WorldWideScience

Sample records for cockroach blaberus giganteus

  1. CIRCADIAN CONTROL OF VISUAL INFORMATION-PROCESSING IN THE OPTIC LOBE OF THE GIANT COCKROACH BLABERUS-GIGANTEUS

    NARCIS (Netherlands)

    BULT, R; MASTEBROEK, HAK

    1993-01-01

    Extracellular spike activity from three different types of visual interneurons found in the optic lobe of the giant cockroach Blaberus giganteus was recorded. The spike rate of all three types of neurons fluctuated in a circadian manner in constant darkness (DD). Two types, so-called ''on'' neurons

  2. Aromatic hexamerin subunit from adult female cockroaches (Blaberus discoidalis) : Molecular cloning, suppression by juvenile hormone, and evolutionary perspectives

    NARCIS (Netherlands)

    Jamroz, RC; Beintema, JJ; Stam, WT; Bradfield, JY

    In an effort to identify several polypeptides that are strongly suppressed by juvenile hormone (JH) in fat body of adult female Blaberus discoidalis cockroaches, we have cloned a cDNA representing a polypeptide member of the hexamerin family of arthropod serum proteins. The deduced primary

  3. Leg Regrowth in Blaberus discoidalis (Discoid Cockroach) following Limb Autotomy versus Limb Severance and Relevance to Neurophysiology Experiments

    Science.gov (United States)

    Marzullo, Timothy C.

    2016-01-01

    Background Many insects can regenerate limbs, but less is known about the regrowth process with regard to limb injury type. As part of our neurophysiology education experiments involving the removal of a cockroach leg, 1) the ability of Blaberus discoidalis cockroaches to regenerate a metathoracic leg was examined following autotomy at the femur/trochanter joint versus severance via a transverse coxa-cut, and 2) the neurophysiology of the detached legs with regard to leg removal type was studied by measuring spike firing rate and microstimulation movement thresholds. Leg Regrowth Results First appearance of leg regrowth was after 5 weeks in the autotomy group and 12 weeks in the coxa-cut group. Moreover, regenerated legs in the autotomy group were 72% of full size on first appearance, significantly larger (pbarbs, and a 10% higher electrical microstimulation threshold for movement. Summary It is recommended that neurophysiology experiments on cockroach legs remove the limb at autotomy joints instead of coxa cuts, as the leg regenerates significantly faster when autotomized and does not detract from the neurophysiology educational content. PMID:26824931

  4. Leg Regrowth in Blaberus discoidalis (Discoid Cockroach following Limb Autotomy versus Limb Severance and Relevance to Neurophysiology Experiments.

    Directory of Open Access Journals (Sweden)

    Timothy C Marzullo

    Full Text Available Many insects can regenerate limbs, but less is known about the regrowth process with regard to limb injury type. As part of our neurophysiology education experiments involving the removal of a cockroach leg, 1 the ability of Blaberus discoidalis cockroaches to regenerate a metathoracic leg was examined following autotomy at the femur/trochanter joint versus severance via a transverse coxa-cut, and 2 the neurophysiology of the detached legs with regard to leg removal type was studied by measuring spike firing rate and microstimulation movement thresholds.First appearance of leg regrowth was after 5 weeks in the autotomy group and 12 weeks in the coxa-cut group. Moreover, regenerated legs in the autotomy group were 72% of full size on first appearance, significantly larger (p<0.05 than coxa-cut legs (29% of full size at first appearance. Regenerated legs in both groups grew in size with each subsequent molt; the autotomy-removed legs grew to full size within 18 weeks, whereas coxa-cut legs took longer than 28 weeks to regrow. Removal of the metathoracic leg in both conditions did not have an effect on mortality compared to matched controls with unmolested legs.Autotomy-removed legs had lower spontaneous firing rates, similar marked increased firing rates upon tactile manipulation of tibial barbs, and a 10% higher electrical microstimulation threshold for movement.It is recommended that neurophysiology experiments on cockroach legs remove the limb at autotomy joints instead of coxa cuts, as the leg regenerates significantly faster when autotomized and does not detract from the neurophysiology educational content.

  5. Control of obstacle climbing in the cockroach, Blaberus discoidalis. I. Kinematics.

    Science.gov (United States)

    Watson, James T; Ritzmann, Roy E; Zill, Sasha N; Pollack, Alan J

    2002-02-01

    An advantage of legged locomotion is the ability to climb over obstacles. We studied deathhead cockroaches as they climbed over plastic blocks in order to characterize the leg movements associated with climbing. Movements were recorded as animals surmounted 5.5-mm or 11-mm obstacles. The smaller obstacles were scaled with little change in running movements. The higher obstacles required altered gaits, leg positions and body posture. The most frequent sequence used was to first tilt the front of the body upward in a rearing stage, and then elevate the center of mass to the level of the top of the block. A horizontal running posture was re-assumed in a leveling-off stage. The action of the middle legs was redirected by rotations of the leg at the thoracal-coxal and the trochanteral-femoral joints. The subsequent extension movements of the coxal-trochanteral and femoral-tibial joints were within the range seen during horizontal running. The structure of proximal leg joints allows for flexibility in leg use by generating subtle, but effective changes in the direction of leg movement. This architecture, along with the resulting re-direction of movements, provides a range of strategies for both animals and walking machines.

  6. Is the carbamate juvenoid W-328 an insect growth regulator for the cockroach .I.Blaberus craniifer./I. Br. (Insecta, Dictyoptera)?

    Czech Academy of Sciences Publication Activity Database

    Goudey-Perriere, F.; Lemonnier, F.; Perriere, C.; Dahmani, F. Z.; Wimmer, Zdeněk

    2003-01-01

    Roč. 75, - (2003), s. 47-59 ISSN 0048-3575 Institutional research plan: CEZ:AV0Z4055905 Keywords : Blaberus craniifer * Blattella germanica * carbamate juvenoids Subject RIV: CC - Organic Chemistry Impact factor: 0.768, year: 2003

  7. Locomotion control of hybrid cockroach robots

    Science.gov (United States)

    Sanchez, Carlos J.; Chiu, Chen-Wei; Zhou, Yan; González, Jorge M.; Vinson, S. Bradleigh; Liang, Hong

    2015-01-01

    Natural systems retain significant advantages over engineered systems in many aspects, including size and versatility. In this research, we develop a hybrid robotic system using American (Periplaneta americana) and discoid (Blaberus discoidalis) cockroaches that uses the natural locomotion and robustness of the insect. A tethered control system was firstly characterized using American cockroaches, wherein implanted electrodes were used to apply an electrical stimulus to the prothoracic ganglia. Using this approach, larger discoid cockroaches were engineered into a remotely controlled hybrid robotic system. Locomotion control was achieved through electrical stimulation of the prothoracic ganglia, via a remotely operated backpack system and implanted electrodes. The backpack consisted of a microcontroller with integrated transceiver protocol, and a rechargeable battery. The hybrid discoid roach was able to walk, and turn in response to an electrical stimulus to its nervous system with high repeatability of 60%. PMID:25740855

  8. In vivo observation of gold nanoparticles in the central nervous system of Blaberus discoidalis

    Directory of Open Access Journals (Sweden)

    González Jorge M

    2011-02-01

    Full Text Available Abstract Background Nanoparticles (NPs are widely studied for biomedical applications. Understanding interactions between NPs and biomolecules or cells has yet to be achieved. Here we present a novel in vivo method to study interactions between NPs and the nervous system of the discoid or false dead-head roach, Blaberus discoidalis. The aims of this study were to present a new and effective method to observe NPs in vivo that opens the door to new methods of study to observe the interactions between NPs and biological systems and to present an inexpensive and easy-to-handle biological system. Results Negatively charged gold nanoparticles (nAuNPs of 50 nm in diameter were injected into the central nervous system (CNS of the insect. By using such a cost effective method, we were able to characterize nAuNPs and to analyze their interactions with a biological system. It showed that the charged particles affected the insect's locomotion. The nAuNPs affected the insect's behavior but had no major impacts on the life expectancy of the cockroach after two months of observation. This was apparently due to the encapsulation of nAuNPs inside the insect's brain. Based on cockroach's daily activity, we believed that the encapsulation occurred in the first 17 days. Conclusions The method proposed here is an inexpensive and reliable way of observing the response of biological systems to nanoparticles in-vivo. It opens new windows to further understand how nanoparticles affect neural communication by monitoring insect activity and locomotion.

  9. Cockroach allergy

    African Journals Online (AJOL)

    hi-tech

    2000-11-11

    Nov 11, 2000 ... the effect of associated factors on cockroach sensitisation in Nigeria is largely unknown. Objective: To determine the ... in most of these studies has been on the house dust mite(1-. 5). Since cockroaches are ... location of their residences did not influence the positivity of the test (p=0.46 and p=0.84).

  10. Conjugation-Mediated Transfer of Antibiotic-Resistance Plasmids Between Enterobacteriaceae in the Digestive Tract of Blaberus craniifer (Blattodea: Blaberidae).

    Science.gov (United States)

    Anacarso, I; Iseppi, R; Sabia, C; Messi, P; Condò, C; Bondi, M; de Niederhäusern, S

    2016-05-01

    Cockroaches, insects of the order Blattodea, seem to play a crucial role in the possible conjugation-mediated genetic exchanges that occur among bacteria that harbor in the cockroach intestinal tract. The gut of these insects can be thought of as an effective in vivo model for the natural transfer of antimicrobial resistance plasmids among bacteria. In our study, we evaluated the conjugation-mediated horizontal transfer of resistance genes between Escherichia coli and other microorganisms of the same Enterobacteriaceae family within the intestinal tract of Blaberus craniifer Burmeister, 1838 (Blattodea: Blaberidae). Different in vivo mating experiments were performed using E. coli RP4 harboring the RP4 plasmid carrying ampicillin, kanamycin, and tetracycline resistance genes as the donor and E. coli K12 resistant to nalidixic acid or Salmonella enterica serovar Enteritidis IMM39 resistant to streptomycin as the recipients. The RP4 plasmid was successfully transferred to both recipients, producing E. coli K12-RP4 and S. Enteritidis IMM39-RP4 transconjugants. Conjugation frequencies in vivo were similar to those previously observed in vitro. The transfer of the RP4 plasmid in all transconjugants was confirmed by small-scale plasmid isolation and agar gel electrophoresis, suggesting that the intestinal tract of cockroaches is an effective in vivo model for natural gene transfer. Our results confirm that cockroaches allow for the exchange of antimicrobial resistance plasmids among bacteria and may represent a potential reservoir for the dissemination of antibiotic-resistant bacteria in different environments. These findings are particularly significant to human health in the context of health care settings such as hospitals. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Cockroach Allergy

    Science.gov (United States)

    ... at School Allergies Types of Allergies Drug Allergy Food Allergy Insect Allergy Cockroach Allergy Dust Mite Allergy Latex ... Climate and Health Epinephrine in Schools Healthy Settings Food Allergies National Asthma Control Program Patient and Family Engagement ...

  12. Characterization of a novel glycolipid from the giant cockroach, Blaberus colosseus

    Energy Technology Data Exchange (ETDEWEB)

    Stoskopf, M.K.

    1986-01-01

    Microdissection and quantitative high performance liquid chromatography demonstrated 93% of blaberosides were in the head. Extracephalic blaberosides were limited to the tarsus and egg case. In the head, 70% of blaberosides were in hypopharynx, 19% in the eye, and the remainder in the esophagus, mentum, submentum, and maxilla. Isolation of blaberosides from roaches maintained six months on a blaberoside free diet, and rapid incorporation of intravascularly injected D-(/sup 14/C(U)) glucose, proved blaberosides were endogenous constituents of the roaches. Based on infrared spectrometry, and specific thin layer chromatography detection reagents, blaberoside did not contain nitrogen, sulfur, phosphorus or carbonyl groups. Laser desorption, plasma desorption and fast atom bombardment mass spectrometry indicated blaberosides consisted of two homologs with masses of 975 and 949 amu.

  13. Pheromones of cockroaches

    NARCIS (Netherlands)

    Persoons, C.J.; Ritter, F.J.

    1979-01-01

    The article presents a review of the bíological significance and the chemistry of several pheromones of cockroaches. The data given are in part based on our own work, and in part taken from the literature.

  14. Aspiration of a cockroach

    Directory of Open Access Journals (Sweden)

    Albert Bousso

    2008-12-01

    Full Text Available It is described a five-month-old infant admitted to our pediatricintensive care unit who aspirated a cockroach. The cockroach wasremoved through bronchoscopy. The child arrived at the emergencyroom in cardiopulmonary arrest and despite full respiratory andcardiovascular support was discharged with evidence of severeneurological sequelae. It is known that this is the first case of acockroach aspiration in a five-month-old infant and reinforces thataspiration of an insect must be considered a possibility in patientswith an unidentified organic foreign body aspiration.

  15. Synergism of cockroach ( Periplaneta americana )

    African Journals Online (AJOL)

    Cockroach Periplaneta Americana α-amylase hydrolysed starch to maltose and maltodextrin. However, this enzyme was not active against maltose and maltotriose (2 h of reaction). α-Glucosidase of the same organism exhibited activities toward maltose and maltodextrin to glucose. Synergism was observed especially ...

  16. Cockroach hypersensitivity in asthmatics in Lagos, Nigeria | Adanijo ...

    African Journals Online (AJOL)

    Background: Cockroach allergy occurs frequently in asthmatics in urban areas, where the level of cockroach infestation is usually high. The prevalence of cockroach allergy, as well as the effect of associated factors on cockroach sensitisation in Nigeria is largely unknown. Objective: To determine the prevalence of ...

  17. The epidemiological implications of cockroaches ( Periplaneta ...

    African Journals Online (AJOL)

    The epidemiological implications of cockroaches ( Periplaneta americana ) in the dissemination of human diseases in Owerri, south-east, Nigeria. ... Overall, 14 parasites were recovered which included helminthes, protozoa and acanthocephalans. One hundred and thirty (65.0%) of 200 cockroaches examined were ...

  18. Herbivorous Insects Diversity at Miscanthus × Giganteus in Ukraine

    Directory of Open Access Journals (Sweden)

    Stefanovska Tatyana

    2017-05-01

    Full Text Available Miscanthus × giganteus is considered as a perspective energy crop for biomass production in Ukraine where its commercial production has been observed. The herbivorous pest may pose a risk of yield reduction when an energy crop is growing on monoculture. The herbivorous diversity, species composition and potential damage associated with growing M. × giganteus were studied on seven experimental sites at three locations in Ukraine. The different life stages of herbivorous insects from seven orders representing thirteen families were found on M. × giganteus during the herbivorous survey and most of the insects had a pest status. Research indicated that crop was an alternate host for key cereal pest the Hessian fly Mayetiola destructor (Say (Diptera: Cecidomyiidae. A comparative analysis of the biodiversity of herbivorous insects across research locations was done using statistical analysis. It was found that site location played a significant role in the level of biodiversity and an increase in the insect’s herbivores diversity was associated with the type of researched lands. The massive scale commercial use of M. × giganteus should take into account a responsible consideration of the benefits and risks associated with that crop in order to protect agroecosystems.

  19. REGIONAL EVALUATION OF BACTERIAL CONTAMINATION IN HOSPITAL ENVIRONMENT COCKROACHES

    Directory of Open Access Journals (Sweden)

    A. Vahabi, J. Rafinejad, P. Mohammadi, F. Biglarian

    2007-01-01

    Full Text Available Cockroaches play an important role in transmission of different diseases either mechanically and occasionally biologically. The aim of current study was on the identification of cockroaches and their contamination to different bacteria in two hospitals affiliated to the Kordestan University of Medical Sciences which was performed in 2003. Cockroaches were collected from different parts using sticky traps, direct collection, and by means of vacuum cleaner. Collected cockroaches were identified according to the reliable systematic keys. Some of the collected cockroaches were selected randomly for the presence of bacteria in their external parts as well as in the digestive tract using specific culture media. Totally 450 specimens were collected. From which 44.4% identified as American Cockroach, Periplaneta Americana and remaining German cockroach, Blattella germanica. Among collected cockroaches 58 specimens of German cockroaches and 40 American cockroaches were selected to search for the presence of bacteria. Results of culture media exhibited that 89.8% (88.98 of cockroaches were positive to the bacteria. The bacteria were found mainly on external parts (67% and remaining from alimentary canal. The main common bacteria was found Escherichia coli, however, only 5.1% was Escherichia sp., which was found on external parts. Among two hospitals it is found that Tohid hospital was more infected (97.5%. In the hospitals the infectivity of American cockroaches was more prevalent than other species. All the American cockroaches and 70% of German cockroaches were infected to at least one bacterium. Result showed that the presence of cockroaches in the hospitals can threaten the health of hospitalized patients. Both cosmopolitan species was found infected in the hospitals. Sanitation of different departments as well as different method of control is recommended in the context of Integrated Vector Management for cockroach control.

  20. Classical Olfactory Conditioning in the Cockroach Periplaneta americana(Neurobiology)

    OpenAIRE

    Hidehiro, Watanabe; Yuko, Kobayashi; Midori, Sakura; Yukihisa, Matsumoto; Makoto, Mizunami; Graduate School of Life Sciences, Tohoku University; Research Institute for Electronic Science, Hokkaido University; Research Institute for Electronic Science, Hokkaido University; Graduate School of Life Sciences, Tohoku University:Research Institute for Electronic Science, Hokkaido University; Graduate School of Life Sciences, Tohoku University:Research Institute for Electronic Science, Hokkaido University

    2003-01-01

    We established a classical conditioning procedure for the cockroach, Periplaneta americana, by which odors were associated with reward or punishment. Cockroaches underwent differential conditioning trials in which peppermint odor was associated with sucrose solution and vanilla odor was associated with saline solution. Odor preference of cockroaches was tested by allowing them to choose between peppermint and vanilla sources. Cockroaches that had undergone one set of differential conditioning...

  1. Cockroaches probably cleaned up after dinosaurs.

    Directory of Open Access Journals (Sweden)

    Peter Vršanský

    Full Text Available Dinosaurs undoubtedly produced huge quantities of excrements. But who cleaned up after them? Dung beetles and flies with rapid development were rare during most of the Mesozoic. Candidates for these duties are extinct cockroaches (Blattulidae, whose temporal range is associated with herbivorous dinosaurs. An opportunity to test this hypothesis arises from coprolites to some extent extruded from an immature cockroach preserved in the amber of Lebanon, studied using synchrotron X-ray microtomography. 1.06% of their volume is filled by particles of wood with smooth edges, in which size distribution directly supports their external pre-digestion. Because fungal pre-processing can be excluded based on the presence of large particles (combined with small total amount of wood and absence of damages on wood, the likely source of wood are herbivore feces. Smaller particles were broken down biochemically in the cockroach hind gut, which indicates that the recent lignin-decomposing termite and cockroach endosymbionts might have been transferred to the cockroach gut upon feeding on dinosaur feces.

  2. Cockroaches probably cleaned up after dinosaurs.

    Science.gov (United States)

    Vršanský, Peter; van de Kamp, Thomas; Azar, Dany; Prokin, Alexander; Vidlička, L'ubomír; Vagovič, Patrik

    2013-01-01

    Dinosaurs undoubtedly produced huge quantities of excrements. But who cleaned up after them? Dung beetles and flies with rapid development were rare during most of the Mesozoic. Candidates for these duties are extinct cockroaches (Blattulidae), whose temporal range is associated with herbivorous dinosaurs. An opportunity to test this hypothesis arises from coprolites to some extent extruded from an immature cockroach preserved in the amber of Lebanon, studied using synchrotron X-ray microtomography. 1.06% of their volume is filled by particles of wood with smooth edges, in which size distribution directly supports their external pre-digestion. Because fungal pre-processing can be excluded based on the presence of large particles (combined with small total amount of wood) and absence of damages on wood, the likely source of wood are herbivore feces. Smaller particles were broken down biochemically in the cockroach hind gut, which indicates that the recent lignin-decomposing termite and cockroach endosymbionts might have been transferred to the cockroach gut upon feeding on dinosaur feces.

  3. Mechanical properties of the cuticles of three cockroach species that differ in their wind-evoked escape behavior

    Directory of Open Access Journals (Sweden)

    Andrew J. Clark

    2014-07-01

    Full Text Available The structural and material properties of insect cuticle remain largely unexplored, even though they comprise the majority (approximately 80% of animals. Insect cuticle serves many functions, including protection against predatory attacks, which is especially beneficial to species failing to employ effective running escape responses. Despite recent advances in our understanding of insect escape behaviors and the biomechanics of insect cuticle, there are limited studies on the protective qualities of cuticle to extreme mechanical stresses and strains imposed by predatory attacks, and how these qualities vary between species employing different escape responses. Blattarians (cockroaches provide an appropriate model system for such studies. Wind-evoked running escape responses are strong in Periplaneta americana, weak in Blaberus craniifer and absent in Gromphodorhina portentosa, putting the latter two species at greater risk of being struck by a predator. We hypothesized that the exoskeletons in these two larger species could provide more protection from predatory strikes relative to the exoskeleton of P. americana. We quantified the protective qualities of the exoskeletons by measuring the puncture resistance, tensile strength, strain energy storage, and peak strain in fresh samples of thoracic and abdominal cuticles from these three species. We found a continuum in puncture resistance, tensile strength, and strain energy storage between the three species, which were greatest in G. portentosa, moderate in B. craniifer, and smallest in P. americana. Histological measurements of total cuticle thickness followed this same pattern. However, peak strain followed a different trend between species. The comparisons in the material properties drawn between the cuticles of G. portentosa, B. craniifer, and P. americana demonstrate parallels between cuticular biomechanics and predator running escape responses.

  4. The shadow response of the cockroach periplaneta americana.

    Science.gov (United States)

    Meyer, D J; Margiotta, J F; Walcott, B

    1981-01-01

    We show that the "escape response" (running) of the cockroach Periplaneta americana is interrupted when the insect runs through a shadow. Shadows were cast by holding an opaque plastic sheet so that the cockroach ran beneath it. In control experiments, a similarly positioned clear plastic sheet was ineffective. Removal of the shadow stimulus allowed running to continue. The likelihood that cockroaches would resume running after removal of the shadow stimulus decreased with the time they were allowed to remain in shadow.

  5. Chronic phalaris toxicity in eastern grey kangaroos (Macropus giganteus).

    Science.gov (United States)

    Bacci, B; Whiteley, P L; Barrow, M; Phillips, P H; Dalziel, J; El-Hage, C M

    2014-12-01

    Seven eastern grey kangaroos (Macropus giganteus) grazing pastures including Phalaris spp. in Victoria showed neurological deficits characterised by ataxia, head tremors and collapse. Gross examination of the brains and spinal cords of affected kangaroos showed a greenish discolouration in several regions of the grey matter. Histologically, intracytoplasmic accumulation of pigment granules was detected in the neurons, most prominently in the thalamus, brainstem and ventral horns of the spinal cord. Pigment granules were positive to stains used for identification of melanin, including Fontana-Masson stain and Schmorl's reaction. The combination of clinical signs and obvious neuronal pigmentation is consistent with chronic Phalaris spp. toxicity, a condition well documented in domestic ruminants. © 2014 Australian Veterinary Association.

  6. Description and Codification of Miscanthus × giganteus Growth Stages for Phenological Assessment

    Directory of Open Access Journals (Sweden)

    Mauricio D. Tejera

    2017-10-01

    Full Text Available Triploid Miscanthus × giganteus (Greef et Deu. ex Hodkinson et Renvoize is a sterile, perennial grass used for biomass production in temperate environments. While M. × giganteus has been intensively researched, a scale standardizing description of M. × giganteus morphological stages has not been developed. Here we provide such a scale by adapting the widely-used Biologische Bundesanstalt, Bundessortenamt, CHemische Industrie (BBCH scale and its corresponding numerical code to describe stages of morphological development in M. × giganteus using observations of the “Freedom” and “Illinois” clone in Iowa, USA. Descriptive keys with images are also presented. Because M. × giganteus plants overlap in the field, the scale was first applied to individual stems and then scaled up to assess plants or communities. Of the 10 principal growth stages in the BBCH system, eight were observed in M. × giganteus. Each principal stage was subdivided into secondary stages to enable a detailed description of developmental progression. While M. × giganteus does not have seed development stages, descriptions of those stages are provided to extend the scale to other Miscanthus genotypes. We present methods to use morphological development data to assess phenology by calculating the onset, duration, and abundance of each developmental stage. This scale has potential to harmonize previously described study-specific scales and standardize results across studies. Use of the precise staging presented here should more tightly constrain estimates of developmental parameters in crop models and increase the efficacy of timing-sensitive crop management practices like pest control and harvest.

  7. Olfactory Receptor Response to the Cockroach Sexual Attractant.

    Science.gov (United States)

    Boeckh, J; Priesner, E; Schneider, D; Jacobson, M

    1963-08-23

    The recently isolated sex attractant of the female American cockroach elicits an electical response in the antennae of males, females, and mymphs of this species. These electroantennograms are known to be summated receptor (generator) potentials of many olfactory sensillae stimulated simultaneously. Many other odorous substances also elicit such responses in the cockroach antenna.

  8. Vectorial Potential of Cockroaches in Transmitting Parasites of ...

    African Journals Online (AJOL)

    A study was conducted to determine the role of cockroaches as potential carriers of parasites of medical importance in Arkilla Federal Low Cost, Sokoto, Nigeria from October 2011 to February 2012. A total of 218 cockroaches, comprising of two species were collected from different locations using sweep net and examined ...

  9. Mite and cockroach sensitisation in patients with allergic rhinitis in ...

    African Journals Online (AJOL)

    No studies have been conducted on sensitisation to the other storage mites, spider mites or cockroaches. We aimed to determine the prevalence of sensitisation to various housedust mites, storage mites, spider mites and cockroaches in patients with allergic rhinitis living in the Free State. Methods. Fifty consecutive patients ...

  10. Vectorial Potential of Cockroaches in Transmitting Parasites of ...

    African Journals Online (AJOL)

    Cockroaches are abundant in most homes in Nigeria, where they are actually called. “landlords” in homes. Cockroaches are among the most notorious pests of premises, they frequently feed on human faeces, and therefore they can disseminate cysts of enteric protozoans in the environment if such faeces are contaminated ...

  11. The Role of Cockroaches ( Blatta Orientalis and Periplaneta ...

    African Journals Online (AJOL)

    A study was carried out on the parasitic profile of cockroaches caught in various sections of many houses in Owerri. A total of 340 cockroaches trapped from different sites (toilet, kitchen, store room and living room) were examined using standard parasitological techniques which included washing and examination of the ...

  12. Multiple-antibiotic-resistant bacteria from cockroaches trapped from ...

    African Journals Online (AJOL)

    The ability of cockroaches, found in and around hospital settings, to harbour multiple- antibioticresistant bacteria poses serious health implications. This study investigated and compared multiple-antibioticresistant bacteria carried by cockroaches from a hospital environment. Antibiotic susceptibility patterns of isolated ...

  13. Active antennal movement in cockroaches - towards understanding multimodal exploration

    DEFF Research Database (Denmark)

    Pequeno-Zurro, Alejandro; Nitschke, Jahn; Szyszka, Paul

    The long and highly mobile cockroach antennae are multifunctional sensory appendages incorporating two of the most fundamental senses – olfaction and touch. Previous laboratory experiments with cockroaches in unisensory tasks have demonstrated the animal’s ability to perform antenna-dependent tasks...

  14. Agronomic Experiences with Miscanthus x giganteus in Illinois, USA

    Science.gov (United States)

    Pyter, Richard; Heaton, Emily; Dohleman, Frank; Voigt, Tom; Long, Stephen

    Since 2002, researchers at the University of Illinois, Urbana-Champaign, Illinois, have been studying the perennial warm-season grass Miscanthus × giganteus (M. × g.) to determine its potential as a biomass feedstock. M. × g. originated in Japan and is a hybrid believed to have M. sinensis and M. sacchariflorus as its parents. Until recently, it was used as a landscape plant in the United States, but it is now the subject of research interest because of its potentially great biomass production. In central Illinois, M. × g. begins growth in April, typically reaches 2 m by the end of May, and is normally greater than 3 m by the end of September. The grass is sterile and propagated asexually using plantlets produced in tissue culture or by rhizome divisions. Following field planting, it generally takes at least three growing seasons to become fully established and reach optimal biomass production. In central Illinois, the senesced stems are harvested from early December through early March and can potentially be treated to produce ligno-cellulosic ethanol. In University of Illinois, research started in 2002. M. × g. produced an annual average of 22.0 t/ha in northern Illinois, 34.7 t/ha in central Illinois, and 35.4 t/ha in southern Illinois per year in 2004, 2005, and 2006.

  15. Cockroaches (Blattaria) of Ecuador-checklist and history of research.

    Science.gov (United States)

    Vidlička, Lubomír

    2013-01-09

    Cockroaches are an understudied group and the total number of described taxa increases every year. The last checklist of Ecuador species was published in 1926. The main aim of this study was to complete a new checklist of cockroach species recorded in Ecuador supplemented with a research history of cockroaches (Blattaria) on the territory of continental Ecuador. In addition, the checklist contains comments on Ecuadorian faunistic records, including the Galápagos Islands. A total of 114 species (105 in continental Ecuador and 18 in Galápagos Islands) belonging to 6 families and 44 genera are listed. Forty species (38.1 %) occur solely in continental Ecuador and five (27.8 %) are endemic on Galápagos Islands. The results indicate that further research on the cockroach fauna of Ecuador as well as determination of museum collections from this territory is needed.

  16. On triatomines, cockroaches and haemolymphagy under laboratory conditions: new discoveries

    Directory of Open Access Journals (Sweden)

    Pamela Durán

    Full Text Available For a long time, haematophagy was considered an obligate condition for triatomines (Hemiptera: Reduviidae to complete their life cycle. Today, the ability to use haemolymphagy is suggested to represent an important survival strategy for some species, especially those in genus Belminus. As Eratyrus mucronatus and Triatoma boliviana are found with cockroaches in the Blaberinae subfamily in Bolivia, their developmental cycle from egg to adult under a “cockroach diet” was studied. The results suggested that having only cockroach haemolymph as a food source compromised development cycle completion in both species. Compared to a “mouse diet”, the cockroach diet increased: (i the mortality at each nymphal instar; (ii the number of feedings needed to molt; (iii the volume of the maximum food intake; and (iv the time needed to molt. In conclusion, haemolymph could effectively support survival in the field in both species. Nevertheless, under laboratory conditions, the use of haemolymphagy as a survival strategy in the first developmental stages of these species was not supported, as their mortality was very high. Finally, when Triatoma infestans, Rhodnius stali and Panstrongylus rufotuberculatus species were reared on a cockroach diet under similar conditions, all died rather than feeding on cockroaches. These results are discussed in the context of the ecology of each species.

  17. Classical olfactory conditioning in the cockroach Periplaneta americana.

    Science.gov (United States)

    Watanabe, Hidehiro; Kobayashi, Yuko; Sakura, Midori; Matsumoto, Yukihisa; Mizunami, Makoto

    2003-12-01

    We established a classical conditioning procedure for the cockroach, Periplaneta americana, by which odors were associated with reward or punishment. Cockroaches underwent differential conditioning trials in which peppermint odor was associated with sucrose solution and vanilla odor was associated with saline solution. Odor preference of cockroaches was tested by allowing them to choose between peppermint and vanilla sources. Cockroaches that had undergone one set of differential conditioning trials exhibited a significantly greater preference for peppermint odor than did untrained cockroaches. Memory formed by three sets of differential conditioning trials, with an inter-trial interval of 5 min, was retained at least 4 days after conditioning. This conditioning procedure was effective even for cockroaches that had been harnessed in plastic tubes. This study shows, for the first time in hemimetaborous insects, that both freely moving and harnessed insects are capable of forming olfactory memory by classical conditioning procedure. This procedure may be useful for future electrophysiological and pharmacological studies aimed at elucidation of neural mechanisms underlying olfactory learning and memory.

  18. Physiological and growth responses to water deficit in the bioenergy crop Miscanthus x giganteus.

    Directory of Open Access Journals (Sweden)

    Jennifer eIngs

    2013-11-01

    Full Text Available High yielding perennial biomass crops of the species Miscanthus are widely recognized as one of the most promising lignocellulosic feedstocks for the production of bioenergy and bioproducts. Miscanthus is a C4 grass and thus has relatively high water use efficiency. Cultivated Miscanthus comprises primarily of a single clone, Miscanthus x giganteus, a sterile hybrid between M. sacchariflorus and M. sinensis. M. x giganteus is high yielding and expresses desirable combinations of many traits present in the two parental species types; however, it responds poorly to low water availability. To identify the physiological basis of the response to water stress in M. x giganteus and to identify potential targets for breeding improvements we characterised the physiological responses to water-deficit stress in a pot experiment. The experiment has provided valuable insights into the temporal aspects of drought-induced responses of M. x giganteus. Withholding water resulted in marked changes in plant physiology with growth-associated traits among the first affected, the most rapid response being a decline in the rate of stem elongation. A reduction in photosynthetic performance was among the second set of changes observed; indicated by a decrease in stomatal conductance followed by decreases in chlorophyll fluorescence and chlorophyll content. Measures reflecting the plant water status were among the last affected by the drought treatment. Metabolite analysis indicated that proline was a drought stress marker in M. x giganteus, metabolites in the proline synthesis pathway were more abundant when stomatal conductance decreased and dry weight accumulation ceased. The outcomes of this study in terms of drought-induced physiological changes, accompanied by a proof-of-concept metabolomics investigation, provide a platform for identifying targets for improved drought-tolerance of the Miscanthus bioenergy crop.

  19. Life style of people and surveillance of management related to cockroaches in Southern Punjab, Pakistan

    OpenAIRE

    NAEEM, Afifa; JALEEL, Waqar; SAEED, Qamar; ZAKA, Syed Muhammad; SAEED, Shafqat; NAQQASH, Muhammad Nadir; BAKHTAWAR, Marryam; AYUB, Waleed Bin

    2014-01-01

    Cockroaches are the major household pests which prefer humid areas for habitation i.e. bathrooms, kitchens, sewerage systems etc., where warmth, moisture and food are satisfactory. Cockroaches are responsible for transmitting microorganisms like pathogenic bacteria, virus and fungi. Some examples of common bacterial diseases of human beings transmitted by cockroaches are Pasteurellapestisand bubonic plague; Shigellaalkalescensand dysentery; Staphylococcus aureusand boils and abscesses; Shigel...

  20. Gut bacteria mediate aggregation in the German cockroach

    Science.gov (United States)

    Wada-Katsumata, Ayako; Zurek, Ludek; Nalyanya, Godfrey; Roelofs, Wendell L.; Zhang, Aijun; Schal, Coby

    2015-01-01

    Aggregation of the German cockroach, Blattella germanica, is regulated by fecal aggregation agents (pheromones), including volatile carboxylic acids (VCAs). We demonstrate that the gut microbial community contributes to production of these semiochemicals. Chemical analysis of the fecal extract of B. germanica revealed 40 VCAs. Feces from axenic cockroaches (no microorganisms in the alimentary tract) lacked 12 major fecal VCAs, and 24 of the remaining compounds were represented at extremely low amounts. Olfactory and aggregation bioassays demonstrated that nymphs strongly preferred the extract of control feces over the fecal extract of axenic cockroaches. Additionally, nymphs preferred a synthetic blend of 6 fecal VCAs over a solvent control or a previously identified VCA blend. To test whether gut bacteria contribute to the production of fecal aggregation agents, fecal aerobic bacteria were cultured, isolated, and identified. Inoculation of axenic cockroaches with individual bacterial taxa significantly rescued the aggregation response to the fecal extract, and inoculation with a mix of six bacterial isolates was more effective than with single isolates. The results indicate that the commensal gut microbiota contributes to production of VCAs that act as fecal aggregation agents and that cockroaches discriminate among the complex odors that emanate from a diverse microbial community. Our results highlight the pivotal role of gut bacteria in mediating insect–insect communication. Moreover, because the gut microbial community reflects the local environment, local plasticity in fecal aggregation pheromones enables colony-specific odors and fidelity to persistent aggregation sites. PMID:26644557

  1. Biomass valorisation of Arundo donax L., Miscanthus × giganteus and Sida hermaphrodita for biofuel production

    Science.gov (United States)

    Krička, Tajana; Matin, Ana; Bilandžija, Nikola; Jurišić, Vanja; Antonović, Alan; Voća, Neven; Grubor, Mateja

    2017-10-01

    In the context of the growing demand for biomass, which is being encouraged by the EU directives on the promotion of the use of renewable energy, recent investigations have been increasingly focused on fast-growing energy crops. The aim of this study was to investigate the energy properties of three types of agricultural energy crops: Arundo donax L., Miscanthus × giganteus and Sida hermaphrodita. This investigation looked into the content of non-combustible and combustible matter, higher and lower heating values, lignocellulose content, and biomass macro-elements. The results indicate that the energy values of these crops are comparable, while their lignocellulose content shows significant variations. Thus, Arundo donax L. can best be utilised as solid biofuel due to its highest lignin content, while Miscanthus × giganteus and Sida hermaphrodita L. can be used for both liquid and solid biofuels production. As far as Arundo donax L. is concerned, a higher ash level should be taken into consideration.

  2. Aided phytostabilization using Miscanthus sinensis × giganteus on heavy metal-contaminated soils.

    Science.gov (United States)

    Pavel, Petronela-Bianca; Puschenreiter, Markus; Wenzel, Walter W; Diacu, Elena; Barbu, Constantin Horia

    2014-05-01

    A field experiment was carried out to evaluate the use of red mud, a by-product of the alumina industry, as a soil amendment on highly contaminated soils in the vicinity of a former Pb-Zn smelter in Copșa Mică (Romania). Changes in the distribution of Zn, Cd and Pb in various soil fractions, mobility of heavy metals in the soil, and their uptake and effects on growth and productivity of Miscanthus sinensis × giganteus were evaluated. Uptake of Zn, Cd and Pb was determined in different tissues of M. sinensis × giganteus cultivated in field plots situated at increasing distance from the pollution source and with different levels of contamination and metal availabilities. Soluble metal concentrations were determined in centrifugates, whereas potentially soluble fractions were analyzed by diffusive gradients in thin films. In terms of the biomass productivity there were significant differences among the plants obtained in plots with different characteristics and pollution levels. Bioconcentration factors were much lower than 1, indicating that M. sinensis × giganteus is an excluder of heavy metals, especially Pb. Amending soils with red mud reduced the exchangeable or phytoavailable fractions of Zn, Cd and Pb. Overall the results suggest that M. sinensis × giganteus is a valuable energy plant and can be successfully grown on heavily contaminated soils with Zn, Cd and Pb. Moreover, the addition of red mud to these soils can lead to a significant decrease in the concentration of heavy metals in the soil and in metal uptake by plant tissues. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Toxoplasmosis and genotyping of Toxoplasma gondii in Macropus rufus and Macropus giganteus in Argentina.

    Science.gov (United States)

    Moré, G; Pardini, L; Basso, W; Machuca, M; Bacigalupe, D; Villanueva, M C; Schares, G; Venturini, M C; Venturini, L

    2010-04-19

    Toxoplasma gondii infection is frequently asymptomatic; however, it can be severe or even fatal to some hosts. In this study, diagnosis of disseminated toxoplasmosis in one red kangaroo (Macropus rufus) and one great grey kangaroo (Macropus giganteus) from the La Plata Zoo, Argentina and the isolation and molecular characterization of T. gondii are reported. Both male kangaroos showed depression and sudden death. Toxoplasma gondii infection was diagnosed by fresh examination, histopathology, immunohistochemistry, PCR and bioassay in mice. During fresh examination many protozoan cysts were observed in diaphragm, heart and hind limb muscles of M. rufus. Cysts were also observed in samples from M. giganteus, although in lower number. Cysts from both kangaroos stained strongly with T. gondii anti-serum by immunohistochemistry. The M. rufus showed more considerable histopathological lesions like non-suppurative meningoencephalitis, myositis and myocarditis. All mice inoculated with tissues from both kangaroos developed IFAT titers to T. gondii (titer >or=800) and brain cysts at necropsy. Both T. gondii isolates were maintained by mice passages and the M. rufus isolate was also maintained in cell culture. Toxoplasma gondii DNA from tissue samples was analyzed by PCR-RFLP analysis using the markers 5'SAG2, 3'SAG2, BTUB, GRA6, SAG3, c22-8, L358, PK1, c29-2 and Apico. Genotyping revealed that the T. gondii isolate from M. rufus was clonal type III and the isolate from M. giganteus was clonal type II. This is the first report of disseminated toxoplasmosis in M. rufus and M. giganteus in Argentina caused by genotypes of T. gondii considered non-virulent in a mouse model.

  4. Food-borne human parasitic pathogens associated with household cockroaches and houseflies in Nigeria

    Directory of Open Access Journals (Sweden)

    Oyetunde T. Oyeyemi

    2016-03-01

    Full Text Available Cockroaches and houseflies pose significant public health threat owning to their ability to mechanically transmit human intestinal parasites and other disease-causing microorganisms. This study aims at assessing the vectoral capacity of cockroaches and houseflies in the transmission of human intestinal parasites. Intestinal parasite external surface contamination of 130 cockroaches and 150 houseflies caught within dwelling places in Ilishan-Remo town, Ogun State, Nigeria was determined. Cockroaches (six parasite species were more contaminated than houseflies (four parasite species. The most prevalent parasites were Trichuris trichiura (74.0% and hookworm (63.0% in houseflies and cockroaches respectively. There were significant differences in the prevalence of hookworm, T. trichiura and Taenia spp. isolated from cockroaches and houseflies (P < 0.05. There is high contamination of human intestinal parasites in cockroaches and houseflies in human dwelling places in the study area, thus they have the ability to transmit these parasites to unkempt food materials.

  5. There are more asthmatics in homes with high cockroach infestation

    Directory of Open Access Journals (Sweden)

    Sarinho E.

    2004-01-01

    Full Text Available Although asthma has been commonly associated with sensitivity to cockroaches, a clear causal relationship between asthma, allergy to cockroaches and exposure levels has not been extensively investigated. The objective of the present study was to determine whether asthma occurs more frequently in children living in homes with high cockroach infestation. The intensity of household infestation was assessed by the number of dead insects after professional pesticide application. Children living in these houses in the metropolitan area of Recife, PE, were diagnosed as having asthma by means of a questionnaire based on the ISAAC study. All children had physician-diagnosed asthma and at least one acute exacerbation in the past year. Children of both sexes aged 4 to 12 years who had been living in the households for more than 2 years participated in this transverse study and had a good socioeconomic status. In the 172 houses studied, 79 children were considered to have been exposed to cockroaches and 93 not to have been exposed. Children living in residences with more than 5 dead cockroaches after pesticide application were considered to be at high infestation exposure. Asthma was diagnosed by the questionnaire in 31.6% (25/79 of the exposed group and in 11.8% (11/93 of the non-exposed group (P = 0.001, with a prevalence ratio of 3.45 (95%CI, 1.48-8.20. The present results indicate that exposure to cockroaches was significantly associated with asthma among the children studied and can be considered a risk factor for the disease. Blattella germanica and Periplaneta americana were the species found in 96% of the infested houses.

  6. Life history and habitat associations of the broad wood cockroach, Parcoblatta lata (Blattaria: Blattellidae) and other native cockroaches in the Coastal Plain of South Carolina.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Scott; Hanula, James, L.

