoonen, W.G.E.J.; Kloks, C.P.A.M.; Ploemen, J.P.H.T.M.; Horbach, G.J.; Smit, M.J.; Zandberg, P.; Mellema, J.R.; Zuylen, C.T. van; Tas, A.C.; Nesselrooij, J.H.J. van; Vogels, J.T.W.E.

    2007-01-01

    1H nuclear magnetic resonance (NMR) spectroscopy of rat urine in combination with pattern recognition analysis was evaluated for early noninvasive detection of toxicity of investigational chemical entities. Bromobenzene (B) and paracetamol (P) were administered at five single oral dosages between 2

  13. No genetic footprints of the fat mass and obesity associated (FTO) gene in human plasma 1H CPMG NMR metabolic profiles

    DEFF Research Database (Denmark)

    Kjeldahl, Karin; Rasmussen, Morten Arendt; Hasselbalch, Ann Louise

    2014-01-01

    In this paper it was investigated if any genotypic footprints from the fat mass and obesity associated (FTO) SNP could be found in 600 MHz 1H CPMG NMR profiles of around 1,000 human plasma samples from healthy Danish twins. The problem was addressed with a combination of univariate and multivariate...

  14. Sensitivity of 1H NMR analysis of rat urine in relation to toxicometabonomics. Part I: Dose-dependent toxic fffects of Bromobenzene and paracetamol

    NARCIS (Netherlands)

    Schoonen, W.G.E.J.; Kloks, C.P.A.M.; Ploemen, J.P.H.T.M.; Horbach, G.J.; Smit, M.J.; Zandberg, P.; Mellema, J.R.; Zuylen, C.T. van; Tas, A.C.; Nesselrooij, J.H.J. van; Vogels, J.T.W.E.

    2007-01-01

    1H nuclear magnetic resonance (NMR) spectroscopy of rat urine in combination with pattern recognition analysis was evaluated for early noninvasive detection of toxicity of investigational chemical entities. Bromobenzene (B) and paracetamol (P) were administered at five single oral dosages between 2

  15. Intermolecular Interactions between Eosin Y and Caffeine Using 1H-NMR Spectroscopy

    Directory of Open Access Journals (Sweden)

    Macduff O. Okuom

    2013-01-01

    Full Text Available DETECHIP has been used in testing analytes including caffeine, cocaine, and tetrahydrocannabinol (THC from marijuana, as well as date rape and club drugs such as flunitrazepam, gamma-hydroxybutyric acid (GHB, and methamphetamine. This study investigates the intermolecular interaction between DETECHIP sensor eosin Y (DC1 and the analyte (caffeine that is responsible for the fluorescence and color changes observed in the actual array. Using 1H-NMR, 1H-COSY, and 1H-DOSY NMR methods, a proton exchange from C-8 of caffeine to eosin Y is proposed.

  16. /sup 3/H-/sup 1/H shift correlation NMR spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Funke, C.W.; Wagenaars, G.N.; Kaspersen, F.M.

    1986-05-01

    Three two-dimensional /sup 3/H-/sup 1/H chemical shift correlation experiments are described, all using familiar pulse sequences. The experiments reveal the chemical shifts of the /sup 1/H spins which are coupled scalarly to a /sup 3/H spin and, thus, assist in the unambiguous location of this /sup 3/H spin within the molecule. The limitations for molecules involving a /sup 3/H spin which is coupled differently to various /sup 1/H spins are indicated. In practice, the detection limit is of the order of 100 MBq per /sup 3/H-labelling site.

  17. Predictions for surveys with the SPICA Mid-infrared Instrument

    CERN Document Server

    Bonato, M; Cai, Z -Y; De Zotti, G; Bressan, A; Wada, T; Kohno, K; Maiolino, R; Gruppioni, C; Pozzi, F; Lapi, A

    2015-01-01

    We present predictions for number counts and redshift distributions of galaxies detectable in continuum and in emission lines with the Mid-infrared (MIR) Instrument (SMI) proposed for the Space Infrared Telescope for Cosmology and Astrophysics (SPICA). We have considered 24 MIR fine-structure lines, four Polycyclic Aromatic Hydrocarbon (PAH) bands (at 6.2, 7.7, 8.6 and 11.3$\\mu$m) and two silicate bands (in emission and in absorption) at 9.7$\\mu$m and 18.0$\\mu$m. Six of these lines are primarily associated with Active Galactic Nuclei (AGNs), the others with star formation. A survey with the SMI spectrometers of 1 hour integration per field-of-view (FoV) over an area of $1\\,\\hbox{deg}^2$ will yield $5\\,\\sigma$ detections of $\\simeq 140$ AGN lines and of $\\simeq 5.2\\times10^{4}$ star-forming galaxies, $\\simeq 1.6\\times10^{4}$ of which will be detected in at least two lines. The combination of a shallow ($20.0\\,\\hbox{deg}^{2}$, $1.4\\times10^{-1}$ h integration per FoV) and a deep survey ($6.9\\times10^{-3}\\,\\hbox...

  18. Infrared heating

    Science.gov (United States)

    1983-11-01

    The transfer of energy by radiation whose limits lie between 1 mm and 400 mm is indicated. The radiation used lies practically completely in the infrared region. Its use therefore depends on the thermal radiation laws (black body or integral receiver laws). These laws were derived mathematically in accordance with the properties of an ideal body, the so-called ""integral receiver'' (formerly black body). According to definition this integral receiver has the property of absorbing completely all incident electromagnetic radiation. From these the following laws were deduced: (1) All bodies with a temperature above absolute zero emit a radiation. (2) The energy emitted by the integral receiver is proportional to the 4th power of the absolute temperature. (3) The emission theoretically comprizes the whole radiation. (4) The radiation comprizing the emission spectrum does not transport the same amount of energy at every wavelength.

  19. {sup 1}H-MR spectroscopy in anorexia nervosa. Reversible cerebral metabolic changes; {sup 1}H-MR-Spektroskopie bei Anorexia nervosa: Reversible zerebrale Metabolitenaenderungen

    Energy Technology Data Exchange (ETDEWEB)

    Moeckel, R.; Schlemmer, H.P.; Becker, G.; Koepke, J.; Georgi, M. [Heidelberg Univ. (Germany). Inst. fuer Klinische Radiologie; Gueckel, C.; Goepel, C.; Schmidt, M. [Zentralinstitut fuer Seelische Gesundheit, Mannheim (Germany). Klinik fuer Kinder- und Jugendpsychiatrie; Hentschel, F. [Zentralinstitut fuer Seelische Gesundheit, Mannheim (Germany). Neuroradiologie

    1999-04-01

    Purpose: By using localized {sup 1}H-MR spectroscopy in the brain of patients with anorexia nervosa we wanted to verify our preliminary results and to look for a reversibility of the metabolic changes under therapy. Methods: In 22 patients and 17 healthy volunteers (11 follow-up examinations) single voxel {sup 1}H-MR spectroscopy (TE=50 ms, TM=30 ms, TR=1500 ms, voxel (2 cm){sup 3}, acq.: 256) was used in two different localizations (thalamus and parieto-occipital region). The first examination of the patients was performed before therapy, the follow-up examination at the end of therapy. Results: In both regions of the brain we found a statistically significant elevation of the Cho/Cr-ratio in comparison to normal controls. The follow-up examinations revealed reversibility of the metabolic changes under successful therapy. Conclusion: {sup 1}H-MR spectroscopy reveals metabolic changes in the brain of patients with anorexia nervosa, which are reversible under successful therapy. These metabolic changes can be conclusively explained using a biochemical model. (orig.) [Deutsch] Ziel: Im Rahmen dieser weiterfuehrenden Studie sollten die bisherigen Ergebnisse der lokalisierten {sup 1}H-MR-Spektroskopie des Gehirns an Patienten mit Anorexia nervosa verifiziert werden. Weiter sollte ueberprueft werden, ob die von uns nachgewiesenen metabolischen Veraenderungen unter Therapie reversibel sind. Methode: Die {sup 1}H-MR-Spektren wurden bei 22 Patientinnen und 17 Probanden (11 Verlaufskontrollen) in Einzelvolumentechnik (TE=50 ms, TM=30 ms, TR=1500 ms, Voxel: (2 cm){sup 3}, Acq.: 256) in zwei unterschiedlichen Hirnregionen (Thalamus, parieto-okzipitale Region) durchgefuehrt. Die erste Untersuchung der Patienten erfolgte bei Aufnahme und die Verlaufskontrolle zum Abschluss der stationaeren Behandlung. Ergebnisse: Bei den Patienten wurde in beiden Hirnregionen ein statistisch signifikant erhoehter Wert fuer das Cho/Cr-Verhaeltnis im Vergleich zu dem Normalkollektiv nachgewiesen

  20. Insight into the composition and evolution of compost-derived dissolved organic matter using high-performance liquid chromatography combined with Fourier transform infrared and nuclear magnetic resonance spectra.

    Science.gov (United States)

    He, Xiao-Song; Xi, Bei-Dou; Li, Wen-Tao; Gao, Ru-Tai; Zhang, Hui; Tan, Wen-Bing; Huang, Cai-Hong

    2015-11-13

    Size exclusion chromatography and reversed-phase high-performance liquid chromatography (RP-HPLC) were combined with Fourier transform infrared spectra (FTIR) and nuclear magnetic resonance (NMR) based on two dimensional (2D) hetero-spectral correlation spectra techniques to fractionate compost-derived dissolved organic matter (DOM) and determine how size- and hydrophobicity-distinguished fractions differ in the composition and evolution. The results showed that the compost-derived DOM was comprised of protein- and humic-like species. The low apparent molecule weight (AMW) protein-like components were enriched in C-C=H3 and N-C=O, and showed more bioreactivity compared with the high AMW counterpart. The hydrophobic and hydrophilic protein-like components both consisted of CCH3 and N-C=O. However, the relatively hydrophilic protein-like components were more easily consumed. As to the humic-like species, the relatively hydrophilic components were slightly larger than the relatively hydrophobic ones. The high AMW and relatively hydrophilic humic-like components were high in C-H, OCH3, N-C=O, N-H, COO, O-H and aromatic C. The low AMW and relatively hydrophobic humic-like components were enriched in CCH3 and N-C=O, and were easily biodegraded during composting. 2D hetero-spectral correlation spectra techniques enhance the characterization of DOM and provide a promising way to elucidate the environmental behaviors of DOM.

  1. Element analysis and characteristic identification of non-fumigated and sulfur-fumigated Fritillaria thunbergii Miq. using microwave digestion-inductively coupled plasma atomic emission spectrometry combined with Fourier transform infrared spectrometry

    Directory of Open Access Journals (Sweden)

    Yajing Lou

    2014-01-01

    Full Text Available Background: Sulfur-fumigation may induce chemical transformation of traditional Chinese medicines leading to harmful effects following patient ingestion. For quality control, it is urgently needed to develop a reliable and efficient method for sulfur-fumigation identification. Materials and Methods: The spectrochemical identification of non-fumigated and sulfur-fumigated Fritillaria thunbergii Miq. was carried out to evaluate inorganic elements and organic components. The concentrations of 12 elements, including Zn, Mn, Cu, Fe, Li, Mg, Sr, Pb, As, Cd, Hg, and S of samples were determined by microwave digestion - inductively coupled plasma atomic emission spectrometry (ICP-AES. Meanwhile, Fourier transform infrared spectrometry (FTIR was used for the study of chemical group characteristic reactions after sulfur-fumigation. Results: The concentrations of Fe, Mg, Hg, and S elements showed significant differences between non-fumigated and sulfur-fumigated Fritillaria thunbergii Miq. The characteristic stretching vibrations of some groups in FTIR spectra, such as -OH, -S = O and -S-O, provided the identification basis for the discrimination of non-fumigated and sulfur-fumigated Fritillaria thunbergii Miq. Conclusion: The application of microwave digestion - ICP-AES was successfully used in combination with FTIR to authenticate and evaluate the quality of medicinal Fritillaria thunbergii Miq. Further applications of this technique should be explored.

  2. Element analysis and characteristic identification of non-fumigated and sulfur-fumigated Fritillaria thunbergii Miq. using microwave digestion-inductively coupled plasma atomic emission spectrometry combined with Fourier transform infrared spectrometry

    Science.gov (United States)

    Lou, Yajing; Cai, Hao; Liu, Xiao; Tu, Sicong; Pei, Ke; Zhao, Yingying; Cao, Gang; Li, Songlin; Qin, Kunming; Cai, Baochang

    2014-01-01

    Background: Sulfur-fumigation may induce chemical transformation of traditional Chinese medicines leading to harmful effects following patient ingestion. For quality control, it is urgently needed to develop a reliable and efficient method for sulfur-fumigation identification. Materials and Methods: The spectrochemical identification of non-fumigated and sulfur-fumigated Fritillaria thunbergii Miq. was carried out to evaluate inorganic elements and organic components. The concentrations of 12 elements, including Zn, Mn, Cu, Fe, Li, Mg, Sr, Pb, As, Cd, Hg, and S of samples were determined by microwave digestion - inductively coupled plasma atomic emission spectrometry (ICP-AES). Meanwhile, Fourier transform infrared spectrometry (FTIR) was used for the study of chemical group characteristic reactions after sulfur-fumigation. Results: The concentrations of Fe, Mg, Hg, and S elements showed significant differences between non-fumigated and sulfur-fumigated Fritillaria thunbergii Miq. The characteristic stretching vibrations of some groups in FTIR spectra, such as -OH, -S = O and -S-O, provided the identification basis for the discrimination of non-fumigated and sulfur-fumigated Fritillaria thunbergii Miq. Conclusion: The application of microwave digestion - ICP-AES was successfully used in combination with FTIR to authenticate and evaluate the quality of medicinal Fritillaria thunbergii Miq. Further applications of this technique should be explored. PMID:24914306

  3. Adding diffuse reflectance infrared Fourier transform spectroscopy capability to extended x-ray-absorption fine structure in a new cell to study solid catalysts in combination with a modulation approach

    Science.gov (United States)

    Chiarello, Gian Luca; Nachtegaal, Maarten; Marchionni, Valentina; Quaroni, Luca; Ferri, Davide

    2014-07-01

    We describe a novel cell used to combine in situ transmission X-ray absorption spectroscopy (XAS) with diffuse reflectance infrared Fourier transform spectroscopy (DRIFTS) in a single experiment. The novelty of the cell design compared to current examples is that both radiations are passed through an X-ray and IR transparent window in direct contact with the sample. This innovative geometry also offers a wide surface for IR collection. In order to avoid interference from the crystalline IR transparent materials (e.g., CaF2, MgF2, diamond) a 500 μm carbon filled hole is laser drilled in the center of a CaF2 window. The cell is designed to represent a plug flow reactor, has reduced dead volume in order to allow for fast exchange of gases and is therefore suitable for experiments under fast transients, e.g., according to the concentration modulation approach. High quality time-resolved XAS and DRIFTS data of a 2 wt.% Pt/Al2O3 catalyst are obtained in concentration modulation experiments where CO (or H2) pulses are alternated to O2 pulses at 150 °C. We show that additional information can be obtained on the Pt redox dynamic under working conditions thanks to the improved sensitivity given by the modulation approach followed by Phase Sensitive Detection (PSD) analysis. It is anticipated that the design of the novel cell is likely suitable for a number of other in situ spectroscopic and diffraction methods.

  4. A novel method for evaluating and improving the 1H-MRSI glioma data quality

    Institute of Scientific and Technical Information of China (English)

    YUAN Kehong; LU Hongyu; BAO Shanglian; CHEN Qiansheng; LI Shaowu; DUAN Chaijie

    2005-01-01

    Metabolic information obtained by proton magnetic resonance spectroscopic imaging (1H-MRSI) has been approved to be a powerful tool to identify either benign or malignant glioma, as well as to confirm the tumor level. However, 1H-MRSI data are affected by various factors, such as the thermal noise, eddy currents, susceptibility artifacts, and rigid body motion. To get accurate quantitative metabolic information, the key problem is to assess the 1H-MRSI data quality. In this paper, we introduce a new evaluating system to filter the data, and a new method, called wavelet denoising method, to improve the data quality under the evaluating system. Experimental results on 1H-MRSI glioma data demonstrate that preprocessing is prerequisite and the proposed algorithm with evaluating system is effective.

  5. On the {sup 1}H NMR spectra of 2-substituted benzoquinones

    Energy Technology Data Exchange (ETDEWEB)

    Tedeschi, E.; Rezende, D.B. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica; Arruda Campos, I.P. de, E-mail: ipdacamp@uol.com.br [Universidade Paulista, Sao Paulo, SP (Brazil). Inst. de Ciencias Exatas e Tecnologia. Programa de Pos-Graduacao em Engenharia de Producao

    2009-07-01

    The novel complete analysis of the {sup 1}H NMR spectra of six monosubstituted benzoquinones is reported herein, together with a brief but complete review of the scanty previously published data on benzoquinone and its monosubstituded derivatives. (author)

  6. Synthesis of 2-Substituted Hexahydro-1H-1,4-diazepine Analogues

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    2-substituted hexahydro-1H-1,4-diazepine analogues were synthesized starting from N,N?-dibenzyl-1,3-propylene diamine and methyl-2,3-dibromo propionate through nucleophilic substitution, reduction, chlorination and debenzylation.

  7. catena-Poly[[(diiodidocadmium-μ-{1-[(1H-benzimidazol-2-ylmethyl]-1H-imidazole-κ2N:N′}] N,N-dimethylformamide monosolvate

    Directory of Open Access Journals (Sweden)

    Bingtao Liu

    2011-12-01

    Full Text Available In the title complex, {[CdI2(C11H10N4]·C3H7NO}n, the CdII ion is four-coordinated by two N atoms from two 1-[(1H-benzimidazol-1-ylmethyl]-1H-imidazole (bmi ligands and by two terminal I− anions in a distorted tetrahedral geometry. One of the two I− anions is disordered over two sets of sites, with refined occupancies of 0.66 (5 and 0.34 (5. The CdII ions are bridged by bmi ligands, leading to the formation of a chain along [001]. Dimethylformamide solvent molecules are located between these chains. Classical N—H...O hydrogen bonding between the bmi ligands and the solvent molecules leads to a consolidation of the structure.

  8. Complete 1H, 15N and 13C assignment of trappin-2 and 1H assignment of its two domains, elafin and cementoin.

    Science.gov (United States)

    Loth, Karine; Alami, Soha Abou Ibrahim; Habès, Chahrazed; Garrido, Solène; Aucagne, Vincent; Delmas, Agnès F; Moreau, Thierry; Zani, Marie-Louise; Landon, Céline

    2016-04-01

    Trappin-2 is a serine protease inhibitor with a very narrow inhibitory spectrum and has significant anti-microbial activities. It is a 10 kDa cationic protein composed of two distinct domains. The N-terminal domain (38 residues) named cementoin is known to be intrinsically disordered when it is not linked to the elafin. The C-terminal domain (57 residues), corresponding to elafin, is a cysteine-rich domain stabilized by four disulfide bridges and is characterized by a flat core and a flexible N-terminal part. To our knowledge, there is no structural data available on trappin-2. We report here the complete (1)H, (15)N and (13)C resonance assignment of the recombinant trappin-2 and the (1)H assignments of cementoin and elafin, under the same experimental conditions. This is the first step towards the 3D structure determination of the trappin-2.

  9. Tetraaqua{1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole}sulfatozinc(II dihydrate

    Directory of Open Access Journals (Sweden)

    Yan-Zhi Wang

    2010-11-01

    Full Text Available In the title complex, [Zn(SO4(C9H8N6(H2O4]·2H2O, the ZnII ion is six-coordinated by one N atom from a 1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole ligand and five O atoms from one monodentate sulfate anion and four water molecules in a distorted octahedral geometry. The sulfate tetrahedron is rotationally disordered over two positions in a 0.618 (19:0.382 (19 ratio. In the crystal, adjacent molecules are linked through O—H...O and O—H...N hydrogen bonds involving the cation, the anion, and the coordinated and uncoordinated water molecules into a three-dimensional network.

  10. Tetraaqua{1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole}sulfatocadmium dihydrate

    Directory of Open Access Journals (Sweden)

    Yu-xian Li

    2011-09-01

    Full Text Available In the title complex, [Cd(SO4(C9H8N6(H2O4]·2H2O, the CdII ion is six-coordinated by one N atom from a 1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole ligand and by five O atoms from four water molecules and one monodentate sulfate anion in a distorted octahedral geometry. The sulfate tetrahedron is rotationally disordered over two positions in a 0.651 (12:0.349 (12 ratio. In the crystal, adjacent molecules are linked through O—H...O and O—H...N hydrogen bonds into a three-dimensional network.

  11. Comparative analysis of fecal fat quantitation via nuclear magnetic resonance spectroscopy (1H NMR) and gravimetry.

    Science.gov (United States)

    Korpi-Steiner, Nichole L; Ward, Jennie N; Kumar, Vivek; McConnell, Joseph P

    2009-02-01

    Fecal-fat is typically measured by extracting lipid from homogenized feces with subsequent gravimetric/titrimetric analyses that are time-consuming and involve toxic solvents. Accordingly, an efficient and more safe method to quantitate fecal-fat is needed. The present objective was to adapt CEM SmartTrac technology (i.e. (1)H NMR) to rapidly (fecal-fat and compare (1)H NMR and gravimetric performance characteristics. (1)H NMR and gravimetric measurements of stool-fat were conducted using excess stool samples (72 h collection; n=107) homogenized to semi-liquid consistency prior to analyses. The (1)H NMR method demonstrated acceptable linearity (R(2)=0.9999) and recovery (mean=105%) with imprecision (intra-assay CV=1.2-6.5%; inter-assay CV=1.8-5.8%) comparable to or better than gravimetry (intra-assay CV=1.0-17.2%; inter-assay CV=3.8-6.5%). Excellent correlation between fecal-fat quantitation by (1)H NMR and gravimetry (n=107; R(2)=0.983; y=1.0173x-0.6859) was exhibited; moreover, (1)H NMR demonstrated good sensitivity (92.3%), specificity (94.5%), negative-predictive value (92.9%) and positive-predictive value (94.1%) for malabsorption using the reference cut-off of fat/24 h. These data demonstrate that (1)H NMR permits rapid and safe quantitation of fecal-fat while maintaining acceptable performance characteristics, thereby supporting the utility of (1)H NMR as an alternative method to gravimetry for fecal-fat quantitation.

  12. Supramolecular assemblies based on 2-ureido-4[1H]-pyrimidinone building block

    Institute of Scientific and Technical Information of China (English)

    WANG Sumin; WU Lizhu; ZHANG Liping; TUNG Chenho

    2006-01-01

    With high association constants in nonpolar solvents, the quadruple hydrogen bonding arrays of 2-ureido-4[1H]-pyrimidinones are recently considered to be one of the ideal building blocks to construct the complicated and functional supramole- cular systems. In this paper, we review the latest achievements of the supramolecular assemblies based on 2-ureido-4[1H]-pyrimidinone AADD quadruple hydrogen bonding building blocks.

  13. Regioselective Synthesis and Base Catalyzed Transacylation of Substituted 1H-Pyrazole-4-carboxamides

    Institute of Scientific and Technical Information of China (English)

    REN,Jun(任军); ZHANG,Xiao-Hong(张晓弘); LIU,Ying(刘莹); CHEN,Wei-Qiang(陈卫强); JIN,Gui-Yu(金桂玉)

    2002-01-01

    New type of substituted 1H-pyrazole-4-carboxamides were obtained by regioselective synthesis under the catalysis of different bases. The structures of the title compounds were confirmed by elemental analysis, 1H NMR, IR, MS and X-ray crystallogaphy. Compounds 1 were transacylated into their corresponding amides 3 in the presence of sodium hydride.Preliminary bioassays indicated that some compounds showed fungicidal activities against Rhizoctonia solani and Sclerotinia sclerotiorum.

  14. Synthesis of 5-substituted 1H-tetrazoles by the copper-catalyzed [3+2] cycloaddition of nitriles and trimethylsilyl azide.

    Science.gov (United States)

    Jin, Tienan; Kitahara, Fukuzou; Kamijo, Shin; Yamamoto, Yoshinori

    2008-09-01

    The copper-catalyzed [3+2] cycloaddition between various nitriles and trimethylsilyl azide in DMF/MeOH produced the corresponding 5-substituted 1H-tetrazoles in good to high yields. It was proposed that the reaction proceeds through the formation in situ of a copper azide species and subsequent [3+2] cycloaddition with the nitriles. Furthermore, we found that a copper and triethylamine combined catalyst also promoted the cycloaddition of nitriles and trimethylsilyl azide to afford the 5-substituted 1H-tetrazoles at relatively low reaction temperatures. The copper azide species would be formed by reaction of the copper catalyst with Et(3)NHN(3) generated in situ.

  15. Proton-detected 3D {sup 1}H/{sup 13}C/{sup 1}H correlation experiment for structural analysis in rigid solids under ultrafast-MAS above 60 kHz

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Rongchun; Ramamoorthy, Ayyalusamy, E-mail: ramamoor@umich.edu [Biophysics and Department of Chemistry, The University of Michigan, Ann Arbor, Michigan 48109-1055 (United States); Nishiyama, Yusuke [JEOL RESONANCE Inc., Musashino, Akishima, Tokyo 196-8558 (Japan); RIKEN CLST-JEOL Collaboration Center, RIKEN, Yokohama, Kanagawa 230-0045 (Japan)

    2015-10-28

    A proton-detected 3D {sup 1}H/{sup 13}C/{sup 1}H chemical shift correlation experiment is proposed for the assignment of chemical shift resonances, identification of {sup 13}C-{sup 1}H connectivities, and proximities of {sup 13}C-{sup 1}H and {sup 1}H-{sup 1}H nuclei under ultrafast magic-angle-spinning (ultrafast-MAS) conditions. Ultrafast-MAS is used to suppress all anisotropic interactions including {sup 1}H-{sup 1}H dipolar couplings, while the finite-pulse radio frequency driven dipolar recoupling (fp-RFDR) pulse sequence is used to recouple dipolar couplings among protons and the insensitive nuclei enhanced by polarization transfer technique is used to transfer magnetization between heteronuclear spins. The 3D experiment eliminates signals from non-carbon-bonded protons and non-proton-bonded carbons to enhance spectral resolution. The 2D (F1/F3) {sup 1}H/{sup 1}H and 2D {sup 13}C/{sup 1}H (F2/F3) chemical shift correlation spectra extracted from the 3D spectrum enable the identification of {sup 1}H-{sup 1}H proximity and {sup 13}C-{sup 1}H connectivity. In addition, the 2D (F1/F2) {sup 1}H/{sup 13}C chemical shift correlation spectrum, incorporated with proton magnetization exchange via the fp-RFDR recoupling of {sup 1}H-{sup 1}H dipolar couplings, enables the measurement of proximities between {sup 13}C and even the remote non-carbon-bonded protons. The 3D experiment also gives three-spin proximities of {sup 1}H-{sup 1}H-{sup 13}C chains. Experimental results obtained from powder samples of L-alanine and L-histidine ⋅ H{sub 2}O ⋅ HCl demonstrate the efficiency of the 3D experiment.

  16. Formation of a dinuclear copper(II) complex through the cleavage of CN bond of 1-benzoyl-3-(pyridin-2-yl)-1H-pyrazole

    Science.gov (United States)

    Shardin, Rosidah; Pui, Law Kung; Yamin, Bohari M.; Kassim, Mohammad B.

    2014-09-01

    A simple mononuclear octahedral copper(II) complex was attempted from the reaction of three moles of 1-benzoyl-3-(pyridin-2-yl)-1H-pyrazole and one mole of copper(II) perchlorate hexahydrate in methanol. However, the product of the reaction was confirmed to be a dinuclear copper(II) complex with μ-{3-(pyridin-2-yl)-pyrazolato} and 3-(pyridin-2-yl)-1H-pyrazole ligands attached to each of the Cu(II) centre atom. The copper(II) ion assisted the cleavage of the CbenzoylN bond afforded a 3-(pyridin-2-yl)-1H-pyrazole molecule. Deprotonation of the 3-(pyridin-2-yl)-1H-pyrazole gave a 3-(pyridin-2-yl)-pyrazolato, which subsequently reacted with the Cu(II) ion to give the {3-(pyridin-2-yl)-pyrazolato}{3-(pyridin-2-yl)-1H-pyrazole}Cu(II) product moiety. The structure of the dinuclear complex was confirmed by x-ray crystallography. The complex crystallized in a monoclinic crystal system with P2(1)/n space group and cell dimensions of a = 12.2029(8) Å, b = 11.4010(7) Å, c = 14.4052(9) Å and β = 102.414(2)°. The compound was further characterized by mass spectrometry, CHN elemental analysis, infrared and UV-visible spectroscopy and the results concurred with the x-ray structure. The presence of d-d transition at 671 nm (ɛ = 116 dm3 mol-1 cm-1) supports the presence of Cu(II) centres.

  17. Novel 1H-pyrrolo[2,3-b]pyridine derivative nortopsentin analogues: synthesis and antitumor activity in peritoneal mesothelioma experimental models.

    Science.gov (United States)

    Carbone, Anna; Pennati, Marzia; Parrino, Barbara; Lopergolo, Alessia; Barraja, Paola; Montalbano, Alessandra; Spanò, Virginia; Sbarra, Stefania; Doldi, Valentina; De Cesare, Michelandrea; Cirrincione, Girolamo; Diana, Patrizia; Zaffaroni, Nadia

    2013-09-12

    In this study, we describe the synthesis of new nortopsentin analogues, 1H-pyrrolo[2,3-b]pyridine derivatives and their biological effects in experimental models of diffuse malignant peritoneal mesothelioma (DMPM), a rare and rapidly fatal disease, poorly responsive to conventional therapies. The three most active compounds, 1f (3-[2-(5-fluoro-1-methyl-1H-indol-3-yl)-1,3-thiazol-4-yl]-1H-pyrrolo[2,3-b]pyridine), 3f (3-[2-(1H-indol-3-yl)-1,3-thiazol-4-yl]-1-methyl-1H-pyrrolo[2,3-b]pyridine), and 1l (3-[2-(5-fluoro-1-methyl-1H-indol-3-yl)-1,3-thiazol-4-yl]-1-methyl-1H-pyrrolo[2,3-b] pyridine), which were shown to act as cyclin-dependent kinase 1 inhibitors, consistently reduced DMPM cell proliferation and induced a caspase-dependent apoptotic response, with a concomitant reduction of the expression of the active Thr(34)-phosphorylated form of the antiapoptotic protein survivin. Moreover, the combined treatment of DMPM cells with 3f derivative and paclitaxel produced a synergistic cytotoxic effect, which was paralleled by an enhanced apoptotic response. In the mouse model, i.p. administration of 1f, 3f, and 1l derivatives was effective, resulting in a significant tumor volume inhibition of DMPM xenografts (range, 58-75%) at well-tolerated doses, and two complete responses were observed in each treatment group.

  18. 1H-NMR as a Structural and Analytical Tool of Intra- and Intermolecular Hydrogen Bonds of Phenol-Containing Natural Products and Model Compounds

    Directory of Open Access Journals (Sweden)

    Pantelis Charisiadis

    2014-09-01

    Full Text Available Experimental parameters that influence the resolution of 1H-NMR phenol OH signals are critically evaluated with emphasis on the effects of pH, temperature and nature of the solvents. Extremely sharp peaks (Δν1/2 ≤ 2 Hz can be obtained under optimized experimental conditions which allow the application of 1H-13C HMBC-NMR experiments to reveal long range coupling constants of hydroxyl protons and, thus, to provide unequivocal assignment of the OH signals even in cases of complex polyphenol natural products. Intramolecular and intermolecular hydrogen bonds have a very significant effect on 1H OH chemical shifts which cover a region from 4.5 up to 19 ppm. Solvent effects on –OH proton chemical shifts, temperature coefficients (Δδ/ΔT, OH diffusion coefficients, and nJ(13C, O1H coupling constants are evaluated as indicators of hydrogen bonding and solvation state of phenol –OH groups. Accurate 1H chemical shifts of the OH groups can be calculated using a combination of DFT and discrete solute-solvent hydrogen bond interaction at relatively inexpensive levels of theory, namely, DFT/B3LYP/6-311++G (2d,p. Excellent correlations between experimental 1H chemical shifts and those calculated at the ab initio level can provide a method of primary interest in order to obtain structural and conformational description of solute-solvent interactions at a molecular level. The use of the high resolution phenol hydroxyl group 1H-NMR spectral region provides a general method for the analysis of complex plant extracts without the need for the isolation of the individual components.

  19. Detection of poly(ethylene glycol) residues from nonionic surfactants in surface water by1h and13c nuclear magnetic resonance spectrometry

    Science.gov (United States)

    Leenheer, J.A.; Wershaw, R. L.; Brown, P.A.; Noyes, T.I.

    1991-01-01

    ??? Poly(ethylene glycol) (PEG) residues were detected in organic solute isolates from surface water by 1H nuclear magnetic resonance spectrometry (NMR), 13C NMR spectrometry, and colorimetric assay. PEG residues were separated from natural organic solutes in Clear Creek, CO, by a combination of methylation and chromatographic procedures. The isolated PEG residues, characterized by NMR spectrometry, were found to consist of neutral and acidic residues that also contained poly(propylene glycol) moieties. The 1H NMR and the colorimetric assays for poly(ethylene glycol) residues were done on samples collected in the lower Mississippi River and tributaries between St. Louis, MO, and New Orleans, LA, in July-August and November-December 1987. Aqueous concentrations for poly(ethylene glycol) residues based on colorimetric assay ranged from undetectable to ???28 ??g/L. Concentrations based on 1H NMR spectrometry ranged from undetectable to 145 ??g/L.

  20. Determination of total nitrogen content, pH, density, refractive index, and brix in Thai fish sauces and their classification by near-infrared spectroscopy with searching combination moving window partial least squares.

    Science.gov (United States)

    Ritthiruangdej, Pitiporn; Kasemsumran, Sumaporn; Suwonsichon, Thongchai; Haruthaithanasan, Vichai; Thanapase, Warunee; Ozaki, Yukihiro

    2005-10-01

    Near-infrared (NIR) transflectance spectra in the region of 1100-2500 nm were measured for 100 Thai fish sauces. Quantitative analyses of total nitrogen (TN) content, pH, refractive index, density and brix in the Thai fish sauces and their qualitative analyses were carried out by multivariate analyses with the aid of wavelength interval selection method named searching combination moving window partial least squares (SCMWPLS). The optimized informative region for TN selected by SCMWPLS was the region of 2264-2428 nm. A PLS calibration model, which used this region, yielded the lowest root mean square error of prediction (RMSEP) of 0.100% w/v for the PLS factor of 5. This prediction result is significantly better than those obtained by using the whole spectral region or informative regions selected by moving window partial least squares regression (MWPLSR). As for pH, density, refractive index and brix, the 1698-1722, and 2222-2258 nm regions, the 1358-1438 nm region, the 1774-1846, and 2078-2114 nm regions, and the 1322-1442, and 2000-2076 nm regions were selected by SCMWPLS as the optimized regions. The best prediction results were always obtained by use of the optimized regions selected by SCMWPLS. The lowest RMSEP for pH, density, refractive index and brix were 0.170, 0.007 g cm(-3), 0.0079 and 0.435 degrees Brix, respectively. Qualitative models were developed by using four supervised pattern recognitions, linear discriminant analysis (LDA), factor analysis-linear discriminant analysis (FA-LDA), soft independent modeling of class analog (SIMCA), and K neareat neighbors (KNN) for the optimized combination of informative regions of the NIR spectra of fish sauces to classify fish sauces into three groups based on TN. All the developed models can potentially classify the fish sauces with the correct classification rate of more than 82%, and the KNN classified model has the highest correct classification rate (95%). The present study has demonstrated that NIR

  1. Bulk magnetization and {sup 1}H NMR spectra of magnetically heterogeneous model systems

    Energy Technology Data Exchange (ETDEWEB)

    Levin, E.M., E-mail: levin@iastate.edu [Division of Materials Sciences and Engineering, Ames Laboratory of US DOE (United States); Department of Physics and Astronomy, Iowa State University, Iowa, IA 50011-3020 (United States); Bud' ko, S.L. [Division of Materials Sciences and Engineering, Ames Laboratory of US DOE (United States); Department of Physics and Astronomy, Iowa State University, Iowa, IA 50011-3020 (United States)

    2011-10-15

    Bulk magnetization and {sup 1}H static and magic angle spinning (MAS) nuclear magnetic resonance (NMR) spectra of two magnetically heterogeneous model systems based on laponite (LAP) layered silicate or polystyrene (PS) with low and high proton concentration, respectively, and ferrimagnetic Fe{sub 2}O{sub 3} nano- or micro-particles have been studied. In LAP+Fe{sub 2}O{sub 3}, a major contribution to the NMR signal broadening is due to the dipolar coupling between the magnetic moments of protons and magnetic particles. In PS+Fe{sub 2}O{sub 3}, due to the higher proton concentration in polystyrene and stronger proton-proton dipolar coupling, an additional broadening is observed, i.e. {sup 1}H MAS NMR spectra of magnetically heterogeneous systems are sensitive to both proton-magnetic particles and proton-proton dipolar couplings. An increase of the volume magnetization by {approx}1 emu/cm{sup 3} affects the {sup 1}H NMR signal width in a way that is similar to an increase of the proton concentration by {approx}2x10{sup 22}/cm{sup 3}. {sup 1}H MAS NMR spectra, along with bulk magnetization measurements, allow the accurate determination of the hydrogen concentration in magnetically heterogeneous systems. - Highlights: > {sup 1}H NMR and magnetization allow study of dipolar interactions in magnetically heterogeneous systems. > Both the proton-proton and proton-magnetic particle dipolar interactions affect {sup 1}H NMR spectra. > {sup 1}H NMR and magnetization can be used for the accurate determination of the hydrogen concentration.

  2. Characterization of Maytenus ilicifolia samples by {sup 1}H NMR relaxation in the solid state; Caracterizacao dos constituintes polimericos da Maytenus ilicifolia por relaxacao nuclear de {sup 1}H por RMN no estado solido

    Energy Technology Data Exchange (ETDEWEB)

    Preto, Monica S. de M.; Tavares, Maria I.B., E-mail: mibt@ima.ufrj.br [Universidade Federal do Rio de Janeiro (IMA/UFRJ), RJ (Brazil). Inst. de Macromoleculas Professora Eloisa Mano. Lab de Ressonancia Magnetica Nuclear; Sebastiao, Pedro J.O. [Departamento de Fisica, Instituto Superior Tecnico, Lisboa (Portugal)

    2011-07-01

    The Maytenus ilicifolia (espinheira-santa) is a popular medicinal plant with different uses. It is native of South America and can be found in Brazil. In the Brazilian market it is possible found products labeled as M. ilicifolia. So far, the studies published in the literature involve the modification of the natural materials and do not concern the comparison between commercial the raw natural materials. Different non-destructive NMR techniques can be used to study natural materials. In this work it is presented a characterization study by Fast Field Cycling of the {sup 1}H spin-lattice relaxation time (T{sub 1}) NMR, in the frequency range 100 khz-10 MHz. The results obtained in two commercial M. ilicifolia samples and one control sample collected in natura are compared. It was intended to study the possibility to elaborate a characterization method using FFCNMR suitable for the verification of authenticity and/or evaluation of tampering on products. The differences detected by FFCNMR relaxometry were confirmed by thermogravimetric analysis and infrared spectroscopy. (author)

  3. Colorimetric calibration of coupled infrared simulation system

    Science.gov (United States)

    Zhang, Ying; Fei, Jindong; Gao, Yang; Du, Jian

    2015-10-01

    In order to test 2-color infrared sensors, a coupled infrared simulation system can generate radiometric outputs with wavelengths that range from less than 3 microns to more than 12 microns. There are two channels in the coupled simulation system, optically combined by a diachronic beam combiner. Each channel has an infrared blackbody, a filter, a diaphragm, and diaphragm-motors. The system is projected to the sensor under testing by a collimator. This makes it difficult to calibrate the system with only one-band thermal imager. Errors will be caused in the radiance levels measured by the narrow band thermal imager. This paper describes colorimetric temperature measurement techniques that have been developed to perform radiometric calibrations of these infrared simulation systems above. The calibration system consists of two infrared thermal imagers; one is operated at the wavelength range of MW-IR, and the other at the range of LW-IR.

  4. New infrared photon absorption processes

    Energy Technology Data Exchange (ETDEWEB)

    Bayfield, J.E.

    1993-05-01

    The fast ionization of atoms by very short laser pulses, and its possible suppression at extreme pulse intensities, is an active new field of investigation at present. Described is an investigation of whether past techniques for infrared laser multiphoton ionization of excited hydrogen atoms and of one-dimensional microwave ionization of highly excited hydrogen atoms can be combined and extended to address the new issues. Although technically difficult and requiring further improvement of apparatus, intense-field infrared laser experiments on excited hydrogen atoms are possible and can directly test theoretical and numerical results.