    2002-06-18

    Wood cockroaches are an important prey of the red-cockaded woodpecker, Picoides borealis, an endangered species inhabiting pine forests in the southern United States. These woodpeckers forage on the boles of live pine trees, but their prey consists of a high proportion of wood cockroaches, Parcoblatta spp., that are more commonly associated with dead plant material. Cockroach population density samples were conducted on live pine trees, dead snags and coarse woody debris on the ground. The studies showed that snags and logs are also important habitats of wood cockroaches in pine forests.

  7. Comparison of cockroach fungal contamination in the clinical and non-clinical environments from Iran

    Directory of Open Access Journals (Sweden)

    B. Davari

    2017-09-01

    Full Text Available Cockroaches have been associated with human environments threatening human health. A cross-sectional study about cockroach fungal contamination in the hospital, restaurant and household environments from Khorramabad, Lorestan province of Iran between August 2015 and March 2016 was done. Sampling was uniformly carried out monthly from the randomly selected sites. Fungi were isolated from the external surfaces of cockroaches using standard method. Periplaneta americana (66.7% was found the most infested cockroach, less percentage were observed in Blattella germanica (18.6% and Blatta orientalis (14.7%. Hospitals (66.7% were found the most infested places in comparison with households (18.6% and restaurants (14.7%. Households (64.3% were found the most cockroach fungal contaminated places than hospitals (49.0% and restaurants (59.1%. The highest and the lowest infestation of cockroaches were observed in January (30.0% and March (7.0% respectively, while the highest and the lowest cockroach fungal contamination were observed in November (73.3% and March (14.3%. B. germanica (60.7% was the most fungal contaminated cockroach. Candida, Geotrichum and Penicillium were the most frequent cockroach fungal contaminating genera. Statistical analysis revealed significant differences between cockroach infestation places (P=0.022, locality (P=0.03, and monthly (P=0.0001 cockroach fungal contamination, respectively. As a conclusion, the highest cockroach fungal contamination was observed in B. germanica, followed by P. americana and B. orientalis. Some human fungal opportunistic pathogens were also found among the fungal contaminated cockroaches. Recent epidemiological survey showed that the mortality rates of the infective diseases were increased, indicating cockroaches involved in their transferring.

  8. Contamination of cockroaches (Insecta: Blattaria) to medically fungi: A systematic review and meta-analysis.

    Science.gov (United States)

    Nasirian, H

    2017-12-01

    Fungal infections have emerged worldwide. Cockroaches have been proved vectors of medically fungi. A systematic meta-analysis review about cockroach fungal contamination was investigated. Relevant topics were collected between January 2016 and January 2017. After a preliminary review among 392 collected papers, 156 were selected to become part of the detailed systematic meta-analysis review. Cockroaches contaminated to 38 fungi species belonging to 19 families and 12 orders. About 38, 25 and 13 fungal species were recovered from the American, German and brown-banded cockroaches, respectively with a variety of medical importance. Except the fungi isolated from German and brown-banded cockroaches, 15 species have been isolated only from the American cockroaches. The global world mean and trend of cockroach fungal contamination were 84.1 and 50.6-100%, respectively in the human dwelling environments. There is a significant difference between cockroach fungal contamination in the urban and rural environments (P0.05). The external and internal cockroach fungal contamination is more dangerous than entire surfaces, while the internal is more dangerous than the external surface. The German and brown-banded cockroach fungal contamination are more dangerous than the American cockroaches in the hospital environments. The study indicates that globally cockroach fungal contamination has been increased recognizing as agents of human infections and associating with high morbidity and mortality in immune-compromised patients. These facts, along with insecticide resistance emergence and increasing globally cockroach infestation, reveal importance of cockroaches and need for their control more than ever. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  9. Cockroach (Insecta: Blattaria) infestation of homes in selected ...

    African Journals Online (AJOL)

    The study was therefore undertaken to determine cockroach infestation of homes in some ten selected communities in the Kumasi Metropolitan area in the Ashanti Region of Ghana using sticky traps. Twenty (20) houses in each community were ran-domly selected for the study. A trap was set up in three areas: living room, ...

  10. Nest sanitation through defecation: antifungal properties of wood cockroach feces.

    Science.gov (United States)

    Rosengaus, Rebeca B; Mead, Kerry; Du Comb, William S; Benson, Ryan W; Godoy, Veronica G

    2013-11-01

    The wood cockroach Cryptocercus punctulatus nests as family units inside decayed wood, a substrate known for its high microbial load. We tested the hypothesis that defecation within their nests, a common occurrence in this species, reduces the probability of fungal development. Conidia of the entomopathogenic fungus, Metarhizium anisopliae, were incubated with crushed feces and subsequently plated on potato dextrose agar. Relative to controls, the viability of fungal conidia was significantly reduced following incubation with feces and was negatively correlated with incubation time. Although the cockroach's hindgut contained abundant β-1,3-glucanase activity, its feces had no detectable enzymatic function. Hence, these enzymes are unlikely the source of the fungistasis. Instead, the antifungal compound(s) of the feces involved heat-sensitive factor(s) of potential microbial origin. When feces were boiled or when they were subjected to ultraviolet radiation and subsequently incubated with conidia, viability was "rescued" and germination rates were similar to those of controls. Filtration experiments indicate that the fungistatic activity of feces results from chemical interference. Because Cryptocercidae cockroaches have been considered appropriate models to make inferences about the factors fostering the evolution of termite sociality, we suggest that nesting in microbe-rich environments likely selected for the coupling of intranest defecation and feces fungistasis in the common ancestor of wood cockroaches and termites. This might in turn have served as a preadaptation that prevented mycosis as these phylogenetically related taxa diverged and evolved respectively into subsocial and eusocial organizations.

  11. Binary Cockroach Swarm Optimization for Combinatorial Optimization Problem

    Directory of Open Access Journals (Sweden)

    Ibidun Christiana Obagbuwa

    2016-09-01

    Full Text Available The Cockroach Swarm Optimization (CSO algorithm is inspired by cockroach social behavior. It is a simple and efficient meta-heuristic algorithm and has been applied to solve global optimization problems successfully. The original CSO algorithm and its variants operate mainly in continuous search space and cannot solve binary-coded optimization problems directly. Many optimization problems have their decision variables in binary. Binary Cockroach Swarm Optimization (BCSO is proposed in this paper to tackle such problems and was evaluated on the popular Traveling Salesman Problem (TSP, which is considered to be an NP-hard Combinatorial Optimization Problem (COP. A transfer function was employed to map a continuous search space CSO to binary search space. The performance of the proposed algorithm was tested firstly on benchmark functions through simulation studies and compared with the performance of existing binary particle swarm optimization and continuous space versions of CSO. The proposed BCSO was adapted to TSP and applied to a set of benchmark instances of symmetric TSP from the TSP library. The results of the proposed Binary Cockroach Swarm Optimization (BCSO algorithm on TSP were compared to other meta-heuristic algorithms.

  12. Genetic diversity of Entamoeba: Novel ribosomal lineages from cockroaches.

    Directory of Open Access Journals (Sweden)

    Tetsuro Kawano

    Full Text Available Our current taxonomic perspective on Entamoeba is largely based on small-subunit ribosomal RNA genes (SSU rDNA from Entamoeba species identified in vertebrate hosts with minor exceptions such as E. moshkovskii from sewage water and E. marina from marine sediment. Other Entamoeba species have also been morphologically identified and described from non-vertebrate species such as insects; however, their genetic diversity remains unknown. In order to further disclose the diversity of the genus, we investigated Entamoeba spp. in the intestines of three cockroach species: Periplaneta americana, Blaptica dubia, and Gromphadorhina oblongonota. We obtained 134 Entamoeba SSU rDNA sequences from 186 cockroaches by direct nested PCR using the DNA extracts of intestines from cockroaches, followed by scrutinized BLASTn screening and phylogenetic analyses. All the sequences identified in this study were distinct from those reported from known Entamoeba species, and considered as novel Entamoeba ribosomal lineages. Furthermore, they were positioned at the base of the clade of known Entamoeba species and displayed remarkable degree of genetic diversity comprising nine major groups in the three cockroach species. This is the first report of the diversity of SSU rDNA sequences from Entamoeba in non-vertebrate host species, and should help to understand the genetic diversity of the genus Entamoeba.

  13. Laboratory evaluation of azadirachtin against the oriental cockroach ...

    African Journals Online (AJOL)

    In this work, the toxicity of azadirachtin applied topically at various doses (300, 600, 1200, 2400, 4800 and 9000 ng/ insect) was evaluated against newly emerged adults of the oriental cockroach, Blatta orientalis L. (Dictyoptera, Blattellidae) under laboratory conditions. Results show that treated insects exhibited toxic ...

  14. Natural insect repellents: activitity against mosquitoes and cockroaches

    Science.gov (United States)

    Gretchen Schultz; Chris Peterson; Joel Coats

    2006-01-01

    Recent research has focused on the repellent properties of extracts from the catnip plant (Nepeta cataria) and the Osage orange (Maclura pornifera) fruit. This chapter includes results on German cockroach (Blattella germanica), and house fly (Musca domestics) contact irritancy to catnip...

  15. Parasitic and microbial profile of cockroaches caught in University of ...

    African Journals Online (AJOL)

    A total of 120 cockroaches trapped and collected from different sites of the male and female hostels were examined using standard parasitological and mirobial techniques. Washing and examination of the external surfaces in saline, disection and examination of digestive tracts; culturing the external surface wash and gut ...

  16. Selected food-borne parasites associated with cockroaches and ...

    African Journals Online (AJOL)

    Of these, 20 (62.5%) were protozoa and 12 (37.5%) were helminthes from the houseflies while 19 (54.3%) were protozoa and 16 (45.7%) were helminthes from the cockroaches. The protozoa that were identified include; cysts of Balantidium coli, cysts of Entamoeba coli, Entamoeba Histolytica and Endolimax nana. Also ...

  17. Genetic diversity of Entamoeba: Novel ribosomal lineages from cockroaches

    Science.gov (United States)

    Kawano, Tetsuro; Imada, Mihoko; Chamavit, Pennapa; Kobayashi, Seiki; Hashimoto, Tetsuo

    2017-01-01

    Our current taxonomic perspective on Entamoeba is largely based on small-subunit ribosomal RNA genes (SSU rDNA) from Entamoeba species identified in vertebrate hosts with minor exceptions such as E. moshkovskii from sewage water and E. marina from marine sediment. Other Entamoeba species have also been morphologically identified and described from non-vertebrate species such as insects; however, their genetic diversity remains unknown. In order to further disclose the diversity of the genus, we investigated Entamoeba spp. in the intestines of three cockroach species: Periplaneta americana, Blaptica dubia, and Gromphadorhina oblongonota. We obtained 134 Entamoeba SSU rDNA sequences from 186 cockroaches by direct nested PCR using the DNA extracts of intestines from cockroaches, followed by scrutinized BLASTn screening and phylogenetic analyses. All the sequences identified in this study were distinct from those reported from known Entamoeba species, and considered as novel Entamoeba ribosomal lineages. Furthermore, they were positioned at the base of the clade of known Entamoeba species and displayed remarkable degree of genetic diversity comprising nine major groups in the three cockroach species. This is the first report of the diversity of SSU rDNA sequences from Entamoeba in non-vertebrate host species, and should help to understand the genetic diversity of the genus Entamoeba. PMID:28934335

  18. Species Diversity and Distributional Pattern of Cockroaches in Lahore, Pakistan

    Directory of Open Access Journals (Sweden)

    Hafsa Memona

    2017-06-01

    Full Text Available Background: Cockroaches are found as the most common urban pests of tropical countries, prompting economic and serious health risk problem for humans by carrying microbes and allergens, acting as vector for various patho­gens of diseases. The present study was conducted from April 2013 to March 2014 in various human dwelling local­ities of urban area of district Lahore, Pakistan.Methods: Cockroaches were collected randomly by hand, food baited and sticky traps throughout the year. Four species of cockroaches (Periplaneta Americana (P. amercana, Blattella germanica (B. germanica, Blatta orientalis (B. orientalis, and Blatta lateralis (B. lateralis were collected and identified from the study site.Results: B. germanica was the most dominant indoor species with highest diversity indices in study areas. Overall cockroach species diversity was highest in July–September, 2013 with highest Simpson index of diversity and Shan­non index as well. P. americana was found second broadly distributed in the study area followed by B. orientalis and B. lateralis were intermediately distributed in residential areas and narrowly distributed in hospitals. Residential ar­eas and hospitals were highly infested with B. germanica followed by P. americana. Population index of B. ger­manica for hospitals was double than residential areas. B. lateralis was observed as displacing B. orientalis in out­door habitat through competing with its habitat and food sources.Conclusion: The infestation rate of different species depends on availability of food sources, sanitary conditions and climatic conditions. Cockroach infestation can be controlled with knowledge about their biology and behavior, at­tention to sanitation and effective use of commercial insecticides.

  19. Potential uses of biomass from fast-growing crop miscanthus×giganteus

    Directory of Open Access Journals (Sweden)

    Babović Nada V.

    2012-01-01

    Full Text Available There is an increasing interest in perennial grasses as a renewable source of bioenergy and feedstock for second-generation cellulosic biofuels. Switchgrass (Panicum virgatum and miscanthus (Miscanthus×giganteus, belonging to the parennial grasses group, are the major lignocellulosic materials being studied today as sources for direct energy production, biofuels, bioremediation and other. They have the ability to grow at low cost on marginal land where they will not compete with the traditional food crops. Miscanthus×giganteus possesses a number of advantages in comparison with the other potential energy crops such as are: high yields, low moisture content at harvest, high water and nitrogen use efficiencies, low need for annual agronomic inputs such as fertilizers and pesticides, high cellulose content, non-invasive character, low susceptibility to pests and diseases and broad adaptation to temperate growing environments. The main problems are low rate of survival during the first winter after the creation of plantation and the relatively high establishment costs. Miscanthus×giganteus is grown primarily for heat and electricity generation but can also be used to produce transport fuels. Miscanthus biomass has a very good combustion quality due to its low water concentration as well as its low Cl, K, N, S and ash concentrations compared to other lignocellulose plants. It is expected that miscanthus will provide cheaper and more sustainable source of cellulose for production of bioethanol than annual crops such as corn. Miscanthus has great promise as a renewable energy source, but it can only be realised when the grass production has been optimised for large-scale commercial cultivation. However, further research is still needed to optimise agronomy of miscanthus, to develop the production chain and pre-treatment as well as to optimise energy conversation route to produce heat, electricity, and/or fuels from biomass, if miscanthus is to

  20. CLINICOPATHOLOGIC CORRELATES OF FASCIOLIASIS IN TWO EASTERN GREY KANGAROOS (MACROPUS GIGANTEUS).

    Science.gov (United States)

    Portas, Timothy J; Taylor, David

    2015-12-01

    Infection with the introduced trematode Fasciola hepatica was associated with anemia, mild to moderate azotemia, hypoalbuminemia, and elevated liver enzymes and creatine kinase values in two free-ranging eastern grey kangaroos (Macropus giganteus). Both kangaroos were euthanized because of the severity of clinical signs associated with infection. Histopathologic changes included severe cholangiohepatitis, biliary hyperplasia, and fibrosis. Hepatic, splenic, and intestinal amyloidosis was present in one kangaroo and hepatic abscessation in the other; neither histologic change has been reported in macropodids with fascioliasis previously.

  1. Composition of root exudates of Miscanthus × Giganteus Greef et Deu

    Directory of Open Access Journals (Sweden)

    Ladislav Hromádko

    2010-01-01

    Full Text Available Rate of root exudation and identification of selected compounds in root exudates of Miscanthus × Giganteus in the autumnal period of growth was performed. Total organic carbon of root exudates was formed from 7.8 % by carbohydrates and from 1.5 % by proteins. Aspartic acid, arginine, alanine and glutamic acid were exuded with the highest rate of all amino acids. This work brings new basic know­led­ge which can be used for phytoremediations.

  2. Food-borne human parasitic pathogens associated with household cockroaches and houseflies in Nigeria

    OpenAIRE

    Oyeyemi, Oyetunde T.; Agbaje, Mariam O.; Okelue, Uchechi B.

    2016-01-01

    Cockroaches and houseflies pose significant public health threat owning to their ability to mechanically transmit human intestinal parasites and other disease-causing microorganisms. This study aims at assessing the vectoral capacity of cockroaches and houseflies in the transmission of human intestinal parasites. Intestinal parasite external surface contamination of 130 cockroaches and 150 houseflies caught within dwelling places in Ilishan-Remo town, Ogun State, Nigeria was determined. Cockr...

  3. Separation of peroxidases from Miscanthus x giganteus, their partial characterisation and application for degradation of dyes.

    Science.gov (United States)

    Dragana, Robajac; Nikola, Gligorijević; Željko, Dželetović; Gordana, Andrejić; Olgica, Nedić

    2017-11-01

    Due to wide applicative potential of peroxidases (POXs), the search for novel sources and forms, possibly with better characteristics and performances, is justified. In this study, POXs from Miscanthus x giganteus rhizomes grown in chernozem-like soil and mine tailings were examined. Higher activity of POXs in samples originating from the metal-contaminated soil was found. The quantity of acidic isoforms was much greater than basic. The rates of reactions catalysed by acidic POX isoforms decreased slightly at 50 °C, whereas stability of basic isoforms was affected at 40 °C. Concentrations of Zn, Mn and Fe were higher in rhizomes grown in mine tailings, and negatively correlated with the concentration of proteins. Basic POX isoforms effectively degraded CBB R250, while Amidoblack 10b was predominantly degraded by acidic isoforms. Thus, Miscanthus x giganteus can be used as a source of POXs which can be applied for dye decomposition and, possibly, waste water management. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  4. Octopaminergic agonists for the cockroach neuronal octopamine receptor

    Directory of Open Access Journals (Sweden)

    Akinori Hirashima

    2003-04-01

    Full Text Available The compounds 1-(2,6-diethylphenylimidazolidine-2-thione and 2-(2,6-diethylphenylimidazolidine showed the almost same activity as octopamine in stimulating adenylate cyclase of cockroach thoracic nervous system among 70 octopamine agonists, suggesting that only these compounds are full octopamine agonists and other compounds are partial octopamine agonists. The quantitative structure-activity relationship of a set of 22 octopamine agonists against receptor 2 in cockroach nervous tissue, was analyzed using receptor surface modeling. Three-dimensional energetics descriptors were calculated from receptor surface model/ligand interaction and these three-dimensional descriptors were used in quantitative structure-activity relationship analysis. A receptor surface model was generated using some subset of the most active structures and the results provided useful information in the characterization and differentiation of octopaminergic receptor.

  5. Cockroach allatostatin-immunoreactive neurons and effects of cockroach allatostatin in earwigs.

    Science.gov (United States)

    Rankin, S M; Stay, B; Chan, K; Jackson, E S

    1998-01-01

    A monoclonal antibody to allatostatin I of the cockroach Diploptera punctata was used to demonstrate the presence of allatostatin-immunoreactive cells and fiber tracts in the neuroendocrine system of the earwig Euborellia annulipes. The corpora cardiaca cells were not immunoreactive, nor were the neurosecretory endings of fiber tracts from the brain to the corpora cardiaca. No immunoreactive material was detected in the corpus allatum, although the corpus allatum contained neurosecretory endings, and some cells of the brain, including medial and lateral protocerebral cells, showed immunoreactivity. In addition, the recurrent and esophageal nerves were allatostatin-positive. The last abdominal ganglion contained immunoreactive somata, and immunoreactive axons of the proctodeal nerve innervated the rectum, anterior intestine, and posterior midgut. We did not detect reactive endocrine cells in the midgut. Allatostatin I at concentrations of 10(-5) and 10(-7) M did not inhibit juvenile hormone biosynthesis by E. annulipes corpora allata in vitro. This was true for glands of low activity from 2-day females and brooding females, as well as for relatively high activity glands from 10-day females. In contrast, 10(-7) M allatostatin I significantly and reversibly decreased hindgut motility. Motility was decreased in hindguts of high endogenous motility from 2-day females and in those of relatively low activity from brooding females. These results support the notion that a primary function of allatostatin might be to reduce gut motility.

  6. Effects of DDT, DDE, and PCBs on mitochondrial respiration. [Cockroaches

    Energy Technology Data Exchange (ETDEWEB)

    Khan, H.M.; Cutkomp, L.K.

    1982-11-01

    Data dealing with the action of DDT, its metabolite DDE and other related chlorinated compounds such as polychlorinated biphenyls (PCBs) are presented in this study. Results show that both DDT and DDE effectively reduce oxidative phosphorylation as determined from cockroach muscle mitochondria. DDT is more effective as was also determined for inhibition of oligomycin-sensitive Mg/sup 2 +/ATPase. The PCBs tested were uncouplers of oxidative phosphorylation. (JMT)

  7. De novo transcriptome of the Hemimetabolous German cockroach (Blattella germanica.

    Directory of Open Access Journals (Sweden)

    Xiaojie Zhou

    Full Text Available BACKGROUND: The German cockroach, Blattella germanica, is an important insect pest that transmits various pathogens mechanically and causes severe allergic diseases. This insect has long served as a model system for studies of insect biology, physiology and ecology. However, the lack of genome or transcriptome information heavily hinder our further understanding about the German cockroach in every aspect at a molecular level and on a genome-wide scale. To explore the transcriptome and identify unique sequences of interest, we subjected the B. germanica transcriptome to massively parallel pyrosequencing and generated the first reference transcriptome for B. germanica. METHODOLOGY/PRINCIPAL FINDINGS: A total of 1,365,609 raw reads with an average length of 529 bp were generated via pyrosequencing the mixed cDNA library from different life stages of German cockroach including maturing oothecae, nymphs, adult females and males. The raw reads were de novo assembled to 48,800 contigs and 3,961 singletons with high-quality unique sequences. These sequences were annotated and classified functionally in terms of BLAST, GO and KEGG, and the genes putatively coding detoxification enzyme systems, insecticide targets, key components in systematic RNA interference, immunity and chemoreception pathways were identified. A total of 3,601 SSRs (Simple Sequence Repeats loci were also predicted. CONCLUSIONS/SIGNIFICANCE: The whole transcriptome pyrosequencing data from this study provides a usable genetic resource for future identification of potential functional genes involved in various biological processes.

  8. Synanthropic Cockroaches (Blattidae: Periplaneta spp.) Harbor Pathogenic Leptospira in Colombia.

    Science.gov (United States)

    Gonzalez-Astudillo, Viviana; Bustamante-Rengifo, Javier A; Bonilla, Álvaro; Lehmicke, Anna Joy J; Castillo, Andrés; Astudillo-Hernández, Miryam

    2016-01-01

    Leptospirosis cases in Colombia are typically linked to peridomestic rodents; however, empirical data suggest that Leptospira-infected patients with no apparent exposure to these reservoirs are common. Cockroaches (Periplaneta spp.) have equal or greater interaction with humans than rodents, yet their potential role as carriers of Leptospira has not been assessed. We determined if pathogenic Leptospira is harbored by Periplaneta spp. in Cali (Colombia) and the variables influencing this relationship. Fifty-nine cockroaches were captured from seven sites and DNA was extracted from the body surface and digestive tract for a multiplex polymerase chain reaction, targeting genes secY and flaB. Logistic regression models and proportion tests showed a higher likelihood for Leptospira to be isolated from body surfaces (P > 0.001) and from individuals inside houses (six times more likely). These findings are the first to demonstrate an association between Periplaneta spp. and Leptospira, suggesting the need to investigate the potential for cockroaches to serve as reservoirs or transport hosts for Leptospira. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Reversible brain inactivation induces discontinuous gas exchange in cockroaches.

    Science.gov (United States)

    Matthews, Philip G D; White, Craig R

    2013-06-01

    Many insects at rest breathe discontinuously, alternating between brief bouts of gas exchange and extended periods of breath-holding. The association between discontinuous gas exchange cycles (DGCs) and inactivity has long been recognised, leading to speculation that DGCs lie at one end of a continuum of gas exchange patterns, from continuous to discontinuous, linked to metabolic rate (MR). However, the neural hypothesis posits that it is the downregulation of brain activity and a change in the neural control of gas exchange, rather than low MR per se, which is responsible for the emergence of DGCs during inactivity. To test this, Nauphoeta cinerea cockroaches had their brains inactivated by applying a Peltier-chilled cold probe to the head. Once brain temperature fell to 8°C, cockroaches switched from a continuous to a discontinuous breathing pattern. Re-warming the brain abolished the DGC and re-established a continuous breathing pattern. Chilling the brain did not significantly reduce the cockroaches' MR and there was no association between the gas exchange pattern displayed by the insect and its MR. This demonstrates that DGCs can arise due to a decrease in brain activity and a change in the underlying regulation of gas exchange, and are not necessarily a simple consequence of low respiratory demand.

  10. Vigas de concreto reforçadas com bambu Dendrocalamus giganteus. I: análise experimental Concrete beams reinforced with bamboo (Dendrocalamus giganteus. I: experimental analysis

    Directory of Open Access Journals (Sweden)

    Humberto C. Lima Júnior

    2005-12-01

    Full Text Available Neste trabalho, apresenta-se e se discute um estudo experimental sobre o comportamento estrutural de vigas de concreto reforçadas com bambu. Ensaiaram-se dez vigas de concreto armado, sendo oito vigas armadas longitudinalmente com varas de bambu Dendrocalamus giganteus e duas vigas de referência, armadas com barras de aço. Duas variáveis foram estudadas: a taxa de armadura longitudinal (1,6 e 3,2% e a relação área/perímetro das varas de bambu (0,25 e 0,33 cm. Para cada combinação de variáveis foram confeccionadas duas vigas. Curvas força vs. deslocamento e força vs. deformação dos materiais são apresentadas e discutidas. Constatou-se que o comportamento estrutural das vigas de concreto reforçadas com bambu segue a teoria de flexão de Bernoulli-Kirchoff, sendo possível a aplicação dos procedimentos usuais de dimensionamento do concreto armado no projeto desses elementos. Observou-se, também, que a capacidade de carga dessas vigas se assemelha à das vigas de aço; contudo, estas são mais rígidas que aquelas.In this paper, an experimental study about bamboo reinforced concrete beams is presented and discussed. Ten reinforced concrete beams were tested, where eight of them were reinforced with Dendrocalamus giganteus bamboo-splint and two reference beams were reinforced with steel bars. Two factors were studied: the longitudinal reinforcement ratio (1.6 and 3.2% and the area/perimeter ratio of the bamboo-splint (0.25 and 0.33 cm. For each factor combination, two beams were cast. Force vs. displacement and force vs. strain curves are presented and discussed. It was found out that the structural behaviour of bamboo-concrete beams follow the Bernoulli-Kirchoff bending theory. Therefore, the usual design procedures of reinforced concrete can be used to design the bamboo-concrete beams. The load capacity of the bamboo-concrete beams is almost the same as that of reinforced with steel; nevertheless, are more stiffer than those

  11. Cockroaches ’ bacterial infections in wards of hospitals, Hamedan city, west of Iran

    Directory of Open Access Journals (Sweden)

    Nejati Jalil

    2012-10-01

    Full Text Available Objective: To identify the relationship between different species of cockroaches with their bacterial infection in different wards of Hamedan county hospitals, western Iran. Methods: Using sticky trap, hand collection and glass trap, 250 cockroaches were collected from 14 wards of 5 hospitals. After having their identification determined by detection key, all of them were used to isolate bacteria from cuticle and alimentary tract. Results: From four identified species, Blatella germanica were the most common in all of the wards (88.8% and next was the Periplaneta Americana (8%. 20 bacteria species isolated from cockroaches' surface and 21 from digestive organ. Escherichia coli were the most predominant bacteria isolated from external surface (26.5 % as well as alimentary tract (30.8%. The frequency of investigated bacteria on cockroaches' body surface was not significantly different between Periplaneta Americana and Blattella germanica except for Kllebsiella oxytoca (P<0.001 and Providensia Spp (P=0.035. Also, frequency of detected bacteria in cockroaches' digestive organ was not significantly different between these two species. Furthermore, the frequency of bacteria isolated from the cockroaches' external surface was not significantly different from that of digestive organ except for shigella disantery (P<0.001, Pseudomonas aeroginosa (P<0.001 and Klebsiella oxytoca (P=0.01 3. Conclusions: Since cockroaches can carry pathogenic bacteria, so their existence in the hospitals could be a serious public health problem. It is suggested to compile programs in order to control cockroaches especially in the hospitals.

  12. Microbial Carriage of Cockroaches at a Tertiary Care Hospital in Ghana

    Directory of Open Access Journals (Sweden)

    Patience B. Tetteh-Quarcoo

    2013-01-01

    Full Text Available Cockroaches are common in the environment of many hospitals in Ghana; however, little is known about their public health risks. To evaluate potential risks, we investigated the external and internal microbial flora of 61 cockroaches from a tertiary hospital in Ghana and evaluated the antibiotic resistance profiles of the common bacterial species. Standard methods were used in all the microbiological investigations and antibiotic susceptibility testing. A rotavirus carriage rate of 19.7% was observed among the cockroaches. Four types of intestinal parasites were carried externally by the cockroaches, and the most prevalent was Hookworm (4.9%. Eight nosocomial bacteria were isolated from the cockroaches, and the most prevalent was Klebsiella pneumoniae , which occurred internally in 29.5% of the cockroaches and 26.2% externally. Multiple drug resistance among common bacteria isolated from the cockroaches ranged from 13.8% ( Escherichia coli to 41.1% ( Klebsiella pneumoniae . Cockroaches constitute an important reservoir for pathogenic microorganisms, and may be important vectors of multiple resistant nosocomial pathogens in the studied hospital.

  13. Chow Down! Using Madagascar Hissing Cockroaches to Explore Basic Nutrition Concepts

    Science.gov (United States)

    Wagler, Ron

    2009-01-01

    The Madagascar hissing cockroach ("Gromphadorhina portentosa") is one of the most exciting and enjoyable animals to incorporate into your science curriculum. Madagascar hissing cockroaches (MHCs) do not bite, are easy to handle, produce little odor compared to many terrarium animals, have a fascinating social structure, are easy to breed, teach…

  14. Cloning and characterization of the adipokinetic hormone receptor from the cockroach Periplaneta americana

    DEFF Research Database (Denmark)

    Hansen, Karina K; Hauser, Frank; Cazzamali, Giuseppe

    2006-01-01

    Cockroaches have long been used as insect models to investigate the actions of biologically active neuropeptides. Here, we describe the cloning and functional expression in Chinese hamster ovary cells of an adipokinetic hormone (AKH) G protein-coupled receptor from the cockroach Periplaneta ameri...

  15. Comparative analysis of pathogenic organisms in cockroaches from different community settings in Edo State, Nigeria.

    Science.gov (United States)

    Isaac, Clement; Orue, Philip Ogbeide; Iyamu, Mercy Itohan; Ehiaghe, Joy Imuetiyan; Isaac, Osesojie

    2014-04-01

    Cockroaches are abundant in Nigeria and are seen to harbour an array of pathogens. Environmental and sanitary conditions associated with demographic/socio-economic settings of an area could contribute to the prevalence of disease pathogens in cockroaches. A total of 246 cockroaches (Periplaneta americana) in urban (Benin, n=91), semi-urban (Ekpoma, n=75) and rural (Emuhi, n=70) settings in Edo State, Nigeria were collected within and around households. The external body surfaces and alimentary canal of these cockroaches were screened for bacterial, fungal, and parasitological infections. Bacillus sp. and Escherichia coli were the most common bacteria in cockroaches. However, Enterococcus faecalis could not be isolated in cockroaches trapped from Ekpoma and Emuhi. Aspergillus niger was the most prevalent fungus in Benin and Ekpoma, while Mucor sp. was predominant in Emuhi. Parasitological investigations revealed the preponderance of Ascaris lumbricoides in Benin and Emuhi, while Trichuris trichura was the most predominant in Ekpoma. The prevalence and burden of infection in cockroaches is likely to be a reflection of the sanitary conditions of these areas. Also, cockroaches in these areas making incursions in homes may increase the risk of human infections with these disease agents.

  16. Pseudoanaplectinia yumotoi, A New Ovoviviparous Myrmecophilous Cockroach Genus and Species from Sarawak (Blattaria: Blattellidae; Blattellinae)

    OpenAIRE

    Roth, Louis M.

    1995-01-01

    Pseudoanaplectinia yumotoi, a new myrmecophilous cockroach genus and species, is described from Sarawak. Based on the male genital phallomeres, it is placed in the Blattellidae: Blattellinae. The genus is ovoviviparous and probably arose from an anaplectinoid-like ancestor. This is the third case of ovoviviparity arising in the Blattellidae. The cockroach has a symbiotic relationship with an ant Crematogaster sp.

  17. Pseudoanaplectinia yumotoi, A New Ovoviviparous Myrmecophilous Cockroach Genus and Species from Sarawak (Blattaria: Blattellidae; Blattellinae

    Directory of Open Access Journals (Sweden)

    Louis M. Roth

    1995-01-01

    Full Text Available Pseudoanaplectinia yumotoi, a new myrmecophilous cockroach genus and species, is described from Sarawak. Based on the male genital phallomeres, it is placed in the Blattellidae: Blattellinae. The genus is ovoviviparous and probably arose from an anaplectinoid-like ancestor. This is the third case of ovoviviparity arising in the Blattellidae. The cockroach has a symbiotic relationship with an ant Crematogaster sp.

  18. Investigation on American cockroaches medically important bacteria in Khorramshahr hospital, Iran

    Directory of Open Access Journals (Sweden)

    Hamid Kassiri

    2014-06-01

    Full Text Available Objective: To investigate American cockroaches' infection to various bacteria in Khorramshahr Vali-e-Asr hospital, which was done in 2008. Methods: In this descriptive cross-sectional study, 20 American cockroaches were caught via direct collection. Medically important bacteria were extracted from their outer surface of bodies by standard procedures. Results: Culturing outer surface wash of cockroaches resulted in the separation of Klebsiella, Pseudomonas, Escherichia coli, Staphylococcus, Proteus and Streptococcus. The main common bacteria were Klebsiella (35% and Pseudomonas (30%. Also, results of culture media showed that about 90% of cockroaches infected to at least one bacterium. Conclusions: American cockroaches can transmit pathogenic and potential pathogenic bacteria, therefore their presence in hospitals may be a sanitation challenge. It is recommended to assess plans in purpose to combat these pests in the hospitals.

  19. Fluorosis as a probable cause of chronic lameness in free ranging eastern grey kangaroos (Macropus giganteus).

    Science.gov (United States)

    Clarke, Emily; Beveridge, Ian; Slocombe, Ron; Coulson, Graeme

    2006-12-01

    A population of eastern grey kangaroos (Macropus giganteus) inhabiting heathland and farmland surrounding an aluminum smelter at Portland, Victoria, Australia, exhibited clinical signs of lameness. An investigation was undertaken to determine the cause of this lameness. Hematology, necropsy, histopathology, fecal egg count, total worm count, reproductive status, and the population age range were examined and failed to reveal any additional underlying disease state. The specific problem of lameness was addressed with bone histopathology, radiography, quantitative ultrasonography, microradiography, and multielement analysis of bone ash samples. The significant lesions observed were: osteophytosis of the distal tibia and fibula, tarsal bones, metatarsus IV, and proximal coccygeal vertebrae; osteopenia of the femur, tibia, and metatarsus IV; incisor enamel hypoplasia; stained, uneven, and abnormal teeth wear; abnormal bone matrix mineralization and mottling; increased bone density; and elevated bone fluoride levels. Microradiography of affected kangaroos exhibited "black osteons," which are a known manifestation of fluorosis. Collectively, these lesions were consistent with a diagnosis of fluorosis.

  20. Steroidal Saponin Toxicity in Eastern Grey Kangaroos ( Macropus giganteus): A Novel Clinicopathologic Presentation of Hepatogenous Photosensitization.

    Science.gov (United States)

    Steventon, Chloe A; Raidal, Shane R; Quinn, Jane C; Peters, Andrew

    2018-03-02

    We describe the clinicopathologic features of a mortality event characterized by blindness and dermatitis affecting eastern grey kangaroos ( Macropus giganteus), secondary to hepatogenous photosensitization. Affected animals exhibited photophobic behavior, blindness, ataxia, recumbency, lethargy, ear shaking, and behavior consistent with distress or depression. The photophobia manifested as abnormal shade-seeking during the day, including finding refuge under or in structures used frequently by people. Severely affected kangaroos were jaundiced and had markedly elevated serum bilirubin and gamma glutamyl-transpeptidase concentrations. Blindness in affected animals was attributed to moderate to severe corneal opacity due to corneal edema and inflammation. Skin lesions were typically subtle on gross examination even in cases which had severe necrotizing dermatitis histologically. Histologic lesions in the liver of affected animals included the presence of acicular clefts typical of steroidal saponins. The outbreak was associated with pasture dominated by the invasive grass, Panicum gilvum, which is a recognized source of saponin-induced photosensitization in livestock.

  1. Callus induction and plant regeneration from different explant types of Miscanthus x ogiformis Honda 'Giganteus'

    DEFF Research Database (Denmark)

    Holme, Inger Bæksted; Petersen, Karen Koefoed

    1996-01-01

    Different explants of Miscanthus x ogiformis Honda 'Giganteus' were tested in order to develop an efficient tissue culture system. Shoot apices, leaf and root sections from in vitro-propagated plants, and leaf and immature inflorescence sections from 6-month-old greenhouse-grown plants were used....... The explants were cultured on urashige and Skoog medium supplemented with 4.5, 13.6, 22.6 or 31.7 μM 2,4-dichlorophenoxyacetic acid. Three types of callus were formed but only one was embryogenic and regenerated plants. Callus induction and formation of embryogenic callus depended on the type and developmental...... stage of the explants. Shoot apices formed the highest percentage of embryogenic callus. There was a difference in the formation of embryogenic callus between leaf explants from in vitro-propagated shoots and greenhouse-grown plants. The best results were obtained from newly formed leaves of in vitro...

  2. The effect of daytime rain on the Indian Flying Fox (Mammalia: Chiroptera: Pteropodidae Pteropus giganteus

    Directory of Open Access Journals (Sweden)

    S. Baskaran

    2016-02-01

    Full Text Available Excessive water loss during the day due to heat stress in bats of the genus Pteropus appears to be inevitable, because these bats are exposed to direct sunlight.  Rain also affects the rest pattern of the Indian Flying Fox Pteropus giganteus during the day.  When rain occurred during the day, most of the bats hung in a slanting position and did not exhibit any movements.  After rain, they licked both ventral and dorsal surfaces of the wing membrane and scratched their body with their thumb claws.  They also licked the water droplets that remained on the leaves and branches of the tree.  Even though their rest had been affected by the rain the bats utilized the water droplets to quench their thirst, cool their body and clean their fur.  The construction of water reservoirs near Pteropus roosts will help to assure their long-term conservation. 

  3. Comparing the performance of Miscanthus x giganteus and wheat straw biomass in sulfuric acid based pretreatment.

    Science.gov (United States)

    Kärcher, M A; Iqbal, Y; Lewandowski, I; Senn, T

    2015-03-01

    The objective of this study was to assess and compare the suitability of Miscanthus x giganteus and wheat straw biomass in dilute acid catalyzed pretreatment. Miscanthus and wheat straw were treated in a dilute sulfuric acid/steam explosion pretreatment. As a result of combining dilute sulfuric acid- and steam explosion pretreatment the hemicellulose hydrolysis yields (96% in wheat straw and 90% in miscanthus) in both substrates were higher than reported in literature. The combined severity factor (=CSF) for optimal hemicellulose hydrolysis was 1.9 and 1.5 in for miscanthus and wheat straw respectively. Because of the higher CSF value more furfural, furfuryl alcohol, 5-hydroxymethylfurfural and acetic acid was formed in miscanthus than in wheat straw pretreatment. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Pleurotus giganteus (Berk.) Karunarathna & K.D. Hyde: Nutritional value and in vitro neurite outgrowth activity in rat pheochromocytoma cells.

    Science.gov (United States)

    Phan, Chia-Wei; Wong, Wei-Lun; David, Pamela; Naidu, Murali; Sabaratnam, Vikineswary

    2012-07-19

    Drugs dedicated to alleviate neurodegenerative diseases like Parkinson's and Alzheimer's have always been associated with debilitating side effects. Medicinal mushrooms which harness neuropharmacological compounds offer a potential possibility for protection against such diseases. Pleurotus giganteus (formerly known as Panus giganteus) has been consumed by the indigenous people in Peninsular Malaysia for many years. Domestication of this wild mushroom is gaining popularity but to our knowledge, medicinal properties reported for this culinary mushroom are minimal. The fruiting bodies P. giganteus were analysed for its nutritional values. Cytotoxicity of the mushroom's aqueous and ethanolic extracts towards PC12, a rat pheochromocytoma cell line was assessed by using 3-[4,5-dimethythiazol-2-yl]-2,5-diphenyltetrazolium bromide (MTT) assay. Neurite outgrowth stimulation assay was carried out with nerve growth factor (NGF) as control. To elucidate signaling mechanisms involved by mushroom extract-induced neurite outgrowth, treatment of specific inhibitor for MEK/ERK and PI3K signalling pathway was carried out. The fruiting bodies of P. giganteus were found to have high carbohydrate, dietary fibre, potassium, phenolic compounds and triterpenoids. Both aqueous and ethanolic extracts induced neurite outgrowth of PC12 cells in a dose- and time-dependant manner with no detectable cytotoxic effect. At day 3, 25 μg/ml of aqueous extract and 15 μg/ml of ethanolic extract showed the highest percentage of neurite-bearing cells, i.e. 31.7 ± 1.1% and 33.3 ± 0.9%; respectively. Inhibition treatment results suggested that MEK/ERK and PI3K/Akt are responsible for neurite outgrowth of PC12 cells stimulated by P. giganteus extract. The high potassium content (1345.7 mg/100 g) may be responsible for promoting neurite extension, too. P. giganteus contains bioactive compounds that mimic NGF and are responsible for neurite stimulation. Hence, this mushroom may be

  5. Biogas Production Based On Miscanthus × Giganteus (Miscanthus Sinensis Anderss. Within Dry Fermentation Process

    Directory of Open Access Journals (Sweden)

    Porvaz Pavol

    2015-11-01

    Full Text Available “Dry fermentation“ technology may be used for energy recovery of phytomass substrate which has dry matter content from 20 to 60%. In agriculture sector, while only rarely used, it is a very perspective technology at such types of biomass – phytomass which is not recommended to be processed within “wet fermentation” (process is energetically and operationally very costly. For detecting the suitability of Miscanthus × giganteus phytomass to biogas for production through dry fermentation process, as well as determining the biogas yield, at the Slovak university of Agriculture (SUA there has been developed an experimental device enabling the pilot plant trials, which is installed at the biogas station within the area of the VPP SPU Ltd. in Kolíňany. A pilot plant experiment of biogas production based on Miscanthus × giganteus (Miscanthus sinensis Anderss. phytomass within dry fermentation process was carried out at the period from 25 February to 25 March 2013. The monitored production of biogas was based on the substrate mixture of components formed as follows: the biomass from preceding cycle (farmyard manure and ensilage from Miscanthus phytomass. In these experiments the amount of produced biogas, analysis of biogas and the input substrate were materialized by standard methodology. On base of the obtained results, we can formulate the conclusion: the tested substrate mainly consists of Miscanthus phytomass and manure was suitable for biogas production technology and anaerobic dry fermentation process. The yield of Miscanthus substrate in our experiments was around 117 litres of biogas per 1 kg of dry matter silage. For assurance of the continuity and uniformity in the production of biogas by dry fermentation process, the multiple-fermentation chamber is needed, which must be saturated gradually with dosing interval. This dosing interval is caused by residence time and the number of chambers. For example, at the residence time of 28

  6. [Asymmetry of antennal grooming in the cockroach (Periplaneta americana)].

    Science.gov (United States)

    2014-07-01

    The present study was conducted to determine the key features of antennal grooming of male American cockroaches in neutral circumstances. It was shown for the first time that the right antenna was cleaned significantly more often than the left one, which indicates the presence of functional asymmetry of antennal grooming in this insect species. At the same time, no statistically significant asymmetry was found for grooming of antennal bases and legs. Morphological asymmetries of antennae and legs and/or brain lateralization are the plausible sources of observed behavioral asymmetry in antennal grooming.

  7. Medically Important Parasites Carried by Cockroaches in Melong Subdivision, Littoral, Cameroon

    Directory of Open Access Journals (Sweden)

    R. J. Atiokeng Tatang

    2017-01-01

    Full Text Available Cockroaches have been recognized as mechanical vectors of pathogens that can infest humans or animals. A total of 844 adult cockroaches (436 males and 408 females were caught. In the laboratory, cockroaches were first washed in saturated salt solution to remove ectoparasites and then rinsed with 70% alcohol, dried, and dissected for endoparasites. An overall transport rate of 47.39% was recorded. Six genera of parasites were identified. These were Ascaris (33.76%, Trichuris (11.97%, Capillaria (6.16%, Toxocara (4.86%, Hook Worm (4.86%, and Eimeria (2.73%. The parasites were more recorded on the external surface (54.27% of cockroaches than in the internal surface (GIT, 38.51%. The same tendency was obtained between sexes with female cockroaches having a higher transport rate (36.69%. Cockroaches caught in toilets carried more parasites (31.99% as compared to those from kitchens (22.63% and houses (11.14%. Almost all encountered parasites were recognized as responsible of zoonosis and they can be consequently released in nature by hosts and easily disseminated by cockroaches as mechanical vectors. Sanitary education, reenforcement of worms’ eradication programs, and the fight against these insects remain a necessity in the Mélong Subdivision.

  8. Gut Bacterial Community of the Xylophagous Cockroaches Cryptocercus punctulatus and Parasphaeria boleiriana

    Science.gov (United States)

    Berlanga, Mercedes; Llorens, Carlos; Comas, Jaume; Guerrero, Ricardo

    2016-01-01

    Cryptocercus punctulatus and Parasphaeria boleiriana are two distantly related xylophagous and subsocial cockroaches. Cryptocercus is related to termites. Xylophagous cockroaches and termites are excellent model organisms for studying the symbiotic relationship between the insect and their microbiota. In this study, high-throughput 454 pyrosequencing of 16S rRNA was used to investigate the diversity of metagenomic gut communities of C. punctulatus and P. boleiriana, and thereby to identify possible shifts in symbiont allegiances during cockroaches evolution. Our results revealed that the hindgut prokaryotic communities of both xylophagous cockroaches are dominated by members of four Bacteria phyla: Bacteroidetes, Firmicutes, Proteobacteria, and Actinobacteria. Other identified phyla were Spirochaetes, Planctomycetes, candidatus Saccharibacteria (formerly TM7), and Acidobacteria, each of which represented 1–2% of the total population detected. Community similarity based on phylogenetic relatedness by unweighted UniFrac analyses indicated that the composition of the bacterial community in the two species was significantly different (P cockroach species clustered with sequences previously described in termites and other cockroaches, but not with those from other animals or environments. These results suggest that, during their evolution, those cockroaches conserved several bacterial communities from the microbiota of a common ancestor. The ecological stability of those microbial communities may imply the important functional role for the survival of the host of providing nutrients in appropriate quantities and balance. PMID:27054320

  9. Cockroaches as a Source of High Bacterial Pathogens with Multidrug Resistant Strains in Gondar Town, Ethiopia.

    Science.gov (United States)

    Moges, Feleke; Eshetie, Setegn; Endris, Mengistu; Huruy, Kahsay; Muluye, Dagnachew; Feleke, Tigist; G/Silassie, Fisha; Ayalew, Getenet; Nagappan, Raja

    2016-01-01

    Background. Cockroaches are source of bacterial infections and this study was aimed to assess bacterial isolates and their antimicrobial profiles from cockroaches in Gondar town, Ethiopia. Methods. A total of 60 cockroaches were collected from March 1 to May 30, 2014, in Gondar town. Bacterial species were isolated from external and internal parts of cockroaches. Disk diffusion method was used to determine antibiotic susceptibility patterns. Data were entered and analyzed by using SPSS version 20; P values cockroaches, respectively. Klebsiella pneumoniae 32 (17.7%), Escherichia coli 29 (16%), and Citrobacter spp. 27 (15%) were the predominant isolates. High resistance rate was observed to cotrimoxazole, 60 (33.1%), and least resistance rate was noted to ciprofloxacin, 2 (1.1%). Additionally, 116 (64.1%) of the isolates were MDR strains; Salmonella spp. were the leading MDR isolates (100%) followed by Enterobacter (90.5%) and Shigella spp. (76.9%). Conclusion. Cockroaches are the potential source of bacteria pathogens with multidrug resistant strains and hence effective preventive and control measures are required to minimize cockroach related infections.

  10. Rapid Elimination of German Cockroach, Blatella germanica, by Fipronil and Imidacloprid Gel Baits

    Directory of Open Access Journals (Sweden)

    H Nasirian

    2008-08-01

    Full Text Available Background: Baits have become popular and effective formulations against urban insect pests. Compared with re­sidual sprays toxic gel baits are used more and more frequently to control urban cockroach populations. The aim of this study was to investigate the usage of two commercially available fipronil and imidacloprid gel bait formulations against Blattella germanica field infested in Iran. Methods:  The study was carried out in an urban area at Tehran from March 2004 to September 2005. The 0.05% fipronil and 2.15% imidacloprid gel baits were placed continuously in 3 residential German cockroach infested units. Pre- and post-treatment cockroach density was assessed by visual count method. Results: Pre- and post-treatment visual count of cockroaches in treatment and control areas, and percentage reduc­tion in cockroach density in treatment areas in comparison to control areas was showed that density reduction was increased with the 0.05% fipronil and 2.15% imidacloprid gel baits in treated areas from 1st to 9th week in compari­son to control area. After 60 days, German cockroaches eliminated completely from these areas. Conclusion: These results show that fipronil and imidacloprid gel baits are highly effective in field German cock­roach infested after insecticide spraying control failure German cockroach infested fields where spraying  of pyrethroid insecticides failed to control the situation and confirm previous  reports stating that avermectin and hydramethylnon are more effective than conventional insecticides in baits against cockroaches. Therefore, fipronil and imidacloprid gel baits are appropriate candidates for controlling German cockroach infested dwellings in Iran where control with other insectices failed because of resistance.

  11. Rapid Elimination of German Cockroach, Blatella germanica, by Fipronil and Imidacloprid Gel Baits

    Directory of Open Access Journals (Sweden)

    H Nasirian

    2008-06-01

    Full Text Available Background: Baits have become popular and effective formulations against urban insect pests. Compared with re­sidual sprays toxic gel baits are used more and more frequently to control urban cockroach populations. The aim of this study was to investigate the usage of two commercially available fipronil and imidacloprid gel bait formulations against Blattella germanica field infested in Iran.Methods:  The study was carried out in an urban area at Tehran from March 2004 to September 2005. The 0.05% fipronil and 2.15% imidacloprid gel baits were placed continuously in 3 residential German cockroach infested units. Pre- and post-treatment cockroach density was assessed by visual count method.Results: Pre- and post-treatment visual count of cockroaches in treatment and control areas, and percentage reduc­tion in cockroach density in treatment areas in comparison to control areas was showed that density reduction was increased with the 0.05% fipronil and 2.15% imidacloprid gel baits in treated areas from 1st to 9th week in compari­son to control area. After 60 days, German cockroaches eliminated completely from these areas.Conclusion: These results show that fipronil and imidacloprid gel baits are highly effective in field German cock­roach infested after insecticide spraying control failure German cockroach infested fields where spraying  of pyrethroid insecticides failed to control the situation and confirm previous  reports stating that avermectin and hydramethylnon are more effective than conventional insecticides in baits against cockroaches. Therefore, fipronil and imidacloprid gel baits are appropriate candidates for controlling German cockroach infested dwellings in Iran where control with other insectices failed because of resistance.

  12. Chemical disguise of myrmecophilous cockroaches and its implications for understanding nestmate recognition mechanisms in leaf-cutting ants.

    Science.gov (United States)

    Nehring, Volker; Dani, Francesca R; Calamai, Luca; Turillazzi, Stefano; Bohn, Horst; Klass, Klaus-Dieter; d'Ettorre, Patrizia

    2016-08-05

    Cockroaches of the genus Attaphila regularly occur in leaf-cutting ant colonies. The ants farm a fungus that the cockroaches also appear to feed on. Cockroaches disperse between colonies horizontally (via foraging trails) and vertically (attached to queens on their mating flights). We analysed the chemical strategies used by the cockroaches to integrate into colonies of Atta colombica and Acromyrmex octospinosus. Analysing cockroaches from nests of two host species further allowed us to test the hypothesis that nestmate recognition is based on an asymmetric mechanism. Specifically, we test the U-present nestmate recognition model, which assumes that detection of undesirable cues (non-nestmate specific substances) leads to strong rejection of the cue-bearers, while absence of desirable cues (nestmate-specific substances) does not necessarily trigger aggression. We found that nests of Atta and Acromyrmex contained cockroaches of two different and not yet described Attaphila species. The cockroaches share the cuticular chemical substances of their specific host species and copy their host nest's colony-specific cuticular profile. Indeed, the cockroaches are accepted by nestmate but attacked by non-nestmate ant workers. Cockroaches from Acromyrmex colonies bear a lower concentration of cuticular substances and are less likely to be attacked by non-nestmate ants than cockroaches from Atta colonies. Nest-specific recognition of Attaphila cockroaches by host workers in combination with nest-specific cuticular chemical profiles suggest that the cockroaches mimic their host's recognition labels, either by synthesizing nest-specific substances or by substance transfer from ants. Our finding that the cockroach species with lower concentration of cuticular substances receives less aggression by both host species fully supports the U-present nestmate recognition model. Leaf-cutting ant nestmate recognition is thus asymmetric, responding more strongly to differences than to

  13. Pavlov's cockroach: classical conditioning of salivation in an insect.

    Directory of Open Access Journals (Sweden)

    Hidehiro Watanabe

    Full Text Available Secretion of saliva to aid swallowing and digestion is an important physiological function found in many vertebrates and invertebrates. Pavlov reported classical conditioning of salivation in dogs a century ago. Conditioning of salivation, however, has been so far reported only in dogs and humans, and its underlying neural mechanisms remain elusive because of the complexity of the mammalian brain. We previously reported that, in cockroaches Periplaneta americana, salivary neurons that control salivation exhibited increased responses to an odor after conditioning trials in which the odor was paired with sucrose solution. However, no direct evidence of conditioning of salivation was obtained. In this study, we investigated the effects of conditioning trials on the level of salivation. Untrained cockroaches exhibited salivary responses to sucrose solution applied to the mouth but not to peppermint or vanilla odor applied to an antenna. After differential conditioning trials in which an odor was paired with sucrose solution and another odor was presented without pairing with sucrose solution, sucrose-associated odor induced an increase in the level of salivation, but the odor presented alone did not. The conditioning effect lasted for one day after conditioning trials. This study demonstrates, for the first time, classical conditioning of salivation in species other than dogs and humans, thereby providing the first evidence of sophisticated neural control of autonomic function in insects. The results provide a useful model system for studying cellular basis of conditioning of salivation in the simpler nervous system of insects.

  14. Nitrogen Reserve Pools in Two Miscanthus × giganteus Genotypes under Contrasting N Managements

    Directory of Open Access Journals (Sweden)

    Ryan M. Dierking

    2017-09-01

    Full Text Available Nitrogen (N reserves in vegetative tissues contribute N to regrowth of Miscanthus × giganteus shoots in spring, but our understanding of how N fertilization and plant genotype affect this process is incomplete. Our specific objectives were to: (1 determine how N fertilizer management impacts accumulation of dry matter and N among aboveground and belowground tissues and organs; (2 understand how changes in N management and tissue N concentration influence seasonal fluctuations in concentrations of buffer-soluble proteins and amino acids in putative storage organs including rhizomes and roots; and (3 characterize genotypic variability and genotype × N interactions for N reserve accumulation and use among Miscanthus × giganteus genotypes. Established plots of the IL Clone and Nagara-sib population were fertilized with 0–0, 0–150, 75–75, 150–0, and 150–150 kg N ha-1 where the first numeral denotes the N rate applied in 2011 (Year 1 and the second number denotes the N rate applied in 2012 (Year 2. Rhizomes, roots, stembases, and shoots were sampled at 6-week intervals between March and August and then in November at dormancy. Concentrations of N, soluble protein and amino-N increased in all tissues with fertilizer N application. With the exception of rhizome amino-N, concentrations of these N pools in roots and rhizomes declined as plants resumed growth in spring and increased sharply between August and November as growth slowed. Losses in shoot and stembase N mass between August and November were similar to total N accumulation in roots and rhizomes during this interval. Compared to the unfertilized control, specific N managements enhanced growth of above- and belowground tissues. The IL Clone generally had greater biomass yield of all organs than the Nagara-sib; the exception being shoot biomass in November when extensive leaf senescence reduce yield of the IL Clone. High biomass yields were obtained with 75 kg N ha-1 applied annually

  15. Water use and the thermoregulatory behaviour of kangaroos in arid regions: insights into the colonisation of arid rangelands in Australia by the Eastern Grey Kangaroo (Macropus giganteus).

    Science.gov (United States)

    Dawson, Terence J; McTavish, Kirsten J; Munn, Adam J; Holloway, Joanne

    2006-01-01

    The Eastern Grey Kangaroo (Macropus giganteus) occurs mostly in the wetter regions of eastern Australia. However, in the past 30-40 years it has moved into more arid regions (rainfall Kangaroo (Macropus rufus). An increased access to water (supplied for domestic stock) may explain this range extension, but changes in the availability of preferred feed could also be involved. The water use, drinking patterns and thermoregulatory behaviour of these two species of kangaroo have been examined in a semi-free range study, during summer at an arid rangeland site. Foraging was largely nocturnal in both species and during the day they behaved to reduce heat loads. This was especially so for M. giganteus, which showed greater shade seeking. However, it still used more water (72 +/- 2.6 mL kg(-1) day(-1), mean +/- SE) than M. rufus (56 +/- 7.6 mL kg(-1) day(-1)) and drank twice as frequently. Although M. giganteus produced a less concentrated urine (1422 +/- 36 mosmol kg(-1)) than M. rufus (1843 +/- 28 mosmol kg(-1)), kidney physiology did not explain all of the differences in water metabolism between the species. Water from the feed and faecal water retention also appear to be involved. Broadly, a better access to reliable water and the utilisation of mesic microhabitats has enabled M. giganteus to make inroads into the changing rangelands of eastern Australia. However, changes in the vegetation, due to stock grazing, have also favoured M. giganteus, which is a grass eating specialist.

  16. Cockroaches (Blattella germanica) as carriers of microorganisms of medical importance in hospitals.

    OpenAIRE

    Fotedar, R.; Shriniwas, U. B.; Verma, A.

    1991-01-01

    A study was conducted to isolate and identify microorganisms of medical importance from cockroaches (Blattella germanica) and to ascertain their vector potential in the epidemiology of nosocomial infections. Bacteria, fungi and parasites of medical importance were isolated and identified. Important bacterial pathogens responsible for wound infections, were further studies by antibiograms. One hundred and fifty-eight out of 159 (99.4%) cockroaches collected from hospital (test) and 113 out of ...

  17. Cockroaches (Insecta, Blattodea from caves of Polillo Island (Philippines, with description of a new species

    Directory of Open Access Journals (Sweden)

    Cristian C. Lucanas

    2016-09-01

    Full Text Available Cockroaches collected during a protracted series of fieldwork in several limestone caves in Polillo Island, Philippines were taxonomically studied. A new species of Nocticola (Nocticolidae, N. gonzalezi Lucañas & Lit, sp. n., is described. The male of Periplaneta banksi Hanitsch (Blattidae is described for the first time. Altogether, the present cave cockroach fauna of the island consists of six species.

  18. Microbial Carriage of Cockroaches at a Tertiary Care Hospital in Ghana

    OpenAIRE

    Eric S. Donkor; Patience B. Tetteh-Quarcoo; Patrick F. Ayeh-Kumi; Simon K. Attah; Kwabena O. Duedu; Emmanuel Afutu; Isaac Boamah; Michael Olu-Taiwo; Isaac Anim-Baidoo

    2013-01-01

    Cockroaches are common in the environment of many hospitals in Ghana; however, little is known about their public health risks. To evaluate potential risks, we investigated the external and internal microbial flora of 61 cockroaches from a tertiary hospital in Ghana and evaluated the antibiotic resistance profiles of the common bacterial species. Standard methods were used in all the microbiological investigations and antibiotic susceptibility testing. A rotavirus carriage rate of 19.7% was o...

  19. Bacterial, fungal and parasitic contamination of cockroaches in public hospitals of Hamadan, Iran.

    Science.gov (United States)

    Salehzadeh, A; Tavacol, P; Mahjub, H

    2007-06-01

    To determine the possible role of cockroaches in dissemination of medically important microorganisms, a study was carried out in public hospitals and residential areas of Hamadan city, west of Iran. Bacteria, fungi and parasites of medical importance were isolated and identified. The total number of Blattella germanica collected from hospitals were 133 as the case group. The cockroaches collected from residential areas were 45 as the control group. A total of 178 cockroaches were collected, over a period of two years (133 from hospitals; and 45 from residential areas) in Hamadan. Medically important microorganisms were isolated from external and internal surfaces using standard methods. In the case group, 130 out of 133 (98%) Blattella germanica showed contamination with high bacterial load (more than 1 x 10(3)) whereas only 2 out of 45 (4.45%) cockroaches of the control group were carrying medically important bacteria with high bacterial load. Bacteriological examinations revealed that almost all test cockroaches had at least one of the following microorganisms either in their body surface or digestive tract. Enterobacter (22.6%), Klebsiela (21%), Enterococcus (17.3%), Staphylococcus (16.5%), Esherichia coli and Streptococcus (8.3%), Pseudomonas (3%), and also Shigella, Haemophilus and group A beta-hemolytic Streptococcus each less than 1%. In addition the results showed (74.4.%) of test cockroaches harboured fungi-Candida (48.9%), Mucor (10.5%), Aspergillus niger (7.5%), Rhizopus (4.5) and also Penicillium and Aspergillus fumigans each 1.5%. Some parasitic worms of medical importance were also isolated from the test cockroaches, but carriage rates were low. The data from this study emphasise the importance of cockroaches as potential vectors of medically important microorganisms such as pathogenic bacteria and fungi in hospital environments.

  20. Grooming behavior in American cockroach is affected by novelty and odor.

    Science.gov (United States)

    Zhukovskaya, Marianna I

    2014-01-01

    The main features of grooming behavior are amazingly similar among arthropods and land vertebrates and serve the same needs. A particular pattern of cleaning movements in cockroaches shows cephalo-caudal progression. Grooming sequences become longer after adaptation to the new setting. Novelty related changes in grooming are recognized as a form of displacement behavior. Statistical analysis of behavior revealed that antennal grooming in American cockroach, Periplaneta americana L., was significantly enhanced in the presence of odor.

  1. Profile of antimicrobial resistance of bacteria isolated from cockroaches (Periplaneta americana) in a Brazilian health care institution

    OpenAIRE

    Prado, Marinésia Aparecida; Gir, Elucir; Pereira, Milca Severino; Reis, Cleomenes; Pimenta, Fabiana Cristina

    2006-01-01

    Cockroaches carry microorganisms to sterilized materials, equipment and non-contaminated food in hospitals and in homes. Hence, they are regarded as major microbial vectors. We isolated and identified microorganisms from living cockroaches captured from a Brazilian health care institution and we determined the antimicrobial susceptibility profile of the isolates. Following collection, cockroaches were immobilized at 4ºC for 10 to 20 minutes, immersed in 0.8% saline solution and then homogeniz...

  2. Do Quiescence and Wasp Venom-Induced Lethargy Share Common Neuronal Mechanisms in Cockroaches?

    Directory of Open Access Journals (Sweden)

    Stav Emanuel

    Full Text Available The escape behavior of a cockroach may not occur when it is either in a quiescent state or after being stung by the jewel wasp (Ampulex compressa. In the present paper, we show that quiescence is an innate lethargic state during which the cockroach is less responsive to external stimuli. The neuronal mechanism of such a state is poorly understood. In contrast to quiescence, the venom-induced lethargic state is not an innate state in cockroaches. The Jewel Wasp disables the escape behavior of cockroaches by injecting its venom directly in the head ganglia, inside a neuropile called the central complex a 'higher center' known to regulate motor behaviors. In this paper we show that the coxal slow motoneuron ongoing activity, known to be involved in posture, is reduced in quiescent animals, as compared to awake animals, and it is further reduced in stung animals. Moreover, the regular tonic firing of the slow motoneuron present in both awake and quiescent cockroaches is lost in stung cockroaches. Injection of procaine to prevent neuronal activity into the central complex to mimic the wasp venom injection produces a similar effect on the activity of the slow motoneuron. In conclusion, we speculate that the neuronal modulation during the quiescence and venom-induced lethargic states may occur in the central complex and that both states could share a common neuronal mechanism.

  3. The antennal system and cockroach evasive behavior. II. Stimulus identification and localization are separable antennal functions.

    Science.gov (United States)

    Comer, C M; Parks, L; Halvorsen, M B; Breese-Terteling, A

    2003-02-01

    Cockroaches ( Periplaneta americana) orient their antennae toward moving objects based on visual cues. Presumably, this allows exploration of novel objects by the antennal flagellum. We used videographic and electrophysiological methods to determine if receptors on the flagellum are essential for triggering escape, or if they enable cockroaches to discriminate threatening from non-threatening objects that are encountered. When a flagellum was removed, and replaced with a plastic fiber, deflection of a "prosthetic flagellum" still activated the descending mechanosensory interneurons associated with escape and produced typical escape responses. However, escape was essentially eliminated by constraining the movement of the scape and pedicel at the antennal base. When cockroaches approached and briefly explored the surface of a spider or another cockroach with the flagellum, they produced escape significantly more often in response to subsequent controlled contact from a spider than from a cockroach. This discrimination did not depend on visual or wind-sensory input, but required flagellar palpation of the surface. The crucial sensory cues appear to involve texture rather than surface chemicals. These results indicate that cockroaches acquire basic information on stimulus identity during exploration of surfaces with flagellar receptors, but that basal receptors are triggers for escape behavior.

  4. Deterministic Assembly of Complex Bacterial Communities in Guts of Germ-Free Cockroaches.

    Science.gov (United States)

    Mikaelyan, Aram; Thompson, Claire L; Hofer, Markus J; Brune, Andreas

    2016-02-15

    The gut microbiota of termites plays important roles in the symbiotic digestion of lignocellulose. However, the factors shaping the microbial community structure remain poorly understood. Because termites cannot be raised under axenic conditions, we established the closely related cockroach Shelfordella lateralis as a germ-free model to study microbial community assembly and host-microbe interactions. In this study, we determined the composition of the bacterial assemblages in cockroaches inoculated with the gut microbiota of termites and mice using pyrosequencing analysis of their 16S rRNA genes. Although the composition of the xenobiotic communities was influenced by the lineages present in the foreign inocula, their structure resembled that of conventional cockroaches. Bacterial taxa abundant in conventional cockroaches but rare in the foreign inocula, such as Dysgonomonas and Parabacteroides spp., were selectively enriched in the xenobiotic communities. Donor-specific taxa, such as endomicrobia or spirochete lineages restricted to the gut microbiota of termites, however, either were unable to colonize germ-free cockroaches or formed only small populations. The exposure of xenobiotic cockroaches to conventional adults restored their normal microbiota, which indicated that autochthonous lineages outcompete foreign ones. Our results provide experimental proof that the assembly of a complex gut microbiota in insects is deterministic. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  5. Ultralong Cycle Life Achieved by a Natural Plant: Miscanthus × giganteus for Lithium Oxygen Batteries.

    Science.gov (United States)

    Li, Shu; Bi, Xuanxuan; Tao, Ran; Wang, Qingzhen; Yao, Ying; Wu, Feng; Zhang, Cunzhong

    2017-02-08

    Large energy-storage systems and electric vehicles require energy devices with high power and high energy density. Lithium oxygen (Li-O 2 ) batteries could achieve high energy density, but they are still facing problems such as low practical capacity and poor cyclability. Here, we prepare activated carbons (MGACs) based on the natural plant Miscanthus × giganteus (MG) through slow pyrolysis. It possesses a large surface area, plenty of active sites, and high porosity, which are beneficial to the utilization of oxygen electrode in Li-O 2 batteries. The MGACs-based oxygen electrode delivers a high specific capacity of 9400 mAh/g at 0.02 mA/cm 2 , and long cycle life of 601 cycles (with a cutoff capacity of 500 mAh/g) and 295 cycles (with a cutoff capacity of 1000 mAh/g) at 0.2 mA/cm 2 , respectively. Additionally, the material exhibits high rate capability and high reversibility, which is a promising candidate for the application in Li-O 2 batteries.

  6. Phylogeography of Eastern Grey Kangaroos, Macropus giganteus, Suggests a Mesic Refugium in Eastern Australia.

    Directory of Open Access Journals (Sweden)

    Brett A Coghlan

    Full Text Available Phylogeographic studies around the world have identified refugia where fauna were able to persist during unsuitable climatic periods, particularly during times of glaciation. In Australia the effects of Pleistocene climate oscillations on rainforest taxa have been well studied but less is known about the effects on mesic-habitat fauna, such as the eastern grey kangaroo (Macropus giganteus. The eastern grey kangaroo is a large mammal that is common and widespread throughout eastern Australia, preferring dry mesic habitat, rather than rainforest. As pollen evidence suggests that the central-eastern part of Australia (southeast Queensland and northern New South Wales experienced cycles of expansion in mesic habitat with contraction in rainforests, and vice versa during glacial and interglacial periods, respectively, we hypothesise that the distribution of the eastern grey kangaroo was affected by these climate oscillations and may have contracted to mesic habitat refugia. From 375 mitochondrial DNA control region sequences from across the distribution of eastern grey kangaroos we obtained 108 unique haplotypes. Phylogenetic analysis identified two clades in Queensland, one of which is newly identified and restricted to a small coastal region in southern Queensland north of Brisbane, known as the Sunshine Coast. The relatively limited geographic range of this genetically isolated clade suggests the possibility of a mesic habitat refugium forming during rainforest expansion during wetter climate cycles. Other potential, although less likely, reasons for the genetic isolation of the highly distinct clade include geographic barriers, separate northward expansions, and strong local adaptation.

  7. Anthelmintic Treatment Does Not Change Foraging Strategies of Female Eastern Grey Kangaroos, Macropus giganteus.

    Directory of Open Access Journals (Sweden)

    Jemma K Cripps

    Full Text Available Large mammalian herbivores are commonly infected with gastrointestinal helminths. Heavily parasitised hosts are likely to have increased nutritional requirements and would be predicted to increase their food intake to compensate for costs of being parasitised, but experimental tests of the impacts of these parasites on the foraging efficiency of hosts are lacking, particularly in free-ranging wildlife. We conducted a field experiment on a population of free-ranging eastern grey kangaroos (Macropus giganteus to test this prediction, removing nematodes from one group of adult females using an anthelmintic treatment. We then carried out observations before and following treatment to assess the influence of parasites on foraging behaviour. Contrary to our predictions, the manipulation of parasite burdens did not result in changes in any of the key foraging variables we measured. Our results suggest that despite carrying large burdens of gastrointestinal parasites, the foraging strategy of female kangaroos is likely be driven by factors unrelated to parasitism, and that kangaroos in high nutritional environments may be able acquire sufficient nutrients to offset the costs of parasitism. We conclude that the drivers of forage intake likely differ between domesticated and free-ranging herbivores, and that free-ranging hosts are likely more resilient to parasitism.

  8. Dominance, body size and internal relatedness influence male reproductive success in eastern grey kangaroos (Macropus giganteus).

    Science.gov (United States)

    Miller, Emily J; Eldridge, Mark D B; Cooper, Desmond W; Herbert, Catherine A

    2010-01-01

    Knowledge of the determinants of reproductive success is essential for understanding the adaptive significance of particular traits. The present study examined whether particular behavioural, morphological, physiological or genetic traits were correlated with male dominance and reproductive success using three semi-free-ranging captive populations (n = 98) of the eastern grey kangaroo (Macropus giganteus). The morphological traits measured included bodyweight, head, forearm, tail, pes and leg length, forearm and bicep circumference, and testis size. Blood samples were collected to determine serum testosterone concentrations. All individuals were typed for 10 microsatellite loci and paternity determined for each pouch young. To determine the influence of relatedness and genetic diversity on male reproductive success, internal relatedness, standardised heterozygosity and mean d(2) were calculated. Dominant males sired a significantly higher proportion of offspring than smaller, lower-ranked males and had higher testosterone concentrations. Males that sired offspring were significantly heavier and had larger body size. Sires were significantly more heterozygous and genetically dissimilar to breeding females than non-sires. Despite the wealth of knowledge on the social organisation of kangaroos, this is the first study to assign parentage and male reproductive success using molecular evidence.

  9. Anthelmintic Treatment Does Not Change Foraging Strategies of Female Eastern Grey Kangaroos, Macropus giganteus.

    Science.gov (United States)

    Cripps, Jemma K; Martin, Jennifer K; Coulson, Graeme

    2016-01-01

    Large mammalian herbivores are commonly infected with gastrointestinal helminths. Heavily parasitised hosts are likely to have increased nutritional requirements and would be predicted to increase their food intake to compensate for costs of being parasitised, but experimental tests of the impacts of these parasites on the foraging efficiency of hosts are lacking, particularly in free-ranging wildlife. We conducted a field experiment on a population of free-ranging eastern grey kangaroos (Macropus giganteus) to test this prediction, removing nematodes from one group of adult females using an anthelmintic treatment. We then carried out observations before and following treatment to assess the influence of parasites on foraging behaviour. Contrary to our predictions, the manipulation of parasite burdens did not result in changes in any of the key foraging variables we measured. Our results suggest that despite carrying large burdens of gastrointestinal parasites, the foraging strategy of female kangaroos is likely be driven by factors unrelated to parasitism, and that kangaroos in high nutritional environments may be able acquire sufficient nutrients to offset the costs of parasitism. We conclude that the drivers of forage intake likely differ between domesticated and free-ranging herbivores, and that free-ranging hosts are likely more resilient to parasitism.

  10. The efficacy of anthelmintic drugs against nematodes infecting free-ranging eastern grey kangaroos, Macropus giganteus.

    Science.gov (United States)

    Cripps, Jemma; Beveridge, Ian; Coulson, Graeme

    2013-07-01

    Effective anthelmintics are valuable tools for biologists conducting manipulative field experiments to examine effects of parasites on wildlife. However, before such experiments are carried out the efficacy of these drugs must be determined. We conducted three field experiments (May 2010-September 2011) on free-ranging eastern grey kangaroos (Macropus giganteus) at a golf course in Victoria, Australia, treating animals with the anthelmintic drugs moxidectin (subcutaneous, 1 mg/kg, 2 mg/kg), ivermectin (subcutaneous, 200 μg/kg), and albendazole (oral, 3.8 mg/kg). After treatment we monitored strongylid fecal egg counts (FECs) over time and assessed anthelmintic efficacy using fecal egg count reduction tests (FECRTs). We also performed a larval development assay (LDA) to evaluate directly the efficacy in the nematode population. Unexpectedly, moxidectin and ivermectin had low efficacy with maximum FEC reductions of 82% and 28%, respectively. However, treatment with albendazole reduced FECs by 100% in all kangaroos and egg counts remained low for up to 3 mo. The results from the LDA supported the FECRTs, with low macrocyclic lactone efficacy and high albendazole efficacy. Macrocyclic lactones, at recommended dose rates, were much less effective against strongylid nematodes in kangaroos than has been reported for domestic herbivores. This may be partly due to pharmacokinetics in the host and partly due to low susceptibility in some of the nematodes infecting eastern grey kangaroos.

  11. Toxoplasmosis in the Eastern Grey Kangaroo, Macropus giganteus and the Cape Hyrax, Procavis capensis in Japan

    Directory of Open Access Journals (Sweden)

    Khaled Mohamed El-Dakhly1,4, Nagwan El-Habashi2, El-Shaymaa El-Nahass3,4, Hiroki Sakai4 and Tokuma Yanai4,*

    2013-11-01

    Full Text Available Toxoplasmosis was investigated in an eastern grey kangaroo, Macropus giganteus, and four cape hyraxes, Procavia capensis, in a Japanese zoo. Clinically, the kangaroo showed neurological signs, emaciation, diarrhea, elevated AST and CK, and subjected to coma before death. One young cape hyrax had severe anorexia, while the other three died without exhibiting clinical signs. Grossly, lungs of the kangaroo were dark red in color, while hyraxes, besides, showed hepatic multifocal white foci, and intestinal multifocal hemorrhages. Histologically, the kangaroo had frequent Toxoplasma gondii pseudocysts in brain, heart and skeletal muscles. All hyraxes had multifocal necrosis with cysts containing numerous bradyzoites in liver and spleen, along with necrotic gastroenteritis and intestinal hemorrhages. Immunohistochemically, cysts showed positive reaction to anti-T. gondii antibodies. These findings indicate possible outbreaks of toxoplasmosis in eastern grey kangaroos and cape hyraxes, zoo habitants; therefore, they could be susceptible intermediate hosts for T. gondii in terms of zoonosis. This is the first report of toxoplasmosis in eastern grey kangaroos and cape hyraxes in Japanese zoos.

  12. In vitro Propagation of Giant Bamboo (Dendrocalamus giganteus) and Arudinaria alpina

    International Nuclear Information System (INIS)

    Machua, J.; Sigu, G. Gathura M.; Nyingi, J

    2007-01-01

    The giant bamboo (Dendrocalamus giganteus) is a multipurpose tree with uses and it has been widely cultivated in Asia while the indigenous bamboo (Arudinaria alpina) has a very low rate of domestication. The propagation and establishment of bamboo species is hampered by infrequent flowering, insufficient and irregular supply of seeds and inadequate knowledge of propagation technologies. The study aimed at developing in vitro techniques for mass propagation of the bamboo. Bamboo explant material was collected and and sterilized in a permutation of sterilizers over varying durations. The explants were further inoculated into matrix of hormonal concentrations. Successful sterilization of both Dendrocalamous giganteous and Arudinaria alpina was achieved in 25% v/v formaldehyde for 20 minutes resulting in a 75% survival. On the other hand sterilization with sodium hypochlorite was found to be ineffective for both species. Root initiation was not achieved after six weeks in varying concentrations of IBA (indolebutyric acid), NAA (+ n aphthalene acetic acid) and a blanket application of 0.3mgl -1 BAP, by which time most microshoots had overgrown the culture tubes. In conclusion, 25% v/v formaldehyde for 20 minutes is adequate for bamboo explant sterilization while microshoots induction could be achieved though varying BAP concentrations while the culture conditions were optimal for toot initiation

  13. Phylogeography of Eastern Grey Kangaroos, Macropus giganteus, Suggests a Mesic Refugium in Eastern Australia.

    Science.gov (United States)

    Coghlan, Brett A; Goldizen, Anne W; Thomson, Vicki A; Seddon, Jennifer M

    2015-01-01

    Phylogeographic studies around the world have identified refugia where fauna were able to persist during unsuitable climatic periods, particularly during times of glaciation. In Australia the effects of Pleistocene climate oscillations on rainforest taxa have been well studied but less is known about the effects on mesic-habitat fauna, such as the eastern grey kangaroo (Macropus giganteus). The eastern grey kangaroo is a large mammal that is common and widespread throughout eastern Australia, preferring dry mesic habitat, rather than rainforest. As pollen evidence suggests that the central-eastern part of Australia (southeast Queensland and northern New South Wales) experienced cycles of expansion in mesic habitat with contraction in rainforests, and vice versa during glacial and interglacial periods, respectively, we hypothesise that the distribution of the eastern grey kangaroo was affected by these climate oscillations and may have contracted to mesic habitat refugia. From 375 mitochondrial DNA control region sequences from across the distribution of eastern grey kangaroos we obtained 108 unique haplotypes. Phylogenetic analysis identified two clades in Queensland, one of which is newly identified and restricted to a small coastal region in southern Queensland north of Brisbane, known as the Sunshine Coast. The relatively limited geographic range of this genetically isolated clade suggests the possibility of a mesic habitat refugium forming during rainforest expansion during wetter climate cycles. Other potential, although less likely, reasons for the genetic isolation of the highly distinct clade include geographic barriers, separate northward expansions, and strong local adaptation.

  14. Laparoscopic ovariectomy in eastern grey kangaroos (Macropus giganteus) and red kangaroos (Macropus rufus).

    Science.gov (United States)

    Colgan, S A; Green, L A

    2018-03-01

    To develop a technique for permanent sterilisation of female eastern grey kangaroos (Macropus giganteus) and red kangaroos (M. rufus) as part of a large-scale macropod management program on an enclosed 1545-ha site in western Sydney. Free-ranging female kangaroos (n = 1409: 1285 eastern grey kangaroos, 124 red kangaroos) were anaesthetised via remote anaesthetic drug delivery of tiletamine/zolazepam, medetomidine and acepromazine prior to inhalational anaesthesia using isoflurane-oxygen. A laparoscopic ovariectomy technique was developed using standard laparoscopic equipment to effect permanent sterilisation of the kangaroos. The technique described was also adapted for use on immature animals weighing as little as 1 kg. No direct post-surgical care was provided once the animals had recovered from the anaesthetic. The procedure was simple to perform and had a very high success rate, with an overall project mortality rate of 2.13% (n = 30). Seven kangaroos (0.05% of all operated kangaroos) were euthanased as a direct result of the surgical procedure. Surgical complications were rare but included inadvertent gastrointestinal tract puncture with the trocar, intraoperative haemorrhage and subcutaneous emphysema leading to pouch eversion following surgery. The procedure described is a rapid and effective method of permanent fertility control in macropods and carries a low mortality rate. © 2018 Australian Veterinary Association.

  15. Activity of the Antifungal Protein from Aspergillus giganteus Against Botrytis cinerea.

    Science.gov (United States)

    Moreno, Ana Beatriz; Del Pozo, Alvaro Martínez; Borja, Marisé; Segundo, Blanca San

    2003-11-01

    ABSTRACT Botrytis blight (gray mold), caused by Botrytis cinerea, is one of the most widely distributed diseases of ornamental plants. In geranium plants, gray mold is responsible for important losses in production. The mold Aspergillus giganteus is known to produce and secrete a basic low-molecular-weight protein, the antifungal protein (AFP). Here, the antifungal properties of the Aspergillus AFP against various B. cinerea isolates obtained from naturally infected geranium plants were investigated. AFP strongly inhibited mycelial growth as well as conidial germination of B. cinerea. Microscopic observations of fungal cultures treated with AFP revealed reduced hyphal elongation and swollen hyphal tips. Washout experiments in which B. cinerea was incubated with AFP for different periods of time and then washed away revealed a fungicidal activity of AFP. Application of AFP on geranium plants protected leaves against Botrytis infection. Cecropin A also was active against this pathogen. An additive effect against the fungus was observed when AFP was combined with cecropin A. These results are discussed in relation to the potential of the afp gene to enhance crop protection against B. cinerea diseases.

  16. In Vitro Fermentation of Xylooligosaccharides Produced from Miscanthus × giganteus by Human Fecal Microbiota.

    Science.gov (United States)

    Chen, Ming-Hsu; Swanson, Kelly S; Fahey, George C; Dien, Bruce S; Beloshapka, Alison N; Bauer, Laura L; Rausch, Kent D; Tumbleson, M E; Singh, Vijay

    2016-01-13

    Purified xylooligosaccharides from Miscanthus × giganteus (M×G XOS) were used in an in vitro fermentation experiment inoculated with human fecal microbiota. A commercial XOS product and pectin were used as controls. Decreases in pH by 2.3, 2.4, and 2.0 units and production of short-chain fatty acids (SCFA; acetic acid, 7764.2, 6664.1, and 6387.9 μmol/g; propionic acid, 1006.7, 1089.5, and 661.5 μmol/g; and butyric acid, 955.5, 1252.9, and 917.7 μmol/g) were observed in M×G XOS, commercial XOS, and pectin medium after 12 h of fermentation, respectively. Titers of Bifidobacterium spp., Lactobacillus spp., and Escherichia coli increased when fed all three substrates as monitored by qPCR. There was no significant trend for Clostridium perfringens. During fermentation, M×G XOS was statistically equivalent in performance to the commercial XOS sample as measured by culture acidification and growth of health-promoting bacteria and resulted in the highest SCFA production among the three substrates.

  17. Juvenile hormone and the ontogeny of cockroach aggression.

    Science.gov (United States)

    Kou, Rong; Chou, Szu-Ying; Chen, Shu-Chun; Huang, Zachary Y

    2009-09-01

    Our previous study [Kou et al., 2008. Juvenile hormone levels are increased in winners of cockroach fights. Horm. Behav. 52, 252-260] showed that the basic principle of the challenge hypothesis (hormone levels can respond to social stimuli to modulate aggression in vertebrates] could be applied to juvenile hormone (JH) levels and aggression in the lobster cockroach Nauphoeta cinerea. In that study, 80- to 85-day-old socially naïve males were used, as fighting is much more easily initiated in these older animals than in younger males, and JH III levels in the dominant were found to be significantly increased after an encounter compared to before the encounter and were significantly higher than those in the subordinates. In N. cinerea, newly emerged males usually show no aggressiveness towards each other and aggression is only initiated after several days of close contact. To investigate the development of aggression from an early age, in the present study, newly emerged males were paired to investigate the relationship between JH levels and aggression. The results showed that injection of JH III significantly increased the probability of the young males being fight winners. In each age group in which aggression was initiated, the dominants had significantly higher JH levels than either the subordinates or the same aged non-fighters. JH injection of subordinates on the day of rank establishment had no effect on the probability of rank switch. These results indicate that, (i) in newly emerged male pairs, JH plays a decisive role in rank establishment and the fact that dominant status is significantly associated with a higher JH titer and subordinate status with a lower JH titer is consistent with the basic principle of the challenge hypothesis, and (ii) after rank establishment, the lack of effect of JH treatment on rank change is consistent with the idea of "social inertia" in vertebrates.

  18. Polymorphisms in IL12A and cockroach allergy in children with asthma

    Directory of Open Access Journals (Sweden)

    Murphy Amy

    2008-07-01

    Full Text Available Abstract Background IL12A has been implicated in T-cell development and may thus influence the development of atopy and allergic diseases. Methods We tested for association between four linkage disequilibrium (LD-tagging SNPs (rs2243123, rs2243151, rs668998, and rs17826053 in IL12A and asthma and allergy-related (serum total and allergen-specific IgE, and skin test reactivity [STR] to two common allergens phenotypes in two samples: 417 Costa Rican children with asthma and their parents, and 470 families of 503 white children in the Childhood Asthma Management Program (CAMP. The analysis was conducted using the family-based association test (FBAT statistic implemented in the PBAT program. Results Among Costa Rican children with asthma, homozygosity for the minor allele of each of two SNPs in IL12A (rs2243123 and rs2243151 was associated with increased risks of STR to American cockroach (P ≤ 0.03 for both SNPs, STR to German cockroach (P ≤ 0.01 for both SNPs, and having a positive IgE to German cockroach (P IL12A was inversely associated with STR to German cockroach (P = 0.03 and homozygosity for the minor allele of SNP rs17826053 in IL12A was associated with increased risks of STR to American cockroach (P = 0.01 and STR to German cockroach (P = 0.007. There was no significant association between any SNP in IL12A and asthma, STR to dust mite, or total IgE in Costa Rica or CAMP. Conclusion Our findings suggest that variants in IL12A influence cockroach allergy among children with asthma.