  5. 1H magnetic resonance spectroscopy studies on subclinical neurocysticercosis%脑实质囊虫病亚临床期的1H-MRS成像研究

    Institute of Scientific and Technical Information of China (English)

    王青; 张承志; 李信响; 徐鲲; 苏洁

    2016-01-01

    Objective: To evaluate the clinical application of single voxel 1H magnetic resonance spectroscopy in diagnosis of subclinical neurocysticercosis. Materials and Methods: One hundred and ten cases of subclinical neurocysticercosis and 130 cases of cerebral cysticercosis (live worms stage) with contrast enhanced single voxel 1H magnetic resonance spectroscopy were screened for this study. Observation of the change in ratio of the lesions of the subclinical neurocysticercosis and some trace metabolites around the lesions was done. Results: The group of subclinical neurocysticercosis has no significant difference with normal control group in various biochemical metabolites. The ratios of NAA/Cho, Cho/Cr and Lip/Cr have statistical significance in the analysis and evaluation of subclinical neurocysticercosis group and live worms stage group. The ratio of NAA/Cho in subclinical neurocysticercosis group is higher than live worms stage group. The ratios of Cho/Cr and Lip/Cr of the former are lower than that of the latter. The ratios of NAA/Cho and Lip/Cr evaluate the differential diagnosis efficiency between subclinical neurocysticercosis stage and live worms stage on ROC curve. Conclusions: 1H-MRS reveals the changes in characteristics of subclinical neurocysticercosis stage and live worms stage so as to evaluate the corresponding diagnosis index of the ratios of NAA/Cho and Lip/Cr, which are of great value to early diagnosis and treatment of the neurocysticercosis.%目的:应用单体素1H-MRS波谱成像前瞻性研究对其脑实质囊虫病亚临床期的诊断价值。材料与方法筛选110例脑实质囊虫病亚临床期为研究对象,并与130例脑实质囊虫病活虫期为对照,进行单体素1H-MRS波谱成像检查,观测脑实质囊虫(亚临床期)病灶及其周围区域某些微量代谢产物比值的变化,并进行对照评价。结果脑实质囊虫病亚临床期与正常镜像区组各生化代谢物比值结果均无显著性差异

  6. Design, synthesis and anticancer activity of new 3-cyano-2 (1H -pyridone and 3-cyanopyridine-2-(1H-thione derivatives

    Directory of Open Access Journals (Sweden)

    E. A. Abdel Motaal

    2015-06-01

    Full Text Available The main objective of the present research study is to synthesize some novel chalcone, cyanoacetohydrazone, enaminone, 3-cyano-2(1H-pyridone and 3-cyanopyridine-2-(1H-thione derivatives and evaluate them for their anticancer effect. The novel chalcones 2a-c were achieved by Claisen-Schmidt condensation of appropriate benzaldehydes with ethanone derivative 1. Treatment of cyanoacetic acid hydrazide with ethanone derivative 1 yielded the correspondinghydrazone derivative 3. Condensation of ethanone derivative 1 with DMF-DMA afforded (E-3-(dimethylamino-1- (4- morpholinophenylprop-2-en-1-one 4. Heterocyclization of chalcones 2a-c with cyanothioacetamide yielded 2-thioxo-1,2-dihydropyridine-3-carbonitriles 7a-c. In a similar manner, cyclocondensation of chalcones 2a,b with cyanoacetamide afforded the corresponding 2-oxo-1,2-dihydropyridine-3-carbonitriles 8a,b. The Reaction of compound 2a with ethyl cyanoacetate furnished 2-oxo-1,2-dihydropyridine-3-carboxylate 12. The 2-oxo-4-phenyl-1,2-dihydro-pyridine-3,5-dicarbonitriles 14a,b were obtained by cyclization of cyano-acetohydrazone 3 with cinnamonitriles. The structures of the synthesized compounds were confirmed by elemental analysis, mass spectrometry, IR and 1H-NMR spectroscopy. The anticancer activity of the newly synthesized compounds was screened in vitro against Human lung carcinoma (A 549 cell line indicating that compounds 7b and 8a possess the most potent inhibitory effect against the human lung carcinoma cell line (A549.

  7. Transformation of 1H-benzotriazole by ozone in aqueous solution.

    Science.gov (United States)

    Mawhinney, Douglas B; Vanderford, Brett J; Snyder, Shane A

    2012-07-01

    Recent studies have shown that 1H-benzotriazole is a widespread contaminant of wastewater and surface water. Although disinfection by ozone has been shown to efficiently remove this compound, the transformation products have not been identified. To that end, the reaction of ozone with 1H-benzotriazole in aqueous solution has been studied in real time employing quadrupole time-of-flight mass spectrometry (Q-TOF MS) and negative electrospray ionization. The transformation products have been identified by calculating their empirical formulas using accurate mass measurements, and further confirmed by performing the reaction with stable isotope-labeled 1H-benzotriazole and measuring product ion spectra. Stable reaction products were distinguished from transient species by plotting their extracted mass profiles. The products that resulted from ozone and hydroxyl radicals in the reaction were qualitatively identified by modifying the conditions to either promote the formation of hydroxyl radicals, or to scavenge them. Based on experimental evidence, a mechanism for the direct reaction between ozone and 1H-benzotriazole is proposed that results in the formation of 1H-1,2,3-triazole-4,5-dicarbaldehyde, which has an empirical formula of C(4)H(3)O(2)N(3). Lastly, it was confirmed that the same transformation products formed in surface water and tertiary-treated wastewater, although they were observed to degrade at higher ozone doses.

  8. A disc wind interpretation of the strong Fe Kα features in 1H 0707-495

    Science.gov (United States)

    Hagino, Kouichi; Odaka, Hirokazu; Done, Chris; Tomaru, Ryota; Watanabe, Shin; Takahashi, Tadayuki

    2016-10-01

    1H 0707-495 is the most convincing example of a supermassive black hole with an X-ray spectrum being dominated by extremely smeared, relativistic reflection, with the additional requirement of strongly supersolar iron abundance. However, here we show that the iron features in its 2-10 keV spectrum are rather similar to the archetypal wind dominated source, PDS 456. We fit all the 2-10 keV spectra from 1H 0707-495 using the same wind model as used for PDS 456, but viewed at higher inclination so that the iron absorption line is broader but not so blueshifted. This gives a good overall fit to the data from 1H 0707-495, and an extrapolation of this model to higher energies also gives a good match to the NuSTAR data. Small remaining residuals indicate that the iron line emission is stronger than in PDS 456. This is consistent with the wider angle wind expected from a continuum-driven wind from the super-Eddington mass accretion rate in 1H 0707-495, and/or the presence of residual reflection from the underlying disc though the presence of the absorption line in the model removes the requirement for highly relativistic smearing, and highly supersolar iron abundance. We suggest that the spectrum of 1H 0707-495 is sculpted more by absorption in a wind than by extreme relativistic effects in strong gravity.

  9. 1H relaxation dispersion in solutions of nitroxide radicals: Influence of electron spin relaxation

    Science.gov (United States)

    Kruk, D.; Korpała, A.; Kubica, A.; Kowalewski, J.; Rössler, E. A.; Moscicki, J.

    2013-03-01

    The work presents a theory of nuclear (1H) spin-lattice relaxation dispersion for solutions of 15N and 14N radicals, including electron spin relaxation effects. The theory is a generalization of the approach presented by Kruk et al. [J. Chem. Phys. 137, 044512 (2012)], 10.1063/1.4736854. The electron spin relaxation is attributed to the anisotropic part of the electron spin-nitrogen spin hyperfine interaction modulated by rotational dynamics of the paramagnetic molecule, and described by means of Redfield relaxation theory. The 1H relaxation is caused by electron spin-proton spin dipole-dipole interactions which are modulated by relative translational motion of the solvent and solute molecules. The spectral density characterizing the translational dynamics is described by the force-free-hard-sphere model. The electronic relaxation influences the 1H relaxation by contributing to the fluctuations of the inter-molecular dipolar interactions. The developed theory is tested against 1H spin-lattice relaxation dispersion data for glycerol solutions of 4-oxo-TEMPO-d16-15N and 4-oxo-TEMPO-d16-14N covering the frequency range of 10 kHz-20 MHz. The studies are carried out as a function of temperature starting at 328 K and going down to 290 K. The theory gives a consistent overall interpretation of the experimental data for both 14N and 15N systems and explains the features of 1H relaxation dispersion resulting from the electron spin relaxation.

  10. Localized 1H-MR spectroscopy in moyamoya disease before and after revascularization surgery

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Soo Mee; Choi, Hye Young; Suh, Jung Soo [Ewha Womans University Hospital, Seoul (Korea, Republic of); Lee, Jung Hee; Lim, Keun Ho; Suh, Dae Chul; Lee, Ho Kyu; Lim, Tae Hwan; Ra, Young Shin [Ulsan University College of Medicine, Seoul (Korea, Republic of)

    2003-06-01

    To evaluate, using localized proton magnetic resonance spectroscopy (1H-MRS), the cerebral metabolic change apparent after revascularization surgery in patients with moyamoya disease. Sixteen children with moyamoya disease and eight age-matched normal controls underwent MR imaging, MR angiography, conventional angiography, and {sup 99m}Tc- ECD SPECT. Frontal white matter and the basal ganglia of both hemispheres were subjected to localized {sup 1}H-MRS, and after revascularization surgery, four patients underwent follow-up {sup 1}H-MRS. Decreased NAA/Cr ratios (1.35{+-}0.14 in patients vs. 1.55{+-}0.24 in controls) and Cho/Cr ratios (0.96{+-}0.13 in patients vs. 1.10{+-}0.11 in controls) were observed in frontal white matter. After revascularization surgery, NAA/Cr and Cho/Cr ratios in this region increased. In the basal ganglia, there is no abnormal metabolic ratios. Localized 1H-MRS revealed abnormal metabolic change in both hemispheres of children with moyamoya disease. Because of its non-invasive nature, {sup 1}H-MRS is potentially useful for the preoperative evaluation of metabolic abnormalities and their postoperative monitoring.

  11. Adding diffuse reflectance infrared Fourier transform spectroscopy capability to extended x-ray-absorption fine structure in a new cell to study solid catalysts in combination with a modulation approach

    Energy Technology Data Exchange (ETDEWEB)

    Chiarello, Gian Luca [Dipartimento di Chimica, Università degli Studi di Milano, Via C. Golgi 19, I-20133 Milano, Italy and Empa, Swiss Federal Laboratories for Materials Science and Technology, Lab. for Solid State Chemistry and Catalysis, Ueberlandstrasse 129, CH-8600 Dübendorf (Switzerland); Nachtegaal, Maarten; Marchionni, Valentina; Quaroni, Luca; Ferri, Davide, E-mail: davide.ferri@psi.ch [Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland)

    2014-07-15

    We describe a novel cell used to combine in situ transmission X-ray absorption spectroscopy (XAS) with diffuse reflectance infrared Fourier transform spectroscopy (DRIFTS) in a single experiment. The novelty of the cell design compared to current examples is that both radiations are passed through an X-ray and IR transparent window in direct contact with the sample. This innovative geometry also offers a wide surface for IR collection. In order to avoid interference from the crystalline IR transparent materials (e.g., CaF{sub 2}, MgF{sub 2}, diamond) a 500 μm carbon filled hole is laser drilled in the center of a CaF{sub 2} window. The cell is designed to represent a plug flow reactor, has reduced dead volume in order to allow for fast exchange of gases and is therefore suitable for experiments under fast transients, e.g., according to the concentration modulation approach. High quality time-resolved XAS and DRIFTS data of a 2 wt.% Pt/Al{sub 2}O{sub 3} catalyst are obtained in concentration modulation experiments where CO (or H{sub 2}) pulses are alternated to O{sub 2} pulses at 150 °C. We show that additional information can be obtained on the Pt redox dynamic under working conditions thanks to the improved sensitivity given by the modulation approach followed by Phase Sensitive Detection (PSD) analysis. It is anticipated that the design of the novel cell is likely suitable for a number of other in situ spectroscopic and diffraction methods.

  12. Effect of fertilizers on galanthamine and metabolite profiles in Narcissus bulbs by 1H NMR.

    Science.gov (United States)

    Lubbe, Andrea; Choi, Young Hae; Vreeburg, Peter; Verpoorte, Robert

    2011-04-13

    Narcissus bulbs contain the biologically active alkaloid galanthamine, and Narcissus is being developed as a natural source of the molecule for the pharmaceutical industry. The effect of fertilizer on galanthamine production was investigated in a field study using a (1)H nuclear magnetic resonance (NMR) metabolite profiling approach. Galanthamine was quantitated and major metabolites in the bulbs were identified. The application of standard fertilization levels of nitrogen and potassium caused a significant increase in galanthamine as compared to a control. Multivariate data analysis of the (1)H NMR data revealed that applying double the standard level of nitrogen fertilizer resulted in production of more amino acids and citric acid cycle intermediates, but not more galanthamine. The results indicated that standard levels of fertilizer currently applied in The Netherlands are sufficient for optimal galanthamine accumulation in the bulbs. This study shows how (1)H NMR-based metabolic profiling can provide insight into the response of plant metabolism to agricultural practices.

  13. Approximation methods of mixed l 1/H2 optimization problems for MIMO discrete-time systems

    Institute of Scientific and Technical Information of China (English)

    李昇平

    2004-01-01

    The mixed l1/H2 optimization problem for MIMO (multiple input-multiple output) discrete-time systems is eonsidered. This problem is formulated as minimizing the l1-norm of a dosed-loop transfer matrix while maintaining the H2-norm of another closed-loop transfer matrix at prescribed level. The continuity property of the optimal value in respect to changes in the H2-norm constraint is studied. The existence of the optimal solutions of mixed l1/H2 problem is proved. Becatse the solution of the mixed l1/H2 problem is based on the scaled-Q method, it avoids the zero interpolation difficulties. The convergent upper and lower bounds can be obtained by solving a sequence of finite dimensional nonlinear programming for which many efficient numerical optimization algorithms exist.

  14. Double-tuned radiofrequency coil for (19)F and (1)H imaging.

    Science.gov (United States)

    Otake, Yosuke; Soutome, Yoshihisa; Hirata, Koji; Ochi, Hisaaki; Bito, Yoshitaka

    2014-01-01

    We developed a double-tuned radiofrequency (RF) coil using a novel circuit method to double tune for fluorine-19 (19F) and 1H magnetic resonance imaging, whose frequencies are very close to each other. The RF coil consists of 3 parallel-connected series inductor capacitor circuits. A computer simulation for our double-tuned RF coil with a phantom demonstrated that the coil has tuned resonant frequency and high sensitivity for both 19F and 1H. Drug distribution was visualized at 7 tesla using this RF coil and a rat administered perfluoro 15-crown-5-ether emulsion. The double-tune RF coil we developed may be a powerful tool for 19F and 1H imaging.

  15. Relativistic Force Field: Parametrization of (13)C-(1)H Nuclear Spin-Spin Coupling Constants.

    Science.gov (United States)

    Kutateladze, Andrei G; Mukhina, Olga A

    2015-11-01

    Previously, we reported a reliable DU8 method for natural bond orbital (NBO)-aided parametric scaling of Fermi contacts to achieve fast and accurate prediction of proton-proton spin-spin coupling constants (SSCC) in (1)H NMR. As sophisticated NMR experiments for precise measurements of carbon-proton SSCCs are becoming more user-friendly and broadly utilized by the organic chemistry community to guide and inform the process of structure determination of complex organic compounds, we have now developed a fast and accurate method for computing (13)C-(1)H SSCCs. Fermi contacts computed with the DU8 basis set are scaled using selected NBO parameters in conjunction with empirical scaling coefficients. The method is optimized for inexpensive B3LYP/6-31G(d) geometries. The parametric scaling is based on a carefully selected training set of 274 ((3)J), 193 ((2)J), and 143 ((1)J) experimental (13)C-(1)H spin-spin coupling constants reported in the literature. The DU8 basis set, optimized for computing Fermi contacts, which by design had evolved from optimization of a collection of inexpensive 3-21G*, 4-21G, and 6-31G(d) bases, offers very short computational (wall) times even for relatively large organic molecules containing 15-20 carbon atoms. The most informative SSCCs for structure determination, i.e., (3)J, were computed with an accuracy of 0.41 Hz (rmsd). The new unified approach for computing (1)H-(1)H and (13)C-(1)H SSCCs is termed "DU8c".

  16. Protein conformational exchange measured by 1H R1ρ relaxation dispersion of methyl groups.

    Science.gov (United States)

    Weininger, Ulrich; Blissing, Annica T; Hennig, Janosch; Ahlner, Alexandra; Liu, Zhihong; Vogel, Hans J; Akke, Mikael; Lundström, Patrik

    2013-09-01

    Activated dynamics plays a central role in protein function, where transitions between distinct conformations often underlie the switching between active and inactive states. The characteristic time scales of these transitions typically fall in the microsecond to millisecond range, which is amenable to investigations by NMR relaxation dispersion experiments. Processes at the faster end of this range are more challenging to study, because higher RF field strengths are required to achieve refocusing of the exchanging magnetization. Here we describe a rotating-frame relaxation dispersion experiment for (1)H spins in methyl (13)CHD2 groups, which improves the characterization of fast exchange processes. The influence of (1)H-(1)H rotating-frame nuclear Overhauser effects (ROE) is shown to be negligible, based on a comparison of R 1ρ relaxation data acquired with tilt angles of 90° and 35°, in which the ROE is maximal and minimal, respectively, and on samples containing different (1)H densities surrounding the monitored methyl groups. The method was applied to ubiquitin and the apo form of calmodulin. We find that ubiquitin does not exhibit any (1)H relaxation dispersion of its methyl groups at 10 or 25 °C. By contrast, calmodulin shows significant conformational exchange of the methionine methyl groups in its C-terminal domain, as previously demonstrated by (1)H and (13)C CPMG experiments. The present R 1ρ experiment extends the relaxation dispersion profile towards higher refocusing frequencies, which improves the definition of the exchange correlation time, compared to previous results.

  17. Elevated glutamatergic compounds in pregenual anterior cingulate in pediatric autism spectrum disorder demonstrated by 1H MRS and 1H MRSI.

    Directory of Open Access Journals (Sweden)

    Anthony Bejjani

    Full Text Available Recent research in autism spectrum disorder (ASD has aroused interest in anterior cingulate cortex and in the neurometabolite glutamate. We report two studies of pregenual anterior cingulate cortex (pACC in pediatric ASD. First, we acquired in vivo single-voxel proton magnetic resonance spectroscopy ((1H MRS in 8 children with ASD and 10 typically developing controls who were well matched for age, but with fewer males and higher IQ. In the ASD group in midline pACC, we found mean 17.7% elevation of glutamate + glutamine (Glx (p<0.05 and 21.2% (p<0.001 decrement in creatine + phosphocreatine (Cr. We then performed a larger (26 subjects with ASD, 16 controls follow-up study in samples now matched for age, gender, and IQ using proton magnetic resonance spectroscopic imaging ((1H MRSI. Higher spatial resolution enabled bilateral pACC acquisition. Significant effects were restricted to right pACC where Glx (9.5%, p<0.05, Cr (6.7%, p<0.05, and N-acetyl-aspartate + N-acetyl-aspartyl-glutamate (10.2%, p<0.01 in the ASD sample were elevated above control. These two independent studies suggest hyperglutamatergia and other neurometabolic abnormalities in pACC in ASD, with possible right-lateralization. The hyperglutamatergic state may reflect an imbalance of excitation over inhibition in the brain as proposed in recent neurodevelopmental models of ASD.

  18. Electrowetting Performances of Novel Fluorinated Polymer Dielectric Layer Based on Poly(1H,1H,2H,2H-perfluoroctylmethacrylate Nanoemulsion

    Directory of Open Access Journals (Sweden)

    Jiaxin Hou

    2017-06-01

    Full Text Available In electrowetting devices, hydrophobic insulating layer, namely dielectric layer, is capable of reversibly switching surface wettability through applied electric field. It is critically important but limited by material defects in dielectricity, reversibility, film forming, adhesiveness, price and so on. To solve this key problem, we introduced a novel fluorinated polyacrylate—poly(1H,1H,2H,2H-perfluoroctylmethacrylate (PFMA to construct micron/submicron-scale dielectric layer via facile spray coating of nanoemulsion for replacing the most common Teflon AF series. All the results illustrated that, continuous and dense PFMA film with surface relief less than 20 nm was one-step fabricated at 110 °C, and exhibited much higher static water contact angle of 124°, contact angle variation of 42°, dielectric constant of about 2.6, and breakdown voltage of 210 V than Teflon AF 1600. Particularly, soft and highly compatible polyacrylate mainchain assigned five times much better adhesiveness than common adhesive tape, to PFMA layer. As a promising option, PFMA dielectric layer may further facilitate tremendous development of electrowetting performances and applications.

  19. (1)H-NMR, (1)H-NMR T2-edited, and 2D-NMR in bipolar disorder metabolic profiling.

    Science.gov (United States)

    Sethi, Sumit; Pedrini, Mariana; Rizzo, Lucas B; Zeni-Graiff, Maiara; Mas, Caroline Dal; Cassinelli, Ana Cláudia; Noto, Mariane N; Asevedo, Elson; Cordeiro, Quirino; Pontes, João G M; Brasil, Antonio J M; Lacerda, Acioly; Hayashi, Mirian A F; Poppi, Ronei; Tasic, Ljubica; Brietzke, Elisa

    2017-12-01

    The objective of this study was to identify molecular alterations in the human blood serum related to bipolar disorder, using nuclear magnetic resonance (NMR) spectroscopy and chemometrics. Metabolomic profiling, employing (1)H-NMR, (1)H-NMR T2-edited, and 2D-NMR spectroscopy and chemometrics of human blood serum samples from patients with bipolar disorder (n = 26) compared with healthy volunteers (n = 50) was performed. The investigated groups presented distinct metabolic profiles, in which the main differential metabolites found in the serum sample of bipolar disorder patients compared with those from controls were lipids, lipid metabolism-related molecules (choline, myo-inositol), and some amino acids (N-acetyl-L-phenyl alanine, N-acetyl-L-aspartyl-L-glutamic acid, L-glutamine). In addition, amygdalin, α-ketoglutaric acid, and lipoamide, among other compounds, were also present or were significantly altered in the serum of bipolar disorder patients. The data presented herein suggest that some of these metabolites differentially distributed between the groups studied may be directly related to the bipolar disorder pathophysiology. The strategy employed here showed significant potential for exploring pathophysiological features and molecular pathways involved in bipolar disorder. Thus, our findings may contribute to pave the way for future studies aiming at identifying important potential biomarkers for bipolar disorder diagnosis or progression follow-up.

  20. Unambiguous Metabolite Identification in High-Throughput Metabolomics by Hybrid 1H-NMR/ESI-MS1 Approach

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-18

    The invention improves accuracy of metabolite identification by combining direct infusion ESI-MS with one-dimensional 1H-NMR spectroscopy. First, we apply a standard 1H-NMR metabolite identification protocol by matching the chemical shift, J-coupling and intensity information of experimental NMR signals against the NMR signals of standard metabolites in a metabolomics reference libraries. This generates a list of candidate metabolites. The list contains both false positive and ambiguous identifications. The software tool (the invention) takes the list of candidate metabolites, generated from NMRbased metabolite identification, and then calculates, for each of the candidate metabolites, the monoisotopic mass-tocharge (m/z) ratios for each commonly observed ion, fragment and adduct feature. These are then used to assign m/z ratios in experimental ESI-MS spectra of the same sample. Detection of the signals of a given metabolite in both NMR and MS spectra resolves the ambiguities, and therefore, significantly improves the confidence of the identification.

  1. (1)H NMR-based metabolomics study on repeat dose toxicity of fine particulate matter in rats after intratracheal instillation.

    Science.gov (United States)

    Zhang, Yannan; Hu, Hejing; Shi, Yanfeng; Yang, Xiaozhe; Cao, Lige; Wu, Jing; Asweto, Collins Otieno; Feng, Lin; Duan, Junchao; Sun, Zhiwei

    2017-07-01

    Systemic metabolic effects and toxicity mechanisms of ambient fine particulate matter (PM2.5) remain uncertain. In order to investigate the mechanisms in PM2.5 toxicity, we explored the endogenous metabolic changes and possible influenced metabolic pathways in rats after intratracheal instillation of PM2.5 by using a (1)H nuclear magnetic resonance (NMR)-based metabolomics approach. Liver and kidney histopathology examinations were also performed. Chemical characterization demonstrated that PM2.5 was a complex mixture of elements. Histopathology showed cellular edema in liver and glomerulus atrophy of the PM2.5 treated rats. We systematically analyzed the metabolites changes of serum and urine in rats using (1)H NMR techniques in combination with multivariate statistical analysis. Significantly reduced levels of lactate, alanine, dimethylglycine, creatine, glycine and histidine in serum, together with increased levels of citrate, arginine, hippurate, allantoin and decreased levels of allthreonine, lactate, alanine, acetate, succinate, trimethylamine, formate in urine were observed of PM2.5 treated rats. The mainly affected metabolic pathways by PM2.5 were glycine, serine and threonine metabolism, glyoxylate and dicarboxylate metabolism, citrate cycle (TCA cycle), nitrogen metabolism and methane metabolism. Our study provided important information on assessing the toxicity of PM2.5 and demonstrated that metabolomics approach can be employed as a tool to understand the toxicity mechanism of complicated environmental pollutants. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. A practical, metal-free synthesis of 1H-indazoles.

    Science.gov (United States)

    Counceller, Carla M; Eichman, Chad C; Wray, Brenda C; Stambuli, James P

    2008-03-06

    The synthesis of 1H-indazoles is achieved from o-aminobenzoximes by the selective activation of the oxime in the presence of the amino group. The reaction occurs with a variety of substituted o-aminobenzoximes using a slight excess of methanesulfonyl chloride and triethylamine at 0-23 degrees C and is amenable to scale-up. The synthesis of 1H-indazoles under these conditions is extremely mild compared with previous synthetic approaches and affords the desired compounds in good to excellent yields.

  3. A novel approach for the synthesis of 5-substituted-1H-tetrazoles

    Energy Technology Data Exchange (ETDEWEB)

    Akhlaghinia, Batool; Rezazadeh, Soodabeh, E-mail: akhlaghinia@um.ac.ir [Department of Chemistry, Faculty of Sciences, Ferdowsi University of Mashhad, Mashhad (Iran, Islamic Republic of)

    2012-12-15

    A series of 5-substituted-1H-tetrazoles (RCN{sub 4}H) have been synthesized by cycloaddition reaction of different aryl and alkyl nitriles with sodium azide in DMSO using CuSO{sub 4}{center_dot}5H{sub 2}O as catalyst. A wide variety of aryl nitriles underwent [3+2] cycloaddition to afford tetrazoles under mild reaction conditions in good to excellent yields. The catalyst used is readily available and environmentally friendly. Short reaction times, good to excellent yields, safe process and simple workup make this method an attractive and useful contribution to present organic synthesis of 5-substituted-1H-tetrazoles. (author)

  4. Synthesis of 2-azetidinone derivatives of 6-nitro-1H-indazole and their biological importance

    Directory of Open Access Journals (Sweden)

    Pushkal Samadhiya

    2012-01-01

    Full Text Available A new series of 3-chloro-1-{[2-(6-nitro-1H-indazol-1-ylethyl]amino}-4-(substituted phenyl-2-azetidinones (4a-j was synthesized in four steps from 6-nitro-1H-indazole and characterized by IR, ¹H NMR, 13C NMR, FAB-mass spectrometry and chemical methods. Compounds 4(a-j were screened in vitro for their antibacterial, antifungal and antitubercular activities against some selected microorganism and for their antiinflammatory activity (in vivo against albino rats (either sex. All above activities of compounds 4(a-j showed acceptable results.

  5. Copper-Promoted Oxidative C-H Bond Amination of Hydrazones: Synthesis of 1H-Indazoles and 1H-Pyrazoles%铜促进下腙的氧化胺化反应:1H-吲唑和1H-吡唑的合成

    Institute of Scientific and Technical Information of China (English)

    丁正伟; 谭启涛; 刘秉新; 张可; 许斌

    2015-01-01

    吲唑和吡唑是两类重要的含氮杂环化合物,具有广泛的生物活性.发展了一类铜促进下腙的C(sp2)-H键氧化胺化反应,简便、高效地构建了一系列1H-吲唑和1H-吡唑衍生物.该反应条件温和,具有广泛的底物适用范围和较好的官能团兼容性.

  6. Methylation of 5-Amino-3-methylthio-1H-pyrazole Derivatives and Two Related Crystal Structures

    Institute of Scientific and Technical Information of China (English)

    REN, Xue-Ling(任雪玲); WU, Chao(吴超); HU, Fang-Zhong(胡方中); ZOU, Xiao-Mao(邹小毛); YANG, Hua-Zheng(杨华铮)

    2004-01-01

    5-Amino-3-methylthio-1H-pyrazoles are very important building blocks from which a wide variety of pyrazole derivatives can be prepared. When substituted 5-amino-3-methylthio-1H-pyrazole was treated with CH3I, the methylation occurres at endocyclic two nitrogens at the same time. The ratio of isomers in products was depended upon the nature of 4-position substituent in the pyrazole ring. The products were characterized by X-ray diffraction analysis, and the ratios of isomer were explained by means of the results of ab inito calculation.

  7. A Shearlets-based Edge Identification Algorithem for Infrared Image

    OpenAIRE

    Rui-bin ZOU; Cai-cheng SHI

    2013-01-01

    A shearlets-based edge identification algorithem for infrared image is proposed. The algorithem demonstrates the performance of edge detection based on shearlets, combines with the edge hysteresis thresholding, designs steps of edge detection, which is proper to use in infrared images.Simultaneously, with the advantage of edge geometric features provided by the shearlets, infrared image were extracted the direction information of edge of Infrared image, and classified. In computer simulations...

  8. Spiroheterocyclization of Methyl 1-Aryl-3-cinnamoyl-4,5-dioxo-4,5-dihydro-1H-pyrrole-2-carboxylates by the Action of 3-(Arylamino-1H-inden-1-ones

    Directory of Open Access Journals (Sweden)

    Аndrey N. Maslivets

    2012-11-01

    Full Text Available Methyl 1-aryl-3-cinnamoyl-4,5-dioxo-4,5-dihydro-1H-pyrrole-2-carboxylates interact with 3-(arylamino-1H-inden-1-ones to give the corresponding 1,1'-diaryl-3'-cinnamoyl-4'-hydroxy-1H-spiro[indeno[1,2-b]pyrrole-3,2'-pyrrole]-2,4,5'(1'H-triones in good yields.

  9. Nano-mole scale side-chain signal assignment by 1H-detected protein solid-state NMR by ultra-fast magic-angle spinning and stereo-array isotope labeling.

    Directory of Open Access Journals (Sweden)

    Songlin Wang

    Full Text Available We present a general approach in 1H-detected 13C solid-state NMR (SSNMR for side-chain signal assignments of 10-50 nmol quantities of proteins using a combination of a high magnetic field, ultra-fast magic-angle spinning (MAS at ~80 kHz, and stereo-array-isotope-labeled (SAIL proteins [Kainosho M. et al., Nature 440, 52-57, 2006]. First, we demonstrate that 1H indirect detection improves the sensitivity and resolution of 13C SSNMR of SAIL proteins for side-chain assignments in the ultra-fast MAS condition. 1H-detected SSNMR was performed for micro-crystalline ubiquitin (~55 nmol or ~0.5mg that was SAIL-labeled at seven isoleucine (Ile residues. Sensitivity was dramatically improved by 1H-detected 2D 1H/13C SSNMR by factors of 5.4-9.7 and 2.1-5.0, respectively, over 13C-detected 2D 1H/13C SSNMR and 1D 13C CPMAS, demonstrating that 2D 1H-detected SSNMR offers not only additional resolution but also sensitivity advantage over 1D 13C detection for the first time. High 1H resolution for the SAIL-labeled side-chain residues offered reasonable resolution even in the 2D data. A 1H-detected 3D 13C/13C/1H experiment on SAIL-ubiquitin provided nearly complete 1H and 13C assignments for seven Ile residues only within ~2.5 h. The results demonstrate the feasibility of side-chain signal assignment in this approach for as little as 10 nmol of a protein sample within ~3 days. The approach is likely applicable to a variety of proteins of biological interest without any requirements of highly efficient protein expression systems.

  10. Nano-Mole Scale Side-Chain Signal Assignment by 1H-Detected Protein Solid-State NMR by Ultra-Fast Magic-Angle Spinning and Stereo-Array Isotope Labeling

    KAUST Repository

    Wang, Songlin

    2015-04-09

    We present a general approach in 1H-detected 13C solid-state NMR (SSNMR) for side-chain signal assignments of 10-50 nmol quantities of proteins using a combination of a high magnetic field, ultra-fast magic-angle spinning (MAS) at ~80 kHz, and stereo-array-isotope-labeled (SAIL) proteins [Kainosho M. et al., Nature 440, 52–57, 2006]. First, we demonstrate that 1H indirect detection improves the sensitivity and resolution of 13C SSNMR of SAIL proteins for side-chain assignments in the ultra-fast MAS condition. 1H-detected SSNMR was performed for micro-crystalline ubiquitin (~55 nmol or ~0.5mg) that was SAIL-labeled at seven isoleucine (Ile) residues. Sensitivity was dramatically improved by 1H-detected 2D 1H/13C SSNMR by factors of 5.4-9.7 and 2.1-5.0, respectively, over 13C-detected 2D 1H/13C SSNMR and 1D 13C CPMAS, demonstrating that 2D 1H-detected SSNMR offers not only additional resolution but also sensitivity advantage over 1D 13C detection for the first time. High 1H resolution for the SAIL-labeled side-chain residues offered reasonable resolution even in the 2D data. A 1H-detected 3D 13C/13C/1H experiment on SAIL-ubiquitin provided nearly complete 1H and 13C assignments for seven Ile residues only within ~2.5 h. The results demonstrate the feasibility of side-chain signal assignment in this approach for as little as 10 nmol of a protein sample within ~3 days. The approach is likely applicable to a variety of proteins of biological interest without any requirements of highly efficient protein expression systems.

  11. Study of the cardiotoxicity of Venenum Bufonis in rats using an 1H NMR-based metabolomics approach.

    Directory of Open Access Journals (Sweden)

    Ge Dong

    Full Text Available Venenum Bufonis, a well-known traditional Chinese medicine, has been widely used in Asia and has gained popularity in Western countries over the last decade. Venenum Bufonis has obvious side effects that have been observed in clinical settings, but few studies have reported on its cardiotoxicity. In this work, the cardiotoxicity of Venenum Bufonis was investigated using a 11H NMR-based metabolomics approach. The 1H NMR profiles of the serum, myocardial extracts and liver extracts of specific-pathogen-free rats showed that Venenum Bufonis produced significant metabolic perturbations dose-dependently with a distinct time effect, peaking at 2 hr after dosing and attenuating gradually. Clinical chemistry, electrocardiographic recordings, and histopathological evaluation provided additional evidence of Venenum Bufonis-induced cardiac damage that complemented and supported the metabolomics findings. The combined results demonstrated that oxidative stress, mitochondrial dysfunction, and energy metabolism perturbations were associated with the cardiac damage that results from Venenum Bufonis.

  12. {sup 1}H-NMR-based metabolomics studies of the toxicity of mesoporous carbon nanoparticles in Zebrafish (Daniorerio)

    Energy Technology Data Exchange (ETDEWEB)

    Raja, Ganesan; Kim, Si Won; Yoon, Da Hye; Yoon, Chang Shin; Kim, Suhkmann [Dept. of Chemistry, Center for Proteome Biophysics and Chemistry Institute for Functional Materials, Pusan National University, Busan (Korea, Republic of)

    2017-02-15

    Mesoporous carbon nanoparticles (MCNs) have been applied in a variety of drug/gene carriers. In addition to their potential benefits, many studies of their potential toxicity have been reported, showing the limitations of metabolic contextualization. In this study, we conducted {sup 1}H-nuclear magnetic resonance (NMR) profiling combined with statistical methods such as orthogonal partial least squares discriminant analysis and Pearson correlation analysis to assess metabolic alterations in the whole body of zebrafish (Danio rerio) in the presence of various concentrations of MCNs. The MCN exposure influenced numerous metabolites in energy metabolism (e.g., metabolites involved in glycolysis and tricarboxylic acid cycle) and disturbed the balance of neurotransmitters and osmoregulators. Our findings demonstrate the potential applicability of using a metabolomics approach to determine underlying metabolic disturbances caused by MCNs.

  13. 1H DNP at 1.4 T of Water Doped with a Triarylmethyl-Based Radical

    DEFF Research Database (Denmark)

    Wind, Robert A.; Ardenkjær-Larsen, Jan Henrik

    1999-01-01

    Recently a triarylmethyl-based (TAM) radical has been developed for research in biological and other aqueous systems, and in low magnetic fields, 10 mT or less, large 1H dynamic nuclear polarization (DNP) enhancements have been reported. In this paper the DNP properties of this radical have been.......85, and the coupling factor is −0.0187. It is shown that these results agree very well with an analysis where the electron–dipolar interactions are the dominant DNP mechanism, and where the relaxation transitions resulting from these interactions are governed by translational diffusion of the water molecules. Finally......, the possibilities of combining DNP with magnetic resonance microscopy (MRM) are discussed. It is shown that at 26°C the overall DNP-enhanced proton polarization should become maximal in an external field of 0.3 T and become comparable to the thermal equilibrium polarization in a field of 30 T, considerably larger...

  14. Evaluation of 1H NMR relaxometry for the assessment of pore size distribution in soil samples

    NARCIS (Netherlands)

    Jaeger, F.; Bowe, S.; As, van H.; Schaumann, G.E.

    2009-01-01

    1H NMR relaxometry is used in earth science as a non-destructive and time-saving method to determine pore size distributions (PSD) in porous media with pore sizes ranging from nm to mm. This is a broader range than generally reported for results from X-ray computed tomography (X-ray CT) scanning, wh

  15. Aminosilanes derived from 1H-benzimidazole-2(3H)-thione

    Energy Technology Data Exchange (ETDEWEB)

    Palomo-Molina, Juliana [Facultad de Ciencias Químicas, Universidad de Colima, Carretera Coquimatlán-Colima, Coquimatlán Colima 28400 (Mexico); García-Báez, Efrén V. [Unidad Profesional Interdisciplinaria de Biotecnología, Instituto Politécnico Nacional, Avenida Acueducto s/n, Barrio La Laguna Ticomán, México DF 07340 (Mexico); Contreras, Rosalinda [Departamento de Química, Centro de Investigación y de Estudios Avanzados del IPN, Apartado Postal 14-740, México DF 07000 (Mexico); Barrio La Laguna Ticomán, México DF 07340 (Mexico); Pineda-Urbina, Kayim; Ramos-Organillo, Angel, E-mail: aaramos@ucol.mx [Facultad de Ciencias Químicas, Universidad de Colima, Carretera Coquimatlán-Colima, Coquimatlán Colima 28400 (Mexico)

    2015-08-12

    In two trimethylsilyl-substituted 1H-benzimidazole-2(3H)-thiones, noncovalent C—H⋯π interactions between the centroid of the benzmidazole system and the SiMe{sub 3} groups form helicoidal arrangements in one, and dimerization results in the formation of R{sub s} {sup 2}(8) rings via N—H⋯S interactions, along with parallel π–π interactions between imidazole and benzene rings, in the second compound. Two new molecular structures, namely 1,3-bis(trimethylsilyl)-1H-benzimidazole-2(3H)-thione, C{sub 13}H{sub 22}N{sub 2}SSi{sub 2}, (2), and 1-trimethylsilyl-1H-benzimidazole-2(3H)-thione, C{sub 10}H{sub 14}N{sub 2}SSi, (3), are reported. Both systems were derived from 1H-benzimidazole-2(3H)-thione. Noncovalent C—H⋯π interactions between the centroid of the benzmidazole system and the SiMe{sub 3} groups form helicoidal arrangements in (2). Dimerization of (3) results in the formation of R{sub 2}{sup 2}(8) rings via N—H⋯S interactions, along with parallel π–π interactions between imidazole and benzene rings.

  16. Synthesis, antimicrobial and cytotoxic activity of novel azetidine-2-one derivatives of 1H-benzimidazole

    Directory of Open Access Journals (Sweden)

    Malleshappa Noolvi

    2014-04-01

    Full Text Available A series of 1-methyl-N-[(substituted-phenylmethylidene-1H-benzimidazol-2-amines (4a–4g were prepared via the formation of 1-methyl-1H-benzimidazol-2-amine (3, which was prepared by the cycloaddition of o-phenylenediamine (1 with cyanogen bromide in the presence of aqueous base followed by N-methylation with methyl iodide in the presence of anhydrous potassium carbonate in dry acetonitrile. Moreover, the four-membered β-lactam ring was introduced by the cycloaddition of 4a–4g and chloroacetyl chloride in the presence of triethylamine catalyst to give 3-chloro-1-(1-methyl-1H-benzimidazol-2-yl-(4′-substituted-phenylazetidin-2-one 5a–5g. A total of 14 compounds were synthesized and characterized by IR, 1H NMR, 13C NMR and Mass spectral technique, in addition they were evaluated for anti-bacterial and cytotoxic properties. Among the chemicals tested 4a, 4b, 5a, 5b, 5g exhibited good antibacterial activity and 5f, 5g shown good cytotoxic activity in vitro.

  17. One-pot synthesis of novel 2,3-dihydro-1H-indazoles.

    Science.gov (United States)

    Breton, Gary W; Lepore, Antonio J

    2011-11-16

    A copper(I)-mediated one-pot synthesis of 2,3-dihydro-1H-indazole heterocycles has been developed. This synthetic route provides the desired indazoles in moderate to good yields (55%-72%) which are substantially better than those achievable with an alternative two-step reaction sequence. The reaction is tolerant of functionality on the aromatic ring.

  18. Synthesis of 1H-Indazoles from Imidates and Nitrosobenzenes via Synergistic Rhodium/Copper Catalysis.

    Science.gov (United States)

    Wang, Qiang; Li, Xingwei

    2016-05-06

    Nitrosobenzenes have been used as a convenient aminating reagent for the efficient synthesis of 1H-indazoles via rhodium and copper catalyzed C-H activation and C-N/N-N coupling. The reaction occurred under redox-neutral conditions with high efficiency and functional group tolerance. Moreover, a rhodacyclic imidate complex has been identified as a key intermediate.

  19. The neutron star soft X-ray transient 1H 1905+000 in quiescence

    NARCIS (Netherlands)

    Jonker, P.G.; Bassa, C.G.; Nelemans, G.; Juett, A.M.; Brown, E.F.; Chakrabarty, D.

    2006-01-01

    In this paper, we report on our analysis of a ~25ks. Chandra X-ray observation of the neutron star soft X-ray transient (SXT) 1H 1905+000 in quiescence. Furthermore, we discuss our findings of the analysis of optical photometric observations which we obtained using the Magellan telescope and photome

  20. Quantitative Analysis of Chemically Modified Starches by 1H-NMR Spectroscopy

    NARCIS (Netherlands)

    Graaf, R.A. de; Lammers, G.; Janssen, L.P.B.M.; Beenackers, A.A.C.M.

    1995-01-01

    A quantitative 1H-NMR method for the determination of the Molar Substitution (MS) of acetylated and hydroxypropylated starches was developed and tested for MS ranging from 0.09 to 0.5. Results were checked using the Johnson method and a titration method for hydroxypropylated and acetylated starch, r

  1. Conformational analysis of MBBA fluorinated analogues by 1H and 13C - NMR

    Science.gov (United States)

    Pivovarova, N. S.; Boldeskul, I. E.; Shelyagenko, S. V.; Fialkov, Yu. A.

    1988-05-01

    1H- 13C -chemical shifts correlation analysis for MBBA and a series of its fluorinated analogues have been carried out. The azomethine proton chemical shift is shown to be sensitive to the aniline ring torsion angle and can be used for its approximate estimation.

  2. Bulk magnetization and 1H NMR spectra of magnetically heterogeneous model systems

    Science.gov (United States)

    Levin, E. M.; Bud'ko, S. L.