  19. Bone fluoride concentrations of eastern grey kangaroos (Macropus giganteus) resident near an aluminium smelter in south-eastern Australia.

    Science.gov (United States)

    Hufschmid, J; Beveridge, I; Coulson, G; Gould, J

    2011-08-01

    Lesions of skeletal and dental fluorosis have been described recently in eastern grey kangaroos (Macropus giganteus). The present study further examined the epidemiology of skeletal fluorosis in this species. Bone fluoride concentrations were obtained from a range of skeletal sites of animals from a high (Portland Aluminium) and a low (Cape Bridgewater) fluoride environment in Victoria, Australia. Age, but not sex, affected the mean bone fluoride concentration of kangaroos. For a given age, bone fluoride concentrations were significantly higher in kangaroos from Portland than Cape Bridgewater. Concentrations varied between skeletal sites examined, with samples containing cancellous bone having higher fluoride concentrations than those containing only cortical bone.

  20. Growth characteristics and nutrient depletion of Miscanthus x ogiformis Honda 'Giganteus' suspension cultures

    DEFF Research Database (Denmark)

    Holme, Inger Bæksted

    1998-01-01

    The growth characteristics and nutrient depletion in suspension cultures of Miscanthus ogiformis Honda ‘Giganteus' grown in media containing either Murashige and Skoog or N6 basal nutrient salts were studied during a culture period of 15 days. Proline was added to both media in concentrations from...... 0 to 300 mM. The fresh and dry weights of the suspension aggregates and the concentrations of ammonium, nitrate, proline and sugar remaining in the medium were measured at different points in time during the culture period. The results showed an almost total depletion of ammonium but a limited...

  1. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae) cultivados en Costa Rica III: Dendrocalamus giganteus

    OpenAIRE

    Mayra Montiel; Ethel Sánchez

    2006-01-01

    Dendrocalamus giganteus es una de las especies de bambú más grandes y fuertes, y es ampliamente utilizada con propósitos varios. Se llevó a cabo un análisis ultraestructural de una población costarricense, determinando tres formas de acumulación de la cera cuticular en forma de papilas céricas. En la zona abaxial de la lámina foliar se aprecian estructuras cuadradas, constituidas por dos células de sílice en los extremos y en las partes laterales papilas céricas dobles, en el centro hay papil...

  2. Nutrient requirements of Miscanthus x giganteus: Conclusions from a review of published studies

    International Nuclear Information System (INIS)

    Cadoux, Stéphane; Riche, Andrew B.; Yates, Nicola E.; Machet, Jean-Marie

    2012-01-01

    Miscanthus x giganteus is a perennial biomass crop particularly suited to substituting fossil fuel resources in bioenergy production, in order to reduce greenhouse gas (GHG) emissions. The area of miscanthus grown in the EU is likely to increase in the future. However, the exact nutrient and fertiliser requirements of the crop are still under debate, which leads to uncertainties when making global assessments of GHG reductions and economics. The aim of our study was to review and analyse published data, in order to determine a consensus view on the nutrient requirements of the crop, and to identify where further research is needed. The findings of this study highlight the nutrient requirements of miscanthus are low compared to other crops. This is due to: i) high nutrient absorption efficiency through extensive rooting, ii) high absorbed nutrient use efficiency, iii) significant nutrient cycling between the rhizome and aerial biomass, iv) nutrient recycling before harvest through leaf fall, and v) possible contribution of N fixation by bacteria. Due to the low yield in the establishment phase of the crop, it is not recommended to apply any fertiliser during the two first years after planting, unless planted on poor soils. From the third year, typically 4.9, 0.45 and 7.0, grams per kilogram of dry matter, of N, P and K respectively are removed at harvest, and this should be a maximum to be replaced by fertilisers. Uncertainties in the exact requirements are due i) to a lack of data, in the different studies, on the nitrogen provided by soils, ii) to a lack of knowledge on the actual contribution of the rhizome to the plant nutrition, and iii) to the inexistence of tools for the diagnosis of the plant N status.

  3. The prevalence of protozoa in the gut of German cockroaches (Blattella germanica) with special reference to Lophomonas blattarum.

    Science.gov (United States)

    Martínez-Girón, Rafael; Martínez-Torre, Cristina; van Woerden, Hugo Cornelis

    2017-11-01

    The German cockroach (Blattella germanica) is a common domestic pest, which produces allergens that have been associated with broncho-pulmonary disease. Various protozoan species have been identified in the intestine of this cockroach and it has been hypothesised that these protozoa, or their proteases, may contribute to the burden of cockroach-associated allergens and adjuvants present in domestic dust. The aim of this study was therefore to determine the prevalence of protozoan species in the intestine of Blattella germanica. German cockroaches were anesthetised and dissected and gut contents are used to produce wet slides for microscopy. Both, Giemsa and Papanicolaou stains were used to confirm correct identification of Lophomonas blattarum. Representatives of four genera of protozoa were identified in 110 cockroaches: Nyctoterus sp. was observed in 91.8% of cases, Gregarina sp. in 64.5%, Amoeba sp. in 25.4% and Lophomonas blattarum in 13.6%. Nyctoterus and Gregarina were statistically significantly more likely to be found in diseased cockroaches compared to Amoeba or Lophomonas. The prevalence of Lophomonas blattarum was similar to that in published studies of a different species of cockroach, Periplaneta americana. Further work is needed to assess the interplay between protozoa, cockroaches and broncho-pulmonary diseases.

  4. Repellent Activity of Apiaceae Plant Essential Oils and their Constituents Against Adult German Cockroaches.

    Science.gov (United States)

    Lee, Hyo-Rim; Kim, Gil-Hah; Choi, Won-Sil; Park, Il-Kwon

    2017-04-01

    We evaluated the repellent activity of 12 Apiaceae plant essential oils and their components against male and female adult German cockroaches, Blattella germanica L., to find new natural repellents. Of all the plant essential oils tested, ajowan (Trachyspermum ammi Sprague) and dill (Anethum graveolens L.) essential oils showed the most potent repellent activity against male and female adult German cockroaches. Repellent activities of chemicals already identified in active oils were also investigated. Of the compounds identified, carvacrol, thymol, and R-(-)-carvone showed >80% repellent activity against male and female adult German cockroaches at 2.5 µg/cm2. S-(+)-Carvone, (+)-dihydrocarvone, and terpinen-4-ol showed >70% repellent activity against male and female adult German cockroaches at 10 µg/cm2. Our results indicated that Apiaceae plant essential oils and their constituents have good potential as natural repellents against adult German cockroaches. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Horizontal transfer of bait in the German cockroach: indoxacarb causes secondary and tertiary mortality.

    Science.gov (United States)

    Buczkowski, Grzegorz; Scherer, Clay W; Bennett, Gary W

    2008-06-01

    Horizontal transfer of indoxacarb in the German cockroach, Blattella germanica (L.), was examined under laboratory conditions. Results show that a single bait-fed adult cockroach (i.e., the donor) transferred indoxacarb to numerous primary recipients (secondary mortality),which then became secondary donors. These recipients subsequently became donors to other cockroaches and caused significant mortality in other members of the aggregation, resulting in tertiary kill. Indoxacarb was effectively transferred among adult cockroaches and resulted in significant secondary mortality. When adult males served as donors and vectored the insecticide to adult males, the donor:recipient ratio affected the mortality of the recipients and the rate of secondary mortality increased with increasing the ratio of donors to recipients. Furthermore, secondary mortality in the untreated cockroaches was significantly affected by the freshness of excretions from the donors, the presence of alternative food, and the duration of contact between the donors and the recipients. Ingested indoxacarb was most effectively translocated when the recipients interacted with freshly symptomatic donors in the absence of alternative food. The transfer of indoxacarb continued beyond secondary mortality and resulted in significant tertiary mortality. Excretions from a single bait-fed adult killed 38/50 (76%) nymphs within 72 h. The dead nymphs then vectored indoxacarb to 20 adult males and killed 16/20 (81%) recipients within 72 h. Behavioral mechanisms involved in the horizontal transfer of indoxacarb may include: contact with excretions, necrophagy, emetophagy, and ingestion of other excretions that originate from the donors.

  6. Evaluation of Five Local Formulated Insecticides against German Cockroach (Blattella germanica L. in Southern Iran

    Directory of Open Access Journals (Sweden)

    M Shahi

    2008-06-01

    Full Text Available Background: The German cockroach, Blattella germanica L., is a serious household and public health pest worldwide. Con­trol of this species has been very difficult to achieve. Toxicity of cypermethrin EC10%, deltamethrin EC5%, diazi­non EC0.5%, lambda-cyhalothrin EC5% and Negon® (permethrin+propoxur oil liquid1% commercial for­mula­tions were investigated against adult males of German cockroaches collected from four hospitals of Bandar Abbas City, southern Iran, during 2006. These insecticides have been used for cockroach con­trol in this city.Methods: The tests were carried out only on males by the glass jar contact method recommended by the WHO.Results: Maximum mortality rates of 20, 35, 90, and 100% were obtained after one hour contact to label-recom­mended doses of cypermethrin, deltamethrin, lambad-cyhalothrin, diazinon and permethrin+propoxur insecti­cides, respectively. KT50 results were different from 5.68 min for permethrin+propoxur mixture to 240.37 min for cyper­methrin. German cockroach showed < 80 per cent mortality using three pyrethroid insecticides.Conclusion: It seems that the label-recommended concentrations of these insecticides were wrong and lower than WHO advised for cockroach control. For monitoring of resistance it is recommended to do more tests using the pure ac­tive ingredient of these insecticides.

  7. Evaluation of Five Local Formulated Insecticides against German Cockroach (Blattella germanica L. in Southern Iran

    Directory of Open Access Journals (Sweden)

    M Shahi

    2008-08-01

    Full Text Available Background: The German cockroach, Blattella germanica L., is a serious household and public health pest worldwide. Con­trol of this species has been very difficult to achieve. Toxicity of cypermethrin EC10%, deltamethrin EC5%, diazi­non EC0.5%, lambda-cyhalothrin EC5% and Negon® (permethrin+propoxur oil liquid1% commercial for­mula­tions were investigated against adult males of German cockroaches collected from four hospitals of Bandar Abbas City, southern Iran, during 2006. These insecticides have been used for cockroach con­trol in this city. Methods: The tests were carried out only on males by the glass jar contact method recommended by the WHO. Results: Maximum mortality rates of 20, 35, 90, and 100% were obtained after one hour contact to label-recom­mended doses of cypermethrin, deltamethrin, lambad-cyhalothrin, diazinon and permethrin+propoxur insecti­cides, respectively. KT50 results were different from 5.68 min for permethrin+propoxur mixture to 240.37 min for cyper­methrin. German cockroach showed < 80 per cent mortality using three pyrethroid insecticides. Conclusion: It seems that the label-recommended concentrations of these insecticides were wrong and lower than WHO advised for cockroach control. For monitoring of resistance it is recommended to do more tests using the pure ac­tive ingredient of these insecticides.

  8. Effect of thiamethoxam on cockroach locomotor activity is associated with its metabolite clothianidin.

    Science.gov (United States)

    Benzidane, Yassine; Touinsi, Sarra; Motte, Emilie; Jadas-Hécart, Alain; Communal, Pierre-Yves; Leduc, Lionel; Thany, Steeve H

    2010-12-01

    In the present study, the effect of thiamethoxam and clothianidin on the locomotor activity of American cockroach, Periplaneta americana (L.), was evaluated. Because it has been proposed that thiamethoxam is metabolised to clothianidin, high-performance liquid chromatography coupled with mass spectrometry was used to evaluate the amount of clothianidin on thiamethoxam-treated cockroaches. One hour after neonicotinoid treatment, the time spent in the open-field-like apparatus significantly increased, suggesting a decrease in locomotor activity. The percentage of cockroaches displaying locomotor activity was significantly reduced 1 h after haemolymph application of 1 nmol g(-1) neonicotinoid, while no significant effect was found after topical and oral administration. However, at 24 and 48 h, all neonicotinoids were able to reduce locomotor activity, depending on their concentrations and the way they were applied. Interestingly, it was found that thiamethoxam was converted to clothianidin 1 h after application, but the amount of clothianidin did not rise proportionately to thiamethoxam, especially after oral administration. The data suggest that the effect of thiamethoxam on cockroach locomotor activity is due in part to clothianidin action because (1) thiamethoxam levels remained persistent 48 h after application and (2) the amount of clothianidin in cockroach tissues was consistent with the toxicity of thiamethoxam. Copyright © 2010 Society of Chemical Industry.

  9. Design and Implementation of Markerless Augmented Reality Application for Cockroach Phobia Therapy Using Adaptive Threshold

    Directory of Open Access Journals (Sweden)

    Fiandra Fatharany

    2017-01-01

    Full Text Available Augmented reality (AR technology is useful for treating several psychological problems, including phobias such as fear of flying, agoraphobia, claustrophobia, and phobia to insects and small animals. However, the currently existing applications for therapy of cockroach phobia that uses AR technology are still very dependent towards the presence of markers, which might lessen the feeling of being in an actual scenario from everyday lives. In this paper, we created a system that is able to use everyday things as a replacement for markers for phobia therapy for cockroach. There are five main processes: getting the live streaming feed from camera, preprocessing, extracting the center point of the objects, tracking the marker-substitute objects, and lastly, instantiating cockroaches randomly after user lifts the objects according to the number and mode of the cockroaches, whether it is moving or not, that are predetermined by the user. The evaluation in this paper includes eight participants that are carefully selected based on their Fear of Spiders Questionnaire (FSQ score that is translated into Indonesian and modified to accommodate cockroaches instead of spiders. The results is that the system can induce anxiety level on participants with the highest score of 10, which is the highest score in Standard Unit of Discomfort scale (SUDs. While the presence and reality judgment of this paper has the highest score of 7 which is also the highest score in Slater-Usoh-Steed Questionnaire (SUS.

  10. Immediate hypersensitivity to cockroach. Isolation and purification of the major antigens.

    Science.gov (United States)

    Twarog, F J; Picone, F J; Strunk, R S; So, J; Colten, H R

    1977-02-01

    Crude cockroach extract elicited positive skin tests in 50% of patients with positive and in 4% with negative environmental history for cockroach exposure, suggesting a possible role of cockroach in perennial atopic disease. Three major allergens in crude American and German cockroach extracts have been identified using sequential purification steps on Sephadex G-75, diethylaminoethyl (DEAE) cellulose, and agarose gel electrophoresis. Cr-I elicits positive skin tests in 70% of patients sensitive to the crude extracts. It has a molecular weight of approximately 25,500 daltons, is highly acidic, and resists boiling for four hours. Boiling in 4 N acetic acid completely abolishes its allergenicity. The purified allergen elicits positive skin tests at a concentration of 3 mug/ml and is capable of inducing greater than 50% histamine release from sensitive leukocytes at 0.05 ng/ml. A second antigen, Cr-II, elicits positive skin tests also in approximately 70% of cockroach-sensitive individuals, has a molecular weight of approximately 63,000 to 65,000 daltons, and has similar heat stability and acid hydrolysis characteristics to Cr-I. A third, less well-characterized antigen, Cr-III, has a molecular weight less than 10,000 daltons and elicits positive skin tests in 30% of individuals sensitive to the crude extract.

  11. INVESTIGATION OF BACTERIOLOGICAL INFECTIONS OF THE AMERICAN COCKROACHES IN PAVEH CITY, KERMANSHAH PROVINCE

    Science.gov (United States)

    Sayyad, Sirvan; Vahabi, Ahmad; Vahabi, Boshra; Sayyadi, Mahnaz; Sahne, Shahnaz Haji

    2016-01-01

    Introduction: American cockroaches, Periplaneta americana, are the most important pests in hospitals and dwelling environments. They are mechanical vectors of some bacterial pathogens. Goal: The present investigation was carried out in Ghods hospital and 5 dwelling localities of Paveh city to evaluate bacterial infestations of American cockroaches in this region of Iran. Methods: The samples were randomly collected from hospital environments and toilets and kitchens of the dwelling localities from December-March 2012 and July-September 2013. The samples were captured using sterile test tubes and sterile hand gloves. Results: Totally, 98 cockroaches were collected from hospital (45.9%) and dwelling (54.1%) environments. Eight groups of bacteria including: Pseudomonas spp., Proteus spp., Klebsiella spp., Staphylococcus spp., Bacillus spp., Serratia spp., Entrobacter spp. and Escherichia coli were extracted. Conclusions: The findings of the present study revealed that the American cockroaches are very important in transmission of some bacterial pathogens, so health education and using the effective control methods to elimination and reduction of cockroaches are necessary. PMID:27047261

  12. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica III: Dendrocalamus giganteus

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Dendrocalamus giganteus es una de las especies de bambú más grandes y fuertes, y es ampliamente utilizada con propósitos varios. Se llevó a cabo un análisis ultraestructural de una población costarricense, determinando tres formas de acumulación de la cera cuticular en forma de papilas céricas. En la zona abaxial de la lámina foliar se aprecian estructuras cuadradas, constituidas por dos células de sílice en los extremos y en las partes laterales papilas céricas dobles, en el centro hay papilas céricas esféricas. Estas estructuras son únicas para este especie, por lo que tienen alto valor taxonómico.Dendrocalamus giganteus is one of the biggest, strongest and most used bamboos. An ultrastructural analysis of samples from a Costa Rican population showed that there are three forms of cuticular wax accumulations, shaped like ceric papillae. In the abaxial zone of the leaf lamina there are square structures composed by two silica cells in the boundaries and double ceric papillae in the lateral parts; in the center there are spherical papillae. These structures are unique for this species. Rev. Biol. Trop. 54(Suppl. 2: 59-63. Epub 2006 Dec. 01.

  13. The embodiment of cockroach aggregation behavior in a group of micro-robots.

    Science.gov (United States)

    Garnier, Simon; Jost, Christian; Gautrais, Jacques; Asadpour, Masoud; Caprari, Gilles; Jeanson, Raphaël; Grimal, Anne; Theraulaz, Guy

    2008-01-01

    We report the faithful reproduction of the self-organized aggregation behavior of the German cockroach Blattella germanica with a group of robots. We describe the implementation of the biological model provided by Jeanson et al. in Alice robots, and we compare the behaviors of the cockroaches and the robots using the same experimental and analytical methodology. We show that the aggregation behavior of the German cockroach was successfully transferred to the Alice robot despite strong differences between robots and animals at the perceptual, actuatorial, and computational levels. This article highlights some of the major constraints one may encounter during such a work and proposes general principles to ensure that the behavioral model is accurately transferred to the artificial agents.

  14. The majority of cockroaches from the Samutprakarn province of Thailand are carriers of parasitic organisms.

    Science.gov (United States)

    Chamavit, Pennapa; Sahaisook, Panupong; Niamnuy, Nunthawadee

    2011-01-01

    We undertook a study of the mechanical transmission of parasitic organisms in cockroaches in the Samutprakarn province of Thailand. In this study, 920 cockroaches were obtained from 18 open-air shopping markets in 5 districts and 1 subdistrict of this province. All cockroaches were captured during their feeding time in their natural habitat. Direct wet smear and modified acid-fast bacilli staining were used to identify the parasites from the external surface or cuticle of the cockroaches. The results show that 498 (54.1 %) of the cockroaches harbored parasitic organisms. Of these, 56.1 % were protozoa and the remaining 43.9 % were helminthes (pathogenic helminthes- 1.4 %, non-pathogenic helminthes- 42.5 %). Of the pathogenic helminthes, the species included Strongyloides stercoralis (6 instances of the free-living adult male, 0.8 %), Ascaris lumbricoides (2 decorticated eggs, 0.3 %), Trichuris trichiura (2, 0.3 %), and Taenia spp . (1 egg, 0.1 %). The protozoa types that were identified included Cyclospora spp. (10 oocysts, 1.3 %) , Endolimax nana (10 cysts, 1.3 %) , B. hominis (9 instances of the vacuolated form, 1.2 %) , Isospora belli (75 oocysts, 9.6 %) , Entamoeba histolytica/E. dispar (36 cysts, 4.6 %) , Cryptosporidium spp . (220 oocysts, 28.1 %), Chilomastix mesnilli (2 cysts, 0.3 %), Entamoeba coli (31 cysts, 4.0 %), Balantidium coli (45 trophozoites, 5.8 %), and Iodamoeba butschlii (1 cyst, 0.1 %). These results show that cockroaches isolated from these markets are carriers of several parasitic organisms that cause commonly found symptoms of illness such as diarrhea or bowel disorder.

  15. Mucosal exposure to cockroach extract induces allergic sensitization and allergic airway inflammation

    Directory of Open Access Journals (Sweden)

    Arizmendi Narcy G

    2011-12-01

    Full Text Available Abstract Background Allergic sensitization to aeroallergens develops in response to mucosal exposure to these allergens. Allergic sensitization may lead to the development of asthma, which is characterized by chronic airway inflammation. The objective of this study is to describe in detail a model of mucosal exposure to cockroach allergens in the absence of an exogenous adjuvant. Methods Cockroach extract (CE was administered to mice intranasally (i.n. daily for 5 days, and 5 days later mice were challenged with CE for 4 consecutive days. A second group received CE i.n. for 3 weeks. Airway hyperresponsiveness (AHR was assessed 24 h after the last allergen exposure. Allergic airway inflammation was assessed by BAL and lung histology 48 h after the last allergen exposure. Antigen-specific antibodies were assessed in serum. Lungs were excised from mice from measurement of cytokines and chemokines in whole lung lysate. Results Mucosal exposure of Balb/c mice to cockroach extract induced airway eosinophilic inflammation, AHR and cockroach-specific IgG1; however, AHR to methacholine was absent in the long term group. Lung histology showed patchy, multicentric damage with inflammatory infiltrates at the airways in both groups. Lungs from mice from the short term group showed increased IL-4, CCL11, CXCL1 and CCL2 protein levels. IL4 and CXCL1 were also increased in the BAL of cockroach-sensitized mice in the short-term protocol. Conclusions Mucosal exposure to cockroach extract in the absence of adjuvant induces allergic airway sensitization characterized by AHR, the presence of Th2 cytokines in the lung and eosinophils in the airways.

  16. Seasonal dynamics of nutrient accumulation and partitioning in the perennial C{sub 4}-grasses Miscanthus x giganteus and Spartina cynosuroides

    Energy Technology Data Exchange (ETDEWEB)

    Beale, C.V. [Writtle College, Chelmsford (United Kingdom)] Long, S.P. [Essex Univ., Colchester (United Kingdom). Dept. of Biological and Chemical Sciences

    1997-12-31

    Seasonal variation in the accumulation and partitioning of nitrogen, phosphorus and potassium was determined in both the above-ground and below-ground dry matter of the potential energy crops Miscanthus x giganteus and Spartina cynosuroides. It is desirable from both economic and environmental perspectives that such crops should exhibit a high nutrient use efficiency and minimal nutrient losses to the environment. The N, P and K concentrations in the above-ground dry matter, at final harvest, were 5.0, 0.6 and 12.0 mg g{sup -1} respectively in M. x giganteus and 3.0, 0.4 and 1.0 mg g{sup -1} in S. cynosurodes. Both species exhibited the high N-use efficiency expected of C{sub 4} plants. Nitrate leaching was negligible. At the end of the growing season, nutrients were translocated to the rhizomes and, in the case of M. giganteus, recycled to the soil in shed leaves. Consequently the nutrient content of the crop offtake was low. It was calculated that the N, P and K requirements of a M. x giganteus crop producing an above-ground harvest of 1.5 kg m{sup -2} dry matter would be 9.2, .3 and 20.4 g m{sup -2} respectively. The corresponding nutrient requirements for S. cynosuroides would be 7.5, 1.7 and 8.8 g m{sup -2}. Except for the K requirements of M. x giganteus, the N, P and K demands of both species were less than those of typical graminaceous crops, including maize. (Author)

  17. Utility of mtDNA-COI Barcode Region for Phylogenetic Relationship and Diagnosis of Five Common Pest Cockroaches

    Directory of Open Access Journals (Sweden)

    Saedeh Sadat Hashemi-Aghdam

    2017-06-01

    Full Text Available Background: Cockroaches are of vital importance medically and hygienically as they can disperse human patho­genic agents and are especially responsible for food contamination and spreading of food borne pathogens. In this study, part of mtDNA-COI gene of five common pest cockroaches was tested for diagnostic and phylogenetic pur­poses.Methods: We have described barcode region of mtDNA-COI gene of five cockroach species: Blattella germanica, Blatta orientalis, Periplaneta americana, Shelfordella lateralis, and Supella longipalpa, along with the development of a PCR-RFLP method for rapid detection and differentiation of these health pest species.Results: The PCR generates a single 710 bp-sized amplicon in all cockroach specimens, followed by direct se­quencing. AluI predicted from the sequencing data provided different RFLP profiles among five species. There was a significant intra-species variation within the American cockroach populations, but no genetic variation within other species. Accordingly, phylogenetic analysis demonstrates common monophyly for cockroach families in agreement with conventional taxonomy. However S. longipalpa (Ectobiidae diverged as an early ancestor of other cockroaches and was not associated with other Ectobiidae.Conclusion: The PCR-RFLP protocol might be useful when the conventional taxonomic methods are not able to identify specimens, particularly when only small body parts of specimens are available or they are in a decaying condition. mtDNA-COI gene shows potentially useful for studying phylogenetic relationships of Blattodea order.

  18. Pycnoscelus surinamensis cockroach gut microbiota respond consistently to a fungal diet without mirroring those of fungus-farming termites.

    Science.gov (United States)

    Richards, Callum; Otani, Saria; Mikaelyan, Aram; Poulsen, Michael

    2017-01-01

    The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within this "bioreactor", and as a key factor for the divergence of the termite gut microbiota from the omnivorous cockroach ancestor. The gut microbiota in most termites supports primarily the breakdown of lignocellulose, but the fungus-farming sub-family of higher termites has become similar in gut microbiota to the ancestral omnivorous cockroaches. To assess the importance of a fungus diet as a driver of community structure, we compare community compositions in the guts of experimentally manipulated Pycnoscelus surinamensis cockroaches fed on fungus cultivated by fungus-farming termites. MiSeq amplicon analysis of gut microbiotas from 49 gut samples showed a step-wise gradient pattern in community similarity that correlated with an increase in the proportion of fungal material provided to the cockroaches. Comparison of the taxonomic composition of manipulated communities to that of gut communities of a fungus-feeding termite species showed that although some bacteria OTUs shared by P. surinamensis and the farming termites increased in the guts of cockroaches on a fungal diet, cockroach communities remained distinct from those of termites. These results demonstrate that a fungal diet can play a role in structuring gut community composition, but at the same time exemplifies how original community compositions constrain the magnitude of such change.

  19. Antigenic Determinants of the Bilobal Cockroach Allergen Bla g 2.

    Science.gov (United States)

    Woodfolk, Judith A; Glesner, Jill; Wright, Paul W; Kepley, Christopher L; Li, Mi; Himly, Martin; Muehling, Lyndsey M; Gustchina, Alla; Wlodawer, Alexander; Chapman, Martin D; Pomés, Anna

    2016-01-29

    Bla g 2 is a major indoor cockroach allergen associated with the development of asthma. Antigenic determinants on Bla g 2 were analyzed by mutagenesis based on the structure of the allergen alone and in complex with monoclonal antibodies that interfere with IgE antibody binding. The structural analysis revealed mechanisms of allergen-antibody recognition through cation-π interactions. Single and multiple Bla g 2 mutants were expressed in Pichia pastoris and purified. The triple mutant K132A/K251A/F162Y showed an ∼100-fold reduced capacity to bind IgE, while preserving the native molecular fold, as proven by x-ray crystallography. This mutant was still able to induce mast cell release. T-cell responses were assessed by analyzing Th1/Th2 cytokine production and the CD4(+) T-cell phenotype in peripheral blood mononuclear cell cultures. Although T-cell activating capacity was similar for the KKF mutant and Bla g 2 based on CD25 expression, the KKF mutant was a weaker inducer of the Th2 cytokine IL-13. Furthermore, this mutant induced IL-10 from a non-T-cell source at higher levels that those induced by Bla g 2. Our findings demonstrate that a rational design of site-directed mutagenesis was effective in producing a mutant with only 3 amino acid substitutions that maintained the same fold as wild type Bla g 2. These residues, which were involved in IgE antibody binding, endowed Bla g 2 with a T-cell modulatory capacity. The antigenic analysis of Bla g 2 will be useful for the subsequent development of recombinant allergen vaccines. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  20. Antigenic Determinants of the Bilobal Cockroach Allergen Bla g 2*

    Science.gov (United States)

    Woodfolk, Judith A.; Glesner, Jill; Wright, Paul W.; Kepley, Christopher L.; Li, Mi; Himly, Martin; Muehling, Lyndsey M.; Gustchina, Alla; Wlodawer, Alexander; Chapman, Martin D.; Pomés, Anna

    2016-01-01

    Bla g 2 is a major indoor cockroach allergen associated with the development of asthma. Antigenic determinants on Bla g 2 were analyzed by mutagenesis based on the structure of the allergen alone and in complex with monoclonal antibodies that interfere with IgE antibody binding. The structural analysis revealed mechanisms of allergen-antibody recognition through cation-π interactions. Single and multiple Bla g 2 mutants were expressed in Pichia pastoris and purified. The triple mutant K132A/K251A/F162Y showed an ∼100-fold reduced capacity to bind IgE, while preserving the native molecular fold, as proven by x-ray crystallography. This mutant was still able to induce mast cell release. T-cell responses were assessed by analyzing Th1/Th2 cytokine production and the CD4+ T-cell phenotype in peripheral blood mononuclear cell cultures. Although T-cell activating capacity was similar for the KKF mutant and Bla g 2 based on CD25 expression, the KKF mutant was a weaker inducer of the Th2 cytokine IL-13. Furthermore, this mutant induced IL-10 from a non-T-cell source at higher levels that those induced by Bla g 2. Our findings demonstrate that a rational design of site-directed mutagenesis was effective in producing a mutant with only 3 amino acid substitutions that maintained the same fold as wild type Bla g 2. These residues, which were involved in IgE antibody binding, endowed Bla g 2 with a T-cell modulatory capacity. The antigenic analysis of Bla g 2 will be useful for the subsequent development of recombinant allergen vaccines. PMID:26644466

  1. Ultraviolet-induced changes in cuticular waxes of American cockroaches, Periplaneta americana (L.)(Dictyoptera: Blattaria: Blattidae)

    International Nuclear Information System (INIS)

    Gingrich, J.B.

    1975-01-01

    Dorsal cuticles of fully tanned American cockroaches irradiated with sublethal ultraviolet radiation (254 nm) were compared with nonirradiated cockroaches for wax composition. Of the six waxes compared, four (C 18 , C 19 , C 25 , and 3-methylpentacosane) showed increases of more than 50% in UV-irradiated cockroaches while C 17 and C 27 (heptacosa-6,9-diene) showed smaller increases of 27 and 11%, respectively. Traces of C 20 , C 22 , C 23 , and C 24 hydrocarbons were indicated but these were not compared since their identification has not been substantiated by other authors. The possible explanations of cellular damage vs. stimulated production are discussed. (author)

  2. Insecticidal Properties of Essential Oils and Some of Their Constituents on the Turkestan Cockroach (Blattodea: Blattidae).

    Science.gov (United States)

    Gaire, Sudip; O'Connell, Mary; Holguin, Francisco O; Amatya, Anup; Bundy, Scott; Romero, Alvaro

    2017-04-01

    The Turkestan cockroach, Blatta lateralis (Walker), has become the most important peridomestic species in urban areas of the Southwestern United States. The aim of this study was to evaluate the use of botanical compounds to control this urban pest. We tested the acute toxicity and repellency of six botanical constituents and three essential oils on Turkestan cockroach nymphs. Chemical composition of the essential oils was also determined. Topical and fumigant assays with nymphs showed that thymol was the most toxic essential oil constituent, with a LD50 of 0.34 mg/nymph and a LC50 of 27.6 mg/liter air, respectively. Contact toxicity was also observed in assays with trans-Cinnamaldehyde, eugenol, geraniol, methyl eugenol, and p-Cymene. Methyl eugenol and geraniol had limited fumigant toxicity. The essential oils from red thyme, clove bud, and Java citronella exhibited toxicity against nymphs. Cockroaches avoided fresh dry residues of thymol and essential oils. Chemical analysis of the essential oils confirmed high contents of effective essential oil constituents. Our results demonstrated that essential oils and some of their constituents have potential as eco-friendly insecticides for the management of Turkestan cockroaches. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  3. Energetic Cost of Subacute Chlorpyrifos Intoxication in the German Cockroach (Dictyoptera: Blattellidae)

    DEFF Research Database (Denmark)

    Nielsen, Søren Achim; Jensen, Karl-Martin Vagn; Kristensen, Michael

    2006-01-01

    The energetic cost of a sublethal treatment with chlorpyrifos was estimated by use of direct microcalorimetry to measure metabolic heat in susceptible and resistant strains of the German cockroach Blattella germanica L. Moreover, one of the detoxifcation enzyme systems known to be involved in det...

  4. Diet shapes the gut microbiota of the omnivorous cockroach Blattella germanica.

    Science.gov (United States)

    Pérez-Cobas, Ana Elena; Maiques, Elisa; Angelova, Alexandra; Carrasco, Purificación; Moya, Andrés; Latorre, Amparo

    2015-04-01

    The gut microbiota of insects contributes positively to the physiology of its host mainly by participating in food digestion, protecting against pathogens, or provisioning vitamins or amino acids, but the dynamics of this complex ecosystem is not well understood so far. In this study, we have characterized the gut microbiota of the omnivorous cockroach Blattella germanica by pyrosequencing the hypervariable regions V1-V3 of the 16S rRNA gene of the whole bacterial community. Three diets differing in the protein content (0, 24 and 50%) were tested at two time points in lab-reared individuals. In addition, the gut microbiota of wild adult cockroaches was also analyzed. In contrast to the high microbial richness described on the studied samples, only few species are shared by wild and lab-reared cockroaches, constituting the bacterial core in the gut of B. germanica. Overall, we found that the gut microbiota of B. germanica is highly dynamic as the bacterial composition was reassembled in a diet-specific manner over a short time span, with no-protein diet promoting high diversity, although the highest diversity was found in the wild cockroaches analyzed. We discuss how the flexibility of the gut microbiota is probably due to its omnivorous life style and varied diets. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. Home Sweet Home: How to Build a Madagascar Hissing Cockroach Habitat out of Recycled Materials

    Science.gov (United States)

    Wagler, Ron

    2010-01-01

    Madagascar hissing cockroaches (MHC) are amazing insects that can be an integral part of an effective science learning and teaching environment. MHCs have a fascinating social structure. They make excellent pets, teach students how to properly care for animals, and their large size adds to their "wow" factor. These characteristics make them unique…

  6. First record of the German cockroach Blattella germanica Linnaeus, 1767 in Coquimbo, Coquimbo Region, Chile

    Directory of Open Access Journals (Sweden)

    Natalia Pérez

    2015-08-01

    Full Text Available This study describes the first formal record of the German cockroach in Coquimbo and La Serena, Coquimbo Region, northern Chile. Here, I also briefly discussed the sanitary implications that the occurrence of this insect could have in the Coquimbo Region.

  7. A parasitoid wasp manipulates the drive for walking of its cockroach prey.

    Science.gov (United States)

    Gal, Ram; Libersat, Frederic

    2008-06-24

    The parasitoid wasp A. compressa hunts cockroaches as a live food supply for its offspring. The wasp selectively injects venom into the cerebral ganglia of the prey to induce long-term hypokinesia [1-5], during which the stung cockroach, although not paralyzed, does not initiate spontaneous walking and fails to escape aversive stimuli. This allows the wasp to grab the cockroach by the antenna and walk it to a nest much like a dog on a leash. There, the wasp lays an egg on the prey, seals the nest, and leaves. The stung cockroach, however, does not fight to escape its tomb but rather awaits its fate, being consumed alive by the hatching larva over several days. We investigated whether the venom-induced hypokinesia is a result of an overall decrease in arousal or, alternatively, a specific decrease in the drive to initiate or maintain walking. We found that the venom specifically affects both the threshold for the initiation and the maintenance of walking-related behaviors. Nevertheless, the walking pattern generator itself appears to be intact. We thus report that the venom, rather than decreasing overall arousal, manipulates neuronal centers within the cerebral ganglia that are specifically involved in the initiation and maintenance of walking.

  8. Ecological niche models for four native cockroach species (Blattaria: Blattellidae: Ectobiinae) in the Netherlands

    NARCIS (Netherlands)

    Ciliberti, P.; Jong, de H.; Schouten, M.A.; Verweij, P.A.; Heitmans, W.R.B.

    2009-01-01

    This paper aims at modelling the spatial distribution of the cockroach species Capraiellus panzeri, Ectobius lapponicus, Ectobius pallidus and Ectobius sylvestris within the Netherlands and comparing the habitat preferences of these species. Maxent was used to calculate habitat suitability and to

  9. Ecological niche models for four native cockroach species (Blattaria: Blattellidae:Ectobiinae) in the Netherlands

    NARCIS (Netherlands)

    Ciliberti, P.; de Jong, Herman; Schouten, M.A.; Verweij, P.A.; Heitmans, W.R.B.

    2009-01-01

    This paper aims at modelling the spatial distribution of the cockroach species Capraiellus panzeri, Ectobius lapponicus, Ectobius pallidus and Ectobius sylvestris within the Netherlands and comparing the habitat preferences of these species. Maxent was used to calculate habitat suitability and to

  10. X-irradiation effects on the activity of dehydrogenases in the cockroach, Periplaneta Americana L

    Energy Technology Data Exchange (ETDEWEB)

    Vijayalakshmi, S. (Sri Sathya Sai Inst. of Higher Learning, Anantpur (India))

    1984-05-01

    Sublethal dose of X-irradiation caused an early increase and subsequent normalization in succinate and lactate dehydrogenases of the cockroach, while lethal dose produced an irreversible fall in succinate dehydrogenase and a gradual elevation in lactate dehydrogenase at all post-irradiation periods studied, suggesting dose dependent impairment of aerobic and anaerobic pathways.

  11. Afro-Asian cockroach from Chiapas amber and the lost Tertiary American entomofauna

    Science.gov (United States)

    Vršanský, Peter; Cifuentes-Ruiz, Paulina; Vidlička, Ľubomír; Čiampor, Fedor; Vega, Francisco J.

    2011-10-01

    Cockroach genera with synanthropic species (Blattella, Ectobius, Supella, Periplaneta, Diploptera and ?Blatta), as well as other insects such as honeybees, although natively limited to certain continents nowadays, had circumtropic distribution in the past. The ease of their reintroduction into their former range suggests a post-Early Miocene environmental stress which led to the extinction of cosmopolitan Tertiary entomofauna in the Americas, whilst in Eurasia, Africa and Australia this fauna survived. This phenomenon is demonstrated here on a low diversity (10 spp.) living cockroach genus Supella, which is peculiar for the circumtropical synanthropic brownbanded cockroach S. longipalpa and also for its exclusively free-living cavicolous species restricted to Africa. S. (Nemosupella) miocenica sp. nov. from the Miocene amber of Chiapas in Mexico is a sister species to the living S. mirabilis from the Lower Guinea forests and adjacent savannas. The difference is restricted to the shape of the central macula on the pronotum, and size, which may indicate the around-Miocene origin of the living, extremely polymorphic Supella species and possibly also the isochronic invasion into the Americas. The species also has a number of characteristics of the Asian (and possibly also Australian) uniform genus Allacta (falling within the generic variability of Supella) suggesting Supella is a direct ancestor of the former. The present species is the first significant evidence for incomplete hiati between well defined cockroach genera — a result of the extensive fossil record of the group. The reported specimen is covered by a mycelium of a parasitic fungus Cordyceps or Entomophthora.

  12. Diversity of Trypanosomatids in Cockroaches and the Description of Herpetomonas tarakana sp n.

    Czech Academy of Sciences Publication Activity Database

    Yurchenko, V.; Kostygov, A.; Havlová, J.; Grybchuk-Ieremenko, A.; Ševčíková, T.; Lukeš, Julius; Ševčík, J.; Votýpka, Jan

    2016-01-01

    Roč. 63, č. 2 (2016), s. 198-209 ISSN 1066-5234 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Monoxenous Trypanosomatidae * parasites of cockroaches * taxonomy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.692, year: 2016

  13. Some Guides to Discovery About Elm Trees, Owls, Cockroaches, Earthworms, Cement and Concrete.

    Science.gov (United States)

    Busch, Phyllis S.

    The introduction emphasizes the need for environmental and conservation education, and advocates an inquiry approach. Outdoor resources available to every school are listed. Detailed suggestions are made for investigating cement and concrete, cockroaches, earthworms, elm trees, and owls. In each case general background information and a list of…

  14. Skeletal Pathology of Eastern Grey Kangaroos (Macropus giganteus) Exposed to High Environmental Fluoride Levels in South-Eastern Australia.

    Science.gov (United States)

    Hufschmid, J; Beveridge, I; Coulson, G; Walker, G; Shen, P; Reynolds, E; Charles, J

    2015-01-01

    Significantly elevated bone fluoride concentrations have been reported in a population of eastern grey kangaroos (Macropus giganteus) resident near a fluoride-emitting aluminum smelter in southeastern Australia. This paper describes the skeletal and synovial joint lesions observed post mortem in the same sample of kangaroos (n = 76). The prevalence and severity of skeletal lesions, specifically the formation of multiple, large, smooth exostoses over the diaphysis of long bones (especially, but not exclusively, on the tibia, fibula and metatarsi), were positively associated with bone fluoride concentration. So too were lesions of degenerative joint disease, including periarticular osteophytosis, articular cartilage erosion/ulceration, synovial hyperplasia and joint capsular fibrosis. Joint lesions were most commonly seen in the knee, hock and metatarsophalangeal joints. This is the first study to describe in detail the full range of lesions induced by chronic fluorosis in a marsupial species. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Developing County-level Water Footprints of Biofuel Produced from Switchgrass and Miscanthus x Giganteus in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Wu, May M. [Argonne National Lab. (ANL), Argonne, IL (United States); Chiu, Yi-Wen [Argonne National Lab. (ANL), Argonne, IL (United States)

    2014-09-30

    Perennial grass has been proposed as a potential candidate for producing cellulosic biofuel because of its promising productivity and benefits to water quality, and because it is a non-food feedstock. While extensive research focuses on selecting and developing species and conversion technologies, the impact of grass-based biofuel production on water resources remains less clear. As feedstock growth requires water and the type of water consumed may vary considerably from region to region, water use must be characterized with spatial resolution and on a fuel production basis. This report summarizes a study that assesses the impact of biofuel production on water resource use and water quality at county, state, and regional scales by developing a water footprint of biofuel produced from switchgrass and Miscanthus × giganteus via biochemical conversion.