    2011-10-01

    Bulk magnetization and 1H static and magic angle spinning (MAS) nuclear magnetic resonance (NMR) spectra of two magnetically heterogeneous model systems based on laponite (LAP) layered silicate or polystyrene (PS) with low and high proton concentration, respectively, and ferrimagnetic Fe2O3 nano- or micro-particles have been studied. In LAP+Fe2O3, a major contribution to the NMR signal broadening is due to the dipolar coupling between the magnetic moments of protons and magnetic particles. In PS+Fe2O3, due to the higher proton concentration in polystyrene and stronger proton-proton dipolar coupling, an additional broadening is observed, i.e. 1H MAS NMR spectra of magnetically heterogeneous systems are sensitive to both proton-magnetic particles and proton-proton dipolar couplings. An increase of the volume magnetization by ∼1 emu/cm3 affects the 1H NMR signal width in a way that is similar to an increase of the proton concentration by ∼2×1022/cm3. 1H MAS NMR spectra, along with bulk magnetization measurements, allow the accurate determination of the hydrogen concentration in magnetically heterogeneous systems.

  3. An Efficient Approach to 6, 7-Disubstituted-1H-quinoxalin-2-ones

    Institute of Scientific and Technical Information of China (English)

    Xun LI; Qing Ping HU; Xue Gui CUI; Dong Hua WANG

    2004-01-01

    A novel approach to the synthesis of 6, 7-disubstituted-1H-quinoxalin-2-ones is described.The title compounds were regioselectively prepared by starting from substituted phenylamines and chloroacetyl chloride through the efficient sequence ofacylation, nitration, reduction, intramolecular alkylation, and oxidation.

  4. Effect of fertilizers on galanthamine and metabolite profiles in narcissus bulbs by 1H NMR

    NARCIS (Netherlands)

    Lubbe, A.; Choi, Y.H.; Vreeburg, P.J.M.; Verpoorte, R.

    2011-01-01

    Narcissus bulbs contain the biologically active alkaloid galanthamine, and Narcissus is being developed as a natural source of the molecule for the pharmaceutical industry. The effect of fertilizer on galanthamine production was investigated in a field study using a 1H nuclear magnetic resonance (NM

  5. Co-III-Carbene Radical Approach to Substituted 1H-Indenes

    NARCIS (Netherlands)

    Das, B.G.; Chirila, A.; Tromp, M.; Reek, J.N.H.; de Bruin, B.

    2016-01-01

    A new strategy for the catalytic synthesis of substituted 1H-indenes via metalloradical activation of o-cinnamyl N-tosyl hydrazones is presented, taking advantage of the intrinsic reactivity of a Co-III carbene radical intermediate. The reaction uses readily available starting materials and is

  6. An Efficient Green Synthesis of 3-Amino-1H-chromenes Catalyzed ...

    African Journals Online (AJOL)

    NICO

    disorder.18. Traditional methods have been reported for the synthesis of ... vantages and potentially explore industrial applications.38 ... sol-gel, hydrothermal, thermal evaporation, oxidation and anodization.39–45 Although the use of ZnO nanoparticles (NPs) ... 1aryl-1H-benzo[f]chromene-2-carbonitriles (4) via a three-.

  7. Effect of fertilizers on galanthamine and metabolite profiles in narcissus bulbs by 1H NMR

    NARCIS (Netherlands)

    Lubbe, A.; Choi, Y.H.; Vreeburg, P.J.M.; Verpoorte, R.

    2011-01-01

    Narcissus bulbs contain the biologically active alkaloid galanthamine, and Narcissus is being developed as a natural source of the molecule for the pharmaceutical industry. The effect of fertilizer on galanthamine production was investigated in a field study using a 1H nuclear magnetic resonance (NM

  8. NMR resonance splitting of urea in stretched hydrogels: proton exchange and (1)H/(2)H isotopologues.

    Science.gov (United States)

    Kuchel, Philip W; Naumann, Christoph; Chapman, Bogdan E; Shishmarev, Dmitry; Håkansson, Pär; Bacskay, George; Hush, Noel S

    2014-10-01

    Urea at ∼12 M in concentrated gelatin gel, that was stretched, gave (1)H and (2)H NMR spectral splitting patterns that varied in a predictable way with changes in the relative proportions of (1)H2O and (2)H2O in the medium. This required consideration of the combinatorics of the two amide groups in urea that have a total of four protonation/deuteration sites giving rise to 16 different isotopologues, if all the atoms were separately identifiable. The rate constant that characterized the exchange of the protons with water was estimated by back-transformation analysis of 2D-EXSY spectra. There was no (1)H NMR spectral evidence that the chiral gelatin medium had caused in-equivalence in the protons bonded to each amide nitrogen atom. The spectral splitting patterns in (1)H and (2)H NMR spectra were accounted for by intra-molecular scalar and dipolar interactions, and quadrupolar interactions with the electric field gradients of the gelatin matrix, respectively.

  9. Synthesis of 1H-indazoles from N-tosylhydrazones and nitroaromatic compounds.

    Science.gov (United States)

    Liu, Zhenxing; Wang, Long; Tan, Haocheng; Zhou, Shiyi; Fu, Tianren; Xia, Ying; Zhang, Yan; Wang, Jianbo

    2014-05-21

    A new method for the synthesis of 1H-indazoles from readily available N-tosylhydrazones and nitroaromatic compounds has been developed. This transformation occurs under transition-metal-free conditions and shows a wide substrate scope. The method has been successfully applied to the formal synthesis of a bioactive compound, WAY-169916.

  10. [Brain metabolism alterations in patients with anorexia nervosa observed in 1H-MRS

    NARCIS (Netherlands)

    Grzelak, P.; Gajewicz, W.; Wyszogrodzka-Kucharska, A.; Rotkiewicz, A.; Stefanczyk, L.; Goraj, B.M.; Rabe-Jablonska, J.

    2005-01-01

    The causes of metabolic brain changes in patients with anorexia nervosa are still not fully explained. The purpose of this study was to use the 1H-MRS method in investigating metabolic changes in the brain of patients with anorexia nervosa. We studied 10 patients for visible alternations in brain me

  11. Amyloidogenicity and aggregate cytotoxicity of human glucagon-like peptide-1 (hGLP-1).

    Science.gov (United States)

    Poon, S; Birkett, N R; Fowler, S B; Luisi, B F; Dobson, C M; Zurdo, J

    2009-01-01

    The potential of human glucagon-like peptide-1 (hGLP-1) as a therapeutic agent is limited by its high aggregation propensity. We show that hGLP-1 forms amyloid-like structures that are preceded by cytotoxic aggregates, suggesting that aggregation of biopharmaceuticals could present a cytotoxic risk to patients besides the reported increased risk in immunogenicity.

  12. Glycosylation intermediates studied using low temperature 1H- and 19F-DOSY NMR

    DEFF Research Database (Denmark)

    Qiao, Yan; Ge, Wenzhi; Jia, Lingyu

    2016-01-01

    Low temperature 1H- and 19F-DOSY have been used for analyzing reactive intermediates in glycosylation reactions, where a glycosyl trichloroacetimidate donor has been activated using different catalysts. The DOSY protocols have been optimized for low temperature experiments and provided new insight...

  13. MICROWAVE-ASSISTED SYNTHESIS OF SOME 5(6)-NITRO-1H ...

    African Journals Online (AJOL)

    Preferred Customer

    reagents for the synthesis of 2-substitued benzimidazoles [5-9]. ... study, we wish to report the synthesis of 5-nitro-1H-benzimidazoles and their ... Diethyl Ether ... iminoester hydrochloride 1(a-d) (0.013 mol) in methanol (30 mL) were stirred at ...

  14. Effect of paramagnetic manganese cations on (1)H MRS of the brain

    DEFF Research Database (Denmark)

    Madsen, Kathrine Skak; Holm, David Alberg; Vejby Søgaard, Lise

    2008-01-01

    Manganese cations (Mn(2+)) can be used as an intracellular contrast agent for structural, functional and neural pathway imaging applications. However, at high concentrations, Mn(2+) is neurotoxic and may influence the concentration of (1)H MR-detectable metabolites. Furthermore, the paramagnetic Mn...

  15. 1H NMR spectroscopy-based interventional metabolic phenotyping: a cohort study of rheumatoid arthritis patients

    DEFF Research Database (Denmark)

    Lauridsen, Michael Brændgaard; Bliddal, Henning; Christensen, Robin Daniel Kjersgaard;

    2010-01-01

    1H NMR spectroscopy-based metabolic phenotyping was used to identify biomarkers in the plasma of patients with rheumatoid arthritis (RA). Forty-seven patients with RA (23 with active disease at baseline and 24 in remission) and 51 healthy subjects were evaluated during a one-year follow-up with a...

  16. Crystal structures of the two salts 2-methyl-1H-imidazol-3-ium nitrate-2-methyl-1H-imidazole (1/1) and 2-methyl-1H-imidazol-3-ium nitrate.

    Science.gov (United States)

    Diop, Mouhamadou Birame; Diop, Libasse; Maris, Thierry

    2016-04-01

    The title salts, C4H7N2 (+)·NO3 (-)·C4H6N2, (I), and C4H7N2 (+)·NO3 (-), (II), were obtained from solutions containing 2-methyl-imidazole and nitric acid in different concentrations. In the crystal structure of salt (I), one of the -NH H atoms of the imidazole ring shows half-occupancy, hence only every second mol-ecule is in its cationic form. The nitrate anion in this structure lies on a twofold rotation axis. The neutral 2-methyl-imidazole mol-ecule and the 2-methyl-1H-imidazol-3-ium cation inter-act through N-H⋯N hydrogen bonds to form [(C4H6N2)⋯(C4H7N2)(+)] pairs. These pairs are linked with two nitrate anions on both sides through bifurcated N-H⋯(O,O) hydrogen bonds into chains running parallel to [001]. In the crystal structure of salt (II), the C4H7N2 (+) cation and the NO3 (-) anion are both located on a mirror plane, leading to a statistical disorder of the methyl H atoms. The cations and anions again inter-act through bifurcated N-H⋯(O,O) hydrogen bonds, giving rise to the formation of chains consisting of alternating anions and cations parallel to [100].

  17. Crystal structures of the two salts 2-methyl-1H-imidazol-3-ium nitrate–2-methyl-1H-imidazole (1/1) and 2-methyl-1H-imidazol-3-ium nitrate

    Science.gov (United States)

    Diop, Mouhamadou Birame; Diop, Libasse; Maris, Thierry

    2016-01-01

    The title salts, C4H7N2 +·NO3 −·C4H6N2, (I), and C4H7N2 +·NO3 −, (II), were obtained from solutions containing 2-methyl­imidazole and nitric acid in different concentrations. In the crystal structure of salt (I), one of the –NH H atoms of the imidazole ring shows half-occupancy, hence only every second mol­ecule is in its cationic form. The nitrate anion in this structure lies on a twofold rotation axis. The neutral 2-methyl­imidazole mol­ecule and the 2-methyl-1H-imidazol-3-ium cation inter­act through N—H⋯N hydrogen bonds to form [(C4H6N2)⋯(C4H7N2)+] pairs. These pairs are linked with two nitrate anions on both sides through bifurcated N—H⋯(O,O) hydrogen bonds into chains running parallel to [001]. In the crystal structure of salt (II), the C4H7N2 + cation and the NO3 − anion are both located on a mirror plane, leading to a statistical disorder of the methyl H atoms. The cations and anions again inter­act through bifurcated N—H⋯(O,O) hydrogen bonds, giving rise to the formation of chains consisting of alternating anions and cations parallel to [100]. PMID:27375869

  18. Synthesis and Biological Activities of Schiff Bases of 3-Amino-1H-1,2,4-triazole

    Institute of Scientific and Technical Information of China (English)

    SUN,Xiaohong; LIU,Yuanfa; CHEN,Shuzhe; CHEN,Bang; JIA,Yingqi; ZENG,Zhengfang

    2009-01-01

    Eight Schiff bases of 3-amino-1H-1,2,4-triazole have been synthesized by glacial acetic acid catalyzed conden- sation of 3-amino-1H-1,2,4-triazole with substituted benzaldehyde and structurally confirmed by IR, 1H NMR and elemental analysis. The preliminary bioassay showed that the title compounds exhibited good fungicidal activities.

  19. Brief synthesis of 1H-indazole-3-carbaldehyde%1H-吲唑-3-甲醛的简便合成

    Institute of Scientific and Technical Information of China (English)

    朱五福; 王海燕; 曹云云; 白玫; 宫平

    2012-01-01

    1H-Indazole-3-carbaldehyde was obtained by the ring opening of indole in acid condition, and the followed di-azotization with.sodium nitrite,then cyclization,with the yield 36% . This method has the advantage of low cost,simple operation, short reaction time and it is. Also suitable for industrial production.%以吲哚为原料,酸性条件下与亚硝酸钠发生重氮化反应,重氮盐环合得到标题化合物,收率36%,该方法原料易得、操作简单、反应时间短,适合工业化生产.

  20. Study of 1H-MR spectroscopy in the peritumoral area of gliomas%脑胶质瘤周围区的1H-MRS研究

    Institute of Scientific and Technical Information of China (English)

    王佳; 范国光

    2010-01-01

    目的应用多体素氢质子磁共振波谱(1H-MRS)探讨胶质瘤周围区脑代谢改变的特点,评价多体素1H-MRS在胶质瘤周围区的应用价值.方法23例病理证实的脑胶质瘤病人分为低级别组(WHO Ⅰ~Ⅱ级)13例和高级别组(WHOⅢ~Ⅳ级)10例.所有病例术前均行多体素1H-MRS检查,测量肿瘤实质区、周围区及对侧正常脑组织区代谢产物的相对定量,进行统计学比较.结果多体素1H-MRS显示高级别胶质瘤的周围区与实质区NAA/Cr、Cho/Cr、NAA/Cho值差异有统计学意义(P值均为0.00).高级别胶质瘤周围区与对侧正常脑组织区NAA/Cr、Cho/Cr、NAA/Cho、Glx/Cr值差异均有统计学意义(P值均为0.00);低级别胶质瘤周围区与实质区NAA/Cr、Cho/Cr、NAA/Cho值差异均有统计学意义(P值均为0.00);低级别胶质瘤周围区与对侧正常脑组织区Cho/Cr、NAA/Cho值差异均有统计学意义(P值分别为0.02、0.00);高级别与低级别胶质瘤实质区NAA/Cr、NAA/Cho、Cho/Cr、Glx/Cr值差异均有统计学意义(P值分别为0.00、0.00、0.03、0.00);高级别与低级别胶质瘤周嗣区NAA/Cr、NAA/Cho、Cho/Cr、Glx/Cr值差异均有统计学意义(P值均为0.00).结论脑胶质瘤周围区代谢物的改变反映了肿瘤向瘤周组织浸润,对确定胶质瘤的分级及预测侵袭性病变的浸润范围有帮助.

  1. Investigation of Coating Performance of UV-Curable Hybrid Polymers Containing 1H,1H,2H,2H-Perfluorooctyltriethoxysilane Coated on Aluminum Substrates

    Directory of Open Access Journals (Sweden)

    Mustafa Çakır

    2017-03-01

    Full Text Available This study describes preparation and characterization of fluorine-containing organic-inorganic hybrid coatings. The organic part consists of bisphenol-A glycerolate (1 glycerol/phenol diacrylate resin and 1,6-hexanediol diacrylate reactive diluent. The inorganically rich part comprises trimethoxysilane-terminated urethane, 1H,1H,2H,2H-perfluorooctyltriethoxysilane, 3-(trimethoxysilyl propyl methacrylate and sol–gel precursors that are products of hydrolysis and condensation reactions. Bisphenol-A glycerolate (1 glycerol/phenol diacrylate resin was added to the inorganic part in predetermined amounts. The resultant mixture was utilized in the preparation of free films as well as coatings on aluminum substrates. Thermal and mechanical tests such as DSC, thermo-gravimetric analysis (TGA, and tensile and shore D hardness tests were performed on free films. Water contact angle, gloss, Taber abrasion test, cross-cut and tubular impact tests were conducted on the coated samples. SEM examination and EDS analysis was performed on the fractured surfaces of free films. The hybrid coatings on the aluminum sheets gave rise to properties such as moderately glossed surface; low wear rate and hydrophobicity. Tensile strength of free films increased with up to 10% inorganic content in the hybrid structure and this increase was approximately three times that of the control sample. As expected; the % strain value decreased by 17.3 with the increase in inorganic content and elastic modulus values increased by a factor of approximately 6. Resistance to ketone-based solvents was proven and an increase in hardness was observed as the ratio of the inorganic part increased. Samples which contain 10% sol–gel content were observed to provide optimal properties.

  2. 1H NMR spectra. Part 30(+): 1H chemical shifts in amides and the magnetic anisotropy, electric field and steric effects of the amide group.

    Science.gov (United States)

    Abraham, Raymond J; Griffiths, Lee; Perez, Manuel

    2013-03-01

    The (1)H spectra of 37 amides in CDCl(3) solvent were analysed and the chemical shifts obtained. The molecular geometries and conformational analysis of these amides were considered in detail. The NMR spectral assignments are of interest, e.g. the assignments of the formamide NH(2) protons reverse in going from CDCl(3) to more polar solvents. The substituent chemical shifts of the amide group in both aliphatic and aromatic amides were analysed using an approach based on neural network data for near (≤3 bonds removed) protons and the electric field, magnetic anisotropy, steric and for aromatic systems π effects of the amide group for more distant protons. The electric field is calculated from the partial atomic charges on the N.C═O atoms of the amide group. The magnetic anisotropy of the carbonyl group was reproduced with the asymmetric magnetic anisotropy acting at the midpoint of the carbonyl bond. The values of the anisotropies Δχ(parl) and Δχ(perp) were for the aliphatic amides 10.53 and -23.67 (×10(-6) Å(3)/molecule) and for the aromatic amides 2.12 and -10.43 (×10(-6) Å(3)/molecule). The nitrogen anisotropy was 7.62 (×10(-6) Å(3)/molecule). These values are compared with previous literature values. The (1)H chemical shifts were calculated from the semi-empirical approach and also by gauge-independent atomic orbital calculations with the density functional theory method and B3LYP/6-31G(++) (d,p) basis set. The semi-empirical approach gave good agreement with root mean square error of 0.081 ppm for the data set of 280 entries. The gauge-independent atomic orbital approach was generally acceptable, but significant errors (ca. 1 ppm) were found for the NH and CHO protons and also for some other protons.

  3. CINE: Comet INfrared Excitation

    Science.gov (United States)

    de Val-Borro, Miguel; Cordiner, Martin A.; Milam, Stefanie N.; Charnley, Steven B.

    2017-08-01

    CINE calculates infrared pumping efficiencies that can be applied to the most common molecules found in cometary comae such as water, hydrogen cyanide or methanol. One of the main mechanisms for molecular excitation in comets is the fluorescence by the solar radiation followed by radiative decay to the ground vibrational state. This command-line tool calculates the effective pumping rates for rotational levels in the ground vibrational state scaled by the heliocentric distance of the comet. Fluorescence coefficients are useful for modeling rotational emission lines observed in cometary spectra at sub-millimeter wavelengths. Combined with computational methods to solve the radiative transfer equations based, e.g., on the Monte Carlo algorithm, this model can retrieve production rates and rotational temperatures from the observed emission spectrum.

  4. Discovery of 3,4-Dihydropyrimidin-2(1H)-ones As a Novel Class of Potent and Selective A2B Adenosine Receptor Antagonists.

    Science.gov (United States)

    Crespo, Abel; El Maatougui, Abdelaziz; Biagini, Pierfrancesco; Azuaje, Jhonny; Coelho, Alberto; Brea, José; Loza, María Isabel; Cadavid, María Isabel; García-Mera, Xerardo; Gutiérrez-de-Terán, Hugo; Sotelo, Eddy

    2013-11-14

    We describe the discovery and optimization of 3,4-dihydropyrimidin-2(1H)-ones as a novel family of (nonxanthine) A2B receptor antagonists that exhibit an unusually high selectivity profile. The Biginelli-based hit optimization process enabled a thoughtful exploration of the structure-activity and structure-selectivity relationships for this chemotype, enabling the identification of ligands that combine structural simplicity with excellent hA2B AdoR affinity and remarkable selectivity profiles.

  5. 基于衬底温度的红外焦平面联合非均匀性校正%Combined nonuniformity correction algorithm of infrared focal plane arrays based on substrate temperature

    Institute of Scientific and Technical Information of China (English)

    唐艳秋; 孙强; 赵建; 姚凯男

    2016-01-01

    The advantages and disadvantages in nonuniformity correction (NUC) algorithms based on calibration and scene of infrared focal plane arrays(IRFPA) were analysed separately. The combined NUC algorithm was presented. The thermal imaging system extracted the gain and offset factor from the FLASH which storged beforehand according to the substrate temperature of the IRFPA at the moment of power on. These factor was adopted to remove the nonuniformity of the detector simply. Based on the analysis of the characteristic of residual noise after initial correction, the P-M filter was used to replace the linear spatial average filter in the Neural Network nonuniformity correction algorithm (NN-NUC), which could preserve the image edge. Experimental results show that the proposed algorithm can accelerate the rate of convergence, reduces the correction error largely, and avoids the image degradation caused by the response drift of IRFPA.%分别分析了红外焦平面阵列(IRFPA)基于定标的非均匀性校正法(NUC)和基于场景的NUC算法各自的优势和问题,在此基础上提出了联合非均匀性校正方法。根据上电时刻焦平面衬底的温度值,从FLASH中提取事先存储的对应温度区间的增益和偏置校正参数,初步消除探测器的非均匀性。通过分析初步校正后图像残余非均匀性噪声的特性,提出了用具有保边缘特性的P-M滤波取代传统神经网络算法中的四邻域均值滤波来获得期望图像,从而减小了图像边缘误差。实验结果表明,该算法收敛速度快,校正精度高,有效避免了因红外焦平面响应特性漂移而引起的图像降质。

  6. Monitoring tumor response of prostate cancer to radiation therapy by multi-parametric 1H and hyperpolarized 13C magnetic resonance imaging

    Science.gov (United States)

    Zhang, Vickie Yi

    Radiation therapy is one of the most common curative therapies for patients with localized prostate cancer, but despite excellent success rates, a significant number of patients suffer post- treatment cancer recurrence. The accurate characterization of early tumor response remains a major challenge for the clinical management of these patients. Multi-parametric MRI/1H MR spectroscopy imaging (MRSI) has been shown to increase the diagnostic performance in evaluating the effectiveness of radiation therapy. 1H MRSI can detect altered metabolic profiles in cancerous tissue. In this project, the concentrations of prostate metabolites from snap-frozen biopsies of recurrent cancer after failed radiation therapy were correlated with histopathological findings to identify quantitative biomarkers that predict for residual aggressive versus indolent cancer. The total choline to creatine ratio was significantly higher in recurrent aggressive versus indolent cancer, suggesting that use of a higher threshold tCho/Cr ratio in future in vivo 1H MRSI studies could improve the selection and therapeutic planning for patients after failed radiation therapy. Varying radiation doses may cause a diverse effect on prostate cancer micro-environment and metabolism, which could hold the key to improving treatment protocols for individual patients. The recent development and clinical translation of hyperpolarized 13C MRI have provided the ability to monitor both changes in the tumor micro-environment and its metabolism using a multi-probe approach, [1-13C]pyruvate and 13C urea, combined with 1H Multi-parametric MRI. In this thesis, hyperpolarized 13C MRI, 1H dynamic contrast enhancement, and diffusion weighted imaging were used to identify early radiation dose response in a transgenic prostate cancer model. Hyperpolarized pyruvate to lactate metabolism significantly decreased in a dose dependent fashion by 1 day after radiation therapy, prior to any changes observed using 1H DCE and diffusion

  7. Infrared Detectors Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The end goal of this project is to develop proof-of-concept infrared detectors which can be integrated in future infrared instruments engaged in remote...

  8. Feldspar, Infrared Stimulated Luminescence

    DEFF Research Database (Denmark)

    Jain, Mayank

    2014-01-01

    This entry primarily concerns the characteristics and the origins of infrared-stimulated luminescence in feldspars.......This entry primarily concerns the characteristics and the origins of infrared-stimulated luminescence in feldspars....

  9. Synthesis, GC-EIMS, ~1H NMR, ~(13)C NMR, Mechanistic and Thermal Studies of o-Xylylene-α,α'-bis(triphenylphosphinebromide)

    Institute of Scientific and Technical Information of China (English)

    Muddasir Hanif; LU Ping; XU Hai; TIAN Zhi-cheng; YANG Bing; WANG Zhi-ming; TIAN Lei-lei; XU Yuan-ze; XIE Zeng-qi; MA Yu-guang

    2009-01-01

    Organophosphorous compounds containing phosphorus as an integral part have been widely used in industry, organic synthesis and optoelectronics. o-Xylylene-α,α'-bis(triphenylphosphinebromide)(OXBTPPB) is a facile reagent to convert o-quinones(e.g., 9,10-phenanthrenequinone) into polycyclic aromatic hydrocarbons(PAHs). Herein lies an improved synthetic route to OXBTPPB. The resultant was carefully characterized with GC-EIMS, ~1H NMR, ~(13)C NMR, spectroscopic techniques. The EIMS shows characteristic peaks at m/z=262.4, 183.3, 108.2, 77.1 attributed to the [C_(18)H_(15)P]~+, [C_(18)H_8P]~+, [C_6H_5P]~+, [C_6H_5]~+ ions, respectively. The 1H and ~(13)C NMR spectrum shows well resolved peaks and all the hydrogens and carbons were well-assigned via a combined study of ~1H-~1H COSY, HMBC, and HMQC experiments. The mechanism for the formation of OXBTPPB was proposed based on literature and obtained experimental data. Meanwhile, the thermal stability of OXBTPPB was evaluated with TGA analysis, and an onset decomposition temperature(T_d) was recorded at 323.6℃.

  10. 喜疗妥联合远红外线治疗血液透析内瘘患者的效果及护理%Effect of hirudoid combined far infrared ray for hemodialysis fistula patients and nursing

    Institute of Scientific and Technical Information of China (English)

    王海燕; 黄云辉; 邓素红; 古凤玲; 李芸

    2014-01-01

    Objective To explore the effect of hiru doid combined far infrared ray on hemodialysis flow for hemodialysis fistula patients at first used .Methods Chosen 75 hemodialysis fistula patients and divied two groups.Traditional group (n=35) accepted the traditional hirudoid method after fistula operation , improved group (n=40) received hirudoid combined far infrared ray;research would compare the results of nursing care between two groups.Results The research showed the effective rate of nursing care was 95.00% in improved group,and was 48.57%in traditional group, the differences had statistical significance (χ2 =6.08,P0.05 ).Conclusions Improved group advanced the hemodialysis flow by promoting fistula becoming mature , vasoactivity and fistula fibrillation , and reduced clinical complications and enhanced patients'the quality of life .%目的:探讨喜疗妥外涂联合远红外线照护对血液透析患者内瘘护理后初次使用率及透析血流量的影响。方法选取75例血液透析自体动静脉内瘘护理患者,内瘘术后采用传统法局部喜疗妥外涂护理的35例患者为传统组,而采用改良法喜疗妥外涂联合远红外线照护的40例患者为改良组,比较两种不同内瘘护理效果。结果改良组护理有效率为95.00%,高于传统组的48.57%,差异有统计学意义(χ2=6.08,P<0.05);改良组血管内径、壁厚分别为(5.56±0.37),(0.63±0.07)mm,优于传统组(5.01±0.21),(0.54±0.04)mm,差异有统计学意义(t值分别为2.65,2.71;P<0.05);改良组术后4周透析血流量(239.04±35.43)ml大于初次透析血流量(210.31±35.42)ml,差异有统计学意义(t=3.85, P<0.05);改良组血流量不足、血管狭窄、血肿发生率分别为0.00%,5.00%,2.50%,低于传统组的28.57%,20.00%,20.00%,差异有统计学意义(χ2值分别为4.03,3.96

  11. Sequential acquisition of multi-dimensional heteronuclear chemical shift correlation spectra with 1H detection

    Science.gov (United States)

    Bellstedt, Peter; Ihle, Yvonne; Wiedemann, Christoph; Kirschstein, Anika; Herbst, Christian; Görlach, Matthias; Ramachandran, Ramadurai

    2014-03-01

    RF pulse schemes for the simultaneous acquisition of heteronuclear multi-dimensional chemical shift correlation spectra, such as {HA(CA)NH & HA(CACO)NH}, {HA(CA)NH & H(N)CAHA} and {H(N)CAHA & H(CC)NH}, that are commonly employed in the study of moderately-sized protein molecules, have been implemented using dual sequential 1H acquisitions in the direct dimension. Such an approach is not only beneficial in terms of the reduction of experimental time as compared to data collection via two separate experiments but also facilitates the unambiguous sequential linking of the backbone amino acid residues. The potential of sequential 1H data acquisition procedure in the study of RNA is also demonstrated here.

  12. Inclusion complex of benzocaine and β-cyclodextrin: 1H NMR and isothermal titration calorimetry studies

    Science.gov (United States)

    Mic, Mihaela; Pırnǎu, Adrian; Bogdan, Mircea; Turcu, Ioan

    2013-11-01

    The supramolecular structure of the inclusion complex of β-cyclodextrin with benzocaine in aqueous solution has been investigated by 1H NMR spectroscopy and isothermal titration nanocalorimetry (ITC). Analysis of 1H NMR data by continuous variation method indicates that the benzocaine: β-cyclodextrin inclusion complex occurs and has a 1:1 stoichiometry. Rotating frame NOE spectroscopy (ROESY) was used to ascertain the solution geometry of the host-guest complex which indicates that the benzocaine molecule was included with the aromatic ring into the cyclodextrin cavity. Although the affinity of benzocaine for cyclodextrin is relatively high, the association constant cannot be measured using ITC due to the low solubility of benzocaine in water.

  13. A sup 1 H nuclear magnetic resonance study of structural and organisational changes in the cell

    CERN Document Server

    Tunnah, S K

    2000-01-01

    Increasing importance is being placed on understanding the role of membrane lipids in many different areas of biochemistry. It is of interest to determine what interactions may occur between membrane lipids and drug species. Furthermore, an increasing body of evidence suggests that membrane lipids are involved in the pathology of numerous diseases such as rheumatoid arthritis, cancer and HIV. Clearly, the more information available on the mechanisms involved in diseases, the greater the potential for identifying a cure or even a prevention. sup 1 H nuclear magnetic resonance (NMR) spectroscopy was used to study the alterations in membrane lipid organisation and structure in intact, viable cultured cells. Changes in the sup 1 H NMR spectra and the spin-lattice relaxation measurements of the human K562 and the rat FRTL-5 cell lines were observed on the addition of the fatty acid species: triolein, evening primrose oil, arachidonic acid and ITF 1779. Results indicate that the membrane lipids are reorganised to a...

  14. Amplitude-integrated electroencephalogram 1 h after birth in a preterm infant with cystic periventricular leukomalacia.

    Science.gov (United States)

    Kato, Toru; Okumura, Akihisa; Hayakawa, Fumio; Tsuji, Takeshi; Hayashi, Seiji; Natsume, Jun

    2013-01-01

    We report a preterm infant, who showed abnormal amplitude-integrated electroencephalogram (aEEG) findings 1 h after birth and later developed cystic periventricular leukomalacia (PVL). The patient was a girl with a gestational age of 29 weeks. She was delivered by emergency cesarean section because of placental abruption and intrauterine co-twin demise. Artificial ventilation and administration of surfactant were needed to treat respiratory distress syndrome. Her cardiovascular condition was stable with artificial ventilation. Cranial ultrasonography showed extended cystic PVL after 11 days of age. aEEG 1 h after birth showed a consistently inactive pattern that resolved completely 28 h after birth. The neurophysiological findings of this patient suggest that aEEG findings during the very early period after birth provide significant information for predicting PVL.

  15. Shaft Sinking at the Nevada Test Site, U1h Shaft Project

    Energy Technology Data Exchange (ETDEWEB)

    B. Briggs; R. Musick

    2001-03-01

    The U1h Shaft Project is a design/build subcontract to construct one 6.1 meter (m) (20 feet (ft)) finished diameter shaft to a depth of 321.6 m (1,055 ft.) at the Nevada Test Site. Atkinson Construction was subcontracted by Bechtel Nevada to construct the U1h Shaft for the U.S. Department of Energy. The project consists of furnishing and installing the sinking plant, construction of the 321.6 m (1,055 ft.) of concrete lined shaft, development of a shaft station at a depth of 297.5 m (976 ft.), and construction of a loading pocket at the station. The outfitting of the shaft and installation of a new hoist may be incorporated into the project at a later date. This paper will describe the design phase, the excavation and lining operation, shaft station construction and the contractual challenges encountered on this project.

  16. Evaluation of saffron (Crocus sativus L.) adulteration with plant adulterants by (1)H NMR metabolite fingerprinting.

    Science.gov (United States)

    Petrakis, Eleftherios A; Cagliani, Laura R; Polissiou, Moschos G; Consonni, Roberto

    2015-04-15

    In the present work, a preliminary study for the detection of adulterated saffron and the identification of the adulterant used by means of (1)H NMR and chemometrics is reported. Authentic Greek saffron and four typical plant-derived materials utilised as bulking agents in saffron, i.e., Crocus sativus stamens, safflower, turmeric, and gardenia were investigated. A two-step approach, relied on the application of both OPLS-DA and O2PLS-DA models to the (1)H NMR data, was adopted to perform authentication and prediction of authentic and adulterated saffron. Taking into account the deficiency of established methodologies to detect saffron adulteration with plant adulterants, the method developed resulted reliable in assessing the type of adulteration and could be viable for dealing with extensive saffron frauds at a minimum level of 20% (w/w).

  17. GFT projection NMR for efficient (1)H/ (13)C sugar spin system identification in nucleic acids.

    Science.gov (United States)

    Atreya, Hanudatta S; Sathyamoorthy, Bharathwaj; Jaipuria, Garima; Beaumont, Victor; Varani, Gabriele; Szyperski, Thomas

    2012-12-01

    A newly implemented G-matrix Fourier transform (GFT) (4,3)D HC(C)CH experiment is presented in conjunction with (4,3)D HCCH to efficiently identify (1)H/(13)C sugar spin systems in (13)C labeled nucleic acids. This experiment enables rapid collection of highly resolved relay 4D HC(C)CH spectral information, that is, shift correlations of (13)C-(1)H groups separated by two carbon bonds. For RNA, (4,3)D HC(C)CH takes advantage of the comparably favorable 1'- and 3'-CH signal dispersion for complete spin system identification including 5'-CH. The (4,3)D HC(C)CH/HCCH based strategy is exemplified for the 30-nucleotide 3'-untranslated region of the pre-mRNA of human U1A protein.

  18. Data of 1H/13C NMR spectra and degree of substitution for chitosan alkyl urea

    Directory of Open Access Journals (Sweden)

    Jing Wang

    2016-06-01

    Full Text Available The data shown in this article are related to the subject of an article in Carbohydrate Polymers, entitled “Synthesis and characterization of chitosan alkyl urea” [1]. 1H NMR and 13C NMR spectra of chitosan n-octyl urea, chitosan n-dodecyl urea and chitosan cyclohexyl urea are displayed. The chemical shifts of proton and carbon of glucose skeleton in these chitosan derivatives are designated in detail. Besides, 1H NMR spectra of chitosan cyclopropyl urea, chitosan tert-butyl urea, chitosan phenyl urea and chitosan N,N-diethyl urea and the estimation of the degree of substitution are also presented. The corresponding explanations can be found in the above-mentioned article.

  19. Efficient dipolar double quantum filtering under magic angle spinning without a (1)H decoupling field.

    Science.gov (United States)

    Courtney, Joseph M; Rienstra, Chad M

    2016-08-01

    We present a systematic study of dipolar double quantum (DQ) filtering in (13)C-labeled organic solids over a range of magic-angle spinning rates, using the SPC-n recoupling sequence element with a range of n symmetry values from 3 to 11. We find that efficient recoupling can be achieved for values n⩾7, provided that the (13)C nutation frequency is on the order of 100kHz or greater. The decoupling-field dependence was investigated and explicit heteronuclear decoupling interference conditions identified. The major determinant of DQ filtering efficiency is the decoupling interference between (13)C and (1)H fields. For (13)C nutation frequencies greater than 75kHz, optimal performance is observed without an applied (1)H field. At spinning rates exceeding 20kHz, symmetry conditions as low as n=3 were found to perform adequately.

  20. Exploring the 3-piperidin-4-yl-1H-indole scaffold as a novel antimalarial chemotype.

    Science.gov (United States)

    Santos, Sofia A; Lukens, Amanda K; Coelho, Lis; Nogueira, Fátima; Wirth, Dyann F; Mazitschek, Ralph; Moreira, Rui; Paulo, Alexandra

    2015-09-18

    A series of 3-piperidin-4-yl-1H-indoles with building block diversity was synthesized based on a hit derived from an HTS whole-cell screen against Plasmodium falciparum. Thirty-eight compounds were obtained following a three-step synthetic approach and evaluated for anti-parasitic activity. The SAR shows that 3-piperidin-4-yl-1H-indole is intolerant to most N-piperidinyl modifications. Nevertheless, we were able to identify a new compound (10d) with lead-like properties (MW = 305; cLogP = 2.42), showing antimalarial activity against drug-resistant and sensitive strains (EC50 values ∼ 3 μM), selectivity for malaria parasite and no cross-resistance with chloroquine, thus representing a potential new chemotype for further optimization towards novel and affordable antimalarial drugs.

  1. 4(1H)-Quinolones with liver stage activity against Plasmodium berghei.

    Science.gov (United States)

    Lacrue, Alexis N; Sáenz, Fabián E; Cross, R Matthew; Udenze, Kenneth O; Monastyrskyi, Andrii; Stein, Steven; Mutka, Tina S; Manetsch, Roman; Kyle, Dennis E

    2013-01-01

    With the exception of primaquine, tafenoquine, and atovaquone, there are very few antimalarials that target liver stage parasites. In this study, a transgenic Plasmodium berghei parasite (1052Cl1; PbGFP-Luc(con)) that expresses luciferase was used to assess the anti-liver stage parasite activity of ICI 56,780, a 7-(2-phenoxyethoxy)-4(1H)-quinolone (PEQ), as well as two 3-phenyl-4(1H)-quinolones (P4Q), P4Q-146 and P4Q-158, by using bioluminescent imaging (BLI). Results showed that all of the compounds were active against liver stage parasites; however, ICI 56,780 and P4Q-158 were the most active, with low nanomolar activity in vitro and causal prophylactic activity in vivo. This potent activity makes these compounds ideal candidates for advancement as novel antimalarials.

  2. Surface enhanced Raman spectroscopic studies of 1H-indazole on silver sols.

    Science.gov (United States)

    Pergolese, B; Bigotto, A

    2001-05-01

    The SER spectra of 1H-indazole adsorbed on silver hydrosol were recorded in the 1800-100 cm(-1) and in the 3200-2800 cm(-1) regions. The SERS data were interpreted on the basis of previous vibrational assignments, with the help of the results of DFT calculations carried out using the 6-31G** basis. From the comparison of SER and normal Raman spectra it can be deduced that 1H-indazole is non-dissociatively adsorbed on metal surface and that it interacts with silver sol via nitrogen atoms and ring pi-system. The molecular plane assumes a tilted orientation with respect to the silver surface. The effect of varying the concentration of adsorbate was also evaluated. The observed changes of the relative intensities of some enhanced bands suggest that the molecule assumes a more tilted orientation upon lowering the concentration of the adsorbate.

  3. 1H MAS NMR spectra of hy- droxyl species on diatomite surface

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    High spinning speed 1H magic-angle spinning nuclear magnetic resonance (1H MAS NMR) was used to detect surface hydroxyl groups of diatomite, which include isolated hydroxyl groups and hydrogen-bonded hydroxyl groups, and water adsorbed on diatomite surface that include pore water and hydrogen-bonded water. The corresponding proton chemical shifts of above species are ca. 2.0, 6.0-7.1, 4.9 and 3.0 respectively. Accompanied by thermal treatment temperature ascending, the pore water and hydrogen-bonded water are desorbed successively. As a result, the relative intensities of the peaks assigned to protons of isolat-ed hydroxyl groups and hydrogen-bonded hydroxyl groups increase gradually and reach their maxima at 1000℃. After 1100℃ calcination, the hydroxyl groups that classified to strongly hydrogen-bonded ones and the isolated hydroxyl groups condense basically. But some weakly hydrogen-bonded hydroxyl groups may still persist in the micropores.

  4. (1)H-(13)C NMR-Based Profiling of Biotechnological Starch Utilization.

    Science.gov (United States)

    Sundekilde, Ulrik K; Meier, Sebastian

    2016-10-04

    Starch is used in food- and nonfood applications as a renewable and degradable source of carbon and energy. Insight into the chemical detail of starch degradation remains challenging as the starch constituents amylose and amylopectin are homopolymers. We show that considerable molecular detail of starch fragmentation can be obtained from multivariate analysis of spectral features in optimized (1)H-(13)C NMR spectroscopy of starch fragments to identify relevant features that distinguish processes in starch utilization. As a case study, we compare the profiles of starch fragments in commercial beer samples. Spectroscopic profiles of homooligomeric starch fragments can be excellent indicators of process conditions. In addition, differences in the structure and composition of starch fragments have predictive value for downstream process output such as ethanol production from starch. Thus, high-resolution (1)H-(13)C NMR spectroscopic profiles of homooligomeric fragment mixtures in conjunction with chemometric methods provide a useful addition to the analytical chemistry toolbox of biotechnological starch utilization.

  5. N-Carbethoxy-N′-(3-phenyl-1H-1,2,4-triazol-5-ylthiourea

    Directory of Open Access Journals (Sweden)

    Anton V. Dolzhenko

    2010-02-01

    Full Text Available The title compound {systematic name: ethyl N-[N-(3-phenyl-1H-1,2,4-triazol-5-ylcarbamothioyl]carbamate}, C12H13N5O2S, exists in the 3-phenyl-5-thioureido-1H-1,2,4-triazole tautomeric form stabilized by intramolecular hydrogen bonding between the endocyclic NH H atom and the thioureido S atom. The molecular structure is also stabilized by intramolecular N—H...O=C hydrogen bonds arranged in an S(6 graph-set motif within the carbethoxythiourea moiety. The mean planes of the phenyl and 1,2,4-triazole rings make a dihedral angle of 7.61 (11°. In the crystal, the molecules form two types of inversion dimers. Intermolecular hydrogen bonds are arranged in R22(6 and R22(8 graph-set motifs, together forming a network parallel to (111.

  6. Microwave-enhanced transition metal-catalyzed decoration of 2(1H)-pyrazinone scaffolds.

    Science.gov (United States)

    Kaval, Nadya; Bisztray, Katalin; Dehaen, Wim; Kappe, C Oliver; Van der Eycken, Erik

    2003-01-01

    The 2(1H)-pyrazinones have been demonstrated to be versatile building blocks for the synthesis of biologically active compounds. Here, an efficient method is described for the decoration of these interesting scaffolds. Microwave-assisted palladium catalyzed reactions allow the easy introduction of different substituents at the C3- and even at the rather unreactive C5-position of the pyrazinones. Stille, Suzuki, Heck, Sonogashira reactions, in addition to reductive dechlorinations, and cyanation reactions are investigated.