  16. Genetic variation in Miscanthus x giganteus and the importance of estimating genetic distance tresholds for differentiating clones

    DEFF Research Database (Denmark)

    Glowacka, K; Clark, L; Adhikari, S

    2015-01-01

    Miscanthus × giganteus (Mxg) is an important bioenergy feedstock crop, however, genetic diversity among legacy cultivars may be severely constrained. Only one introduction from Japan to Denmark of this sterile, triploid, vegetatively propagated crop was recorded in the 1930s. We sought to determine...... if the Mxg cultivars in North America were all synonyms, and if they were derived from the European introduction. We used 64 nuclear and five chloroplast simple sequence repeat (SSR) markers to estimate genetic similarity for 27 Mxg accessions from North America, and compared them with six accessions from...... Europe, including the species’ type-specimen. A subset of accessions was also evaluated by restriction-site associated DNA sequencing (RAD-seq). In addition, we assessed the potential of new crosses to increase Mxg genetic diversity by comparing eight new triploid Mxg progeny grown from seed, along...

  17. Bambu laminado colado (Dendrocalamus giganteus) aplicado à treliça plana tipo Howe e à viga retangular

    OpenAIRE

    Lima, Douglas Mateus de

    2013-01-01

    O bambu constitui um material que tem atraído a atenção do meio científico há décadas e muitas aplicações do uso desta gramínea ao longo dos últimos séculos têm sido relatadas na literatura. Entre tais aplicações, destacam-se a fabricação de laminados colados de bambu que, dentro do contexto deste estudo, podem ser aplicados na construção civil. Deste modo, esse trabalho teve como objetivo o estudo de laminados colados de bambu da espécie Dendrocalamus giganteus aplicados na fa...

  18. Symbiotic essential amino acids provisioning in the American cockroach, Periplaneta americana (Linnaeus under various dietary conditions

    Directory of Open Access Journals (Sweden)

    Paul A. Ayayee

    2016-05-01

    Full Text Available Insect gut microbes have been shown to provide nutrients such as essential amino acids (EAAs to their hosts. How this symbiotic nutrient provisioning tracks with the host’s demand is not well understood. In this study, we investigated microbial essential amino acid (EAA provisioning in omnivorous American cockroaches (Periplaneta americana, fed low-quality (LQD and comparatively higher-quality dog food (DF diets using carbon stable isotope ratios of EAAs (δ13CEAA. We assessed non-dietary EAA input, quantified as isotopic offsets (Δ13C between cockroach (δ13CCockroach EAA and dietary (δ13CDietary EAA EAAs, and subsequently determined biosynthetic origins of non-dietary EAAs in cockroaches using 13C-fingerprinting with dietary and representative bacterial and fungal δ13CEAA. Investigation of biosynthetic origins of de novo non-dietary EAAs indicated bacterial origins of EAA in cockroach appendage samples, and a mixture of fungal and bacterial EAA origins in gut filtrate samples for both LQD and DF-fed groups. We attribute the bacteria-derived EAAs in cockroach appendages to provisioning by the fat body residing obligate endosymbiont, Blattabacterium and gut-residing bacteria. The mixed signatures of gut filtrate samples are attributed to the presence of unassimilated dietary, as well as gut microbial (bacterial and fungal EAAs. This study highlights the potential impacts of dietary quality on symbiotic EAA provisioning and the need for further studies investigating the interplay between host EAA demands, host dietary quality and symbiotic EAA provisioning in response to dietary sufficiency or deficiency.

  19. [Enterobacteria isolated from cockroaches (Periplaneta americana) captured in a Brazilian hospital].

    Science.gov (United States)

    Prado, Marinésia A; Pimenta, Fabiana C; Hayashid, Miyeko; Souza, Paula R; Pereira, Milca S; Gir, Elucir

    2002-02-01

    To isolate and identify microorganisms from cockroaches that were captured in a public hospital and to test the antimicrobial susceptibility of these microorganisms. Cockroaches were captured in the morning and at night. They were placed in flasks rinsed with 70% alcohol, transferred to sterilized flasks, and then taken to the laboratory. Only cockroaches captured whole and live were utilized for the study. After being immobilized at 0 degree C, each cockroach was placed in a test tube with sterile saline solution (0.8%) and then homogenized. The resulting solution was then placed in the following five culture media: MacConkey agar, nutrient broth, brain-heart infusion agar, Sabouraud agar, and mannitol. The cultures were examined using a stereomicroscope, and colony-forming units were counted. The disk diffusion test was used to determine antimicrobial susceptibility. We found a 56% prevalence of enterobacteria and an 18% prevalence of coagulase-negative staphylococci. Fifteen species of enterobacteria were identified. The most frequent were Klebsiella pneumoniae (17%), Enterobacter aerogenes (14%), Serratia marcescens (13%), Hafnia alvei (12%), Enterobacter gergoviae and Enterobacter cloacae (each 9%), and Serratia spp. (6%). Both the enterobacteria and the coagulase-negative staphylococci showed significant resistance to antimicrobials, including oxacillin. The prevalence of enteropathogenic bacteria and coagulase-negative staphylococci isolated from Periplaneta americana cockroaches in the studied hospital reflects the weakness of the measures adopted both for vector control and for antimicrobial use. The results show the need to implement effective health-institution programs focusing on hygiene and the rational use of antimicrobials.

  20. Phylogeny of cockroaches (Insecta, Dictyoptera, Blattodea), with placement of aberrant taxa and exploration of out-group sampling

    DEFF Research Database (Denmark)

    Djernæs, Marie; Klass, Klaus-Dieter; Picker, Mike D.

    2012-01-01

    We addressed the phylogeny of cockroaches using DNA sequence data from a broad taxon sample of Dictyoptera and other non-endopterygotan insect orders. We paid special attention to several taxa in which relationships are controversial, or where no molecular evidence has been used previously......: Nocticolidae, a family of small, often cave-dwelling cockroaches, has been suggested to be the sister group of the predaceous Mantodea or of the cockroach family Polyphagidae; Lamproblatta, traditionally placed in Blattidae, has recently been given family status and placed as sister to Polyphagidae......; and Saltoblattella montistabularis Bohn, Picker, Klass & Colville, a jumping cockroach, which has not yet been included in any phylogenetic studies. We used mitochondrial (COI + COII and 16S) and nuclear (18S and 28S) genes, and analysed the data using Bayesian inference (BI) and maximum likelihood (ML...

  1. Pycnoscelus surinamensis cockroach gut microbiota respond consistently to a fungal diet without mirroring those of fungus-farming termites

    DEFF Research Database (Denmark)

    Richards, Callum; Otani, Saria; Mikaelyan, Aram

    2017-01-01

    The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within...... this “bioreactor”, and as a key factor for the divergence of the termite gut microbiota from the omnivorous cockroach ancestor. The gut microbiota in most termites supports primarily the breakdown of lignocellulose, but the fungus-farming subfamily of higher termites has become similar in gut microbiota...... to the ancestral omnivorous cockroaches. To assess the importance of a fungus diet as a driver of community structure, we compare community compositions in the guts of experimentally manipulated Pycnoscelus surinamensis cockroaches fed on fungus cultivated by fungus-farming termites. MiSeq amplicon analysis of gut...

  2. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis

    Directory of Open Access Journals (Sweden)

    Fisher Nathan A

    2012-06-01

    Full Text Available Abstract Background Burkholderia pseudomallei and Burkholderia mallei are gram-negative pathogens responsible for the diseases melioidosis and glanders, respectively. Both species cause disease in humans and animals and have been designated as category B select agents by the Centers for Disease Control and Prevention (CDC. Burkholderia thailandensis is a closely related bacterium that is generally considered avirulent for humans. While it can cause disease in rodents, the B. thailandensis 50% lethal dose (LD50 is typically ≥ 104-fold higher than the B. pseudomallei and B. mallei LD50 in mammalian models of infection. Here we describe an alternative to mammalian hosts in the study of virulence and host-pathogen interactions of these Burkholderia species. Results Madagascar hissing cockroaches (MH cockroaches possess a number of qualities that make them desirable for use as a surrogate host, including ease of breeding, ease of handling, a competent innate immune system, and the ability to survive at 37°C. MH cockroaches were highly susceptible to infection with B. pseudomallei, B. mallei and B. thailandensis and the LD50 was 50 for Escherichia coli in MH cockroaches was >105 cfu. B. pseudomallei, B. mallei, and B. thailandensis cluster 1 type VI secretion system (T6SS-1 mutants were all attenuated in MH cockroaches, which is consistent with previous virulence studies conducted in rodents. B. pseudomallei mutants deficient in the other five T6SS gene clusters, T6SS-2 through T6SS-6, were virulent in both MH cockroaches and hamsters. Hemocytes obtained from MH cockroaches infected with B. pseudomallei harbored numerous intracellular bacteria, suggesting that this facultative intracellular pathogen can survive and replicate inside of MH cockroach phagocytic cells. The hemolymph extracted from these MH cockroaches also contained multinuclear giant cells (MNGCs with intracellular B. pseudomallei, which indicates that infected hemocytes can

  3. Larvae of the parasitoid wasp Ampulex compressa sanitize their host, the American cockroach, with a blend of antimicrobials

    OpenAIRE

    Herzner, Gudrun; Schlecht, Anja; Dollhofer, Veronika; Parzefall, Christopher; Harrar, Klaus; Kreuzer, Andreas; Pilsl, Ludwig; Ruther, Joachim

    2013-01-01

    Food resources contaminated with spoilage or pathogenic microorganisms pose severe problems to all higher organisms. Here, we describe a food-hygienic strategy of the emerald cockroach wasp Ampulex compressa. The wasp larvae develop on and inside the American cockroach Periplaneta americana, a host that can harbor various putrefactive microbes, as well as human and insect pathogens. From P. americana, we isolated the Gram-negative bacterium Serratia marcescens, which is a potent entomopathoge...

  4. Physicochemical conditions, metabolites and community structure of the bacterial microbiota in the gut of wood-feeding cockroaches (Blaberidae: Panesthiinae).

    Science.gov (United States)

    Bauer, Eugen; Lampert, Niclas; Mikaelyan, Aram; Köhler, Tim; Maekawa, Kiyoto; Brune, Andreas

    2015-02-01

    While the gut microbiota of termites and its role in symbiotic digestion have been studied for decades, little is known about the bacteria colonizing the intestinal tract of the distantly related wood-feeding cockroaches (Blaberidae: Panesthiinae). Here, we show that physicochemical gut conditions and microbial fermentation products in the gut of Panesthia angustipennis resemble that of other cockroaches. Microsensor measurements confirmed that all gut compartments were anoxic at the center and had a slightly acidic to neutral pH and a negative redox potential. While acetate dominated in all compartments, lactate and hydrogen accumulated only in the crop. The high, hydrogen-limited rates of methane emission from living cockroaches were in agreement with the restriction of F420-fluorescent methanogens to the hindgut. The gut microbiota of both P. angustipennis and Salganea esakii differed strongly between compartments, with the highest density and diversity in the hindgut, but similarities between homologous compartments of both cockroaches indicated a specificity of the microbiota for their respective habitats. While some lineages were most closely related to the gut microbiota of omnivorous cockroaches and wood- or litter-feeding termites, others have been encountered also in vertebrates, reinforcing the hypothesis that strong environmental selection drives community structure in the cockroach gut. © FEMS 2014. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. Pectinase production by Aspergillus giganteus in solid-state fermentation: optimization, scale-up, biochemical characterization and its application in olive-oil extraction.

    Science.gov (United States)

    Ortiz, Gastón E; Ponce-Mora, María C; Noseda, Diego G; Cazabat, Gabriela; Saravalli, Celina; López, María C; Gil, Guillermo P; Blasco, Martín; Albertó, Edgardo O

    2017-02-01

    The application of pectinases in industrial olive-oil processes is restricted by its production cost. Consequently, new fungal strains able to produce higher pectinase titers are required. The aim of this work was to study the capability of Aspergillus giganteus NRRL10 to produce pectinolytic enzymes by SSF and evaluate the application of these in olive-oil extraction. A. giganteus was selected among 12 strains on the basis of high pectinolytic activity and stability. A mixture composed by wheat bran, orange, and lemon peels was selected as the best substrate for enzyme production. Statistical analyses of the experimental design indicated that pH, temperature, and CaCl 2 are the main factors that affect the production. Subsequently, different aeration flows were tested in a tray reactor; the highest activity was achieved at 20 L min -1 per kilogram of dry substrate (kgds). Finally, the pectinolytic enzymes from A. giganteus improved the oil yield and rheological characteristics without affecting oil chemical properties.

  6. The evaluation of growth and phytoextraction potential of Miscanthus x giganteus and Sida hermaphrodita on soil contaminated simultaneously with Cd, Cu, Ni, Pb, and Zn.

    Science.gov (United States)

    Kocoń, Anna; Jurga, Beata

    2017-02-01

    One of the cheapest, environmentally friendly methods for cleaning an environment polluted by heavy metals is phytoextraction. It builds on the uptake of pollutants from the soil by the plants, which are able to grow under conditions of high concentrations of toxic metals. The aim of this work was to assess the possibility of growing and phytoextraction potential of Miscanthus x giganteus and Sida hermaphrodita cultivated on two different soils contaminated with five heavy metals simultaneously: Cd, Cu, Ni, Pb, and Zn. A 3-year microplot experiment with two perennial energy crops, M. x giganteus and S. hermaphrodita, was conducted in the experimental station of IUNG-PIB in Poland (5° 25' N, 21° 58 'E), in the years of 2008-2010. Miscanthus was found more tolerant to concomitant soil contamination with heavy metals and produced almost double biomass than Sida in all three tested years, independent of soil type. Miscanthus collected greater amount of heavy metals (except for cadmium) in the biomass than Sida. Both energy crops absorb high levels of zinc, lower levels of lead, copper, and nickel, and absorbed cadmium at least, generally more metals were taken from the sandy soil, where plants also yielded better. Photosynthesis net rate of Miscanthus was on average 40% higher compared to Sida. Obtained results indicate that M. x giganteus and S. hermaphrodita can successfully be grown on moderately contaminated soil with heavy metals.

  7. Researches Regarding the Adaptation Process of the Species Miscanthus Giganteus under the Conditions of Fly Ash Deposit from Utvin, Timis County

    Directory of Open Access Journals (Sweden)

    Benoni Lixandru

    2013-05-01

    Full Text Available Miscanthus giganteus is a large, perennial (up to 20 years grass hybrid of M. sinensis and M. sacchariflorus native to Japan. Is a C4 carbon fixation plant, and thus exhibits greater photosynthetic efficiency and lower water use requirements than other kinds of plants. It has very low nutritional requirements – it has high nitrogen use efficiency and therefore is capable of growing well on barren land without the aid of heavy fertilization. M. giganteus is a sterile hybrid, therefore propagates vegetative through its rhizomes and that it is a completely non-invasive species. In this paper are presented the results of this grass species growing on fly ash deposit Utvin after the first year from the planting. Order to stimulate the process of vegetative from the first year, have used three different fertilizing: with sewage sludge, with cattle manure and mineral supplement such as N.P.K. We have also provided an adequate irrigation during dry periods of the summer. The best germination percentage was obtained in variants fertilized with sewage sludge and manure of cattle. Further the same variations recorded a good growth rate and higher biomass production. However, good production of biomass produced in the first year of all variants show a good adaptability of the species M. giganteus to arid biotope conditions of the fly ash dump.

  8. Evaluation of sublethal effects of polymer-based essential oils nanoformulation on the german cockroach.

    Science.gov (United States)

    González, Jorge Werdin; Yeguerman, Cristhian; Marcovecchio, Diego; Delrieux, Claudio; Ferrero, Adriana; Band, Beatriz Fernández

    2016-08-01

    The German cockroach, Blattella germanica (L.), is a serious household and public health pest worldwide. The aim of the present study was to evaluate the sublethal activity of polymer-based essential oils (EOs) nanoparticles (NPs) on adults of B. germanica. The LC50 and LC25 for contact toxicity were determined. To evaluate the repellency of EOs and NPs at LC25, a software was specially created in order to track multiple insects on just-recorded videos, and generate statistics using the obtained information. The effects of EOs and NPs at LC25 and LC50 on the nutritional physiology were also evaluated. The results showed that NPs exerted sublethal effects on the German cockroach, since these products enhance the repellent effects of the EOs and negatively affected the nutritional indices and the feeding deterrence index. Copyright © 2016 Elsevier Inc. All rights reserved.

  9. Characterization of the juvenile hormone pathway in the viviparous cockroach, Diploptera punctata.

    Directory of Open Access Journals (Sweden)

    Juan Huang

    Full Text Available Juvenile hormones (JHs are key regulators of insect development and reproduction. The JH biosynthetic pathway is known to involve 13 discrete enzymatic steps. In the present study, we have characterized the JH biosynthetic pathway in the cockroach Diploptera punctata. The effect of exogenous JH precursors on JH biosynthesis was also determined. Based on sequence similarity, orthologs for the genes directly involved in the pathway were cloned, and their spatial and temporal transcript profiles were determined. The effect of shutting down the JH pathway in adult female cockroaches was studied by knocking down genes encoding HMG-CoA reductase (HMGR and Juvenile hormone acid methyltransferase (JHAMT. As a result, oocyte development slowed as a consequence of reduction in JH biosynthesis. Oocyte length, fat body transcription of Vg and ovarian vitellin content significantly decreased. In addition, silencing HMGR and JHAMT resulted in a decrease in the transcript levels of other genes in the pathway.

  10. A wasp manipulates neuronal activity in the sub-esophageal ganglion to decrease the drive for walking in its cockroach prey.

    Directory of Open Access Journals (Sweden)

    Ram Gal

    Full Text Available BACKGROUND: The parasitoid Jewel Wasp hunts cockroaches to serve as a live food supply for its offspring. The wasp stings the cockroach in the head and delivers a cocktail of neurotoxins directly inside the prey's cerebral ganglia. Although not paralyzed, the stung cockroach becomes a living yet docile 'zombie', incapable of self-initiating spontaneous or evoked walking. We show here that such neuro-chemical manipulation can be attributed to decreased neuronal activity in a small region of the cockroach cerebral nervous system, the sub-esophageal ganglion (SEG. A decrease in descending permissive inputs from this ganglion to thoracic central pattern generators decreases the propensity for walking-related behaviors. METHODOLOGY AND PRINCIPAL FINDINGS: We have used behavioral, neuro-pharmacological and electrophysiological methods to show that: (1 Surgically removing the cockroach SEG prior to wasp stinging prolongs the duration of the sting 5-fold, suggesting that the wasp actively targets the SEG during the stinging sequence; (2 injecting a sodium channel blocker, procaine, into the SEG of non-stung cockroaches reversibly decreases spontaneous and evoked walking, suggesting that the SEG plays an important role in the up-regulation of locomotion; (3 artificial focal injection of crude milked venom into the SEG of non-stung cockroaches decreases spontaneous and evoked walking, as seen with naturally-stung cockroaches; and (4 spontaneous and evoked neuronal spiking activity in the SEG, recorded with an extracellular bipolar microelectrode, is markedly decreased in stung cockroaches versus non-stung controls. CONCLUSIONS AND SIGNIFICANCE: We have identified the neuronal substrate responsible for the venom-induced manipulation of the cockroach's drive for walking. Our data strongly support previous findings suggesting a critical and permissive role for the SEG in the regulation of locomotion in insects. By injecting a venom cocktail directly into the

  11. Pycnoscelus surinamensis cockroach gut microbiota respond consistently to a fungal diet without mirroring those of fungus-farming termites.

    Directory of Open Access Journals (Sweden)

    Callum Richards

    Full Text Available The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within this "bioreactor", and as a key factor for the divergence of the termite gut microbiota from the omnivorous cockroach ancestor. The gut microbiota in most termites supports primarily the breakdown of lignocellulose, but the fungus-farming sub-family of higher termites has become similar in gut microbiota to the ancestral omnivorous cockroaches. To assess the importance of a fungus diet as a driver of community structure, we compare community compositions in the guts of experimentally manipulated Pycnoscelus surinamensis cockroaches fed on fungus cultivated by fungus-farming termites. MiSeq amplicon analysis of gut microbiotas from 49 gut samples showed a step-wise gradient pattern in community similarity that correlated with an increase in the proportion of fungal material provided to the cockroaches. Comparison of the taxonomic composition of manipulated communities to that of gut communities of a fungus-feeding termite species showed that although some bacteria OTUs shared by P. surinamensis and the farming termites increased in the guts of cockroaches on a fungal diet, cockroach communities remained distinct from those of termites. These results demonstrate that a fungal diet can play a role in structuring gut community composition, but at the same time exemplifies how original community compositions constrain the magnitude of such change.

  12. Cross-reactive IgE antibody responses to tropomyosins from Ascaris lumbricoides and cockroach.

    Science.gov (United States)

    Santos, Ana Beatriz R; Rocha, Gutemberg M; Oliver, Constance; Ferriani, Virgínia P L; Lima, Rodrigo C; Palma, Mário S; Sales, Valéria S F; Aalberse, Rob C; Chapman, Martin D; Arruda, L Karla

    2008-04-01

    Evidence indicates that infection with Ascaris lumbricoides may promote development of allergy and asthma. To study the role of tropomyosin, a pan-allergen in invertebrates, in IgE responses to A lumbricoides. Recombinant A lumbricoides and Periplaneta americana tropomyosins were expressed in Pichia pastoris. Levels of IgE to tropomyosins from A lumbricoides and P americana were determined by chimeric ELISA in sera from 119 children living in a parasite-endemic area and 112 patients with cockroach allergy from the allergy clinics. Presence of tropomyosin in A lumbricoides larvae at L3 stage was evaluated by immunofluorescence using mAb 1A6, directed against mite tropomyosin. Molecular modeling of P americana and A lumbricoides tropomyosins was performed by using the MODELLER program. A lumbricoides tropomyosin showed 69% to 98% sequence identity to tropomyosins from other invertebrates. The predicted structure of A lumbricoides tropomyosin was similar to that of P americana tropomyosin and showed the characteristic coiled-coil structure. Strong correlation was found for IgE antibodies to tropomyosins from A lumbricoides and P americana in sera from children living in a parasite-endemic area and from patients with cockroach allergy. Larvae of A lumbricoides reacted strongly with mAb 1A6. Tropomyosin induces IgE responses in A lumbricoides-infected children and in patients allergic to cockroach.

  13. Analysis of Cockroach Fauna and Frequency in Human Residential Habitats of North of Isfahan, Iran

    Directory of Open Access Journals (Sweden)

    Dehghani R.1 PhD,

    2016-08-01

    Full Text Available Aims Considering the medical significance of cockroaches as insect vectors of food toxicities, and triggering allergy in respiratory system and skin, this survey was conducted to study the frequency of infestation and their effective factors in Shahin Shahr, Iran. Materials & Methods This cross-sectional descriptive study was carried out in 2010 in Shahin Shahr, Isfahan, Iran. Data gathering instrument was a researcher-made questionnaire regarding to the research aims. Data were analyzed by SPSS 11.5 software using Chi square and Fisher exact tests. Findings 675 of 1000 studied houses (67.5% were infested by all life stages of the cockroaches and 32.5% had no infestation. 46% of infested houses had few, 30% had medium and 24% had high infestation. the bathrooms and toilets were recognized as the most infested places (41%. There were significant relationships between infestation of houses and the age of building (p<0.001, the type of building (p=0.009 and the education level of the family (p<0.001. Significant difference was found between houses equipped their doors and windows by tulles and without tulles (p=0.03. Most infection was found in houses sheltering 5 and more people (72.3%. Significant correlation was found between the infection and the number of family members (p=0.0012. Conclusion Infestation rate of cockroaches in Shahin Shahr houses is high and is mostly of P. americana species.

  14. Species Delimitation and Phylogenetic Relationships in Ectobiid Cockroaches (Dictyoptera, Blattodea from China.

    Directory of Open Access Journals (Sweden)

    Yanli Che

    Full Text Available We collected Ectobiidae cockroach specimens from 44 locations in the south of the Yangtze valley. We obtained 297 COI sequences specimens and carried out phylogenetic and divergence dating analyses, as well as species delimitation analysis using a General Mixed Yule Coalescent (GMYC framework. The intraspecific and interspecific sequence divergence in Ectobiidae cockroaches ranged from 0.0 to 7.0% and 4.6 to 30.8%, respectively. GMYC analysis resulted in 53 (confidence interval: 37-65 entities (likelihood ratio = 103.63 including 14 downloaded species. The COI GMYC groups partly corresponded to the ectobiid species and 52 ectobiid species were delimited successfully based on the combination of GMYC result with morphological information. We used the molecular data and 6 cockroach fossil calibrations to obtain a preliminary estimate of the timescale of ectobiid evolution. The major subfamilies in the group were found to have diverged between ~125-110 Ma, and morphospecies pairs were found to have diverged ~10 or more Ma.

  15. De Novo Transcriptome Analysis and Detection of Antimicrobial Peptides of the American Cockroach Periplaneta americana (Linnaeus).

    Science.gov (United States)

    Kim, In-Woo; Lee, Joon Ha; Subramaniyam, Sathiyamoorthy; Yun, Eun-Young; Kim, Iksoo; Park, Junhyung; Hwang, Jae Sam

    2016-01-01

    Cockroaches are surrogate hosts for microbes that cause many human diseases. In spite of their generally destructive nature, cockroaches have recently been found to harbor potentially beneficial and medically useful substances such as drugs and allergens. However, genomic information for the American cockroach (Periplaneta americana) is currently unavailable; therefore, transcriptome and gene expression profiling is needed as an important resource to better understand the fundamental biological mechanisms of this species, which would be particularly useful for the selection of novel antimicrobial peptides. Thus, we performed de novo transcriptome analysis of P. americana that were or were not immunized with Escherichia coli. Using an Illumina HiSeq sequencer, we generated a total of 9.5 Gb of sequences, which were assembled into 85,984 contigs and functionally annotated using Basic Local Alignment Search Tool (BLAST), Gene Ontology (GO), and Kyoto Encyclopedia of Genes and Genomes (KEGG) database terms. Finally, using an in silico antimicrobial peptide prediction method, 86 antimicrobial peptide candidates were predicted from the transcriptome, and 21 of these peptides were experimentally validated for their antimicrobial activity against yeast and gram positive and -negative bacteria by a radial diffusion assay. Notably, 11 peptides showed strong antimicrobial activities against these organisms and displayed little or no cytotoxic effects in the hemolysis and cell viability assay. This work provides prerequisite baseline data for the identification and development of novel antimicrobial peptides, which is expected to provide a better understanding of the phenomenon of innate immunity in similar species.

  16. Functional symbiosis and communication in microbial ecosystems. The case of wood-eating termites and cockroaches.

    Science.gov (United States)

    Berlanga, Mercedes

    2015-09-01

    Animal hosts typically have strong specificity for microbial symbionts and their functions. The symbiotic relationships have enhanced the limited metabolic networks of most eukaryotes by contributing several prokaryotic metabolic capabilities, such as methanogenesis, chemolithoautotrophy, nitrogen assimilation, etc. This review will examine the characteristics that determine bacterial "fidelity" to certain groups of animals (e.g., xylophagous insects, such as termites and cockroaches) over generations and throughout evolution. The hindgut bacteria of wood-feeding termites and cockroaches belong to several phyla, including Proteobacteria, especially Deltaproteobacteria, Bacteroidetes, Firmicutes, Actinomycetes, Spirochetes, Verrucomicrobia, and Actinobacteria, as detected by 16S rRNA. Termites effectively feed on many types of lignocelluloses assisted by their gut microbial symbionts. Although the community structures differ between the hosts (termites and cockroaches), with changes in the relative abundances of particular bacterial taxa, the composition of the bacterial community could reflect at least in part the host evolution in that the microbiota may derive from the microbiota of a common ancestor. Therefore, factors other than host phylogeny, such as diet could have had strong influence in shaping the bacterial community structure. Copyright© by the Spanish Society for Microbiology and Institute for Catalan Studies.

  17. The orange spotted cockroach (Blaptica dubia, Serville 1839) is a permissive experimental host for Francisella tularensis

    Science.gov (United States)

    Eklund, Bridget E.; Mahdi, Osama; Huntley, Jason F.; Collins, Elliot; Martin, Caleb; Horzempa, Joseph; Fisher, Nathan A.

    2018-01-01

    Francisella tularensis is a zoonotic bacterial pathogen that causes severe disease in a wide range of host animals, including humans. Well-developed murine models of F. tularensis pathogenesis are available, but they do not meet the needs of all investigators. However, researchers are increasingly turning to insect host systems as a cost-effective alternative that allows greater increased experimental throughput without the regulatory requirements associated with the use of mammals in biomedical research. Unfortunately, the utility of previously-described insect hosts is limited because of temperature restriction, short lifespans, and concerns about the immunological status of insects mass-produced for other purposes. Here, we present a novel host species, the orange spotted (OS) cockroach (Blaptica dubia), that overcomes these limitations and is readily infected by F. tularensis. Intrahemocoel inoculation was accomplished using standard laboratory equipment and lethality was directly proportional to the number of bacteria injected. Progression of infection differed in insects housed at low and high temperatures and F. tularensis mutants lacking key virulence components were attenuated in OS cockroaches. Finally, antibiotics were delivered to infected OS cockroaches by systemic injection and controlled feeding; in the latter case, protection correlated with oral bioavailability in mammals. Collectively, these results demonstrate that this new host system provides investigators with a new tool capable of interrogating F. tularensis virulence and immune evasion in situations where mammalian models are not available or appropriate, such as undirected screens of large mutant libraries. PMID:29578544

  18. New predatory cockroaches (Insecta: Blattaria: Manipulatoridae fam.n.) from the Upper Cretaceous Myanmar amber

    Science.gov (United States)

    Vršanský, Peter; Bechly, Günter

    2015-04-01

    We describe a new extinct lineage Manipulatoridae (new family) of cockroaches from the Upper Cretaceous (Cenomanian) amber of Myanmar. Manipulator modificaputis gen. et sp. n. is a morphologically unique extinct cockroach that represents the first (of a total of 29 known worldwide) cockroach family reported exclusively from the Myanmar amber. This family represents an early side branch of the stem group of Mantodea (most probably a sister group of Eadiidae within Blattaria/Corydioidea) because it has some synapomorphies with the Mantodea (including the stem group and Eadiidae). This family also retains symplesiomorphies that exclude a position in the crown group, and furthermore has unique autapomorphies that exclude a position as a direct ancestor of Mantodea. The unique adaptations such as strongly elongated extremities and freely movable head on a long neck suggest that these animals were pursuit predators. Five additional specimens (including two immatures) reported from the Myanmar amber suggest that this group was relatively rare but belonged to the indigenous and autochthonous inhabitants of the ancient amber forest of the Myanmar region.

  19. Smaller and bolder prey snails have higher survival in staged encounters with the sea starPisaster giganteus.

    Science.gov (United States)

    Foster, William C; Armstrong, Connor M; Chism, Gregory T; Pruitt, Jonathan N

    2017-12-01

    Temporally consistent individual differences in behavior, also known as animal personality, can have large impacts on individual fitness. Here, we explore the degree to which individual differences in anti-predator response (or boldness) influence survival rates in groups of snails Chlorostoma funebralis when they encounter a predatory sea star Pisaster giganteus . The snail C. funebralis shows consistent individual variation in predator response where some fearful snails actively flee bodies of water occupied by predators whereas bolder snails consistently do not. We show here that bold snails are significantly more likely to survive encounters with a predatory sea star and, somewhat counterintuitively, fearful snails actually suffer higher mortality rates. We also found that smaller snails and those occurring at higher experimental densities experienced higher per capita survival rates. Positive effects of prey boldness on survival are not uncommonly reported in the animal personality literature; however, such results are inconsistent with classic animal personality theory borrowed from the optimal foraging literature. The findings herein add to the growing body of evidence that consistent individual differences in behavior can impact predator-prey interactions and that boldness is potentially under positive predator-driven selection in some systems.

  20. Factors affecting the occurrence of enteritis in 10- to 12-month-old eastern grey kangaroos (Macropus giganteus).

    Science.gov (United States)

    Kido, Nobuhide; Tanaka, Sohei; Wada, Yuko; Sato, Sumito

    2018-02-16

    Eastern grey kangaroos (Macropus giganteus) younger than 19 months at Kanazawa Zoological Gardens, Japan, frequently died of enteritis. The main cause of death was coccidiosis. This study aimed to reveal retrospectively the clinical features of enteritis and factors contributing to its high occurrence. In addition, haematological and serum biochemical parameters in kangaroos younger than 24 months were analyzed. The findings suggested that enteritis occurrence was higher in 10- to 12-month-old kangaroos than other ages and during seasons with high temperature and humidity than during seasons with low temperature and humidity. The haematological and serum biochemical analyses showed decreases in glucose, total cholesterol, calcium, and triglyceride levels at approximately 10 months of age. Joeys emerge from their mother's pouch at 8 months of age and permanently leave it at approximately 10 months of age. Subsequently, the joeys are exposed to the external environment and infectious agents. Although the joeys continue suckling until 13-19 months of age, the joeys start to eat the similar feed to the adult and their nutritional status may change at approximately 10 months of age. Seasonal influences, species behavior, and shifts in dietary composition are proposed to be contributory to the increased occurrence of enteritis between 10 and 12 months of age. © 2018 Wiley Periodicals, Inc.

  1. Identification and isolation of a novel herpesvirus in a captive mob of eastern grey kangaroos (Macropus giganteus).

    Science.gov (United States)

    Smith, Joseph A; Wellehan, James F X; Pogranichniy, Roman M; Childress, April L; Landolfi, Jennifer A; Terio, Karen A

    2008-06-22

    A novel herpesvirus was detected in a captive mob of eastern grey kangaroos (Macropus giganteus) during diagnostic workup for individuals with ulcerative cloacitis. Virus was initially detected in tissues using a consensus herpesvirus PCR. No viral inclusions or particles had been evident in routine histologic or transmission electron microscopic sections of cloacal lesions. Virus was isolated from samples and transmission electron microscopy of the resulting isolates confirmed that the virus was morphologically consistent with a herpesvirus. Nucleotide sequencing of the PCR product from tissue samples and from the isolates revealed that the virus was in the subfamily Gammaherpesvirinae and was distinct from other known herpesviruses. The correlation between the lesions and the novel virus remains unknown. Two herpesviruses, both in the subfamily Alphaherpesvirinae, have previously been described in macropods and are known to cause systemic clinical disease. This is the first reported gammaherpesvirus within the order Marsupialia, and may provide valuable information regarding the evolution and phylogeny of this virus family. Based on current herpesvirus nomenclature convention, the authors propose the novel herpesvirus be named Macropodid herpesvirus 3 (MaHV-3).

  2. Purification and Characterization of a Unique Pectin Lyase from Aspergillus giganteus Able to Release Unsaturated Monogalacturonate during Pectin Degradation

    Directory of Open Access Journals (Sweden)

    Danielle Biscaro Pedrolli

    2014-01-01

    Full Text Available A pectin lyase, named PLIII, was purified to homogeneity from the culture filtrate of Aspergillus giganteus grown in submerged culture containing orange peel waste as carbon source. PLIII was able to digest apple pectin and citrus pectins with different degrees of methyl esterification. Interestingly, the PLIII activity was stimulated in the presence of some divalent cations including Pb2+ and was not significantly affected by Hg2+. Like other pectin lyases, PLIII is stimulated by but is not dependent on Ca2+. The main soluble product released during the degradation of pectic substances promoted by the PLIII is compatible with an unsaturated monogalacturonate. PLIII is a unique enzyme able to release unsaturated monogalacturonate as the only soluble product during the degradation of pectic substances; therefore, PLIII was classified as an exo-pectin lyase. To our knowledge, this is the first characterization of an exo-pectin lyase. The PLIII described in this work is potentially useful for ethanol production from pectin-rich biomass, besides other common applications for alkaline pectinases like preparation of textile fibers, coffee and tea fermentation, vegetable oil extraction, and the treatment of pulp in papermaking.

  3. Purification and Characterization of a Unique Pectin Lyase from Aspergillus giganteus Able to Release Unsaturated Monogalacturonate during Pectin Degradation

    Science.gov (United States)

    Carmona, Eleonora Cano

    2014-01-01

    A pectin lyase, named PLIII, was purified to homogeneity from the culture filtrate of Aspergillus giganteus grown in submerged culture containing orange peel waste as carbon source. PLIII was able to digest apple pectin and citrus pectins with different degrees of methyl esterification. Interestingly, the PLIII activity was stimulated in the presence of some divalent cations including Pb2+ and was not significantly affected by Hg2+. Like other pectin lyases, PLIII is stimulated by but is not dependent on Ca2+. The main soluble product released during the degradation of pectic substances promoted by the PLIII is compatible with an unsaturated monogalacturonate. PLIII is a unique enzyme able to release unsaturated monogalacturonate as the only soluble product during the degradation of pectic substances; therefore, PLIII was classified as an exo-pectin lyase. To our knowledge, this is the first characterization of an exo-pectin lyase. The PLIII described in this work is potentially useful for ethanol production from pectin-rich biomass, besides other common applications for alkaline pectinases like preparation of textile fibers, coffee and tea fermentation, vegetable oil extraction, and the treatment of pulp in papermaking. PMID:25610636

  4. Profile of antimicrobial resistance of bacteria isolated from cockroaches (Periplaneta americana) in a Brazilian health care institution.

    Science.gov (United States)

    Prado, Marinésia Aparecida; Gir, Elucir; Pereira, Milca Severino; Reis, Cleomenes; Pimenta, Fabiana Cristina

    2006-02-01

    Cockroaches carry microorganisms to sterilized materials, equipment and non-contaminated food in hospitals and in homes. Hence, they are regarded as major microbial vectors. We isolated and identified microorganisms from living cockroaches captured from a Brazilian health care institution and we determined the antimicrobial susceptibility profile of the isolates. Following collection, cockroaches were immobilized at 4 degrees C for 10 to 20 minutes, immersed in 0.8% saline solution and then homogenized. Next, the suspension was seeded in culture media: brain and heart agar infusion, MacConkey agar, Naito agar, and they were incubated for up to 48 hours at 37 degrees C. Sabouraud agar cultures were incubated at ambient temperature. The microbial colonies were analyzed with a stereomicroscope to count and phenotypically identify the colony-forming units (cfu). The disc-diffusion method was used to determine the profile of susceptibility to antimicrobials. Among the 103 cockroaches analyzed, fungi were found in 97%, enterobacteria in 74.6% and coagulase-negative staphylococci (CNS) in 25.40%. Among the enterobacteria, 96% were resistant to gentamicin, 84% to ampicillin, 75.3% to caphalothin, 66.7% to ampicillin-sulbactam, 50% to aztreonam and 30% to chloramphenicol. Among the CNS, 61% were resistant to oxacillin. We concluded that cockroaches carry organisms associated with nosocomial infections and that are resistant to antimicrobials. This fact contributes to the epidemiological chain, complicating therapeutics, and consequently, medical costs are increased.

  5. Antibiotics susceptibility patterns of bacteria isolated from American and German cockroaches as potential vectors of microbial pathogens in hospitals

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Fakoorziba

    2014-09-01

    Full Text Available Objective: To identify the cockroach species, their bacterial flora and antibiotics susceptibility patterns of these bacteria in Shiraz. Methods: In the present descriptive study, only two species of cockroaches were recognized. The washing solutions from the digestion systems and surfaces of 156 American and German cockroaches were cultured. The latter was found to be the commonest (89.7% in all places. Results: Overall, 18 species of bacteria were isolated and identified by standard culture methods. The most frequent bacterium isolated from both species of cockroaches in all places was Pseudomonas (41.7%. The second and third commonest bacteria were Enterobacter (39.7% and Klebsiella (32.7%, respectively. Conclusions: The antibiogram profiles showed full (100% resistance of Klebsiella, Citrobacter, Acinetobacter and Proteus to amoxicillin and ampicillin at both hospitals, while Pseudomonas showed resistance (95.7% to cephalothin. Thus it is concluded that German and American cockroaches carry multidrug resistant bacteria in two hospitals which raises alarm for stricter control measures.

  6. Profile of antimicrobial resistance of bacteria isolated from cockroaches (Periplaneta americana in a Brazilian health care institution

    Directory of Open Access Journals (Sweden)

    Marinésia Aparecida Prado

    Full Text Available Cockroaches carry microorganisms to sterilized materials, equipment and non-contaminated food in hospitals and in homes. Hence, they are regarded as major microbial vectors. We isolated and identified microorganisms from living cockroaches captured from a Brazilian health care institution and we determined the antimicrobial susceptibility profile of the isolates. Following collection, cockroaches were immobilized at 4ºC for 10 to 20 minutes, immersed in 0.8% saline solution and then homogenized. Next, the suspension was seeded in culture media: brain and heart agar infusion, MacConkey agar, Naito agar, and they were incubated for up to 48 hours at 37ºC. Sabouraud agar cultures were incubated at ambient temperature. The microbial colonies were analyzed with a stereomicroscope to count and phenotypically identify the colony-forming units (cfu. The discdiffusion method was used to determine the profile of susceptibility to antimicrobials. Among the 103 cockroaches analyzed, fungi were found in 97%, enterobacteria in 74.6% and coagulase-negative staphylococci (CNS in 25.40%. Among the enterobacteria, 96% were resistant to gentamicin, 84% to ampicillin, 75.3% to caphalothin, 66.7% to ampicillin-sulbactam, 50% to aztreonam and 30% to chloramphenicol. Among the CNS, 61% were resistant to oxacillin. We concluded that cockroaches carry organisms associated with nosocomial infections and that are resistant to antimicrobials. This fact contributes to the epidemiological chain, complicating therapeutics, and consequently, medical costs are increased.

  7. Brain-Computer Interface Controlled Cyborg: Establishing a Functional Information Transfer Pathway from Human Brain to Cockroach Brain.

    Science.gov (United States)

    Li, Guangye; Zhang, Dingguo

    2016-01-01

    An all-chain-wireless brain-to-brain system (BTBS), which enabled motion control of a cyborg cockroach via human brain, was developed in this work. Steady-state visual evoked potential (SSVEP) based brain-computer interface (BCI) was used in this system for recognizing human motion intention and an optimization algorithm was proposed in SSVEP to improve online performance of the BCI. The cyborg cockroach was developed by surgically integrating a portable microstimulator that could generate invasive electrical nerve stimulation. Through Bluetooth communication, specific electrical pulse trains could be triggered from the microstimulator by BCI commands and were sent through the antenna nerve to stimulate the brain of cockroach. Serial experiments were designed and conducted to test overall performance of the BTBS with six human subjects and three cockroaches. The experimental results showed that the online classification accuracy of three-mode BCI increased from 72.86% to 78.56% by 5.70% using the optimization algorithm and the mean response accuracy of the cyborgs using this system reached 89.5%. Moreover, the results also showed that the cyborg could be navigated by the human brain to complete walking along an S-shape track with the success rate of about 20%, suggesting the proposed BTBS established a feasible functional information transfer pathway from the human brain to the cockroach brain.

  8. Developmental and Post-Eruptive Defects in Molar Enamel of Free-Ranging Eastern Grey Kangaroos (Macropus giganteus Exposed to High Environmental Levels of Fluoride.