  7. Multicomponent assembly of diverse pyrazin-2(1H)-one chemotypes.

    Science.gov (United States)

    Azuaje, Jhonny; El Maatougui, Abdelaziz; Pérez-Rubio, José M; Coelho, Alberto; Fernández, Franco; Sotelo, Eddy

    2013-05-03

    An expedient and concise Ugi-based approach for the rapid assembly of pyrazin-2(1H)-one-based frameworks has been developed. This convergent approach encompasses skeletal, functional and stereochemical diversity, exhibiting an unusually high bond-forming efficiency as well as high structure and step economies. The method involves the use of readily available commercial reagents and is an example of the reconciliation of structural complexity with operational simplicity in a time- and cost-effective manner.

  8. Synthesis and antileishmanial activity of new 1-Aryl-1H-Pyrazole-4- carboximidamides derivatives

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Mauricio S. dos; Gomes, Adriana O.; Bernardino, Alice M.R.; Souza, Marcos C. de, E-mail: alicerolim@globo.co [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Programa de Pos-Graduacao em Quimica Organica; Khan, Misbahul A. [The Islamia University of Bahawalpur (Pakistan). Chemistry Dept.; Brito, Monique A. de [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Fac. de Farmacia. Lab. de Quimica Medicinal Computacional; Castro, Helena C.; Abreu, Paula A. [Universidade Federal Fluminense (LABioMol/GCM/UFF), Niteroi, RJ (Brazil). Inst. de Biologia. Lab. de Antibioticos, Bioquimica e Modelagem Molecular; Rodrigues, Carlos R. [Universidade Federal do Rio de Janeiro (ModMol/UFRJ), RJ (Brazil). Fac. de Farmacia. Lab. de Modelagem Molecular e QSAR; Leo, Rosa M.M. de; Leon, Leonor L.; Canto-Cavalheiro, Marilene M. [Fundacao Oswaldo Cruz (IOC/FIOCRUZ), Rio de Janeiro, RJ (Brazil). Instituto Oswaldo Cruz. Lab. de Bioquimica de Tripanosomatideos

    2011-07-01

    Chemotherapy for leishmaniasis, diseases caused by protozoa of the genus Leishmania, remains inefficient in several treatments. So there is a need to search for new drugs. In this work, we have synthesized 1-aryl-1H-pyrazole-4-carboximidamides derivatives and evaluated antileishmanial activities in vitro, as well as cytotoxic effects. Structure-activity relationship (SAR) studies were carried out with all the compounds of the series. Compound 2 showed an activity profile that can be improved through medicinal chemistry strategies. (author)

  9. One-Pot Synthesis of Novel 2,3-Dihydro-1H-indazoles

    Directory of Open Access Journals (Sweden)

    Antonio J. Lepore

    2011-11-01

    Full Text Available A copper(I-mediated one-pot synthesis of 2,3-dihydro-1H-indazole heterocycles has been developed. This synthetic route provides the desired indazoles in moderate to good yields (55%–72% which are substantially better than those achievable with an alternative two-step reaction sequence. The reaction is tolerant of functionality on the aromatic ring.

  10. Search for the Halo Effect in the 1H(6He, 6Li)n Peaction

    Institute of Scientific and Technical Information of China (English)

    李志宏; 柳卫平; 白希祥; 王友宝; 连钢; 李志常; 申庆彪; 林承键; 曾晟; 符长波

    2002-01-01

    The angular distributions of the charge exchange reaction 1 H(6He, 6Li)n were measured in reverse kinematics with a secondary 6He beam at the energy of4.17 AMeV. The data were analysed in the context ora microscopic calculation. It is shown that both the ground state of6He and the second excited state of6Li (3.563 MeV, 0+) have a halo structure.

  11. 1H-MRS metabolites in adults with Down syndrome: Effects of dementia

    Directory of Open Access Journals (Sweden)

    A.-L. Lin

    2016-01-01

    Full Text Available To determine if proton magnetic resonance spectroscopy (1H-MRS detect differences in dementia status in adults with Down syndrome (DS, we used 1H-MRS to measure neuronal and glial metabolites in the posterior cingulate cortex in 22 adults with DS and in 15 age- and gender-matched healthy controls. We evaluated associations between 1H-MRS results and cognition among DS participants. Neuronal biomarkers, including N-acetylaspartate (NAA and glutamate-glutamine complex (Glx, were significantly lower in DS patients with Alzheimer's should probably be changed to Alzheimer (without ' or s through ms as per the new naming standard disease (DSAD when compared to non-demented DS (DS and healthy controls (CTL. Neuronal biomarkers therefore appear to reflect dementia status in DS. In contrast, all DS participants had significantly higher myo-inositol (MI, a putative glial biomarker, compared to CTL. Our data indicate that there may be an overall higher glial inflammatory component in DS compared to CTL prior to and possibly independent of developing dementia. When computing the NAA to MI ratio, we found that presence or absence of dementia could be distinguished in DS. NAA, Glx, and NAA/MI in all DS participants were correlated with scores from the Brief Praxis Test and the Severe Impairment Battery. 1H-MRS may be a useful diagnostic tool in future longitudinal studies to measure AD progression in persons with DS. In particular, NAA and the NAA/MI ratio is sensitive to the functional status of adults with DS, including prior to dementia.

  12. PepsNMR for the 1H-NMR metabolomic data pre-processing

    OpenAIRE

    Martin, Manon; Legat, Benoît; Leenders, Justine; Vanwinsberghe, Julien; Rousseau, Réjane; Boulanger, Bruno; Eilers, Paul H. C.; De Tullio, Pascal; Govaerts, Bernadette

    2017-01-01

    In the analysis of complex biological samples, control over experimental design and data acquisition procedures cannot ensure alone well-conditioned 1H-NMR spectra with maximal information recovery for data analysis. A third major element affects the accuracy and robustness of the results: the data pre-processing/pre-treatment for which not enough attention is usually devoted, in particular in the metabolomic studies. The usual approach is to use proprietary software provided by the analytica...

  13. (E-1-Diphenylmethylidene-2-[(1H-indol-3-ylmethylidene]hydrazine

    Directory of Open Access Journals (Sweden)

    R. Archana

    2010-07-01

    Full Text Available In the title compound, C22H17N3, the 1H-indole unit is essentially planar, with a dihedral angle of 0.95 (10° between the pyrrole ring and the fused benzene ring. The dihedral angle between the two phenyl rings is 65.09 (10°. In the crystal, an intermolecular N—H...N hydrogen bond forms an infinite chain in the b-axis direction.

  14. MR diffusion imaging and 1H spectroscopy in a child with medulloblastoma: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Wilke, M. [Max-Planck-Institute of Psychiatry, Muenchen (Germany). NMR Study Group; Eidenschink, A.; Mueller-Weihrich, S. [Technical Univ. of Muenchen, (Germany). Childrens' Hospital; Auer, D.P. [Max-Planck-Institute of Psychiatry, Muenchen (Germany). NMR Study Group

    2000-01-01

    We report on a child with a metastasising medulloblastoma which was assessed by MR diffusion imaging and 1H MR spectroscopy (MRS). Reduced mean apparent diffusion coefficients and a high amount of taurine could be demonstrated. This is the first reported case of high taurine in medulloblastoma in vivo and confirms earlier in vitro findings. It is suggested that the changes on diffusion imaging, possibly reflecting the small-cell histology of the tumour and high taurine in MRS, are indicative of medulloblastoma.

  15. 1H-13C NMR-based profiling of biotechnological starch utilization

    DEFF Research Database (Denmark)

    Sundekilde, Ulrik K.; Meier, Sebastian

    2016-01-01

    Starch is used in food-and non-food applications as a renewable and degradable source of carbon and energy. Insight into the chemical detail of starch degradation remains challenging as the starch constituents amylose and amylopectin are homopolymers. We show that considerable molecular detail......-resolution 1H-13C NMR spectroscopic profiles of homooligomeric fragment mixtures in conjunction with chemometric methods provide a useful addition to the analytical chemistry toolbox of biotechnologi-cal starch utilization....

  16. Authentication of beef versus horse meat using 60 MHz 1H NMR spectroscopy

    OpenAIRE

    Jakes, W.; Gerdova, A.; Defernez, M.; Watson, A. D.; McCallum, C.; Limer, E.; Colquhoun, I. J.; Williamson, D. C.; Kemsley, E.K.

    2015-01-01

    This work reports a candidate screening protocol to distinguish beef from horse meat based upon comparison of triglyceride signatures obtained by 60 MHz 1H NMR spectroscopy. Using a simple chloroform-based extraction, we obtained classic low-field triglyceride spectra from typically a 10 min acquisition time. Peak integration was sufficient to differentiate samples of fresh beef (76 extractions) and horse (62 extractions) using Naïve Bayes classification. Principal component analysis gave a t...

  17. The neurochemical profile quantified by in vivo(1)H NMR spectroscopy

    OpenAIRE

    João M N Duarte; Lei, Hongxia; Mlynárik, Vladimír; Gruetter, Rolf

    2012-01-01

    Proton NMR spectroscopy is emerging from translational and preclinical neuroscience research as an important tool for evidence based diagnosis and therapy monitoring. It provides biomarkers that offer fingerprints of neurological disorders even in cases where a lesion is not yet observed in MR images. The collection of molecules used as cerebral biomarkers that are detectable by (1)H NMR spectroscopy define the so-called "neurochemical profile". The non-invasive quality of this technique make...

  18. Synthesis and Biological Activity of 3-Methyl-1H-pyrazole-4-carboxylic Ester Derivatives

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wei-Guang; LI Zheng-Ming; YUAN Ping-Wei; WANG Wen-Yan

    2001-01-01

    In search of novel pyrazole derivatives with bioactivity,a se-ries of 3-methyl- 1H-pyrazole-4-caboxylic ester derivatives were synthesized via α-oxoketene dithioacetals as starting ma-terial.The structures of al1 compounds prepared were con-firmed by 1HNMR, IR, MS and elemental analyses.Prelimi-nary bioassays indicated that some compounds showed fungici-dal activity against wheat rust,phoma asparagi and antiviral activity against TMV.

  19. Characterisation of human embryonic stem cells conditioning media by 1H-nuclear magnetic resonance spectroscopy.

    Directory of Open Access Journals (Sweden)

    David A MacIntyre

    Full Text Available BACKGROUND: Cell culture media conditioned by human foreskin fibroblasts (HFFs provide a complex supplement of protein and metabolic factors that support in vitro proliferation of human embryonic stem cells (hESCs. However, the conditioning process is variable with different media batches often exhibiting differing capacities to maintain hESCs in culture. While recent studies have examined the protein complement of conditioned culture media, detailed information regarding the metabolic component of this media is lacking. METHODOLOGY/PRINCIPAL FINDINGS: Using a (1H-Nuclear Magnetic Resonance ((1H-NMR metabonomics approach, 32 metabolites and small compounds were identified and quantified in media conditioned by passage 11 HFFs (CMp11. A number of metabolites were secreted by HFFs with significantly higher concentration of lactate, alanine, and formate detected in CMp11 compared to non-conditioned media. In contrast, levels of tryptophan, folate and niacinamide were depleted in CMp11 indicating the utilisation of these metabolites by HFFs. Multivariate statistical analysis of the (1H-NMR data revealed marked age-related differences in the metabolic profile of CMp11 collected from HFFs every 24 h over 72 h. Additionally, the metabolic profile of CMp11 was altered following freezing at -20°C for 2 weeks. CM derived from passage 18 HFFs (CMp18 was found to be ineffective at supporting hESCs in an undifferentiated state beyond 5 days culture. Multivariate statistical comparison of CMp11 and CMp18 metabolic profiles enabled rapid and clear discrimination between the two media with CMp18 containing lower concentrations of lactate and alanine as well as higher concentrations of glucose and glutamine. CONCLUSIONS/SIGNIFICANCE: (1H-NMR-based metabonomics offers a rapid and accurate method of characterising hESC conditioning media and is a valuable tool for monitoring, controlling and optimising hESC culture media preparation.

  20. Quantitative analysis of amygdalin and prunasin in Prunus serotina Ehrh. using (1) H-NMR spectroscopy.

    Science.gov (United States)

    Santos Pimenta, Lúcia P; Schilthuizen, Menno; Verpoorte, Robert; Choi, Young Hae

    2014-01-01

    Prunus serotina is native to North America but has been invasively introduced in Europe since the seventeenth century. This plant contains cyanogenic glycosides that are believed to be related to its success as an invasive plant. For these compounds, chromatographic- or spectrometric-based (targeting on HCN hydrolysis) methods of analysis have been employed so far. However, the conventional methods require tedious preparation steps and a long measuring time. To develop a fast and simple method to quantify the cyanogenic glycosides, amygdalin and prunasin in dried Prunus serotina leaves without any pre-purification steps using (1) H-NMR spectroscopy. Extracts of Prunus serotina leaves using CH3 OH-d4 and KH2 PO4 buffer in D2 O (1:1) were quantitatively analysed for amygdalin and prunasin using (1) H-NMR spectroscopy. Different internal standards were evaluated for accuracy and stability. The purity of quantitated (1) H-NMR signals was evaluated using several two-dimensional NMR experiments. Trimethylsilylpropionic acid sodium salt-d4 proved most suitable as the internal standard for quantitative (1) H-NMR analysis. Two-dimensional J-resolved NMR was shown to be a useful tool to confirm the structures and to check for possible signal overlapping with the target signals for the quantitation. Twenty-two samples of P. serotina were subsequently quantitatively analysed for the cyanogenic glycosides prunasin and amygdalin. The NMR method offers a fast, high-throughput analysis of cyanogenic glycosides in dried leaves permitting simultaneous quantification and identification of prunasin and amygdalin in Prunus serotina. Copyright © 2013 John Wiley & Sons, Ltd.

  1. Anti-Toxoplasma Activity of 2-(Naphthalene-2-γlthiol-1H Indole.

    Directory of Open Access Journals (Sweden)

    Qasem Asgari

    2015-06-01

    Full Text Available This study was undertaken to evaluate the viability, infectivity and immunity of Toxoplasma gondii tachyzoites exposed to 2-(naphthalene-2-ylthio-1H-indole.Tachyzoites of RH strain were incubated in various concentrations of 2-(naphthalene-2-ylthio-1H-indole (25-800 μM for 1.5 hours. Then, they were stained by PI and analyzed by Fluorescence-activated cell sorting (FACS. To evaluate the infectivity, the tachyzoites exposed to the different concentrations of the compound were inoculated to 10 BALB/c mice groups. For Control, parasites exposed to DMSO (0.2% v/v were also intraperitoneally inoculated into two groups of mice. The immunity of the exposed tachyzoites was evaluated by inoculation of the naïve parasite to the survived mice.The LD50 of 2-(naphthalene-2-ylthio-1H-indole was 57 μmol. The longevity of mice was dose dependent. Five mice out of group 400μmol and 3 out of group 800μmol showed immunization to the parasite.Our findings demonstrated the toxoplasmocidal activity of the compound. The presence of a well-organized transporter mechanism for indole compounds within the parasite in conjunction with several effective mechanisms of these compounds on Toxoplasma viability would open a window for production of new drugs and vaccines.

  2. Stereoelectronic effects on 1H nuclear magnetic resonance chemical shifts in methoxybenzenes

    DEFF Research Database (Denmark)

    Lambert, Maja; Olsen, Lars; Jaroszewski, Jerzy W

    2006-01-01

    the Ar-OCH3 torsion out of the ring plane, resulting in large stereoelectronic effects on the chemical shift of Hpara. Conformational searches and geometry optimizations for 3-16 at the B3LYP/6-31G** level, followed by B3LYP/6-311++G(2d,2p) calculations for all low-energy conformers, gave excellent......Investigation of all O-methyl ethers of 1,2,3-benzenetriol and 4-methyl-1,2,3-benzenetriol (3-16) by 1H NMR spectroscopy and density-functional calculations disclosed practically useful conformational effects on 1H NMR chemical shifts in the aromatic ring. While the conversion of phenol (2......) to anisole (1) causes only small positive changes of 1H NMR chemical shifts (Delta delta Hmeta > Hpara, the experimental O-methylation induced shifts in ortho-disubstituted phenols are largest for Hpara, Delta delta equals; 0.19 +/- 0.02 ppm (n = 11...

  3. Sudan dyes in adulterated saffron (Crocus sativus L.): Identification and quantification by (1)H NMR.

    Science.gov (United States)

    Petrakis, Eleftherios A; Cagliani, Laura R; Tarantilis, Petros A; Polissiou, Moschos G; Consonni, Roberto

    2017-02-15

    Saffron, the dried red stigmas of Crocus sativus L., is considered as one of the most expensive spices worldwide, and as such, it is prone to adulteration. This study introduces an NMR-based approach to identify and determine the adulteration of saffron with Sudan I-IV dyes. A complete (1)H and (13)C resonance assignment for Sudan I-IV, achieved by two-dimensional homonuclear and heteronuclear NMR experiments, is reported for the first time. Specific different proton signals for the identification of each Sudan dye in adulterated saffron can be utilised for quantitative (1)H NMR (qHNMR), a well-established method for quantitative analysis. The quantification of Sudan III, as a paradigm, was performed in varying levels (0.14-7.1g/kg) by considering the NMR signal occurring at 8.064ppm. The high linearity, accuracy and rapidity of investigation enable high resolution (1)H NMR spectroscopy to be used for evaluation of saffron adulteration with Sudan dyes.

  4. Theoretical study of an energetic material di-1H-1,3,4-triazole derivatives

    Directory of Open Access Journals (Sweden)

    Hua Zhou

    2014-12-01

    Full Text Available Computations by density functional theory (DFT method are performed on a series of di-1H-1,3,4-triazole derivatives with different substituents and linkages. The heat of formation (HOF is predicted by the designed isodesmic reactions. The predicted results reveal that –N3 and –NN– groups are effective structural units for increasing the HOF values of the di-1H-1,3,4-triazole derivatives. The HOMO–LUMO gap is affected by the substituents and linkage groups. Detonation performance is evaluated using the Kamlet–Jacobs approach based on the calculated density and HOF. The results indicate that –NO2, –NF2, –NH–, –NH–NH– and –NN– groups are helpful for enhancing the detonation properties of di-1H-1,3,4-triazole derivatives. The bond dissociation energy and bond order of the weakest bonds are analyzed to investigate their stability. It is observed that the –CH2–, –CH2–CH2– and –CHCH– groups are effective structural units for improving the stabilities of these derivatives. Considering the detonation performance and the stability, five compounds are screened as the potential candidates for high energy density materials.

  5. Theoretical study of an energetic material di-1H-1,3,4-triazole derivatives

    Institute of Scientific and Technical Information of China (English)

    Hua ZHOU; Zhong-liang MA; Jian-long WANG; Dong WANG

    2014-01-01

    Computations by density functional theory (DFT) method are performed on a series of di-1H-1,3,4-triazole derivatives with different sub-stituents and linkages. The heat of formation (HOF ) is predicted by the designed isodesmic reactions. The predicted results reveal that eN3 and eN]Ne groups are effective structural units for increasing the HOF values of the di-1H-1,3,4-triazole derivatives. The HOMOeLUMO gap is affected by the substituents and linkage groups. Detonation performance is evaluated using the KamleteJacobs approach based on the calculated density and HOF. The results indicate that eNO2, eNF2, eNHe, eNHeNHe and eN]Ne groups are helpful for enhancing the detonation properties of di-1H-1,3,4-triazole derivatives. The bond dissociation energy and bond order of the weakest bonds are analyzed to investigate their stability. It is observed that the eCH2e, eCH2eCH2e and eCH]CHe groups are effective structural units for improving the stabilities of these derivatives. Considering the detonation performance and the stability, five compounds are screened as the potential candidates for high energy density materials.

  6. Discriminating binding and positioning of amphiphiles to lipid bilayers by {sup 1}H NMR

    Energy Technology Data Exchange (ETDEWEB)

    Evanics, F. [Department of Chemistry, University of Toronto, UTM, 3359 Mississauga Rd. North Mississauga, Ont., L5L 1C6 (Canada); Prosser, R.S. [Department of Chemistry, University of Toronto, UTM, 3359 Mississauga Rd. North Mississauga, Ont., L5L 1C6 (Canada)]. E-mail: sprosser@utm.utoronto.ca

    2005-04-04

    The binding and positioning in lipid bilayers of three well-known drugs--imipramine, nicotine, and caffeine--have been studied using {sup 1}H NMR. The membrane model system consisted of 'fast-tumbling' lipid bicelles, in which a bilayered lipid domain, composed of the unsaturated lipid, 1,2-dimyristelaidoyl-sn-glycero-3-phosphocholine (DMLPC) was surrounded by a rim of deuterated detergent-like lipids, consisting of 1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC-d22). Binding and immersion depth information was obtained by three experiments. (1) {sup 1}H chemical shift perturbations, upon transfer of the amphiphiles from water to a bicelle mixture, were used to estimate regions of the amphiphiles that interact with the membrane. (2) Water contact to resolvable protons was measured through a Nuclear Overhauser Effect (NOE) between water and resolvable drug and lipid resonances. In the case of both lipids and membrane bound drugs, positive NOEs with large cross-relaxation rates were measured for most resonances originating from the membrane hydrophilic region, while negative NOEs were observed predominantly to resonances in the hydrophobic region of the membrane. (3) {sup 1}H NMR measurements of oxygen-induced (paramagnetic) spin-lattice relaxation rates, which are known to increase with membrane immersion depth, were used to corroborate conclusions based on chemical shift perturbations and water-ligand NOEs.