    Directory of Open Access Journals (Sweden)

    Uwe Kierdorf

    Full Text Available Dental fluorosis has recently been diagnosed in wild marsupials inhabiting a high-fluoride area in Victoria, Australia. Information on the histopathology of fluorotic marsupial enamel has thus far not been available. This study analyzed the developmental and post-eruptive defects in fluorotic molar enamel of eastern grey kangaroos (Macropus giganteus from the same high-fluoride area using light microscopy and backscattered electron imaging in the scanning electron microscope. The fluorotic enamel exhibited a brownish to blackish discolouration due to post-eruptive infiltration of stains from the oral cavity and was less resistant to wear than normally mineralized enamel of kangaroos from low-fluoride areas. Developmental defects of enamel included enamel hypoplasia and a pronounced hypomineralization of the outer (sub-surface enamel underneath a thin rim of well-mineralized surface enamel. While the hypoplastic defects denote a disturbance of ameloblast function during the secretory stage of amelogenesis, the hypomineralization is attributed to an impairment of enamel maturation. In addition to hypoplastic defects, the fluorotic molars also exhibited numerous post-eruptive enamel defects due to the flaking-off of portions of the outer, hypomineralized enamel layer during mastication. The macroscopic and histopathological lesions in fluorotic enamel of M. giganteus match those previously described for placental mammals. It is therefore concluded that there exist no principal differences in the pathogenic mechanisms of dental fluorosis between marsupial and placental mammals. The regular occurrence of hypomineralized, opaque outer enamel in the teeth of M. giganteus and other macropodids must be considered in the differential diagnosis of dental fluorosis in these species.

  9. Developmental and Post-Eruptive Defects in Molar Enamel of Free-Ranging Eastern Grey Kangaroos (Macropus giganteus) Exposed to High Environmental Levels of Fluoride.

    Science.gov (United States)

    Kierdorf, Uwe; Death, Clare; Hufschmid, Jasmin; Witzel, Carsten; Kierdorf, Horst

    2016-01-01

    Dental fluorosis has recently been diagnosed in wild marsupials inhabiting a high-fluoride area in Victoria, Australia. Information on the histopathology of fluorotic marsupial enamel has thus far not been available. This study analyzed the developmental and post-eruptive defects in fluorotic molar enamel of eastern grey kangaroos (Macropus giganteus) from the same high-fluoride area using light microscopy and backscattered electron imaging in the scanning electron microscope. The fluorotic enamel exhibited a brownish to blackish discolouration due to post-eruptive infiltration of stains from the oral cavity and was less resistant to wear than normally mineralized enamel of kangaroos from low-fluoride areas. Developmental defects of enamel included enamel hypoplasia and a pronounced hypomineralization of the outer (sub-surface) enamel underneath a thin rim of well-mineralized surface enamel. While the hypoplastic defects denote a disturbance of ameloblast function during the secretory stage of amelogenesis, the hypomineralization is attributed to an impairment of enamel maturation. In addition to hypoplastic defects, the fluorotic molars also exhibited numerous post-eruptive enamel defects due to the flaking-off of portions of the outer, hypomineralized enamel layer during mastication. The macroscopic and histopathological lesions in fluorotic enamel of M. giganteus match those previously described for placental mammals. It is therefore concluded that there exist no principal differences in the pathogenic mechanisms of dental fluorosis between marsupial and placental mammals. The regular occurrence of hypomineralized, opaque outer enamel in the teeth of M. giganteus and other macropodids must be considered in the differential diagnosis of dental fluorosis in these species.

  10. Developmental and Post-Eruptive Defects in Molar Enamel of Free-Ranging Eastern Grey Kangaroos (Macropus giganteus) Exposed to High Environmental Levels of Fluoride

    Science.gov (United States)

    Kierdorf, Uwe; Death, Clare; Hufschmid, Jasmin; Witzel, Carsten; Kierdorf, Horst

    2016-01-01

    Dental fluorosis has recently been diagnosed in wild marsupials inhabiting a high-fluoride area in Victoria, Australia. Information on the histopathology of fluorotic marsupial enamel has thus far not been available. This study analyzed the developmental and post-eruptive defects in fluorotic molar enamel of eastern grey kangaroos (Macropus giganteus) from the same high-fluoride area using light microscopy and backscattered electron imaging in the scanning electron microscope. The fluorotic enamel exhibited a brownish to blackish discolouration due to post-eruptive infiltration of stains from the oral cavity and was less resistant to wear than normally mineralized enamel of kangaroos from low-fluoride areas. Developmental defects of enamel included enamel hypoplasia and a pronounced hypomineralization of the outer (sub-surface) enamel underneath a thin rim of well-mineralized surface enamel. While the hypoplastic defects denote a disturbance of ameloblast function during the secretory stage of amelogenesis, the hypomineralization is attributed to an impairment of enamel maturation. In addition to hypoplastic defects, the fluorotic molars also exhibited numerous post-eruptive enamel defects due to the flaking-off of portions of the outer, hypomineralized enamel layer during mastication. The macroscopic and histopathological lesions in fluorotic enamel of M. giganteus match those previously described for placental mammals. It is therefore concluded that there exist no principal differences in the pathogenic mechanisms of dental fluorosis between marsupial and placental mammals. The regular occurrence of hypomineralized, opaque outer enamel in the teeth of M. giganteus and other macropodids must be considered in the differential diagnosis of dental fluorosis in these species. PMID:26895178

  11. The diet of the Indian Flying Fox Pteropus giganteus (Brünnich. 1782 (Chiroptera: Pteropodidae in Myanmar - conflicts with local people?

    Directory of Open Access Journals (Sweden)

    Sein Sein Win

    2015-07-01

    Full Text Available The diet of Pteropus giganteus from three roosts in Mandalay Region, central Myanmar was investigated for over two years by examining feeding remains in and around two villages.  It consists of 24 species of fruits, six species of flowers and three of leaves.  Of these, 13 species of fruits are eaten by the local people, three of which are also marketed.  Two are used in traditional medicine and one for stuffing pillows. Most dietary plants are native, mangoes are seasonally superabundant and are eaten in large numbers.  Interviews revealed no evidence of conflict between bats and villagers. 

  12. Effectiveness of an integrated pest management intervention in controlling cockroaches, mice, and allergens in New York City public housing.

    Science.gov (United States)

    Kass, Daniel; McKelvey, Wendy; Carlton, Elizabeth; Hernandez, Marta; Chew, Ginger; Nagle, Sean; Garfinkel, Robin; Clarke, Brian; Tiven, Julius; Espino, Christian; Evans, David

    2009-08-01

    Cockroaches and mice, which are common in urban homes, are sources of allergens capable of triggering asthma symptoms. Traditional pest control involves the use of scheduled applications of pesticides by professionals as well as pesticide use by residents. In contrast, integrated pest management (IPM) involves sanitation, building maintenance, and limited use of least toxic pesticides. We implemented and evaluated IPM compared with traditional practice for its impact on pests, allergens, pesticide use, and resident satisfaction in a large urban public housing authority. We assigned IPM or control status to 13 buildings in five housing developments, and evaluated conditions at baseline, 3 months, and 6 months in 280 apartments in Brooklyn and Manhattan, in New York City (New York). We measured cockroach and mouse populations, collected cockroach and mouse urinary protein allergens in dust, and interviewed residents. All statistical models controlled for baseline levels of pests or allergens. Compared with controls, apartments receiving IPM had significantly lower counts of cockroaches at 3 months and greater success in reducing or sustaining low counts of cockroaches at both 3 and 6 months. IPM was associated with lower cockroach allergen levels in kitchens at 3 months and in beds and kitchens at 6 months. Pesticide use was reduced in IPM relative to control apartments. Residents of IPM apartments also rated building services more positively. In contrast to previous IPM studies, which involved extensive cleaning, repeat visits, and often extensive resident education, we found that an easily replicable single IPM visit was more effective than the regular application of pesticides alone in managing pests and their consequences.

  13. Biosolids and distillery effluent amendment to Irish Miscanthus ×giganteus plantations: impacts on groundwater and soil.

    Science.gov (United States)

    Galbally, P; Fagan, C; Ryan, D; Finnan, J; Grant, J; McDonnell, K

    2012-01-01

    It is necessary to determine the risk of water pollution arising from amendment of organic by-products (OBs) to energy crops under Irish conditions. Therefore, the impact of landspreading two OBs on the quality of groundwater underlying plantations of Miscanthus X giganteus was assessed. Municipal biosolids and distillery effluent (DE) were spread annually (for 4 yr) on six 0.117-ha treatment plots at rates of 100, 50, and 0%. The 100% rate represented a maximum P load of 15 t ha(-1) as per Irish EPA regulation. Groundwater was sampled for 25 mo and tested for pH, electrical conductivity, NO(3)(-), orthophosphate (PO(4)(3-)), total soluble P, K(+), Cu, Cd, Cr, Pb, Ni, and Zn. Assessment of quality was based on comparison with Irish groundwater threshold values (GTVs). The study was limited to within-plot using a "well bottom" approach and did not investigate movement of groundwater plumes or vectors of percolation through the soil profile. Mean groundwater concentrations did not exceed GTVs during the sampling period for any species, with the exception of groundwater PO(4)(3-) in the 100% DE plot, which was almost double the GTV of 0.035 mg L(-1). There was no significant build-up of nutrients or heavy metals in groundwater (or soil) for any plot. Excessive PO(4)(3-) in the 100% DE plot groundwater is likely due to high background soil P, soil characteristics, and the occurrence of macropore/soil pore flow. These factors (particularly background soil P) should be assessed when determining suitable sites for land-spreading OBs. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  14. ANÁLISE QUÍMICA DO BAMBU-GIGANTE (DENDROCALAMUS GIGANTEUS WALL. EX MUNRO EM DIFERENTES IDADES

    Directory of Open Access Journals (Sweden)

    Nelson Potenciano Marinho

    2012-01-01

    Full Text Available Bamboo is a monocotyledon of tropical origin which grows fast and is considered an important environment regenerator because of its root system. Dendrocalamus giganteus is popular learned by giant bamboo, being a big bush species, its culms can be from 24 to 40 meters high, with diameters from 10 and 20 centimeters. This work had the objective of a chemical analysis from giant bamboo to aim at giving information from its chemical composition from 2 to 6 years of age. Bamboo culms were collected in the Agriculture Experimental area of the Mechanical Engineering Department of UNESP -Bauru, where it is carried out the systematic handling from different bamboo species to this plant research and divulgation. Samples from base were collected from 2 and 6 years in the same bush, in total of 5 samples, with 2 high meters each, cropped in March, half moon. Chemical analysis was done with internodes using TAPPI Methods. The average percentage extractives from hot water, cool water, total extractives and ash content were not related to the age. The major percentage of hot water extractives, with values of 12.04%, cold water extractives, with 10.25%, and total extractives, with 12.91%, was observed by the age of two years. The major ash content was obtained on three years, with value of 1.09%. The mean value of NaOH extractives decreased from 25.72%, in two years, to 20.17% at six years old. The same behavior was observed for ethanol toluene extractives, decreasing from 10.91% to 4.61%. The mean lignin content was not influenced by age, varying from 22.66 to 24.11%.

  15. Caracterização físico-mecânica do laminado colado de bambu (Dendrocalamus giganteus.

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    2009-09-01

    Full Text Available Normal 0 21 MicrosoftInternetExplorer4 Esta pesquisa teve como objetivo avaliar a influência do tratamento preservativo e do tipo de adesivo nas propriedades físico-mecânicas do laminado colado, confeccionado com o bambu Dendrocalamus giganteus. Para tanto, colmos de bambu foram tratados pelo método de imersão em produto químico (solução de 1% de ingredientes ativos de borato de cobre cromatado - CCB e em água, durante 15 dias. Dos colmos tratados, foram retiradas as camadas externa e interna, obtendo-se lâminas com espessuras de 4 mm, comprimento de 45 cm e largura de 5 cm. Para a colagem das lâminas, utilizaram-se os adesivos "Cascophen RS" (resorcinol-formol e "Cascorez-Extra" (acetato polivinílico. O adesivo à base de resorcinol-formol proporcionou maior resistência à umidade ao BLC, quando comparado àquele à base de acetato polivinílico, tendo as amostras provenientes de peças tratadas com CCB sido mais estáveis que as tratadas com água. Dentre as propriedades mecânicas testadas, o adesivo apresentou resultado significativo para o cisalhamento na linha de cola e o tratamento preservativo para o MOE. A interação dos fatores adesivo e tratamento foi significativa para o MOE, resistência a compressão paralela ao cisalhamento na linha de cola, tendo as peças tratadas com água e aderidas com resorcinol-formol apresentado melhores resultados para o MOE e compressão paralela às fibras e aquelas tratadas com CCB, para o cisalhamento na linha de cola.

  16. Refuge or reservoir? The potential impacts of the biofuel crop Miscanthus x giganteus on a major pest of maize.

    Directory of Open Access Journals (Sweden)

    Joseph L Spencer

    Full Text Available BACKGROUND: Interest in the cultivation of biomass crops like the C4 grass Miscanthus x giganteus (Miscanthus is increasing as global demand for biofuel grows. In the US, Miscanthus is promoted as a crop well-suited to the Corn Belt where it could be cultivated on marginal land interposed with maize and soybean. Interactions (direct and indirect of Miscanthus, maize, and the major Corn Belt pest of maize, the western corn rootworm, (Diabrotica virgifera virgifera LeConte, WCR are unknown. Adding a perennial grass/biomass crop to this system is concerning since WCR is adapted to the continuous availability of its grass host, maize (Zea mays. METHODOLOGY/PRINCIPAL FINDINGS: In a greenhouse and field study, we investigated WCR development and oviposition on Miscanthus. The suitability of Miscanthus for WCR development varied across different WCR populations. Data trends indicate that WCR populations that express behavioural resistance to crop rotation performed as well on Miscanthus as on maize. Over the entire study, total adult WCR emergence from Miscanthus (212 WCR was 29.6% of that from maize (717 WCR. Adult dry weight was 75-80% that of WCR from maize; female emergence patterns on Miscanthus were similar to females developing on maize. There was no difference in the mean no. of WCR eggs laid at the base of Miscanthus and maize in the field. CONCLUSIONS/SIGNIFICANCE: Field oviposition and significant WCR emergence from Miscanthus raises many questions about the nature of likely interactions between Miscanthus, maize and WCR and the potential for Miscanthus to act as a refuge or reservoir for Corn Belt WCR. Responsible consideration of the benefits and risks associated with Corn Belt Miscanthus are critical to protecting an agroecosystem that we depend on for food, feed, and increasingly, fuel. Implications for European agroecosystems in which Miscanthus is being proposed are also discussed in light of the WCR's recent invasion into Europe.

  17. Aerobic Bacterial Community of American Cockroach Periplaneta americana,a Step toward Finding Suitable Paratransgenesis Candidates.

    Science.gov (United States)

    Akbari, Sanaz; Oshaghi, Mohammad Ali; Hashemi-Aghdam, Saedeh Sadat; Hajikhani, Sara; Oshaghi, Ghazaleh; Shirazi, Mohammad Hasan

    2015-06-01

    Cockroaches mechanically spread pathogenic agents, however, little is known about their gut microbiota. Identification of midgut microbial community helps targeting novel biological control strategies such as paratransgenesis. Here the bacterial microbiota of Periplaneta americana midgut, were identified and evaluated for finding proper paratransgenesis candidate. Midgut of specimens were dissected and cultivated in different media. The bacterial isolates were then identified using the phenotypic and 16S-rRNA sequencing methods. The analytical profile index (API) kit showed presence of 11 bacterial species including: Escherichia coli, Shigella flexineri, Citrobacter freundii, E. vulneris, Enterobacter cloacae, Yersinia pseudotuberculosis, Y. intermedia, Leclericia adecarboxylata, Klebsiella oxytoca, K. planticola, and Rahnella aquatilis in the cockroach midguts. The first three species are potentially symbiotic whereas others are transient. The conventional plating method revealed presence of only four isolates of Salmonella, E. coli, and Proteus which in three cases mismatched with API and 16S-rRNA genotyping. The API correctly identified the four isolates as Shigella flexneri, Citrobacter freundii, and E. coli (n= 2). 16S-rRNA sequence analysis confirmed the API results; however the C. freundii sequence was identical with C. murliniae indicating lack of genetic variation in the gene between these two closely related species. A low number of potentially symbiotic bacteria were found in the American cockroach midguts. Among them Enterobacter cloacae is a potential candidate for paratransgenesis approach whereas other bacteria are pathogens and are not useful for the approach. Data analysis showed that identification levels increase from the conventional to API and to genotyping respectively.

  18. Aerobic Bacterial Community of American Cockroach Periplaneta americana,a Step toward Finding Suitable Paratransgenesis Candidates

    Directory of Open Access Journals (Sweden)

    Sanaz Akbari

    2015-10-01

    Full Text Available Background: Cockroaches mechanically spread pathogenic agents, however, little is known about their gut microbiota. Identification of midgut microbial community helps targeting novel biological control strategies such as paratransgenesis. Here the bacterial microbiota of Periplaneta americana midgut, were identified and evaluated for finding proper paratransgenesis candidate.Methods: Midgut of specimens were dissected and cultivated in different media. The bacterial isolates were then identified using the phenotypic and 16S-rRNA sequencing methods.Results: The analytical profile index (API kit showed presence of 11 bacterial species including: Escherichia coli, Shigella flexineri, Citrobacter freundii, E. vulneris, Enterobacter cloacae, Yersinia pseudotuberculosis, Y.intermedia, Leclericia adecarboxylata, Klebsiella oxytoca, K. planticola, and Rahnella aquatilis in the cockroach midguts. The first three species are potentially symbiotic whereas others are transient. The conventional platingmethod revealed presence of only four isolates of Salmonella, E. coli, and Proteus which in three cases mismatched with API and 16S-rRNA genotyping. The API correctly identified the four isolates as Shigella flexneri, Citrobacter freundii, and E. coli (n= 2. 16S-rRNA sequence analysis confirmed the API results; however the C. freundii sequencewas identical with C. murliniae indicating lack of genetic variation in the gene between these two closely related species.Conclusion: A low number of potentially symbiotic bacteria were found in the American cockroach midguts. Among them Enterobacter cloacae is a potential candidate for paratransgenesis approach whereas other bacteria are pathogens and are not useful for the approach. Data analysis showed that identification levels increase from the conventional to API and to genotyping respectively.

  19. THE PAINT FORMULATION IN LAMBDACYHALOTHRIN USAGE AS P. americana COCKROACH CONTROL MEASURES

    Directory of Open Access Journals (Sweden)

    Lulus Susanti

    2014-06-01

    Full Text Available ABSTRAKKecoa adalah salah satu jenis serangga yang dianggap kotor dan merupakan seranggavektor. Scbagian besar kecoa yang ditemukan di sekitar pemukiman adalah Periplanetaamericana, Periplaneta brunea, Periplaneta australisea, Blatella germanica, Supellalongipalpa, Neostylopiga rhombifoUa dan Nauphaeta cinerea. Beberapa kecoa juga dapatmenularkan virus, bakteria, worm, protozoit dan jamur.Pengcndalian kecoa secara fogging dengan menggunakan insektisida masih kurangefektif dan praktis, sehingga dibutuhkan alternatif pengcndali. Dalam rangka untuk mencarimetode alternatif pengcndalian kecoa, maka akan dilakukan percobaan menggunakan cat kayuyang ditambahkan dengan insektisida.Dalam penelitian ini, insektisida cat kayu menggunakan bahan aktif Lambdacyhalothrin10WP. Pertama-tama dibuat beberapa solusi dari cat insektisida dalam dosis banyak. Kemudiancat papan kayu lapis. Setelah kcring sekitar satu hari, kemudian melakukan pengujian bioassayterhadap kecoa {Periplaneta americana . Hasil penelitian ini menunjukkan bahwa kayuinsektisida cat dengan dosis minimal 1,591% efektif untuk membunuh kecoa hingga 95%.Kata kunci: kecoa, cat berinsektisida, lambdacyhalothrinABSTRATCCockroaches are still considered to be disgusting insects and vector. Mostlycockroaches that are found around the resident, such as Periplaneta americana, Periplanetabrunea,Periplaneta australisea, Blatella germanica, Supella longipalpa, NeostylopigarhombifoUa and Nauphaeta cinerea. There are can transmit virus, bakteria, worm, protozoit andfungi.The methods for cocroaches control by using the fogging with insecticide is still lesseffective and practical, so it will need a controlling alternative. In order to find the alternativemethods for control the cockroach, it will conduct an experiments using impregnated paint woodby insecticide.In this research, insecticide paint wood using an active materials Lambdacyhalothrin10WP. For the first, it make some solution from insecticide paint in

  20. Evolutionary convergence and nitrogen metabolism in Blattabacterium strain Bge, primary endosymbiont of the cockroach Blattella germanica.

    Directory of Open Access Journals (Sweden)

    Maria J López-Sánchez

    2009-11-01

    Full Text Available Bacterial endosymbionts of insects play a central role in upgrading the diet of their hosts. In certain cases, such as aphids and tsetse flies, endosymbionts complement the metabolic capacity of hosts living on nutrient-deficient diets, while the bacteria harbored by omnivorous carpenter ants are involved in nitrogen recycling. In this study, we describe the genome sequence and inferred metabolism of Blattabacterium strain Bge, the primary Flavobacteria endosymbiont of the omnivorous German cockroach Blattella germanica. Through comparative genomics with other insect endosymbionts and free-living Flavobacteria we reveal that Blattabacterium strain Bge shares the same distribution of functional gene categories only with Blochmannia strains, the primary Gamma-Proteobacteria endosymbiont of carpenter ants. This is a remarkable example of evolutionary convergence during the symbiotic process, involving very distant phylogenetic bacterial taxa within hosts feeding on similar diets. Despite this similarity, different nitrogen economy strategies have emerged in each case. Both bacterial endosymbionts code for urease but display different metabolic functions: Blochmannia strains produce ammonia from dietary urea and then use it as a source of nitrogen, whereas Blattabacterium strain Bge codes for the complete urea cycle that, in combination with urease, produces ammonia as an end product. Not only does the cockroach endosymbiont play an essential role in nutrient supply to the host, but also in the catabolic use of amino acids and nitrogen excretion, as strongly suggested by the stoichiometric analysis of the inferred metabolic network. Here, we explain the metabolic reasons underlying the enigmatic return of cockroaches to the ancestral ammonotelic state.

  1. Evolutionary Convergence and Nitrogen Metabolism in Blattabacterium strain Bge, Primary Endosymbiont of the Cockroach Blattella germanica

    Science.gov (United States)

    López-Sánchez, Maria J.; Neef, Alexander; Peretó, Juli; Patiño-Navarrete, Rafael; Pignatelli, Miguel; Latorre, Amparo; Moya, Andrés

    2009-01-01

    Bacterial endosymbionts of insects play a central role in upgrading the diet of their hosts. In certain cases, such as aphids and tsetse flies, endosymbionts complement the metabolic capacity of hosts living on nutrient-deficient diets, while the bacteria harbored by omnivorous carpenter ants are involved in nitrogen recycling. In this study, we describe the genome sequence and inferred metabolism of Blattabacterium strain Bge, the primary Flavobacteria endosymbiont of the omnivorous German cockroach Blattella germanica. Through comparative genomics with other insect endosymbionts and free-living Flavobacteria we reveal that Blattabacterium strain Bge shares the same distribution of functional gene categories only with Blochmannia strains, the primary Gamma-Proteobacteria endosymbiont of carpenter ants. This is a remarkable example of evolutionary convergence during the symbiotic process, involving very distant phylogenetic bacterial taxa within hosts feeding on similar diets. Despite this similarity, different nitrogen economy strategies have emerged in each case. Both bacterial endosymbionts code for urease but display different metabolic functions: Blochmannia strains produce ammonia from dietary urea and then use it as a source of nitrogen, whereas Blattabacterium strain Bge codes for the complete urea cycle that, in combination with urease, produces ammonia as an end product. Not only does the cockroach endosymbiont play an essential role in nutrient supply to the host, but also in the catabolic use of amino acids and nitrogen excretion, as strongly suggested by the stoichiometric analysis of the inferred metabolic network. Here, we explain the metabolic reasons underlying the enigmatic return of cockroaches to the ancestral ammonotelic state. PMID:19911043

  2. Experimental transmission of Toxocara canis from Blattella germanica and Periplaneta americana cockroaches to a paratenic host.

    Science.gov (United States)

    González-García, T; Muñoz-Guzmán, M A; Sánchez-Arroyo, H; Prado-Ochoa, M G; Cuéllar-Ordaz, J A; Alba-Hurtado, F

    2017-11-15

    The present study assessed the capacity of Blattella germanica and Periplaneta americana to disseminate and transmit infective phases of T. canis to rats, which were used as a model paratenic host. P. americana and B. germanica inoculated orally with T. canis larvated eggs shed eggs and larvae in their fecal matter during the first 6days post-inoculation. Larvae were recovered from the brain, lungs, kidneys and liver of rats that had been inoculated with either infected cockroaches or their feces. ELISAs of serum detected an increase of antibodies anti-T. canis excretion-secretion antigens, whereas Western Blot (WB) showed 4 bands (120, 50, 35 and 28kDa) that were similar to those found in positive control rats. Macroscopically, the liver and kidneys of infected rats had hemorrhagic areas with milk-spot-like lesions. The lungs showed diffuse grey protuberances. Histologically, hemorrhagic areas with leucocytic infiltrate were observed in the liver, lungs and kidneys. Some larvae were found within a granuloma that was surrounded by eosinophils and other leucocytic infiltrates. Larvae were found in the brain, but without inflammatory infiltrate. Both cockroach species that ingested larvated eggs of T. canis may shed viable larvae or eggs in their fecal matter. The induction of specific serum antibodies, presence of larvae in tissues and characteristic lesions associated with larval migration in the organs of rats that had ingested either whole adults or feces of B. germanica or P. americana demonstrate the capacity of these cockroaches to transmit toxocariosis to paratenic hosts. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Population ecology and movement of the American cockroach (Dictyoptera: Blattidae) in sewers.

    Science.gov (United States)

    Tee, Hui-Siang; Saad, Ahmad Ramli; Lee, Chow-Yang

    2011-07-01

    The population size, age-class structure, and movement of the American cockroach, Periplaneta americana (L.) (Dictyoptera: Blattidae), were studied in three sewers in Penang, Malaysia, from September 2008 to October 2009. Eighteen to 20 glass-jar traps (two per manhole) were deployed for a 24-h period during each sampling occasion at each sewer. Adults and nymphs were active throughout the study period, with an average monthly trap catch of 57-97 adults and 79-99 nymphs. The mean proportions of adults and nymphs at the three sewers ranged from 0.47 to 0.57. Of the 2177 male and 2717 female cockroaches marked and released over the three sewers, recapture rates were 29.4-45.8 and 30.8-47.0%, respectively. The proportion of marked males and females did not differ significantly from the proportion of recaptured marked males and females. However, the mean number of times a marked female was recaptured was significantly greater than that of males. Of the 783 males and 1,030 females that were marked and recaptured, 19.4 and 24.7%, respectively, had moved between manholes, and significantly more females than males moved between manholes. Of the 406 recaptured marked adults that moved between manholes, 90.4% moved a distance of 2-20 m from their initial release site; one male moved 192 m, the longest distance recorded. Trap catch on each sampling occasion was positively correlated with daily mean temperature. The number of cockroach movements between manholes also was correlated with the mean daily minimum temperature.

  4. Biogeography and Phylogeny of Wood-feeding Cockroaches in the Genus Cryptocercus

    Directory of Open Access Journals (Sweden)

    Kiyoto Maekawa

    2011-07-01

    Full Text Available Subsocial, xylophagous cockroaches of the genus Cryptocercus exhibit a disjunct distribution, with representatives in mature montane forests of North America, China, Korea and the Russian Far East. All described species are wingless and dependent on rotting wood for food and shelter at all stages of their life cycle; consequently, their distribution is tied to that of forests and strongly influenced by palaeogeographical events. Asian and American lineages form distinct monophyletic groups, comprised of populations with complex geographic substructuring. We review the phylogeny and distribution of Cryptocercus, and discuss splitting events inferred from molecular data.

  5. [The intracellular localization of the regulatory proteins of the densovirus of German cockroach, Blattella germanica].

    Science.gov (United States)

    Martynova, E U; Kapelinskaia, T V; Schal, C; Mukha, D V

    2014-01-01

    The intracellular localization of the regulatory proteins encoded by the genome of the densovirus of German cockroach was analyzed using western-blotting of nuclear and cytoplasmic extracts of the densovirus-infected passaging cells tissue culture BGE-2. Two of the three regulatory proteins, NS1 and NS3, were shown to possess mainly nuclear localization, while NS2 protein was distributed between the nucleus and cytoplasm. Data obtained provide new information necessary for prediction of the functions of densovirus regulatory proteins. Intracellular localization of NS3 protein was described for the densoviruses for the first time.

  6. The cockroach Periplaneta americana as a potential paratenic host of the lungworm Aelurostrongylus abstrusus.

    Science.gov (United States)

    Falsone, Luigi; Colella, Vito; Napoli, Ettore; Brianti, Emanuele; Otranto, Domenico

    2017-11-01

    Aelurostrongylus abstrusus is a well-known nematode affecting the respiratory system of felids worldwide. Snails and slugs act as intermediate hosts of this parasite, whereas rodents, birds and reptiles may serve as paratenic hosts. Periplaneta americana, the American brown cockroach, shares the same habitat and ecological features (e.g. nocturnal activity) with both snails and cats. The aim of this study was to evaluate the capability of P. americana to maintain alive A. abstrusus third stage larvae (L3s) after artificial inoculation. Twenty-five specimens of P. americana were infected with 100 A. abstrusus L3s collected from experimentally infected Cornu aspersum snails, whereas five specimens were used as control group. After the infection, cockroaches were maintained in individual plastic boxes until dissection for the presence of L3s at 1 (T1), 5 (T5), 10 (T10), 15 (T15), and 20 (T20) days post-infection. Except for T15, alive A. abstrusus L3s (n = 63) were found at all time-points, being 26, 19, 16 and 2 L3s retrieved at T1, T5, T10 and T20, respectively. Eleven (17.4%) L3s were found within the digestive tract, 10 (15.9%) in other-than-digestive organs and 42 (66.7%) in the exoskeleton and associated tissues. Nine out of the twenty-five experimentally inoculated cockroaches (36%) died soon after the artificial infection (T1), while in the control group, two out of the five (40%) died before the end of the study (T15) with no difference in the mortality rate between groups. Results of this study suggest that P. americana could act as a paratenic host of A. abstrusus. Periplaneta americana cockroaches, have a ubiquitous distribution and may be preyed by cats, representing a potential source of infection to cats living in endemic areas. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Trypanosoma brucei Inhibition by Essential Oils from Medicinal and Aromatic Plants Traditionally Used in Cameroon (Azadirachta indica, Aframomum melegueta, Aframomum daniellii, Clausena anisata, Dichrostachys cinerea and Echinops giganteus).

    Science.gov (United States)

    Kamte, Stephane L Ngahang; Ranjbarian, Farahnaz; Campagnaro, Gustavo Daniel; Nya, Prosper C Biapa; Mbuntcha, Hélène; Woguem, Verlaine; Womeni, Hilaire Macaire; Ta, Léon Azefack; Giordani, Cristiano; Barboni, Luciano; Benelli, Giovanni; Cappellacci, Loredana; Hofer, Anders; Petrelli, Riccardo; Maggi, Filippo

    2017-07-06

    Essential oils are complex mixtures of volatile components produced by the plant secondary metabolism and consist mainly of monoterpenes and sesquiterpenes and, to a minor extent, of aromatic and aliphatic compounds. They are exploited in several fields such as perfumery, food, pharmaceutics, and cosmetics. Essential oils have long-standing uses in the treatment of infectious diseases and parasitosis in humans and animals. In this regard, their therapeutic potential against human African trypanosomiasis (HAT) has not been fully explored. In the present work, we have selected six medicinal and aromatic plants ( Azadirachta indica , Aframomum melegueta , Aframomum daniellii , Clausena anisata , Dichrostachys cinerea , and Echinops giganteus ) traditionally used in Cameroon to treat several disorders, including infections and parasitic diseases, and evaluated the activity of their essential oils against Trypanosma brucei TC221. Their selectivity was also determined with Balb/3T3 (mouse embryonic fibroblast cell line) cells as a reference. The results showed that the essential oils from A. indica , A . daniellii , and E. giganteus were the most active ones, with half maximal inhibitory concentration (IC 50 ) values of 15.21, 7.65, and 10.50 µg/mL, respectively. These essential oils were characterized by different chemical compounds such as sesquiterpene hydrocarbons, monoterpene hydrocarbons, and oxygenated sesquiterpenes. Some of their main components were assayed as well on T. brucei TC221, and their effects were linked to those of essential oils.

  8. Trypanosoma brucei Inhibition by Essential Oils from Medicinal and Aromatic Plants Traditionally Used in Cameroon (Azadirachta indica, Aframomum melegueta, Aframomum daniellii, Clausena anisata, Dichrostachys cinerea and Echinops giganteus

    Directory of Open Access Journals (Sweden)

    Stephane L. Ngahang Kamte

    2017-07-01

    Full Text Available Essential oils are complex mixtures of volatile components produced by the plant secondary metabolism and consist mainly of monoterpenes and sesquiterpenes and, to a minor extent, of aromatic and aliphatic compounds. They are exploited in several fields such as perfumery, food, pharmaceutics, and cosmetics. Essential oils have long-standing uses in the treatment of infectious diseases and parasitosis in humans and animals. In this regard, their therapeutic potential against human African trypanosomiasis (HAT has not been fully explored. In the present work, we have selected six medicinal and aromatic plants (Azadirachta indica, Aframomum melegueta, Aframomum daniellii, Clausena anisata, Dichrostachys cinerea, and Echinops giganteus traditionally used in Cameroon to treat several disorders, including infections and parasitic diseases, and evaluated the activity of their essential oils against Trypanosma brucei TC221. Their selectivity was also determined with Balb/3T3 (mouse embryonic fibroblast cell line cells as a reference. The results showed that the essential oils from A. indica, A. daniellii, and E. giganteus were the most active ones, with half maximal inhibitory concentration (IC50 values of 15.21, 7.65, and 10.50 µg/mL, respectively. These essential oils were characterized by different chemical compounds such as sesquiterpene hydrocarbons, monoterpene hydrocarbons, and oxygenated sesquiterpenes. Some of their main components were assayed as well on T. brucei TC221, and their effects were linked to those of essential oils.

  9. Modeling population dynamics of two cockroach species: Effects of the circadian clock, interspecific competition and pest control

    Czech Academy of Sciences Publication Activity Database

    Wu, H. H.; Lee, H. J.; Horng, S. B.; Berec, Luděk

    2007-01-01

    Roč. 249, - (2007), s. 473-486 ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : German cockroach * Blattella germanica * Blatella bisignata Subject RIV: EH - Ecology, Behaviour Impact factor: 2.323, year: 2007

  10. IgE antibodies reactive with silverfish, cockroach and chironomid are frequently found in mite-positive allergic patients

    NARCIS (Netherlands)

    Witteman, A. M.; van den Oudenrijn, S.; van Leeuwen, J.; Akkerdaas, J.; van der Zee, J. S.; Aalberse, R. C.

    1995-01-01

    Approximately 30% of the house dust mite allergic patients in The Netherlands have IgE antibodies reactive with silverfish, cockroach and/or chironomid. In allergic patients without IgE antibodies against Dermatophagoides pteronyssinus less than 5% have IgE antibodies reactive with these insects. By

  11. Subsocial Cockroaches Nauphoeta cinerea Mate Indiscriminately with Kin Despite High Costs of Inbreeding

    Science.gov (United States)

    Bouchebti, Sofia; Durier, Virginie; Pasquaretta, Cristian; Rivault, Colette; Lihoreau, Mathieu

    2016-01-01

    Many animals have evolved strategies to reduce risks of inbreeding and its deleterious effects on the progeny. In social arthropods, such as the eusocial ants and bees, inbreeding avoidance is typically achieved by the dispersal of breeders from their native colony. However studies in presocial insects suggest that kin discrimination during mate choice may be a more common mechanism in socially simpler species with no reproductive division of labour. Here we examined this possibility in the subsocial cockroach Nauphoeta cinerea, a model species for research in sexual selection, where males establish dominance hierarchies to access females and control breeding territories. When given a binary choice between a sibling male and a non-sibling male that had the opportunity to establish a hierarchy prior to the tests, females mated preferentially with the dominant male, irrespective of kinship or body size. Despite the lack of kin discrimination during mate choice, inbred-mated females incurred significant fitness costs, producing 20% less offspring than outbred-mated females. We discuss how the social mating system of this territorial cockroach may naturally limit the probability of siblings to encounter and reproduce, without the need for evolving active inbreeding avoidance mechanisms, such as kin recognition. PMID:27655156

  12. Effective Stimulus Parameters for Directed Locomotion in Madagascar Hissing Cockroach Biobot.

    Directory of Open Access Journals (Sweden)

    Jonathan C Erickson

    Full Text Available Swarms of insects instrumented with wireless electronic backpacks have previously been proposed for potential use in search and rescue operations. Before deploying such biobot swarms, an effective long-term neural-electric stimulus interface must be established, and the locomotion response to various stimuli quantified. To this end, we studied a variety of pulse types (mono- vs. bipolar; voltage- vs. current-controlled and shapes (amplitude, frequency, duration to parameters that are most effective for evoking locomotion along a desired path in the Madagascar hissing cockroach (G. portentosa in response to antennal and cercal stimulation. We identified bipolar, 2 V, 50 Hz, 0.5 s voltage controlled pulses as being optimal for evoking forward motion and turns in the expected contraversive direction without habituation in ≈50% of test subjects, a substantial increase over ≈10% success rates previously reported. Larger amplitudes for voltage (1-4 V and current (50-150 μA pulses generally evoked larger forward walking (15.6-25.6 cm; 3.9-5.6 cm/s but smaller concomitant turning responses (149 to 80.0 deg; 62.8 to 41.2 deg/s. Thus, the radius of curvature of the initial turn-then-run locomotor response (≈10-25 cm could be controlled in a graded manner by varying the stimulus amplitude. These findings could be used to help optimize stimulus protocols for swarms of cockroach biobots navigating unknown terrain.

  13. Transition by head-on collision: mechanically mediated manoeuvres in cockroaches and small robots

    Science.gov (United States)

    Mongeau, Jean-Michel; Mohapatra, Anand; Birkmeyer, Paul; Fearing, Ronald S.; Full, Robert J.

    2018-01-01

    Exceptional performance is often considered to be elegant and free of ‘errors’ or missteps. During the most extreme escape behaviours, neural control can approach or exceed its operating limits in response time and bandwidth. Here we show that small, rapid running cockroaches with robust exoskeletons select head-on collisions with obstacles to maintain the fastest escape speeds possible to transition up a vertical wall. Instead of avoidance, animals use their passive body shape and compliance to negotiate challenging environments. Cockroaches running at over 1 m or 50 body lengths per second transition from the floor to a vertical wall within 75 ms by using their head like an automobile bumper, mechanically mediating the manoeuvre. Inspired by the animal's behaviour, we demonstrate a passive, high-speed, mechanically mediated vertical transitions with a small, palm-sized legged robot. By creating a collision model for animal and human materials, we suggest a size dependence favouring mechanical mediation below 1 kg that we term the ‘Haldane limit’. Relying on the mechanical control offered by soft exoskeletons represents a paradigm shift for understanding the control of small animals and the next generation of running, climbing and flying robots where the use of the body can off-load the demand for rapid sensing and actuation. PMID:29445036

  14. Cellular elements for seeing in the dark: voltage-dependent conductances in cockroach photoreceptors

    Directory of Open Access Journals (Sweden)

    Salmela Iikka

    2012-08-01

    Full Text Available Abstract Background The importance of voltage-dependent conductances in sensory information processing is well-established in insect photoreceptors. Here we present the characterization of electrical properties in photoreceptors of the cockroach (Periplaneta americana, a nocturnal insect with a visual system adapted for dim light. Results Whole-cell patch-clamped photoreceptors had high capacitances and input resistances, indicating large photosensitive rhabdomeres suitable for efficient photon capture and amplification of small photocurrents at low light levels. Two voltage-dependent potassium conductances were found in the photoreceptors: a delayed rectifier type (KDR and a fast transient inactivating type (KA. Activation of KDR occurred during physiological voltage responses induced by light stimulation, whereas KA was nearly fully inactivated already at the dark resting potential. In addition, hyperpolarization of photoreceptors activated a small-amplitude inward-rectifying (IR current mediated at least partially by chloride. Computer simulations showed that KDR shapes light responses by opposing the light-induced depolarization and speeding up the membrane time constant, whereas KA and IR have a negligible role in the majority of cells. However, larger KA conductances were found in smaller and rapidly adapting photoreceptors, where KA could have a functional role. Conclusions The relative expression of KA and KDR in cockroach photoreceptors was opposite to the previously hypothesized framework for dark-active insects, necessitating further comparative work on the conductances. In general, the varying deployment of stereotypical K+ conductances in insect photoreceptors highlights their functional flexibility in neural coding.

  15. Fast and Powerful: Biomechanics and Bite Forces of the Mandibles in the American Cockroach Periplaneta americana.

    Directory of Open Access Journals (Sweden)

    Tom Weihmann

    Full Text Available Knowing the functionality and capabilities of masticatory apparatuses is essential for the ecological classification of jawed organisms. Nevertheless insects, especially with their outstanding high species number providing an overwhelming morphological diversity, are notoriously underexplored with respect to maximum bite forces and their dependency on the mandible opening angles. Aiming for a general understanding of insect biting, we examined the generalist feeding cockroach Periplaneta americana, characterized by its primitive chewing mouth parts. We measured active isometric bite forces and passive forces caused by joint resistance over the entire mandibular range with a custom-built 2D force transducer. The opening angle of the mandibles was quantified by using a video system. With respect to the effective mechanical advantage of the mandibles and the cross-section areas, we calculated the forces exerted by the mandible closer muscles and the corresponding muscle stress values. Comparisons with the scarce data available revealed close similarities of the cockroaches' mandible closer stress values (58 N/cm2 to that of smaller specialist carnivorous ground beetles, but strikingly higher values than in larger stag beetles. In contrast to available datasets our results imply the activity of faster and slower muscle fibres, with the latter becoming active only when the animals chew on tough material which requires repetitive, hard biting. Under such circumstances the coactivity of fast and slow fibres provides a force boost which is not available during short-term activities, since long latencies prevent a specific effective employment of the slow fibres in this case.

  16. Endogenous rhythm and pattern-generating circuit interactions in cockroach motor centres

    Directory of Open Access Journals (Sweden)

    Izhak David

    2016-09-01

    Full Text Available Cockroaches are rapid and stable runners whose gaits emerge from the intricate, and not fully resolved, interplay between endogenous oscillatory pattern-generating networks and sensory feedback that shapes their rhythmic output. Here we studied the endogenous motor output of a brainless, deafferented preparation. We monitored the pilocarpine-induced rhythmic activity of levator and depressor motor neurons in the mesothoracic and metathoracic segments in order to reveal the oscillatory networks’ architecture and interactions. Data analyses included phase relations, latencies between and overlaps of rhythmic bursts, spike frequencies, and the dependence of these parameters on cycle frequency. We found that, overall, ipsilateral connections are stronger than contralateral ones. Our findings revealed asymmetries in connectivity among the different ganglia, in which meta-to-mesothoracic ascending coupling is stronger than meso-to-metathoracic descending coupling. Within-ganglion coupling between the metathoracic hemiganglia is stronger than that in the mesothoracic ganglion. We also report differences in the role and mode of operation of homologue network units (manifested by levator and depressor nerve activity. Many observed characteristics are similar to those exhibited by intact animals, suggesting a dominant role for feedforward control in cockroach locomotion. Based on these data we posit a connectivity scheme among components of the locomotion pattern generating system.

  17. Subsocial Cockroaches Nauphoeta cinerea Mate Indiscriminately with Kin Despite High Costs of Inbreeding.

    Directory of Open Access Journals (Sweden)

    Sofia Bouchebti

    Full Text Available Many animals have evolved strategies to reduce risks of inbreeding and its deleterious effects on the progeny. In social arthropods, such as the eusocial ants and bees, inbreeding avoidance is typically achieved by the dispersal of breeders from their native colony. However studies in presocial insects suggest that kin discrimination during mate choice may be a more common mechanism in socially simpler species with no reproductive division of labour. Here we examined this possibility in the subsocial cockroach Nauphoeta cinerea, a model species for research in sexual selection, where males establish dominance hierarchies to access females and control breeding territories. When given a binary choice between a sibling male and a non-sibling male that had the opportunity to establish a hierarchy prior to the tests, females mated preferentially with the dominant male, irrespective of kinship or body size. Despite the lack of kin discrimination during mate choice, inbred-mated females incurred significant fitness costs, producing 20% less offspring than outbred-mated females. We discuss how the social mating system of this territorial cockroach may naturally limit the probability of siblings to encounter and reproduce, without the need for evolving active inbreeding avoidance mechanisms, such as kin recognition.

  18. Análise química do bambu-gigante (Dendrocalamus giganteus Wall. ex Munro em diferentes idades

    Directory of Open Access Journals (Sweden)

    Nelson Potenciano Marinho

    2012-06-01

    Full Text Available http://dx.doi.org/10.5902/198050985749O bambu é uma planta monocotiledônea de origem tropical, de rápido crescimento, sendo considerado um importante regenerador ambiental devido ao seu sistema radicular. O Dendrocalamus giganteus é popularmente conhecido por bambu-gigante, sendo uma espécie entouceirante de grande porte, cujos colmos podem variar de 24 a 40 metros de altura, com diâmetros entre 10 e 20 cm. Esse trabalho teve como objetivo analisar quimicamente os colmos do bambu-gigante visando fornecer informações sobre a sua composição química nas idades de 2 a 6 anos. Os colmos do bambu foram coletados na área Experimental Agrícola do Departamento de Engenharia Mecânica da UNESP-Bauru, onde é realizado o manejo sistemático de diversas espécies de bambu para fins de pesquisas e divulgação dessa planta. Foram retiradas amostras da base entre bambus com idade de 2 a 6 anos de uma mesma touceira, totalizando 5 amostras, com 2 metros de altura cada, colhidas na lua minguante no mês de março. As análises químicas foram feitas com os entrenós, utilizando as normas e procedimentos da TAPPI. A porcentagem média de extrativos em água quente, extrativos em água fria, extrativos totais e teor de cinzas não apresentaram relação direta com a idade. A maior porcentagem de extrativos em água quente, com valor de 12,04%, extrativos em água fria, com 10,25%, e extrativos totais, com 12,91%, foi observada aos 2 anos de idade. A maior porcentagem de cinzas foi obtida aos três anos, com valores de 1,09%. O teor médio de extrativos em NaOH diminui de 25,72% aos dois anos para 20,17% aos seis anos de idade. O mesmo comportamento foi observado para os extrativos em etanol tolueno, diminuindo de 10,91% para 4,61%. O teor médio de lignina não sofreu influência da idade, variando de 22,66 a 24,11%.

  19. Ecological investigation, density, infestation rate and control strategy of German cockroach, Blattella germanica (L. in two hospitals in Ismailia, Egypt

    Directory of Open Access Journals (Sweden)

    M.F. Mahmoud

    2013-12-01

    Full Text Available A study was conducted to investigate the ecological situation, density, infestation rate and control strategy of German cockroach, Blattella germanica indoors in two hospitals in Ismailia Governorate, Egypt. The sticky traps method was used for 12 months in 2012. The cockroach index, sanitation and ventilation rate tables were tools to investigate the effectiveness of sanitation and related factors on B. germanica in Ismailia. Results showed that the population density of B. germanica increased gradually from January to July, and then decreased gradually till December of 2012 in both hospitals. The population density of B. germanica captured from hospital 1 (urban was higher than hospital 2 (rural in all months. Moreover, the number of German cockroach caught from different apartments in both hospitals was very significant different. Among these apartments, kitchen had the highest number of German cockroach, density, infestation rate and percent of nymphs. The highest population density was in kitchen (298.44, followed by dry food store (69.99, furniture room (25.91 and patient room (8.94, for hospital 1. However, the population was low in all apartments in hospital 2. Although several stages of B. germanica were caught from two hospitals, nymphs showed the higher infestation rate in all apartments surveyed in both hospitals. The infestation rate of nymphs was 92.5% in hospital 1 and 63.06% in hospital 2. In addition, temperature and humidity were measured in hospitals to study the relationship between population density of B. germanica and these parameters. There was a positive correlation between temperature and the population density for hospital 1 and for hospital 2. The correlation was negative between humidity and population density in both hospitals. In conclusion, integrated control measures should be taken according to the seasonal fluctuation, population density in hospitals in Ismailia. It should put the emphasis on environmental

  20. Cymbopogon citratus and Cymbopogon giganteus essential oils have cytotoxic effects on tumor cell cultures. Identification of citral as a new putative anti-proliferative molecule.

    Science.gov (United States)

    Bayala, Bagora; Bassole, Imaël H N; Maqdasy, Salwan; Baron, Silvère; Simpore, Jacques; Lobaccaro, Jean-Marc A

    2018-03-06

    Cymbopogon species are used as traditional remedies in Burkina Faso for treating several diseases. We aimed to study the effects of their essential oils on cancer cell lines. For that purpose, Cymbopogon citratus (DC.) Stapf. and Cymbopogon giganteus Chiov. were studied for their essential oils after various chemical extractions. Antioxidant, potential anti-inflammatory action (inhibition of lipoxygenase) and cytotoxic activities were also tested on various prostate cancer and glioblastoma cell lines. Thirty-three compounds were identified in the essential oil of C. giganteus: Limonene (19.33%), Mentha-1(7),8-dien-2-ol cis (17.34%), Mentha-1(7),8-dien-2-ol trans (13.95%), trans-Mentha-2,8-diene-para-ol 1 (13.91%) and Mentha-2,8-diene-1-ol, cis-para (8.10%) were the most abundant. C. citratus essential oil contained 15 compounds and the major ones were geranial/citral A (48.18%) and neral/citral B (34.37%). Essential oil of C. citratus showed the highest ability to scavenge DPPH + radicals (approximately 68% at 8 mg/mL) while C. giganteus exhibited the highest capability to reduce ABTS + (0.59μmolET/g). The essential oil of C. citratus was the most effective on prostate cell lines LNCaP (IC 50  = 6.36 μg/ml) and PC-3 (IC 50  = 32.1 μg/ml), and on glioblastoma cell lines (SF-767 (IC 50  = 45.13 μg/ml) and SF-763 (IC 50  = 172.05 μg/ml). Interestingly, the activity of essential oil of C. citratus was statistically equal to that of its major component, citral. Combination of both oils showed antagonist, additive, indifferent and synergistic effects on LNCaP, PC-3, SF-767 and SF-763 cell lines, respectively. In conclusion, plants from the traditional medicine in Burkina Faso could be of interest for identifying new compounds, such as citral, for the treatment of prostate cancer and glioblastoma. Copyright © 2018 Elsevier B.V. and Société Française de Biochimie et Biologie Moléculaire (SFBBM). All rights reserved.

  1. High load of multi-drug resistant nosocomial neonatal pathogens carried by cockroaches in a neonatal intensive care unit at Tikur Anbessa specialized hospital, Addis Ababa, Ethiopia

    OpenAIRE

    Tilahun, Birkneh; Worku, Bogale; Tachbele, Erdaw; Terefe, Simegn; Kloos, Helmut; Legesse, Worku

    2012-01-01

    Abstract Background Cockroaches have been described as potential vectors for various pathogens for decades; although studies from neonatal intensive care units are scarce. This study assessed the vector potential of cockroaches (identified as Blatella germanica) in a neonatal intensive care unit setup in Tikur Anbessa Hospital, Addis Ababa, Ethiopia. Methods A total of 400 Blatella germanica roaches were aseptically collected for five consecutive months. Standard laboratory procedures were us...

  2. Effects of Two Temperature Storage Regimes on the Efficacy of 3 Commercial Gel Baits against the German Cockroach, Blattella germanica L. (Dictyoptera: Blattellidae)

    OpenAIRE

    Oz, E; Cetin, H; Cilek, J E; Deveci, O; Yanikoglu, A

    2010-01-01

    "nBackground: To compare the effectiveness of 3 commercial gel bait formulations containing fipronil (Goliathã Cockroach Gel 0.05% AI), chlorpyrifos-A (Clean Baitã Gel, 2% AI), and chloropyrifos-B (Serpaã Gel 2% AI) against German cock­roaches (Blattella germanica) when stored at 23°C and 30° C after treatment."nMethods: Laboratory bioassays consisted of placing groups of fifteen cockroaches (a random combination of adult, mix...

  3. The First Report of Drug Resistant Bacteria Isolated from the Brown-Banded Cockroach, Supella longipalpa, in Ahvaz, South-western Iran

    Science.gov (United States)

    Vazirianzadeh, Babak; Dehghani, Rouhullah; Mehdinejad, Manijeh; Sharififard, Mona; Nasirabadi, Nersi

    2014-01-01

    Background The brown-banded cockroach, Supella longipalpa is known as a carrier of pathogenic bacteria in urban environments, but its role is not well documented regarding the carriage of antibiotic-resistant pathogenic bacteria in Iran. The aim of this study was to determine the resistance bacteria isolated from the brown-banded cockroach in Ahvaz, south west of Iran. Methods: Totally 39 cockroaches were collected from kitchen area of houses and identified. All specimens were cultured to isolate the bacterial agents on blood agar and MacConky agar media. The microorganisms were identified using necessary differential and biochemical tests. Antimicrobial susceptibility tests were performed for isolated organisms by Kirby-Bauer’s disk diffusion according to NCLI guideline, using 18 antibiotics. Results: From the 39 collected S. langipalpa, 179 bacterial agents were isolated, 92 of alimentary ducts and 87 of external body surfaces. Isolated bacteria from cockroaches were identified as Enterobacter spp., Klebsiella spp., Citrobacter spp., Escherichia coli, Salmonella spp., Proteus spp., coagulase negative staphylococci, Serratia marcescens, Staphylococcus aureus, and Bacillus species. The pattern resistance rates were determined for gram negative bacilli and gram positive cocci regarding 18 antibiotics. Conclusion: The brown-banded cockroach can be involved in the spread of drug resistant bacteria and increases the possibility of contacting human environment to drug resistant bacteria. Therefore, the potential of removing this insect should be improved. This is the first original report of drug resistant bacteria isolated from the brown-banded cockroach of Iran. PMID:25629065

  4. Embryogenic callus formation, growth and regeneration in callus and suspension cultures of Miscanthus x ogiformis Honda 'Giganteus' as affected by proline

    DEFF Research Database (Denmark)

    Holme, Inger Bæksted; Krogstrup, Peter; Hansen, Jürgen

    1997-01-01

    to test the effect of proline in suspension cultures. The proline additions affected the formation of embryogenic callus and the growth of suspension cultures. Improvements depended on the proline concentration and the basal salts of the medium. Addition of 12.5 to 50 mM proline to callus induction medium...... with Murashige and Skoog salts increased embryogenic callus formation on shoot apices and leaf explants while proline had no effect on embryogenic callus formation in medium with N6 salts. Increased growth with increasing proline concentration was obtained in suspension aggregates grown in medium with N6 salts......The effects of proline additions to culture systems of Miscanthus x ogiformis Honda Giganteus' were investigated. Proline was added in concentrations of 0, 12.5, 25, 50, 100 or 300 mM to the callus induction and suspension culture media containing either Murashige and Skoog or N6 basal salts and 22...

  5. Cutaneous hyalohyphomycosis in a girdled lizard (Cordylus giganteus) caused by the Chrysosporium anamorph of Nannizziopsis vriesii and successful treatment with voriconazole.

    Science.gov (United States)

    Hellebuyck, Tom; Baert, Kris; Pasmans, Frank; Van Waeyenberghe, Lieven; Beernaert, Lies; Chiers, Koen; De Backer, Patrick; Haesebrouck, Freddy; Martel, An

    2010-08-01

    The Chrysosporium anamorph of Nannizziopsis vriesii was associated with dermatomycosis and high mortality in a group of captive giant girdled lizards (Cordylus giganteus). Treatment of one of the infected girdled lizards with voriconazole, which was selected on the basis of in vitro sensitivity testing of the isolate, resulted in resolution of lesions and negative fungal cultures from the skin. Three hours after oral administration of 10 mg/kg, the plasma level of voriconazole exceeded the 0.25-μg/mL minimal inhibitory concentration tenfold. In conclusion, administration of voriconazole at 10 mg/kg of body weight once daily for 10 weeks resulted in clinical cure and was well tolerated. A longer follow-up time and larger studies will be necessary to determine the long-term efficacy and safety of this treatment in giant girdled lizards. © 2010 The Authors. Journal compilation © 2010 ESVD and ACVD.

  6. Growth and fecundity of fertileMiscanthus × giganteus("PowerCane") compared to feral and ornamentalMiscanthus sinensisin a common garden experiment: Implications for invasion.

    Science.gov (United States)

    Miriti, Maria N; Ibrahim, Tahir; Palik, Destiny; Bonin, Catherine; Heaton, Emily; Mutegi, Evans; Snow, Allison A

    2017-08-01

    Perennial grasses are promising candidates for bioenergy crops, but species that can escape cultivation and establish self-sustaining naturalized populations (feral) may have the potential to become invasive. Fertile Miscanthus  ×  giganteus , known as "PowerCane," is a new potential biofuel crop. Its parent species are ornamental, non-native Miscanthus species that establish feral populations and are sometimes invasive in the USA. As a first step toward assessing the potential for "PowerCane" to become invasive, we documented its growth and fecundity relative to one of its parent species ( Miscanthus sinensis ) in competition with native and invasive grasses in common garden experiments located in Columbus, Ohio and Ames, Iowa, within the targeted range of biofuel cultivation. We conducted a 2-year experiment to compare growth and reproduction among three Miscanthus biotypes-"PowerCane," ornamental M. sinensis , and feral M. sinensis -at two locations. Single Miscanthus plants were subjected to competition with a native grass ( Panicum virgatum ), a weedy grass ( Bromus inermis ), or no competition. Response variables were aboveground biomass, number of shoots, basal area, and seed set. In Iowa, all Miscanthus plants died after the first winter, which was unusually cold, so no further results are reported from the Iowa site. In Ohio, we found significant differences among biotypes in growth and fecundity, as well as significant effects of competition. Interactions between these treatments were not significant. "PowerCane" performed as well or better than ornamental or feral M. sinensis in vegetative traits, but had much lower seed production, perhaps due to pollen limitation. In general, ornamental M. sinensis performed somewhat better than feral M. sinensis . Our findings suggest that feral populations of "PowerCane" could become established adjacent to biofuel production areas. Fertile Miscanthus  ×  giganteus should be studied further to assess its

  7. Relationships between soil parameters and physiological status of Miscanthus x giganteus cultivated on soil contaminated with trace elements under NPK fertilisation vs. microbial inoculation.

    Science.gov (United States)

    Pogrzeba, Marta; Rusinowski, Szymon; Sitko, Krzysztof; Krzyżak, Jacek; Skalska, Aleksandra; Małkowski, Eugeniusz; Ciszek, Dorota; Werle, Sebastian; McCalmont, Jon Paul; Mos, Michal; Kalaji, Hazem M

    2017-06-01

    Crop growth and development can be influenced by a range of parameters, soil health, cultivation and nutrient status all play a major role. Nutrient status of plants can be enhanced both through chemical fertiliser additions (e.g. N, P, K supplementation) or microbial fixation and mobilisation of naturally occurring nutrients. With current EU priorities discouraging the production of biomass on high quality soils there is a need to investigate the potential of more marginal soils to produce these feedstocks and the impacts of soil amendments on crop yields within them. This study investigated the potential for Miscanthus x giganteus to be grown in trace element (TE)-contaminated soils, ideally offering a mechanism to (phyto)manage these contaminated lands. Comprehensive surveys are needed to understand plant-soil interactions under these conditions. Here we studied the impacts of two fertiliser treatments on soil physico-chemical properties under Miscanthus x giganteus cultivated on Pb, Cd and Zn contaminated arable land. Results covered a range of parameters, including soil rhizosphere activity, arbuscular mycorrhization (AM), as well as plant physiological parameters associated with photosynthesis, TE leaf concentrations and growth performance. Fertilization increased growth and gas exchange capacity, enhanced rhizosphere microbial activity and increased Zn, Mg and N leaf concentration. Fertilization reduced root colonisation by AMF and caused higher chlorophyll concentration in plant leaves. Microbial inoculation seems to be a promising alternative for chemical fertilizers, especially due to an insignificant influence on the mobility of toxic trace elements (particularly Cd and Zn). Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Impact of deltamethrin on cockroaches (Periplaneta americana and its residue on environment

    Directory of Open Access Journals (Sweden)

    Endang Puji Astuti

    2015-01-01

    Full Text Available AbstrakLatar belakang: Penggunaan insektisida secara intensif tidak hanya memberikan dampak pada spesies target, namun juga pada spesies non-target dan lingkungan. Pada penelitian ini dilakukan penilaian pengaruh residu deltametrin terhadap kecoa (Periplanetaamericana, ikan lele (Clarias batrachus, dan nila (Oreochromis niloticus. Selain itu laju infiltrasi residu pada tipe tanah dengan komposisi tanah yang berbeda juga diukur. Metode: Percobaan dilakukan terhadap kecoa yang dikembangbiakan  di laboratorium di Institut Pertanian Bogor. Perlakuan dengan tiga ulangan dan lima taraf konsentrasi deltamethrin: 0.8%, 0.4%, 0.2%, 0.1% and 0.05% (v/v dilakukan untuk mengukur pengaruh residu terhadap kecoa selama 24 dan 48 jam. Penentuan LC  dilakukan dengan analisis Probit. Konsentrasi letal yang didapatkan kemudiandiujikan kepada ikan lele dan nila dengan metode semprot. Untuk perbandingan, uji efek organofosfat dengan konsentrasi 1 ppm dan 10 ppm dilakukan melalui metode soaking kepada dua jenis ikan tersebut. Laju infiltrasi residu pada tiga tipe komposisi tanah diukur menggunakan lysimeter. Hasil: Hasil penelitian menunjukkan bahwa LC50 residu deltamethrin terhadap kecoa tercapai pada konsentrasi 0,2% pada 24-jam perlakuan. Lima puluh persen ikan nila mati pada perlakuan deltamethrin0,2% selama 24 jam. Laju infiltrasi residu lebih tinggi pada jenis tanah berpasir (5 ml/menit dibandingkan jenis tanah yang didominasi tanah liat. Kesimpulan: Selain memiliki efek mematikan pada kecoa, Deltamethrin 0,2% mencemari tanah dan air, serta membunuh ikan nila (O. niloticus. (Health Science Indones 2014;2:94-9Kata kunci: deltamethrin, efek residu, P. americana, O. niloticus, tanahAbstractBackground: Intensive use of chemical insecticides not only affect the targetspecies, but also non-target species and environment. In this study, we examined residual effect of deltamethrin on cockroaches (Periplaneta americana, catfishes (Clarias batrachus and nile

  9. Establishing health standards for indoor foreign proteins related to asthma: Dust mite, cat and cockroach

    Energy Technology Data Exchange (ETDEWEB)

    Platts-Mills, T.A.E.; Chapman, M.D.; Pollart, S.M.; Heymann, P.W.; Luczynska, C.M. (Univ. of Virginia, Charlottesville (United States))

    1990-01-01

    There is no doubt that a large number of individuals become allergic to foreign proteins that are predominantly or exclusively present indoors. In each case this immune response can be demonstrated either by immediate skin test responses or by measuring serum IgE antibodies. It has also been obvious for some time that patients presenting with asthma, perennial rhinitis and atopic dermatitis have an increased prevalence of IgE antibodies to these indoor allergens. More recently several epidemiological surveys have suggested that both mite exposure and IgE antibodies are important risk factors for asthma. The present situation is that assays have been developed capable of measuring the presence of mite, cockroach and cat allergens in house dust. Further clinical studies will be necessary to test the proposed standards for mite allergens and to define risk levels for other allergens.

  10. Change in sex pheromone expression by nutritional shift in male cockroaches

    DEFF Research Database (Denmark)

    Jensen, Kim; Shearman, Melanie; Rapkin, James

    2017-01-01

    vs. carbohydrates) in male Nauphoeta cinerea cockroaches on consumption, final lipid reserves, and sex pheromone levels subsequent to completing sexual maturation on a specific diet, at high and low concentration of dietary nutrients. Consumption, lipid reserves, and sex pheromone levels were highly...... affected by dietary nutrient composition with higher values on carbohydrate-biased diet, and males had significantly higher and lower levels of consumption, lipid reserves, and sex pheromones when shifted to a carbohydrate-biased and a protein-biased diet, respectively, compared with males maintained...... on either initial diet throughout the experiment. Males shifted to a carbohydrate-biased diet at high nutrient concentration fully recouped their sex pheromone levels, attaining levels that were not significantly lower than those in males maintained on carbohydrate-biased diet at high nutrient concentration...

  11. Behavioral activity of catnip (Lamiaceae) essential oil components to the German cockroach (Blattodea: Blattellidae).

    Science.gov (United States)

    Peterson, Chris J; Nemetz, Leah T; Jones, Leah M; Coat, Joel R

    2002-04-01

    The essential oil of catnip, Nepeta cataria L., contains two isomers of nepetalactone, E,Z-and Z,E-nepetalactone, and was tested for repellent activity to adult male German cockroaches, Blattella germanica (L.), in a choice-test arena. The two isomers of nepetalactone were purified by using preparative thin-layer chromatography and tested for behavioral activity in the choice-test arena. Significant differences due to concentration were detected by analysis of variance, and the responses were compared by least-squared means analysis. The activities of the essential oil and purified isomers were compared with N,NA-diethyl-3-methylbenzamide (DEET) by a paired t-test. E,Z-Nepetalactone was the most active of the compounds tested, being significantly more active to this species than equivalent doses of DEET, the essential oil, or Z,E-nepetalactone. Antennectomized insects showed no response to concentrations that were active against intact insects.

  12. The Optic Lobes Regulate Circadian Rhythms of Olfactory Learning and Memory in the Cockroach.

    Science.gov (United States)

    Lubinski, Alexander J; Page, Terry L

    2016-04-01

    The cockroach, Leucophaea maderae, can be trained in an associative olfactory memory task by either classical or operant conditioning. When trained by classical conditioning, memory formation is regulated by a circadian clock, but once the memory is formed, it can be recalled at any circadian time. In contrast, when trained via operant conditioning, animals can learn the task at any circadian phase, but the ability to recall the long-term memory is tied to the phase of training. The optic lobes of the cockroach contain a circadian clock that drives circadian rhythms of locomotor activity, mating behavior, sensitivity of the compound eye to light, and the sensitivity of olfactory receptors in the antennae. To evaluate the role of the optic lobes in regulating learning and memory processes, the authors examined the effects of surgical ablation of the optic lobes on memory formation in classical conditioning and memory recall following operant conditioning. The effect of optic lobe ablation was to "rescue" the deficit in memory acquisition at a time the animals normally cannot learn and "rescue" the animal's ability to recall a memory formed by operant conditioning at a phase where memory was not normally expressed. The results suggested that the optic lobe pacemaker regulates these processes through inhibition at "inappropriate" times of day. As a pharmacological test of this hypothesis, the authors showed that injections of fipronil, an antagonist of GABA and glutamate-activated chloride channels, had the same effects as optic lobe ablation on memory formation and recall. The data suggest that the optic lobes contain the circadian clock(s) that regulate learning and memory processes via inhibition of neural processes in the brain. © 2015 The Author(s).

  13. Hierarchical genetic analysis of German cockroach (Blattella germanica populations from within buildings to across continents.

    Directory of Open Access Journals (Sweden)

    Edward L Vargo

    Full Text Available Understanding the population structure of species that disperse primarily by human transport is essential to predicting and controlling human-mediated spread of invasive species. The German cockroach (Blattella germanica is a widespread urban invader that can actively disperse within buildings but is spread solely by human-mediated dispersal over longer distances; however, its population structure is poorly understood. Using microsatellite markers we investigated population structure at several spatial scales, from populations within single apartment buildings to populations from several cities across the U.S. and Eurasia. Both traditional measures of genetic differentiation and Bayesian clustering methods revealed increasing levels of genetic differentiation at greater geographic scales. Our results are consistent with active dispersal of cockroaches largely limited to movement within a building. Their low levels of genetic differentiation, yet limited active spread between buildings, suggests a greater likelihood of human-mediated dispersal at more local scales (within a city than at larger spatial scales (within and between continents. About half the populations from across the U.S. clustered together with other U.S. populations, and isolation by distance was evident across the U.S. Levels of genetic differentiation among Eurasian cities were greater than those in the U.S. and greater than those between the U.S. and Eurasia, but no clear pattern of structure at the continent level was detected. MtDNA sequence variation was low and failed to reveal any geographical structure. The weak genetic structure detected here is likely due to a combination of historical admixture among populations and periodic population bottlenecks and founder events, but more extensive studies are needed to determine whether signatures of global movement may be present in this species.

  14. Identification and characterization of antibacterial compound(s) of cockroaches (Periplaneta americana).

    Science.gov (United States)

    Ali, Salwa Mansur; Siddiqui, Ruqaiyyah; Ong, Seng-Kai; Shah, Muhammad Raza; Anwar, Ayaz; Heard, Peter J; Khan, Naveed Ahmed

    2017-01-01

    Infectious diseases remain a significant threat to human health, contributing to more than 17 million deaths, annually. With the worsening trends of drug resistance, there is a need for newer and more powerful antimicrobial agents. We hypothesized that animals living in polluted environments are potential sources of antimicrobials. Under polluted milieus, organisms such as cockroaches encounter different types of microbes, including superbugs. Such creatures survive the onslaught of superbugs and are able to ward off disease by producing antimicrobial substances. Here, we characterized antibacterial properties in extracts of various body organs of cockroaches (Periplaneta americana) and showed potent antibacterial activity in crude brain extract against methicillin-resistant Staphylococcus aureus and neuropathogenic Escherichia coli K1. The size-exclusion spin columns revealed that the active compound(s) are less than 10 kDa in molecular mass. Using cytotoxicity assays, it was observed that pre-treatment of bacteria with lysates inhibited bacteria-mediated host cell cytotoxicity. Using spectra obtained with LC-MS on Agilent 1290 infinity liquid chromatograph, coupled with an Agilent 6460 triple quadruple mass spectrometer, tissues lysates were analysed. Among hundreds of compounds, only a few homologous compounds were identified that contained the isoquinoline group, chromene derivatives, thiazine groups, imidazoles, pyrrole-containing analogs, sulfonamides, furanones, and flavanones and known to possess broad-spectrum antimicrobial properties and anti-inflammatory, anti-tumour, and analgesic properties. Further identification, characterization, and functional studies using individual compounds can act as a breakthrough in developing novel therapeutics against various pathogens including superbugs.

  15. Antagonist pharmacology of desensitizing and non-desensitizing nicotinic acetylcholine receptors in cockroach neurons.

    Science.gov (United States)

    Salgado, Vincent L

    2016-09-01

    Two α-bungarotoxin-sensitive nicotinic acetylcholine (ACh) receptor subtypes in neurons of the American cockroach have been identified as desensitizing (nAChD) and selectively inhibitable with 100nM imidacloprid, and non-desensitizing (nAChN) and selectively inhibitable with 100pM methyllycaconitine. In this paper, the single-electrode voltage-clamp technique was used to measure concentration-response relations for the action of ACh and five antagonists on pharmacologically separated nAChD and nAChN receptors of acutely dissociated neurons from thoracic ganglia of the American cockroach. A dual bath and U-tube perfusion system was used to achieve rapid application of ACh in the continued presence of antagonists, which was essential to accurately measure inhibition by rapidly-reversible antagonists. ACh activated both receptors with an EC 50 of 7μM and the antagonist potencies were (nAChD/nAChN in nM): dihydro-β-erythroidine: 1.0/5.6, d-tubocurarine: 1000/34, condelphine: 0.39/0.65, phencyclidine: 74/980 and mecamylamine 47/1150. While each of these antagonists displayed some subtype selectivity, none are selective enough to be used as subtype-selective tools. These results bring to a total of 16 the number of nicotinic compounds that have been measured on nAChD and nAChN currents. Characterization of these receptors is important for understanding the role of nAChRs in the insect nervous system and the mechanism of action of insecticides. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. Contamination affects the performance of insecticidal baits against German cockroaches (Dictyoptera: Blattellidae).

    Science.gov (United States)

    Appel, Arthur G

    2004-12-01

    The effects of contamination of insecticidal bait formulations, by using mint oil and silica aerogel, were evaluated in a series of laboratory experiments against the German cockroach, Blattella germanica (L.). Bait consumption at 3 d for uncontaminated baits ranged from 0.01 g for Avert dust to 0.399 g for Combat dry bait with hydramethylnon presented in a station. LT50 values for uncontaminated gel bait deposits ranged from 0.4 d for PreEmpt containing imidacloprid to 4.1 d for Maxforce containing hydramethylnon. As a group, significantly more gel bait was consumed than solid formulations even when both formulations had similar concentrations of the same active ingredient. As a result, gel baits were significantly more toxic than solid formulations. Application of mint oil directly to bait deposits significantly decreased bait consumption and increased overall LT50 values. When bait formulation types were examined individually, there was no difference in consumption or toxicity between contaminated and uncontaminated gel formulations. Contaminated solid baits, however, had significantly greater LT50 values and less consumption than uncontaminated solid baits. Gel formulations probably absorbed the contaminants and removed them from the surface of the bait deposits resulting in normal bait consumption and toxicity. Gel and solid bait deposits, inside plastic exposure stations or alone with no station and placed onto mint oil-contaminated substrates, had significantly lower bait consumption and greater LT50 values than baits placed on uncontaminated substrates. Contamination of a baited area is more likely than contamination of just the bait deposit and therefore a more realistic test of the effects of contamination on bait performance. The importance of contamination to the performance of cockroach baits is discussed.

  17. Gas exchange patterns and water loss rates in the Table Mountain cockroach, Aptera fusca (Blattodea: Blaberidae).

    Science.gov (United States)

    Groenewald, Berlizé; Bazelet, Corinna S; Potter, C Paige; Terblanche, John S

    2013-10-15

    The importance of metabolic rate and/or spiracle modulation for saving respiratory water is contentious. One major explanation for gas exchange pattern variation in terrestrial insects is to effect a respiratory water loss (RWL) saving. To test this, we measured the rates of CO2 and H2O release ( and , respectively) in a previously unstudied, mesic cockroach, Aptera fusca, and compared gas exchange and water loss parameters among the major gas exchange patterns (continuous, cyclic, discontinuous gas exchange) at a range of temperatures. Mean , and per unit did not differ among the gas exchange patterns at all temperatures (P>0.09). There was no significant association between temperature and gas exchange pattern type (P=0.63). Percentage of RWL (relative to total water loss) was typically low (9.79±1.84%) and did not differ significantly among gas exchange patterns at 15°C (P=0.26). The method of estimation had a large impact on the percentage of RWL, and of the three techniques investigated (traditional, regression and hyperoxic switch), the traditional method generally performed best. In many respects, A. fusca has typical gas exchange for what might be expected from other insects studied to date (e.g. , , RWL and cuticular water loss). However, we found for A. fusca that expressed as a function of metabolic rate was significantly higher than the expected consensus relationship for insects, suggesting it is under considerable pressure to save water. Despite this, we found no consistent evidence supporting the conclusion that transitions in pattern type yield reductions in RWL in this mesic cockroach.

  18. Suboptimal nutrient balancing despite dietary choice in glucose-averse German cockroaches, Blattella germanica.

    Science.gov (United States)

    Jensen, Kim; Schal, Coby; Silverman, Jules

    2015-10-01

    Insects have evolved fine-tuned gustatory and post-ingestive physiological mechanisms that enable them to self-select an optimal composition of macronutrients. Their ability to forage optimally among multiple food sources and maximize fitness parameters depends on their ability not only to taste and perceive the nutritional value of potential foods but also to avoid deleterious components; the strength of such avoidance should reflect the severity of the perceived hazard. In German cockroaches (Blattella germanica), glucose aversion has evolved in some populations in response to anthropogenic selection with glucose-containing insecticidal baits. In four feeding treatments, we gave newly eclosed glucose-averse female cockroaches free choice to feed from two artificial, nutritionally complementary foods varying in protein and carbohydrate composition, with glucose or fructose as the sole carbohydrate source in either food. After 6days of feeding, we measured diet consumption and the length of basal oocytes as an estimate of sexual maturation. The females did not compromise on their aversion to glucose in order to balance their protein and carbohydrate intake, and experienced lower sexual maturation rates as a consequence. Nutrient specific hunger via feedback mechanisms, and adjustments to gustatory sensitivity thus do not override the deterrence of glucose, likely due to strong selection against ingesting even small amounts of toxin associated with glucose in baits. In the absence of baits, glucose aversion would be expected to incur a fitness cost compared to wild-type individuals due to lower overall food availability but also to larger difficulty in attaining a nutritionally balanced diet. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. The structural basis for water exchange between the female cockroach (Blattella germanica) and her ootheca.

    Science.gov (United States)

    Mullins, Donald E; Mullins, K June; Tignor, Keith R

    2002-10-01

    Female German cockroaches usually carry their oothecae until they hatch. The success of embryogenesis may be dependent on the water-balance relationship between females and their developing oothecae. Oothecae detached from females early in embryogenesis often fail to develop, especially in low-humidity environments. Experiments reported here using tritiated water have confirmed the transport of a significant amount of water to the ootheca from the female during embryogenesis; 18% of the tritiated water injected into gravid females was recovered in their oothecae after 24 h. We describe a structural basis of water absorption by the oothecae. An area located on the proximal end of the ootheca (adjacent to the 'escutcheon-shaped vaginal imprint') contains small pores that penetrate the oothecal covering to access regions of the chorion lying beneath these pores. Experiments using microparabiotic chambers to examine transport of tritiated water and water-soluble materials across the escutcheon region of the oothecal covering, along with dark-field birefringent microscopy of the chorion, support the hypothesis that this chorionic network is capable of conducting water throughout the interior of the ootheca. Furthermore, the structural arrangement and intimate association of the female vestibulum with the oothecal pore field contained in the region of the escutcheon-shaped vaginal imprint appear to provide an efficient conduit to the chorion. The overall structural relationship might be a means for maintaining water balance between females and their oothecae during embryonic development. Evidence presented here supports observations that this species represents an important link in the transition from oviparity to ovoviviparity by internalization of cockroach oothecae.

  20. The Use of Double Translocation Heterozygotes To Control Populations of the German Cockroach and the Use of Genetic Mechanisms and Behavioral Characteristics To Control Natural Populations of the German Cockroach.

    Science.gov (United States)

    1986-05-30

    from one of the ships. Monogamy predominated, although re-mating sometimes occurred. removal method of population estimation provided estimates of...cockroaches are generally monogamous, although monogamy is not complete. c. Formal genetics (Ross 1975). The inheritance patterns and linkage...Unit 2, especially LCDR Donald McCroddan, Lt. Robert Gay , HM 1 W. M. Slinker, and others that were active at the time of the sterile male experiment

  1. Larvae of the parasitoid wasp Ampulex compressa sanitize their host, the American cockroach, with a blend of antimicrobials.

    Science.gov (United States)

    Herzner, Gudrun; Schlecht, Anja; Dollhofer, Veronika; Parzefall, Christopher; Harrar, Klaus; Kreuzer, Andreas; Pilsl, Ludwig; Ruther, Joachim

    2013-01-22

    Food resources contaminated with spoilage or pathogenic microorganisms pose severe problems to all higher organisms. Here, we describe a food-hygienic strategy of the emerald cockroach wasp Ampulex compressa. The wasp larvae develop on and inside the American cockroach Periplaneta americana, a host that can harbor various putrefactive microbes, as well as human and insect pathogens. From P. americana, we isolated the Gram-negative bacterium Serratia marcescens, which is a potent entomopathogen that can rapidly kill insect larvae. It is also known as a food contaminant and as an opportunistic human pathogen. Using behavioral observations and chemical analyses, we demonstrated that A. compressa larvae impregnate their cockroach hosts from inside with large amounts of an oral secretion containing a blend of γ-lactones and isocoumarins with (R)-(-)-mellein [(R)-(-)-3,4-diydro-8-hydroxy-3-methylisocoumarin] and micromolide [(4R,9Z)-octadec-9-en-4-olide] as dominant components. We fractionated hexane extracts of the secretion and investigated the antimicrobial properties of the fraction containing the lactones and isocoumarins, as well as of synthetic (R)-(-)-mellein and micromolide, against S. marcescens and a Gram-positive bacterium, Staphylococcus hyicus, in broth microdilution assays. The test fraction inhibited growth of both tested bacteria. The activity of the fraction against S. marcescens was explained by (R)-(-)-mellein alone, and the activity against S. hyicus was explained by the combined action of (R)-(-)-mellein and micromolide. Our data suggest that the specific combination of antimicrobials in the larval secretion provides an effective frontline defense against the unpredictable spectrum of microbes that A. compressa larvae may encounter during their development inside their cockroach hosts.

  2. Fumigant Toxicity of Plant Essential Oils and Selected Monoterpenoid Components against the Adult German Cockroach, Blattella germanica (L.) (Dictyoptera: Blattellidae)

    OpenAIRE

    TUNAZ, Hasan; ER, Mehmet Kubilay; IŞIKBER, Ali Arda

    2014-01-01

    The fumigant toxicity of various essential oils and selected monoterpenoid components were tested against the adult German cockroach, Blattella germanica (L.) (Dictyoptera: Blattellidae). Responses varied according to plant material, concentration, and exposure time. High insecticidal activity against adult B. germanica specimens was achieved with allyl isothiocyanate (component of horseradish) and the essential oil of Allium sativum (L.) (Liliales: Liliaceae) at the concentration of 2.5 and ...

  3. Pest Prevalence and Evaluation of Community-Wide Integrated Pest Management for Reducing Cockroach Infestations and Indoor Insecticide Residues.

    Science.gov (United States)

    Zha, Chen; Wang, Changlu; Buckley, Brian; Yang, Ill; Wang, Desen; Eiden, Amanda L; Cooper, Richard

    2018-01-18

    Pest infestations in residential buildings are common, but community-wide pest survey data are lacking. Frequent insecticide applications for controlling indoor pests leave insecticide residues and pose potential health risks to residents. In this study, a community-wide pest survey was carried out in a housing complex consisting of 258 units in 40 buildings in New Brunswick, New Jersey. It was immediately followed by implementation of an integrated pest management (IPM) program in all the cockroach-infested apartments and two bed bug apartments with the goal of eliminating pest infestations, reducing pyrethroid residues, and increasing resident satisfaction with pest control services. The IPM-treated apartments were revisited and treated biweekly or monthly for 7 mo. Initial inspection found the top three pests and their infestation rates to be as follows: German cockroaches (Blattella germanica L. [Blattodea: Blattellidae]), 28%; rodents, 11%; and bed bugs (Cimex lectularius L. [Hemiptera: Cimicidae]), 8%. Floor wipe samples were collected in the kitchens and bedrooms of 20 apartments for pyrethroid residue analysis before the IPM implementation; 17 of the 20 apartments were resampled again at 7 mo. The IPM program reduced cockroach counts per apartment by 88% at 7 wk after initial treatment. At 7 mo, 85% of the cockroach infestations found in the initial survey were eliminated. The average number of pyrethroids detected decreased significantly from 6 ± 1 (mean ± SEM) and 5 ± 1 to 2 ± 1 and 3 ± 1 in the kitchens and bedrooms, respectively. The average concentrations of targeted pyrethroids residue also decreased significantly in the kitchens and bedrooms. © The Author(s) 2018. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  4. Cuticle Fatty Acid Composition and Differential Susceptibility of Three Species of Cockroaches to the Entomopathogenic Fungi Metarhizium anisopliae (Ascomycota, Hypocreales).

    Science.gov (United States)

    Gutierrez, Alejandra C; Gołębiowski, Marek; Pennisi, Mariana; Peterson, Graciela; García, Juan J; Manfrino, Romina G; López Lastra, Claudia C

    2015-04-01

    Differences in free fatty acids (FFAs) chemical composition of insects may be responsible for susceptibility or resistance to fungal infection. Determination of FFAs found in cuticular lipids can effectively contribute to the knowledge concerning insect defense mechanisms. In this study, we have evaluated the susceptibility of three species of cockroaches to the entomopathogenic fungi Metarhizium anisopliae (Metschnikoff) Sorokin by topical application. Mortality due to M. anisopliae was highly significant on adults and nymphs of Blattella germanica L. (Blattodea: Blattellidae). However, mortality was faster in adults than in nymphs. Adults of Blatta orientalis L. (Blattodea: Blattidae) were not susceptible to the fungus, and nymphs of Blaptica dubia Serville (Blattodea: Blaberidae) were more susceptible to the fungus than adults. The composition of cuticular FFAs in the three species of cockroaches was also studied. The analysis indicated that all of the fatty acids were mostly straight-chain, long-chain, saturated or unsaturated. Cuticular lipids of three species of cockroaches contained 19 FFAs, ranging from C14:0 to C24:0. The predominant fatty acids found in the three studied species of cockroaches were oleic, linoleic, palmitic, and stearic acid. Only in adults of Bl. orientalis, myristoleic acid, γ-linolenic acid, arachidic acid, dihomolinoleic acid, and behenic acid were identified. Lignoceric acid was detected only in nymphs of Bl. orientalis. Heneicosylic acid and docosahexaenoic acid were identified in adults of Ba. dubia. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Caffeine-supplemented diet modulates oxidative stress markers and improves locomotor behavior in the lobster cockroach Nauphoeta cinerea.

    Science.gov (United States)

    da Silva, Cícera Simoni; de Cássia Gonçalves de Lima, Rita; Elekofehinti, Olusola Olalekan; Ogunbolude, Yetunde; Duarte, Antonia Eliene; Rocha, João Batista Teixeira; Alencar de Menezes, Irwin Rose; Barros, Luiz Marivando; Tsopmo, Appolinaire; Lukong, Kiven Erique; Kamdem, Jean Paul

    2018-02-25

    The effects of caffeine supplementation is well documented in conventional animal models, however, in the lobster cockroaches Nauphoeta cinerea, they have not been reported. Thus, the aim of this study was to investigate the locomotor behavior and biochemical endpoints in the head of the nymphs of N. cinerea following 60 days exposure to food supplemented with 0, 0.5, 1.0, 2.5, 5.0 and 10.0 mg of caffeine/g of diet. The analysis of the locomotor behavior using the video-tracking software, Any-maze, for 12 min revealed that caffeine supplementation caused significant behavioral improvement. There was increase in distance travelled, velocity, frequency of rotation and turn angle (stereotypical behavior such as circling movements), and this was supported by the representative track plots of the path travelled by cockroaches in the open-field arena. In addition, caffeine supplementation markedly increased total thiol and non-protein thiol glutathione (GSH) levels in the heads of cockroaches, and this was in parallel with significant reduction of lipid peroxidation and free Fe(II) content. Taking together, our results indicate that long-term caffeine supplementation may exert preventive effects against oxidative stress and support the use of N. cinerea as an efficient alternative model to assess the efficacy of food molecules. Copyright © 2018 Elsevier B.V. All rights reserved.