  7. Improving Assessment of Lipoprotein Profile in Type 1 Diabetes by 1H NMR Spectroscopy

    Science.gov (United States)

    Brugnara, Laura; Mallol, Roger; Ribalta, Josep; Vinaixa, Maria; Murillo, Serafín; Casserras, Teresa; Guardiola, Montse; Vallvé, Joan Carles; Kalko, Susana G.; Correig, Xavier; Novials, Anna

    2015-01-01

    Patients with type 1 diabetes (T1D) present increased risk of cardiovascular disease (CVD). The aim of this study is to improve the assessment of lipoprotein profile in patients with T1D by using a robust developed method 1H nuclear magnetic resonance spectroscopy (1H NMR), for further correlation with clinical factors associated to CVD. Thirty patients with T1D and 30 non-diabetes control (CT) subjects, matched for gender, age, body composition (DXA, BMI, waist/hip ratio), regular physical activity levels and cardiorespiratory capacity (VO2peak), were analyzed. Dietary records and routine lipids were assessed. Serum lipoprotein particle subfractions, particle sizes, and cholesterol and triglycerides subfractions were analyzed by 1H NMR. It was evidenced that subjects with T1D presented lower concentrations of small LDL cholesterol, medium VLDL particles, large VLDL triglycerides, and total triglycerides as compared to CT subjects. Women with T1D presented a positive association with HDL size (plipoprotein profile as compared to control counterparts. In addition, slight alterations in BMI and/or body fat composition showed to be relevant to provoking alterations in lipoproteins profiles. Finally, body fat composition appears to be a determinant for cardioprotector lipoprotein profile. PMID:26317989

  8. Permissivity of the NCI-60 cancer cell lines to oncolytic Vaccinia Virus GLV-1h68

    Directory of Open Access Journals (Sweden)

    Bedognetti Davide

    2011-10-01

    Full Text Available Abstract Background Oncolytic viral therapy represents an alternative therapeutic strategy for the treatment of cancer. We previously described GLV-1h68, a modified Vaccinia Virus with exclusive tropism for tumor cells, and we observed a cell line-specific relationship between the ability of GLV-1h68 to replicate in vitro and its ability to colonize and eliminate tumor in vivo. Methods In the current study we surveyed the in vitro permissivity to GLV-1h68 replication of the NCI-60 panel of cell lines. Selected cell lines were also tested for permissivity to another Vaccinia Virus and a vesicular stomatitis virus (VSV strain. In order to identify correlates of permissity to viral infection, we measured transcriptional profiles of the cell lines prior infection. Results We observed highly heterogeneous permissivity to VACV infection amongst the cell lines. The heterogeneity of permissivity was independent of tissue with the exception of B cell derivation. Cell lines were also tested for permissivity to another Vaccinia Virus and a vesicular stomatitis virus (VSV strain and a significant correlation was found suggesting a common permissive phenotype. While no clear transcriptional pattern could be identified as predictor of permissivity to infection, some associations were observed suggesting multifactorial basis permissivity to viral infection. Conclusions Our findings have implications for the design of oncolytic therapies for cancer and offer insights into the nature of permissivity of tumor cells to viral infection.

  9. An elevated 1-h post- load glucose level during the oral glucose tolerance test detects prediabetes.

    Science.gov (United States)

    Buysschaert, Martin; Bergman, Michael; Yanogo, Donald; Jagannathan, Ram; Buysschaert, Benoit; Preumont, Vanessa

    The objective of the study was to compare the diagnosis of dysglycemic states by conventional oral glucose tolerance test (OGTT) criteria (fasting and 2-h plasma glucose) with the 1-h post-load plasma glucose level. 34 individuals (mean age: 55±13years; BMI: 27.7±6.3kg/m(2)) at risk for prediabetes were administered a 75g OGTT. Individuals with normal glucose tolerance (NGT) or prediabetes were identified according to fasting and/or 2-h plasma glucose (PG) concentrations. Subsequently, subjects were divided in 2 groups: group 1 (n=21) with a 1-h PGh PG≥155mg/dl. HOMA was performed to assess β-cell function and insulin sensitivity. NGT or prediabetes based on conventional criteria correlated with the 1-h PGh PG≥155mg/dl was associated with higher HbA1c levels (6.1±0.5 vs. 5.5±0.3%, ph PGh post-load plasma glucose value ≥155mg/dl is strongly associated with conventional criteria for (pre)diabetes and alterations of β-cell function. Copyright © 2016 Diabetes India. Published by Elsevier Ltd. All rights reserved.

  10. Synthesis and antiproliferative activity of 3-amino-N-phenyl-1H-indazole-1-carboxamides.

    Science.gov (United States)

    Raffa, Demetrio; Maggio, Benedetta; Cascioferro, Stella; Raimondi, Maria Valeria; Schillaci, Domenico; Gallo, Giorgio; Daidone, Giuseppe; Plescia, Salvatore; Meneghetti, Fiorella; Bombieri, Gabriella; Di Cristina, Antonietta; Pipitone, Rosaria M; Grimaudo, Stefania; Tolomeo, Manlio

    2009-01-01

    A series of new 3-amino-N-phenyl-1H-indazole-1-carboxamides 10 have been prepared from commercially available phenyl isocyanate precursors 8 and 3-aminoindazole 9. Some of the synthesized compounds were evaluated for their in vitro antineoplastic activity against 60 human cell lines derived from seven clinically isolated cancer types (lung, colon, melanoma, renal, ovarian, brain, and leukemia) according to the NCI standard protocol. The test results indicated that 3-amino-1H-indazole-1-carboxamides 10 were endowed with an interesting antiproliferative activity. The most active compounds of this series, 10d,e, were able to inhibit cell growth of many neoplastic cell lines at concentrations lower than 1 microM (0.0153 microM in SR leukemia) causing a block in G0-G1 phase of cell cycle. Analysis of pRb expression showed that these two compounds increased the ratio between underphosphorylated pRb and total pRb. The X-ray structure of 10w, confirmed the 3-amino-N-phenyl-1H-indazole-1-carboxamide structure of compounds 10.

  11. {sup 1}H NMR spectroscopic studies establish that heparanase is a retaining glycosidase

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Jennifer C., E-mail: jennifer.wilson@griffith.edu.au [Institute for Glycomics, Griffith University Gold Coast Campus, QLD 4222 (Australia); Laloo, Andrew Elohim [School of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, QLD 4072 (Australia); Singh, Sanjesh [Institute for Glycomics, Griffith University Gold Coast Campus, QLD 4222 (Australia); Ferro, Vito, E-mail: v.ferro@uq.edu.au [School of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, QLD 4072 (Australia)

    2014-01-03

    Highlights: •{sup 1}H and {sup 13}C NMR chemical shifts of fondaparinux were fully assigned by 1D and 2D NMR techniques. •Hydrolysis of fondaparinux by heparanase was monitored by {sup 1}H NMR spectroscopy. •Heparanase is established to be a retaining glycosidase. -- Abstract: Heparanase is an endo-β-glucuronidase that cleaves heparan sulfate side chains of proteoglycans in basement membranes and the extracellular matrix (ECM). Heparanase is implicated in several diverse pathological processes associated with ECM degradation such as metastasis, inflammation and angiogenesis and is thus an important target for anti-cancer and anti-inflammatory drug discovery. Heparanase has been classed as belonging to the clan A glycoside hydrolase family 79 based on sequence analysis, secondary structure predictions and mutagenic analysis, and thus it has been inferred that it is a retaining glycosidase. However, there has been no direct experimental evidence to support this conclusion. Herein we describe {sup 1}H NMR spectroscopic studies of the hydrolysis of the pentasaccharide substrate fondaparinux by heparanase, and provide conclusive evidence that heparanase hydrolyses its substrate with retention of configuration and is thus established as a retaining glycosidase. Knowledge of the mechanism of hydrolysis may have implications for future design of inhibitors for this important drug target.

  12. Unstable Resonator Mid-Infrared Laser Sources

    Science.gov (United States)

    2016-02-26

    AFRL-AFOSR-VA-TR-2016-0110 Unstable Resonator Mid-Infrared Laser Sources Steven Brueck UNIVERSITY OF NEW MEXICO Final Report 02/26/2016 DISTRIBUTION...5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) The Regents of the University of New Mexico 8...Transistors: State-of-the- Art ," IEEE J. Electron Device Soc. 2, 44 (2014). 43 A. M. Ionescu1 & H. Riel, "Tunnel field-effect transistors as energy

  13. BEBE(tr) and BUBI: J-compensated concurrent shaped pulses for 1H-13C experiments.

    Science.gov (United States)

    Ehni, Sebastian; Luy, Burkhard

    2013-07-01

    Shaped pulses designed for broadband excitation, inversion and refocusing are important tools in modern NMR spectroscopy to achieve robust pulse sequences especially in heteronuclear correlation experiments. A large variety of mostly computer-optimized pulse shapes exist for different desired bandwidths, available rf-field strengths, and tolerance to B1-inhomogeneity. They are usually derived for a single spin 1/2, neglecting evolution due to J-couplings. While pulses with constant resulting phase are selfcompensated for heteronuclear coupling evolution as long as they are applied exclusively on a single nucleus, the situation changes for concurrently applied pulse shapes. Using the example of a (1)H,(13)C two spin system, two J-compensated pulse pairs for the application in INEPT-type transfer elements were optimized: a point-to-point pulse sandwich called BEBE(tr), consisting of a broadband excitation and time-reversed excitation pulse, and a combined universal rotation and point-to-point pulse pair called BUBI, which acts as a refocusing pulse on (1)H and a corresponding inversion pulse on (13)C. After a derivation of quality factors and optimization protocols, a theoretical and experimental comparison with conventionally derived BEBOP, BIBOP, and BURBOP-180° pulses is given. While the overall transfer efficiency of a single pulse pair is only reduced by approximately 0.1%, resulting transfer to undesired coherences is reduced by several percent. In experiments this can lead to undesired phase distortions for pairs of uncompensated pulse shapes and even differences in signal intensities of 5-10% in HSQC and up to 68% in more complex COB-HSQC experiments.

  14. Evaluation of standard and advanced preprocessing methods for the univariate analysis of blood serum 1H-NMR spectra.

    Science.gov (United States)

    De Meyer, Tim; Sinnaeve, Davy; Van Gasse, Bjorn; Rietzschel, Ernst-R; De Buyzere, Marc L; Langlois, Michel R; Bekaert, Sofie; Martins, José C; Van Criekinge, Wim

    2010-10-01

    Proton nuclear magnetic resonance ((1)H-NMR)-based metabolomics enables the high-resolution and high-throughput assessment of a broad spectrum of metabolites in biofluids. Despite the straightforward character of the experimental methodology, the analysis of spectral profiles is rather complex, particularly due to the requirement of numerous data preprocessing steps. Here, we evaluate how several of the most common preprocessing procedures affect the subsequent univariate analyses of blood serum spectra, with a particular focus on how the standard methods perform compared to more advanced examples. Carr-Purcell-Meiboom-Gill 1D (1)H spectra were obtained for 240 serum samples from healthy subjects of the Asklepios study. We studied the impact of different preprocessing steps--integral (standard method) and probabilistic quotient normalization; no, equidistant (standard), and adaptive-intelligent binning; mean (standard) and maximum bin intensity data summation--on the resonance intensities of three different types of metabolites: triglycerides, glucose, and creatinine. The effects were evaluated by correlating the differently preprocessed NMR data with the independently measured metabolite concentrations. The analyses revealed that the standard methods performed inferiorly and that a combination of probabilistic quotient normalization after adaptive-intelligent binning and maximum intensity variable definition yielded the best overall results (triglycerides, R = 0.98; glucose, R = 0.76; creatinine, R = 0.70). Therefore, at least in the case of serum metabolomics, these or equivalent methods should be preferred above the standard preprocessing methods, particularly for univariate analyses. Additional optimization of the normalization procedure might further improve the analyses.

  15. Artefacts in 1H NMR-based metabolomic studies on cell cultures.

    Science.gov (United States)

    Madhu, Basetti; Dadulescu, Madalina; Griffiths, John

    2015-04-01

    Metabolomic studies on cultured cells involve assays of cell extracts and culture medium, both of which are often performed by (1)H NMR. Cell culture is nowadays performed in plastic dishes or flasks, and the extraction of metabolites from the cells is typically performed with perchloric acid, methanol-chloroform, or acetonitrile, ideally while the cells are still adherent to the culture dish. We conducted this investigation to identify contaminants from cell culture plasticware in metabolomic studies. Human diploid fibroblasts (IMR90) (n = 6), HeLa cells (n = 6), and transformed astrocytes with HIF-1 knockout (Astro-KO) (n = 6) were cultured. Cells were seeded in 100 mm Petri dishes with 10 ml complete growth medium (Dulbecco's minimum essential medium) containing 10 % foetal bovine serum (FBS). Cell cultures were incubated at 37 °C in 5 % CO2 for approximately 3 days. Metabolites were extracted by use of a perchloric acid procedure. (1)H NMR spectroscopy was used for metabolite analysis. "Null sample" (i.e. cell-free) experiments were performed by either rinsing dishes with medium or incubating the medium in Petri dishes from five different manufacturers for 72 h and then by performing a dummy "extraction" of each Petri dish by the perchloric acid, methanol-chloroform, or acetonitrile procedures. Principal components analysis was used for classification of samples and to determine the contaminants arising from plasticware. We found that even brief rinsing of cell culture plasticware with culture medium elutes artefactual chemicals, the (1)H NMR signals of which could confound assays of acetate, succinate, and glycolate. Incubation of culture medium in cell-culture dishes for 72 h (as in a typical cell-culture experiment) followed by perchloric extraction in the dishes enhanced elution of the artefacts. These artefacts were present, but somewhat less pronounced, in the (1)H NMR spectra of null samples extracted with methanol and acetonitrile. Ethanol, lactate

  16. Synthesis and characterization of two novel coordination polymers based on the rigid 1H-1,2,3-triazole-4,5-dicarboxylic acid ligand

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Two novel three-dimensional (3-D) coordination polymers, [Pb(HTDA)]n (1) and [Co5(TDA)2(H2TDA)2(H2O)8]n (2) [H3TDA = 1H-1,2,3-triazole-4,5-dicarboxylic acid], have been prepared by hydrothermal reactions and characterized by elemental analysis, infrared spectroscopy and single-crystal X-ray diffraction. Compound 1 is constructed from rod-shaped secondary building units (SBUs) and exhibits a 3-D network with (410·65)(410·63·82) topology. Compound 2 is built up from ligands bridging three different cobalt ions and exhibits a 3-D network with (4·82)3(4·82·103) topology. In addition, the thermal stabilities of the two compounds, the photoluminescence properties of compound 1 and the magnetic properties of compound 2 have been studied.

  17. Vibrational and theoretical analysis of pentyl-4-benzoyl-1-[2,4-dinitrophenyl]-5-phenyl-1H-pyrazole-3-carboxylate

    Science.gov (United States)

    Arı, Hatice; Büyükmumcu, Zeki; Özpozan, Talat; İlhan, İlhan Özer; Bahadır, Özlem

    2013-06-01

    Infrared spectrum of the compound, pentyl-4-benzoyl-1-[2,4-dinitrophenyl]-5-phenyl-1H-pyrazole-3-carboxylate (PBDPPC) has been measured. Conformational search through relaxed scan has been carried out to find the most stable conformational isomer. After the full geometry optimization for the most stable conformer using B3LYP and BLYP hybrid functionals of Density Functional Theory (DFT), vibrational normal modes have been calculated at the same theoretical levels. Potential Energy Distribution (PED) of each normal mode has been calculated by means of VEDA4 to obtain contributions of internal coordinates to the normal modes. Natural Bond Orbital (NBO) analysis has been performed to get insights into the possible hydrogen bonding sites for all the conformational isomers.

  18. Virotherapy of canine tumors with oncolytic vaccinia virus GLV-1h109 expressing an anti-VEGF single-chain antibody.

    Directory of Open Access Journals (Sweden)

    Sandeep S Patil

    Full Text Available Virotherapy using oncolytic vaccinia virus (VACV strains is one promising new strategy for cancer therapy. We have previously reported that oncolytic vaccinia virus strains expressing an anti-VEGF (Vascular Endothelial Growth Factor single-chain antibody (scAb GLAF-1 exhibited significant therapeutic efficacy for treatment of human tumor xenografts. Here, we describe the use of oncolytic vaccinia virus GLV-1h109 encoding GLAF-1 for canine cancer therapy. In this study we analyzed the virus-mediated delivery and production of scAb GLAF-1 and the oncolytic and immunological effects of the GLV-1h109 vaccinia virus strain against canine soft tissue sarcoma and canine prostate carcinoma in xenograft models. Cell culture data demonstrated that the GLV-1h109 virus efficiently infect, replicate in and destroy both tested canine cancer cell lines. In addition, successful expression of GLAF-1 was demonstrated in virus-infected canine cancer cells and the antibody specifically recognized canine VEGF. In two different xenograft models, the systemic administration of the GLV-1h109 virus was found to be safe and led to anti-tumor and immunological effects resulting in the significant reduction of tumor growth in comparison to untreated control mice. Furthermore, tumor-specific virus infection led to a continued production of functional scAb GLAF-1, resulting in inhibition of angiogenesis. Overall, the GLV-1h109-mediated cancer therapy and production of immunotherapeutic anti-VEGF scAb may open the way for combination therapy concept i.e. vaccinia virus mediated oncolysis and intratumoral production of therapeutic drugs in canine cancer patients.

  19. Synthesis and Structural Studies on Transition Metal Complexes Derived from 4-Hydroxy-4-methyl–2-pentanone-1H-benzimidazol-2-yl-hydrazone

    Directory of Open Access Journals (Sweden)

    M. Neelamma

    2011-01-01

    Full Text Available Transition metal complexes of Cr(III, Fe(III, Mn(II, Co(II, Ni(II, Cu(II and Zn(II with a tridentate ligand, 4-hydroxy-4-methyl-2-pentanone-1H-benzimidazole-2yl-hydrazone (H-HPBH derived from the condensation of 2-hydrazinobenzimidazole and diacetone alcohol was synthesized. Characterization has been done on the basis of analytical, conductance, thermal and magnetic data, infrared, 1H NMR, electronic, mass and ESR spectral data. From analytical and thermal data, the stoichiometry of the complexes has been found to be 1:1 (metal: ligand. Divalent complexes have the general formula [M(HPBHCl(H2O2] in octahedral geometry, [M(HPBHCl] in tetrahedral and square planar stereochemistries and trivalent complexes [M(HPBHCl2(H2O] in octahedral disposition. Infrared spectral data suggest that the ligand HPBH behaves as a monobasic tridentate ligand with N: N: O donor sequence towards the metal ions. On the basis of the above physicochemical data, octahedral, tetrahedral and square planar geometries were assigned for the complexes. The ligand and metal complexes were screened for their physiological activities against E. coli and S. aureus. The order of physiological activity has been found to be Cu(II > Ni(II > Zn(II > Co(II > Cr(III > Mn(II > Fe (III > ligand against E.coli and Ni(II > Cu(II > Zn(II > Mn(II > Cr(III > Fe(III > Co(II > ligand against S. aureus.

  20. Non-invasive assessment of hepatic steatosis in patients with NAFLD using controlled attenuation parameter and 1H-MR spectroscopy.

    Directory of Open Access Journals (Sweden)

    Thomas Karlas

    Full Text Available INTRODUCTION: Non-invasive assessment of steatosis and fibrosis is of growing relevance in non-alcoholic fatty liver disease (NAFLD. 1H-Magnetic resonance spectroscopy (1H-MRS and the ultrasound-based controlled attenuation parameter (CAP correlate with biopsy proven steatosis, but have not been correlated with each other so far. We therefore performed a head-to-head comparison between both methods. METHODS: Fifty patients with biopsy-proven NAFLD and 15 healthy volunteers were evaluated with 1H-MRS and transient elastography (TE including CAP. Steatosis was defined according to the percentage of affected hepatocytes: S1 5-33%, S2 34-66%, S3 ≥67%. RESULTS: Steatosis grade in patients with NAFLD was S1 36%, S2 40% and S3 24%. CAP and 1H-MRS significantly correlated with histopathology and showed comparable accuracy for the detection of hepatic steatosis: areas under the receiver-operating characteristics curves were 0.93 vs. 0.88 for steatosis ≥S1 and 0.94 vs. 0.88 for ≥S2, respectively. Boot-strapping analysis revealed a CAP cut-off of 300 dB/m for detection of S2-3 steatosis, while retaining the lower cut-off of 215 dB/m for the definition of healthy individuals. Direct comparison between CAP and 1H-MRS revealed only modest correlation (total cohort: r = 0.63 [0.44, 0.76]; NAFLD cases: r = 0.56 [0.32, 0.74]. For detection of F2-4 fibrosis TE had sensitivity and specificity of 100% and 98.1% at a cut-off value of 8.85 kPa. CONCLUSION: Our data suggest a comparable diagnostic value of CAP and 1H-MRS for hepatic steatosis quantification. Combined with the simultaneous TE fibrosis assessment, CAP represents an efficient method for non-invasive characterization of NAFLD. Limited correlation between CAP and 1H-MRS may be explained by different technical aspects, anthropometry, and presence of advanced liver fibrosis.