  6. Isolation and Purification of an Antibacterial Protein from Immune Induced Haemolymph of American Cockroach,Periplaneta americana.

    Science.gov (United States)

    Basseri, Hamid Reza; Dadi-Khoeni, Amir; Bakhtiari, Ronak; Abolhassani, Mandan; Hajihosseini-Baghdadabadi, Reza

    2016-12-01

    Antimicrobial peptides play a role as effectors substances in the immunity of vertebrate and invertebrate hosts. In the current study, antimicrobial peptide was isolated from the haemolymph of the American cockroach, Periplaneta americana . Micrococcus luteus as Gram-positive bacteria and Escherichia coli as Gram-negative bacteria were candidate for injection. Induction was done by injecting both bacteria into the abdominal cavity of two groups of cockroaches separately. The haemolymphs were collected 24 hours after post injection and initially tested against both bacteria. Subsequently, the immune induced haemolymph was purified by high performance liquid chromatography (HPLC) to separate the proteins responsible for the antibacterial activity. The non-induced haemolymph did not show any activity against both bacteria whereas induced haemolymph exhibited high activity against M. luteus but did less against E. coli . Two fractions showed antibacterial activity against M. luteus. Finally the molecular weight of the isolated antibacterial proteins were determined as 72 kDa and 62 kDa using SDS-PAGE. Induced haemolymph of American cockroaches has the ability to produce peptides to combat against Gram-positive bacteria when an immune challenge is mounted. Further work has to be done to sequence of the protein, which it would be advantageous.

  7. Ontogeny of hemocyanin in the ovoviviparous cockroach Blaptica dubia suggests an embryo-specific role in oxygen supply.

    Science.gov (United States)

    Pick, Christian; Schneuer, Marco; Burmester, Thorsten

    2010-05-01

    For a long time it had been assumed that specific oxygen transport proteins are absent in insects. Only recently it has been demonstrated that hemocyanins occur in the hemolymph of many ametabolous and hemimetabolous insect taxa, but not in the Eumetabola (Hemiptera+Holometabola). Therefore, the loss of respiratory hemocyanin in insects is not correlated with the evolution of an efficient tracheal system. The specific contribution of hemocyanin to oxygen supply in insects, however, has remained uncertain. Here we investigate the stage-specific expression of hemocyanin in the ovoviviparous cockroach Blaptica dubia (Blattaria), which consists of two distinct subunit types (Hc1 and Hc2). Employing quantitative real-time RT-PCR and Western blotting, we showed that the expression of hemocyanin is restricted to late embryos, thus being detectable also in whole female extracts and oothecae. Hemocyanin protein is also present in 1st instar nymphs, but not in later developmental stages. The ontogeny of hemocyanin in cockroaches is distinct from that known from Zygentoma and Plecoptera, in which hemocyanin occurs in both nymphal and adult stages. Our findings suggest a specific role of hemocyanin in embryonic cockroaches, which may be related to an enhanced oxygen supply in the oothecae. For some reason, the fundamental physiological changes associated to the evolution of holometaboly have made hemocyanin unnecessary. Copyright 2009 Elsevier Ltd. All rights reserved.

  8. The Core Gut Microbiome of the American Cockroach, Periplaneta americana, Is Stable and Resilient to Dietary Shifts.

    Science.gov (United States)

    Tinker, Kara A; Ottesen, Elizabeth A

    2016-11-15

    The omnivorous cockroach Periplaneta americana hosts a diverse hindgut microbiota encompassing hundreds of microbial species. In this study, we used 16S rRNA gene sequencing to examine the effect of diet on the composition of the P. americana hindgut microbial community. Results show that the hindgut microbiota of P. americana exhibit a highly stable core microbial community with low variance in compositions between individuals and minimal community change in response to dietary shifts. This core hindgut microbiome is shared between laboratory-hosted and wild-caught individuals, although wild-caught specimens exhibited a higher diversity of low-abundance microbes that were lost following extended cultivation under laboratory conditions. This taxonomic stability strongly contrasts with observations of the gut microbiota of mammals, which have been shown to be highly responsive to dietary change. A comparison of P. americana hindgut samples with human fecal samples indicated that the cockroach hindgut community exhibited higher alpha diversity but a substantially lower beta diversity than the human gut microbiome. This suggests that cockroaches have evolved unique mechanisms for establishing and maintaining a diverse and stable core microbiome. The gut microbiome plays an important role in the overall health of its host. A healthy gut microbiota typically assists with defense against pathogens and the digestion and absorption of nutrients from food, while dysbiosis of the gut microbiota has been associated with reduced health. In this study, we examined the composition and stability of the gut microbiota from the omnivorous cockroach Periplaneta americana. We found that P. americana hosts a diverse core gut microbiome that remains stable after drastic long-term changes in diet. While other insects, notably ant and bee species, have evolved mechanisms for maintaining a stable association with specific gut microbiota, these insects typically host low-diversity gut

  9. Role of tropomyosin as a cross-reacting allergen in sensitization to cockroach in patients from Martinique (French Caribbean island) with a respiratory allergy to mite and a food allergy to crab and shrimp

    NARCIS (Netherlands)

    Purohit, A.; Shao, J.; Degreef, J. M.; van Leeuwen, A.; van Ree, R.; Pauli, G.; de Blay, F.

    2007-01-01

    BACKGROUND: Tropomyosin has been described as cross-reacting allergen between mite, cockroach and shrimp. METHODS: In 13 patients with asthma and/or rhinitis sensitized to mite and/or German cockroach and presenting urticaria, oral allergy syndrome or angio-edema upon eating shrimp and/or crab, we

  10. Insecticidal and acetylcholine esterase inhibition activity of Asteraceae plant essential oils and their constituents against adults of the German cockroach (Blattella germanica).

    Science.gov (United States)

    Yeom, Hwa-Jeong; Jung, Chan-Sik; Kang, Jaesoon; Kim, Junheon; Lee, Jae-Hyeon; Kim, Dong-Soo; Kim, Hyun-Seok; Park, Pil-Sun; Kang, Kyu-Suk; Park, Il-Kwon

    2015-03-04

    The fumigant and contact toxicities of 16 Asteraceae plant essential oils and their constituents against adult male and female Blattella germanica were examined. In a fumigant toxicity test, tarragon oil exhibited 100% and 90% fumigant toxicity against adult male German cockroaches at 5 and 2.5 mg/filter paper, respectively. Fumigant toxicities of Artemisia arborescens and santolina oils against adult male German cockroaches were 100% at 20 mg/filter paper, but were reduced to 60% and 22.5% at 10 mg/filter paper, respectively. In contact toxicity tests, tarragon and santolina oils showed potent insecticidal activity against adult male German cockroaches. Components of active oils were analyzed using gas chromatography, gas chromatography-mass spectrometry, or nuclear magnetic resonance spectrometer. Among the identified compounds from active essential oils, estragole demonstrated potent fumigant and contact toxicity against adult German cockroaches. β-Phellandrene exhibited inhibition of male and female German cockroach acetylcholinesterase activity with IC50 values of 0.30 and 0.28 mg/mL, respectively.

  11. Toxicity of entomopathogenic fungi, Beauveria bassiana and Lecanicillium muscarium against a field-collected strain of the German cockroach Blattella germanica (L.) (Dictyoptera: Blattellidae).

    Science.gov (United States)

    Davari, B; Limoee, M; Khodavaisy, S; Zamini, G; Izadi, S

    2015-09-01

    The German cockroach, Blattella germanica (L.) has been recognized as a serious health problem throughout the world. Control failures due to insecticide resistance and chemical contamination of environment have led some researchers focus on the other alternative strategy controls. Microbial insecticides such as those containing entomo pathogenic fungi could be of high significance. Lecanicillium muscarium and Beauveria bassiana grow naturally in soils throughout the world and act as a parasite on various arthropod species, causing white muscardine disease. Thus, these two species could be considered as entomopathogenic fungi. The current study conducted to evaluate the toxicity of Beauveria bassiana and Lecanicillium muscarium against German cockroach, Blattella germanica. Conidial formulations of L. muscarium (PTCC 5184) and B. bassiana (PTCC5197) were prepared in aqueous suspensions with Tween 20. Bioassays were performed using two methods including submersion of cockroaches in conidial suspension and baiting. Data were analyzed by Probit program and LC50 and LC90 were estimated. The obtained results indicated that both fungi species were toxic against German cockroach however; Beauveria bassiana was significantly 4.8 fold more toxic than L. muscarium against German cockroach using submersion method.

  12. Synergistic effect of some essential oils on toxicity and knockdown effects, against mosquitos, cockroaches and housefly

    Directory of Open Access Journals (Sweden)

    Idin Zibaee

    2015-12-01

    Full Text Available The toxicity and knockdown effect of Eucalyptus globulus, Rosmarinus officinalis essential oils and their mixed formulation on Periplaneta Americana (L., Blattella germanica (L., Supella longipalpa, Culex pipiens, Anopheles stephensi and Musca domestica were evaluated in a series of laboratory experiments. In all bioassay five different doses (0.625, 1.25, 2.5, 5 and 10% were used by filter paper (cm2 and aerosol (cm3 bioassay methods, all essential oils was toxic to cockroaches, mosquitos and housefly species the lowest and the highest LC50 belong to mixed formulation on B. germanica (LC50 6.1 and E. globulus on P. americana (LC50 27.7 respectively. In continuous exposure experiments, Mortality (LT50 values for cockroaches ranged from 1403.3 min with 0.625% E. globulus (for P. americana to 2.2 min with 10% mixed formulation for A. stephensi. The KT50 values ranged from 0.1 to 1090.8 min for 10% and 0.625 for mixed formulation and R. officinalis respectively. The mortality after 24 h for mixed formulation was 100% but for single essential oils ranged from 81.5 to 98.3 for P. americana treated with R. officinalis and A. stephensi treated with E. globulus respectively. Studies on persistence of essential oils on impregnated paper revealed that it has more adulticidal activity for longer period at low storage temperature. Gas chromatographic-mass spectrometric analysis of essential oil showed 14 and 16 peaks for E. globules and R. officinalis respectively. α-Pinene (39.8%, 1, 8-Cineole (13.2%, Camphene (9.1% and Borneol (3.7% were present in major amounts for R. officinalis and 1,8-Cineole (31.4%, α-Pinene (15.3%, d-Limonene (9.7% and α-Terpinolen (5.3% were present in major amounts for E. globulus respectively. Our results showed that two surveyed essential oils has compatible with synergistic effect on various insect species, furthermore it is useful for applying as integrated pest management tool for studied insects management, especially in

  13. Bioelimination of /sup 51/Cr and /sup 85/Sr by cockroaches, Gromphadorhina portentosa (orthoptera: blaberidae), as affected by mites, Gromphadorholaelaps schaeferi (parasitiformes: laelapidae)

    Energy Technology Data Exchange (ETDEWEB)

    Schowalter, T.D.; Crossley, D.A. Jr.

    1982-03-01

    The rates of Chromium-51 and Strontium-85 assimilation and bioelimination by the hissing cockroach, Gromphadorhina portentosa (Schaum) are described when the symbiotic mite, Gromphadorholaelaps schaeferi Till, was present or removed. Mite-infested cockroaches had significantly higher rates of /sup 51/Cr elimination relative to mite-free cockroaches, implying more rapid gut clearance times. The authors did not find a significant mite effect on /sup 85/Sr elimination by the host, but mite effects could have been masked by the apparently unique process of nutrient assimilation and elimination by G. portentosa. Conventional models of radioactive tracer bioelimination predict a rapid initial loss of tracer due to gut clearance, followed by a slower loss due to excretion of assimilated tracer. The results indicated that assimilated /sup 85/Sr was eliminated earlier than unassimilated /sup 85/Sr, which was lost by defecation.

  14. Bioelimination of /sup 51/Cr and /sup 85/Sr by cockroaches, Gromphadorhina portentosa (Orthoptera: Blaberidae), as affected by mites, Gromphadorholaelaps schaeferi (parasitiformes: laelapidae)

    Energy Technology Data Exchange (ETDEWEB)

    Schowalter, T.D.; Crossley, D.A. Jr.

    1982-03-01

    This paper describes rates of Chromium-51 and Strontium-85 assimilation and bioelimination by the hissing cockroach, Gromphadorhina portentosa (Schaum), when the symbiotic mite, Gromphadorholaelaps schaeferi Till, was present or removed. Mite-infested cockroaches had significantly higher rates of /sup 51/Cr elimination relative to mite-free cockroaches, implying more rapid gut clearance times. We did not find a significant mite effect on /sup 85/Sr elimination by the host, but mite effects could have been masked by the apparently unique process of nutrient assimilation and elimination by G. portentosa. Conventional models of radioactive tracer bioelimination predict a rapid initial loss of tracer due to gut clearance, followed by a slower loss due to excretion of assimilated tracer. Our results indicated that assimilated /sup 85/Sr was eliminated earlier than unassimilated /sup 85/Sr was lost by defecation.

  15. Laboratory Evaluation of Toxicity of Insecticide Formulations from Different Classes against American Cockroach (Dictyoptera: Blattidae.

    Directory of Open Access Journals (Sweden)

    Ruhma Syed

    2014-06-01

    Full Text Available The present study was designed to investigate the insecticidal efficacy of four different classes of insecticides: pyrethroids, organophosphates, phenyl-pyrazoles and neo-nicotenoids. One representative chemical from each class was selected to compare the toxicity: deltamethrin from pyrethroids, Dichlorovinyl Dimethyl Phosphate (DDVP from organophosphates, fipronil from phenyl-pyrazoles and imidacloprid from neo-nicotenoids. The objective of this study was to determine which of these insecticides were most effective against American cockroach.These insecticides were tested for their LC50 values against Periplaneta americana under topical bioassay method, using different concentrations for each chemical.Fipronil 2.5% EC was highly effective at all concentrations applied, while DDVP 50% EC was least toxic amongst all. One way analysis of variance confirmed significant differences between mortality of P. americana and different concentrations applied (P< 0.05.Locality differentiation is an important factor in determining the range of resistance between various localities, as all three localities behaved differently in terms of their levels of resistance.

  16. An augmented reality system validation for the treatment of cockroach phobia.

    Science.gov (United States)

    Bretón-López, Juani; Quero, Soledad; Botella, Cristina; García-Palacios, Azucena; Baños, Rosa Maria; Alcañiz, Mariano

    2010-12-01

    Augmented reality (AR) is a new technology in which various virtual elements are incorporated into the user's perception of the real world. The most significant aspect of AR is that the virtual elements add relevant and helpful information to the real scene. AR shares some important characteristics with virtual reality as applied in clinical psychology. However, AR offers additional features that might be crucial for treating certain problems. An AR system designed to treat insect phobia has been used for treating phobia of small animals, and positive preliminary data about the global efficacy of the system have been obtained. However, it is necessary to determine the capacity of similar AR systems and their elements that are designed to evoke anxiety in participants; this is achieved by testing the correspondence between the inclusion of feared stimuli and the induction of anxiety. The objective of the present work is to validate whether the stimuli included in the AR-Insect Phobia system are capable of inducing anxiety in six participants diagnosed with cockroach phobia. Results support the adequacy of each element of the system in inducing anxiety in all participants.

  17. Neuromodulation of Olfactory Sensitivity in the Peripheral Olfactory Organs of the American Cockroach, Periplaneta americana

    Science.gov (United States)

    Jung, Je Won; Kim, Jin-Hee; Pfeiffer, Rita; Ahn, Young-Joon; Page, Terry L.; Kwon, Hyung Wook

    2013-01-01

    Olfactory sensitivity exhibits daily fluctuations. Several studies have suggested that the olfactory system in insects is modulated by both biogenic amines and neuropeptides. However, molecular and neural mechanisms underlying olfactory modulation in the periphery remain unclear since neuronal circuits regulating olfactory sensitivity have not been identified. Here, we investigated the structure and function of these signaling pathways in the peripheral olfactory system of the American cockroach, Periplaneta americana, utilizing in situ hybridization, qRT-PCR, and electrophysiological approaches. We showed that tachykinin was co-localized with the octopamine receptor in antennal neurons located near the antennal nerves. In addition, the tachykinin receptor was found to be expressed in most of the olfactory receptor neurons in antennae. Functionally, the effects of direct injection of tachykinin peptides, dsRNAs of tachykinin, tachykinin receptors, and octopamine receptors provided further support for the view that both octopamine and tachykinin modulate olfactory sensitivity. Taken together, these findings demonstrated that octopamine and tachykinin in antennal neurons are olfactory regulators in the periphery. We propose here the hypothesis that octopamine released from neurons in the brain regulates the release of tachykinin from the octopamine receptor neurons in antennae, which in turn modulates the olfactory sensitivity of olfactory receptor neurons, which house tachykinin receptors. PMID:24244739

  18. Neuromodulation of olfactory sensitivity in the peripheral olfactory organs of the American cockroach, Periplaneta americana.

    Directory of Open Access Journals (Sweden)

    Je Won Jung

    Full Text Available Olfactory sensitivity exhibits daily fluctuations. Several studies have suggested that the olfactory system in insects is modulated by both biogenic amines and neuropeptides. However, molecular and neural mechanisms underlying olfactory modulation in the periphery remain unclear since neuronal circuits regulating olfactory sensitivity have not been identified. Here, we investigated the structure and function of these signaling pathways in the peripheral olfactory system of the American cockroach, Periplaneta americana, utilizing in situ hybridization, qRT-PCR, and electrophysiological approaches. We showed that tachykinin was co-localized with the octopamine receptor in antennal neurons located near the antennal nerves. In addition, the tachykinin receptor was found to be expressed in most of the olfactory receptor neurons in antennae. Functionally, the effects of direct injection of tachykinin peptides, dsRNAs of tachykinin, tachykinin receptors, and octopamine receptors provided further support for the view that both octopamine and tachykinin modulate olfactory sensitivity. Taken together, these findings demonstrated that octopamine and tachykinin in antennal neurons are olfactory regulators in the periphery. We propose here the hypothesis that octopamine released from neurons in the brain regulates the release of tachykinin from the octopamine receptor neurons in antennae, which in turn modulates the olfactory sensitivity of olfactory receptor neurons, which house tachykinin receptors.

  19. Characterization of an Invertebrate-Type Dopamine Receptor of the American Cockroach, Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Britta Troppmann

    2014-01-01

    Full Text Available We have isolated a cDNA coding for a putative invertebrate-type dopamine receptor (Peadop2 from P. americana brain by using a PCR-based strategy. The mRNA is present in samples from brain and salivary glands. We analyzed the distribution of the PeaDOP2 receptor protein with specific affinity-purified polyclonal antibodies. On Western blots, PeaDOP2 was detected in protein samples from brain, subesophageal ganglion, thoracic ganglia, and salivary glands. In immunocytochemical experiments, we detected PeaDOP2 in neurons with their somata being located at the anterior edge of the medulla bilaterally innervating the optic lobes and projecting to the ventro-lateral protocerebrum. In order to determine the functional and pharmacological properties of the cloned receptor, we generated a cell line constitutively expressing PeaDOP2. Activation of PeaDOP2-expressing cells with dopamine induced an increase in intracellular cAMP. In contrast, a C-terminally truncated splice variant of this receptor did not exhibit any functional property by itself. The molecular and pharmacological characterization of the first dopamine receptor from P. americana provides the basis for forthcoming studies focusing on the significance of the dopaminergic system in cockroach behavior and physiology.

  20. Hormonal control of carbohydrate metabolism in the American cockroach, Periplaneta americana L

    Energy Technology Data Exchange (ETDEWEB)

    Sevala, V.L.

    1987-01-01

    Hormonal control of trehalose synthesis in the fat body of the cockroach, Periplaneta americana, is accompanied by a large decrease in the flux of metabolites through the glycolytic pathway. The decrease in glycolytic flux was investigated by measuring time-dependent changes in the concentrations of glycolytic intermediates at various times after treating the fat body with corpus cardiacum (CC) extract. The concentration of glucose 6-phosphate in fat body which had been treated with CC extract increased by 360 percent after 30 min, whereas that of fructose 6-phosphate and fructose 1,6-bisphosphate increased by only 138 and 150 percent respectively. The concentration of glyceraldehyde 3-phosphate and dihydroxyacetone phosphate were not affected by CC extract. The level of glycerol 3-phosphate in the fat body was increased by 116 percent at 30 minutes. The data provide the first evidence that the decrease in glycolytic activity due to the CC results from the inhibition of aldolase and phosphoglucoisomerase. The data show also that phosphoglucoisomerase is inhibited by glycerol 3-phosphate in the concentration range that occurs in CC treated tissue. The enzyme is also inhibited by erythrose 4-phosphate and 6-phosphogluconate. CC extract showed no apparent effect on the incorporation of /sup 14/C into trehalose or glycogen from /sup 14/C labelled amino acids.

  1. Development-dependent and -independent ubiquitin expression in divisions of the cockroach mushroom body.

    Science.gov (United States)

    Brown, Sheena M; Strausfeld, Nicholas J

    2006-06-01

    It has been proposed that the alpha and beta divisions of the mushroom bodies support intermediate and long-term memory whereas the gamma lobes support short-term memory. Here we investigate developmentally dependent versus developmentally independent alterations of mushroom body structure with special emphasis on its lobes. We show that in the cockroach mushroom bodies there are two types of plastic remodeling. One is developmental, in which episodic addition of new circuitry to the alpha and beta lobes is accomplished by newly born Kenyon cells. The second is revealed as a persistent alteration of structure within the gamma lobe. In the alpha/beta lobes, newly generated Kenyon cell axons extend glutamate-immunoreactive collaterals across layers of the axons of mature Kenyon cells. At specific times in each developmental episode (instar) these collaterals express ubiquitin, undergo localized degeneration, and are scavenged by glial cells. In contrast, the mature Kenyon cells that comprise the gamma lobe express detectable ubiquitin throughout each developmental episode. This pattern of ubiquitin expression suggests that the gamma lobe circuitry undergoes continuous modification independent of development.

  2. Isolation and Purification of an Antibacterial Protein from Immune Induced Haemolymph of American Cockroach, Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Hamid Reza Basseri

    2016-10-01

    Full Text Available Background: Antimicrobial peptides play a role as effectors substances in the immunity of vertebrate and inverte­brate hosts. In the current study, antimicrobial peptide was isolated from the haemolymph of the American cock­roach, Periplaneta americana.Methods: Micrococcus luteus as Gram-positive bacteria and Escherichia coli as Gram-negative bacteria were candi­date for injection. Induction was done by injecting both bacteria into the abdominal cavity of two groups of cock­roaches separately. The haemolymphs were collected 24 hours after post injection and initially tested against both bacteria. Subsequently, the immune induced haemolymph was purified by high performance liquid chromatography (HPLC to separate the proteins responsible for the antibacterial activity.Results: The non-induced haemolymph did not show any activity against both bacteria whereas induced haemo­lymph exhibited high activity against M. luteus but did less against E. coli. Two fractions showed antibacterial activ­ity against M. luteus. Finally the molecular weight of the isolated antibacterial proteins were determined as 72 kDa and 62 kDa using SDS-PAGE.Conclusion: Induced haemolymph of American cockroaches has the ability to produce peptides to combat against Gram-positive bacteria when an immune challenge is mounted. Further work has to be done to sequence of the pro­tein, which it would be advantageous.

  3. Serologic-based investigation of leptospirosis in a population of free-ranging eastern grey kangaroos (Macropus giganteus) indicating the presence of Leptospira weilii serovar Topaz.

    Science.gov (United States)

    Roberts, Michael W; Smythe, Lee; Dohnt, Michael; Symonds, Meegan; Slack, Andrew

    2010-04-01

    Eastern grey kangaroos (Macropus giganteus) are one of the most abundant large macropodids sharing the landscape with humans. Despite this, little is known about the prevalence of Leptospira carriage within this species and the role that they may partake in the transmission of this disease in Australia. The sera of 87 free-ranging eastern grey kangaroos, captured in the Warragamba Catchment Area, Sydney, Australia, from June 2004 to November 2006, were screened against a reference panel of 22 Leptospira serovars using the microscopic agglutination test (MAT). Leptospiral antibodies were detected in 47% (41 of 87) of serum samples collected. Leptospira weilii Topaz, a newly emergent serovar in Australia, was detected in all seropositive kangaroos (41 of 41; 100%). The sex and tail-fat body condition index of kangaroos appeared to have no significant effect on the exposure to the disease. This serologic-based study is the first reported for L. weilii serovar Topaz in New South Wales, to our knowledge, having previously been isolated only in humans and two other animal species (bovine and long-nosed bandicoot [Perameles nasuta]) in Western Australia and Queensland. The potential role of eastern grey kangaroos in the maintenance and zoonotic spread of the disease to livestock and humans is discussed.

  4. Effect of heat wave on the Indian Flying Fox Pteropus giganteus (Mammalia: Chiroptera: Pteropodidae population from Purulia District of West Bengal, India

    Directory of Open Access Journals (Sweden)

    Somenath Dey

    2015-03-01

    Full Text Available The present study was undertaken to examine the effect of heat wave on the behavior and population count of Indian Flying Fox Pteropus giganteus from a roosting colony occupying a Tamarind tree Tamarindus indica at Simla Village of Purulia District of West Bengal, India during the period from March 2010 to July 2010.  A total population comprising 250 individuals, recorded in March 2010, came down to 80 by June 2010.  Information obtained from local villagers affirmed that the roosting bat colony from the present study location was a century old and had no apparent conflicts with villagers; moreover, it was protected with reverence.  However, soaring day temperatures (with a maximum of up to 480C, recorded during May and June 2010 alongside drought were the major threats that the population faced and mass die-offs caused the population to decline during the hotter months.  Continuous fanning and belly-soaking were common behavioural features recorded during the summer months.  However, death rate due to hyperthermia and dehydration was uncommonly high. 

  5. A retrospective study of Babesia macropus associated with morbidity and mortality in eastern grey kangaroos (Macropus giganteus) and agile wallabies (Macropus agilis).

    Science.gov (United States)

    Donahoe, Shannon L; Peacock, Christopher S; Choo, Ace Y L; Cook, Roger W; O'Donoghue, Peter; Crameri, Sandra; Vogelnest, Larry; Gordon, Anita N; Scott, Jenni L; Rose, Karrie

    2015-08-01

    This is a retrospective study of 38 cases of infection by Babesia macropus, associated with a syndrome of anaemia and debility in hand-reared or free-ranging juvenile eastern grey kangaroos (Macropus giganteus) from coastal New South Wales and south-eastern Queensland between 1995 and 2013. Infection with B. macropus is recorded for the first time in agile wallabies (Macropus agilis) from far north Queensland. Animals in which B. macropus infection was considered to be the primary cause of morbidity had marked anaemia, lethargy and neurological signs, and often died. In these cases, parasitised erythrocytes were few or undetectable in peripheral blood samples but were sequestered in large numbers within small vessels of visceral organs, particularly in the kidney and brain, associated with distinctive clusters of extraerythrocytic organisms. Initial identification of this piroplasm in peripheral blood smears and in tissue impression smears and histological sections was confirmed using transmission electron microscopy and molecular analysis. Samples of kidney, brain or blood were tested using PCR and DNA sequencing of the 18S ribosomal RNA and heat shock protein 70 gene using primers specific for piroplasms. The piroplasm detected in these samples had 100% sequence identity in the 18S rRNA region with the recently described Babesia macropus in two eastern grey kangaroos from New South Wales and Queensland, and a high degree of similarity to an unnamed Babesia sp. recently detected in three woylies (Bettongia penicillata ogilbyi) in Western Australia.

  6. Potential of the beneficial fungus Trichoderma to enhance ecosystem-service provision in the biofuel grass Miscanthus x giganteus in agriculture

    Science.gov (United States)

    Chirino-Valle, Ivan; Kandula, Diwakar; Littlejohn, Chris; Hill, Robert; Walker, Mark; Shields, Morgan; Cummings, Nicholas; Hettiarachchi, Dilani; Wratten, Stephen

    2016-01-01

    The sterile hybrid grass Miscanthus x giganteus (Mxg) can produce more than 30 t dry matter/ha/year. This biomass has a range of uses, including animal bedding and a source of heating fuel. The grass provides a wide range of other ecosystem services (ES), including shelter for crops and livestock, a refuge for beneficial arthropods, reptiles and earthworms and is an ideal cellulosic feedstock for liquid biofuels such as renewable (drop-in) diesel. In this study, the effects of different strains of the beneficial fungus Trichoderma on above- and below-ground biomass of Mxg were evaluated in glasshouse and field experiments, the latter on a commercial dairy farm over two years. Other ES benefits of Trichoderma measured in this study included enhanced leaf chlorophyll content as well as increased digestibility of the dried material for livestock. This study shows, for the first time for a biofuel feedstock plant, how Trichoderma can enhance productivity of such plants and complements other recent work on the wide-ranging provision of ES by this plant species. PMID:27117716

  7. A retrospective study of Babesia macropus associated with morbidity and mortality in eastern grey kangaroos (Macropus giganteus and agile wallabies (Macropus agilis

    Directory of Open Access Journals (Sweden)

    Shannon L. Donahoe

    2015-08-01

    Full Text Available This is a retrospective study of 38 cases of infection by Babesia macropus, associated with a syndrome of anaemia and debility in hand-reared or free-ranging juvenile eastern grey kangaroos (Macropus giganteus from coastal New South Wales and south-eastern Queensland between 1995 and 2013. Infection with B. macropus is recorded for the first time in agile wallabies (Macropus agilis from far north Queensland. Animals in which B. macropus infection was considered to be the primary cause of morbidity had marked anaemia, lethargy and neurological signs, and often died. In these cases, parasitised erythrocytes were few or undetectable in peripheral blood samples but were sequestered in large numbers within small vessels of visceral organs, particularly in the kidney and brain, associated with distinctive clusters of extraerythrocytic organisms. Initial identification of this piroplasm in peripheral blood smears and in tissue impression smears and histological sections was confirmed using transmission electron microscopy and molecular analysis. Samples of kidney, brain or blood were tested using PCR and DNA sequencing of the 18S ribosomal RNA and heat shock protein 70 gene using primers specific for piroplasms. The piroplasm detected in these samples had 100% sequence identity in the 18S rRNA region with the recently described Babesia macropus in two eastern grey kangaroos from New South Wales and Queensland, and a high degree of similarity to an unnamed Babesia sp. recently detected in three woylies (Bettongia penicillata ogilbyi in Western Australia.

  8. Aryl Hydrocarbon Receptor (AhR Modulates Cockroach Allergen-Induced Immune Responses through Active TGFβ1 Release

    Directory of Open Access Journals (Sweden)

    Yufeng Zhou

    2014-01-01

    Full Text Available Background. Aryl hydrocarbon receptor (AhR, a multifunctional regulator that senses and responds to environmental stimuli, plays a role in normal cell development and immune regulation. Recent evidence supports a significant link between environmental exposure and AhR in the development of allergic diseases. We sought to investigate whether AhR plays a role in mediating cockroach allergen-induced allergic immune responses. Methods. AhR expression in human lung fibroblasts from asthmatic and healthy individuals and in cockroach extract (CRE treated human lung fibroblasts (WI-38 was examined. The role of AhR in modulating CRE induced TGFβ1 production was investigated by using AhR agonist, TCDD, antagonist CH122319, and knockdown of AhR. The role of latent TGFβ1 binding protein-1 (LTBP1 in mediating TCDD induced active TGFβ1 release was also examined. Results. AhR expression was higher in airway fibroblasts from asthmatic subjects as compared to healthy controls. AhR in fibroblasts was activated by TCDD with an increased expression of cyp1a1 and cyp1b1. Increased AhR expression was observed in CRE-treated fibroblasts. Importantly, CRE induced TGFβ1 production in fibroblasts was significantly enhanced by TCDD but inhibited by CH122319. Reduced TGFβ1 production was further confirmed in fibroblasts with AhR knockdown. Moreover, AhR knockdown inhibited CRE induced fibroblast differentiation. Furthermore, TCDD induced active TGFβ1 release was significantly inhibited by LTBP1 knockdown. Conclusion. These results provide evidence for the role of AhR in modulating cockroach allergen-induced immune responses through controlling the active TGFβ1 release, suggesting a possible synergistic effect between exposure to allergens and environmental chemicals on the development of allergic diseases.

  9. The cockroaches of Balta Tepper from China, with the description of four new species (Blattodea, Ectobiidae, Pseudophyllodromiinae

    Directory of Open Access Journals (Sweden)

    Zhi-Wei Qiu

    2017-11-01

    Full Text Available Four new species of cockroach genus Balta Tepper, 1893 are described and illustrated: B. crena sp. n., B. maculata sp. n., B. tangi sp. n., and B. yaoi sp. n. Balta picea (Bey-Bienko, 1958 is now regarded as a new synonym of Balta hwangorum (Bey-Bienko, 1958, which is redescribed and illustrated. Two new combinations are proposed: B. nodigera (Bey-Bienko, 1958, comb. n. and B. valida (Bey-Bienko, 1958, comb. n., and both species are redescribed and illustrated. A key to all species from China is provided.

  10. The cockroaches of Balta Tepper from China, with the description of four new species (Blattodea, Ectobiidae, Pseudophyllodromiinae)

    Science.gov (United States)

    Qiu, Zhi-Wei; Che, Yan-Li; Zheng, Yu-Hong; Wang, Zong-Qing

    2017-01-01

    Abstract Four new species of cockroach genus Balta Tepper, 1893 are described and illustrated: B. crena sp. n., B. maculata sp. n., B. tangi sp. n., and B. yaoi sp. n. Balta picea (Bey-Bienko, 1958) is now regarded as a new synonym of Balta hwangorum (Bey-Bienko, 1958), which is redescribed and illustrated. Two new combinations are proposed: B. nodigera (Bey-Bienko, 1958), comb. n. and B. valida (Bey-Bienko, 1958), comb. n., and both species are redescribed and illustrated. A key to all species from China is provided. PMID:29290699

  11. Signaling of pigment-dispersing factor (PDF in the Madeira cockroach Rhyparobia maderae.

    Directory of Open Access Journals (Sweden)

    Hongying Wei

    Full Text Available The insect neuropeptide pigment-dispersing factor (PDF is a functional ortholog of vasoactive intestinal polypeptide, the coupling factor of the mammalian circadian pacemaker. Despite of PDF's importance for synchronized circadian locomotor activity rhythms its signaling is not well understood. We studied PDF signaling in primary cell cultures of the accessory medulla, the circadian pacemaker of the Madeira cockroach. In Ca²⁺ imaging studies four types of PDF-responses were distinguished. In regularly bursting type 1 pacemakers PDF application resulted in dose-dependent long-lasting increases in Ca²⁺ baseline concentration and frequency of oscillating Ca²⁺ transients. Adenylyl cyclase antagonists prevented PDF-responses in type 1 cells, indicating that PDF signaled via elevation of intracellular cAMP levels. In contrast, in type 2 pacemakers PDF transiently raised intracellular Ca²⁺ levels even after blocking adenylyl cyclase activity. In patch clamp experiments the previously characterized types 1-4 could not be identified. Instead, PDF-responses were categorized according to ion channels affected. Application of PDF inhibited outward potassium or inward sodium currents, sometimes in the same neuron. In a comparison of Ca²⁺ imaging and patch clamp experiments we hypothesized that in type 1 cells PDF-dependent rises in cAMP concentrations block primarily outward K⁺ currents. Possibly, this PDF-dependent depolarization underlies PDF-dependent phase advances of pacemakers. Finally, we propose that PDF-dependent concomitant modulation of K⁺ and Na⁺ channels in coupled pacemakers causes ultradian membrane potential oscillations as prerequisite to efficient synchronization via resonance.

  12. Immediate responses of the cockroach Blaptica dubia after the exposure to sulfur mustard.

    Science.gov (United States)

    Popp, Tanja; Lüling, Robin; Boekhoff, Ingrid; Seeger, Thomas; Branoner, Francisco; Gudermann, Thomas; Thiermann, Horst; Worek, Franz; Steinritz, Dirk

    2018-01-01

    The chemical agent sulfur mustard (SM) causes erythema, skin blisters, ulcerations, and delayed wound healing. It is accepted that the underlying molecular toxicology is based on DNA alkylation. With an expected delay, DNA damage causes impairment of protein biosynthesis and disturbance of cell division. However, using the cockroach model Blaptica dubia, the presented results show that alkylating compounds provoke immediate behavior responses along with fast changes in the electrical field potential (EFP) of neurons, suggesting that lesions of DNA are probably not the only effect of alkylating compounds. Blaptica dubia was challenged with SM or 2-chloroethyl-ethyl sulfide (CEES). Acute toxicity was objectified by a disability score. Physiological behavior responses (antennae pullback reflex, escape attempts, and grooming) were monitored after exposure. To estimate the impact of alkylating agents on neuronal activity, EFP recordings of the antennae and the thoracic ganglion were performed. After contact to neat SM, a pullback reflex of the antennae was the first observation. Subsequently, a striking escape behavior occured which was characterized by persistent movement of the legs. In addition, an instantaneous processing of the electrical firing pattern from the antennae to the descending ganglia was detectable. Remarkably, comparing the toxicity of the applied alkylating agents, effects induced by CEES were much more pronounced compared to SM. In summary, our findings document immediate effects of B. dubia after exposure to alkylating substances. These fast responses cannot be interpreted as a consequence of DNA alkylation. Therefore, the dogma that DNA alkylation is the exclusive cause for SM toxicity has to be questioned.

  13. Cockroach sensitization mitigates allergic rhinoconjunctivitis symptom severity in patients allergic to house dust mites and pollen.

    Science.gov (United States)

    He, Weijing; Jimenez, Fabio; Martinez, Hernan; Harper, Nathan L; Manoharan, Muthu Saravanan; Carrillo, Andrew; Ingale, Puraskar; Liu, Ya-Guang; Ahuja, Seema S; Clark, Robert A; Rather, Cynthia G; Ramirez, Daniel A; Andrews, Charles P; Jacobs, Robert L; Ahuja, Sunil K

    2015-09-01

    Modifiers of symptom severity in patients with allergic rhinoconjunctivitis (AR) are imprecisely characterized. The hygiene hypothesis implicates childhood microbial exposure as a protective factor. Cockroach sensitization (C+) might be a proxy for microbial exposure. We sought to determine whether C+ assayed by means of skin prick tests influenced AR symptom severity in controlled and natural settings. Total symptom scores (TSSs) were recorded by 21 participants with house dust mite allergy (M+) in the natural setting and during repeated exposures of 3 hours per day to house dust mite allergen in an allergen challenge chamber (ACC). In M+ participants the peripheral blood and nasal cells were assayed for T-cell activation and transcriptomic profiles (by using RNA sequencing), respectively. Participants allergic to mountain cedar (n = 21), oak (n = 34), and ragweed (n = 23) recorded TSSs during separate out-of-season exposures to these pollens (any pollen sensitization [P+]) in the ACC; a subset recorded TSSs in the pollination seasons. The hierarchy of TSSs (highest to lowest) among M+ participants tracked the following skin prick test sensitization statuses: M+P+C- > M+P+C+ > M+P-C- > M+P-C+. In nasal cells and peripheral blood the immune/inflammatory responses were rapidly resolved in M+P+C+ compared with M+P+C- participants. Among those allergic to pollen, C+ was associated with a lower TSS during pollen challenges and the pollination season. After aggregated analysis of all 4 ACC studies, C+ status was associated with a 2.8-fold greater likelihood of a lower TSS compared with C- status (odds ratio, 2.78; 95% CI, 1.18-6.67; P = .02). C+ status is associated with mitigation of AR symptom severity in adults with AR. Published by Elsevier Inc.

  14. Crystal Structure of a Dimerized Cockroach Allergen Bla g 2 Complexed with a Monoclonal Antibody

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mi; Gustchina, Alla; Alexandratos, Jerry; Wlodawer, Alexander; Wünschmann, Sabina; Kepley, Christopher L.; Chapman, Martin D.; Pomes, Anna (INDOOR Bio.); (VCU); (NIH)

    2008-09-03

    The crystal structure of a 1:1 complex between the German cockroach allergen Bla g 2 and the Fab' fragment of a monoclonal antibody 7C11 was solved at 2.8-{angstrom} resolution. Bla g 2 binds to the antibody through four loops that include residues 60-70, 83-86, 98-100, and 129-132. Cation-{pi} interactions exist between Lys-65, Arg-83, and Lys-132 in Bla g 2 and several tyrosines in 7C11. In the complex with Fab', Bla g 2 forms a dimer, which is stabilized by a quasi-four-helix bundle comprised of an {alpha}-helix and a helical turn from each allergen monomer, exhibiting a novel dimerization mode for an aspartic protease. A disulfide bridge between C51a and C113, unique to the aspartic protease family, connects the two helical elements within each Bla g 2 monomer, thus facilitating formation of the bundle. Mutation of these cysteines, as well as the residues Asn-52, Gln-110, and Ile-114, involved in hydrophobic interactions within the bundle, resulted in a protein that did not dimerize. The mutant proteins induced less {beta}-hexosaminidase release from mast cells than the wild-type Bla g 2, suggesting a functional role of dimerization in allergenicity. Because 7C11 shares a binding epitope with IgE, the information gained by analysis of the crystal structure of its complex provided guidance for site-directed mutagenesis of the allergen epitope. We have now identified key residues involved in IgE antibody binding; this information will be useful for the design of vaccines for immunotherapy.

  15. Intersegmental coordination of cockroach locomotion: adaptive control of centrally coupled pattern generator circuits

    Directory of Open Access Journals (Sweden)

    Einat eFuchs

    2011-01-01

    Full Text Available Animals’ ability to demonstrate both stereotyped and adaptive locomotor behavior is largely dependent on the interplay between centrally-generated motor patterns and the sensory inputs that shape them. We utilized a combined experimental and theoretical approach to investigate the relative importance of CPG interconnections vs. intersegmental afferents in the cockroach: an animal that is renowned for rapid and stable locomotion. We simultaneously recorded coxal levator and depressor motor neurons (MN in the thoracic ganglia of Periplaneta americana, while sensory feedback was completely blocked or allowed only from one intact stepping leg. In the absence of sensory feedback, we observed a coordination pattern with consistent phase relationship that shares similarities with a double tripod gait, suggesting central, feedforward control. This intersegmental coordination pattern was then reinforced in the presence of sensory feedback from a single stepping leg. Specifically, we report on transient stabilization of phase differences between activity recorded in the middle and hind thoracic MN following individual front-leg steps, suggesting a role for afferent phasic information in the coordination of motor circuits at the different hemiganglia. Data were further analyzed using stochastic models of coupled oscillators and maximum likelihood techniques to estimate underlying physiological parameters, such as uncoupled endogenous frequencies of hemisegmental oscillators and coupling strengths and directions. We found that descending ipsilateral coupling is stronger than ascending coupling, while left-right coupling in both the meso- and meta-thoracic ganglia appear to be symmetrical. We discuss our results in comparison with recent findings in stick insects that share similar neural and body architectures, and argue that the two species may exemplify opposite extremes of a fast-slow locomotion continuum, mediated through different intersegmental

  16. Midgut Transcriptome of the Cockroach Periplaneta americana and Its Microbiota: Digestion, Detoxification and Oxidative Stress Response.

    Directory of Open Access Journals (Sweden)

    Jianhua Zhang

    Full Text Available The cockroach, Periplaneta americana, is an obnoxious and notorious pest of the world, with a strong ability to adapt to a variety of complex environments. However, the molecular mechanism of this adaptability is mostly unknown. In this study, the genes and microbiota composition associated with the adaptation mechanism were studied by analyzing the transcriptome and 16S rDNA pyrosequencing of the P. americana midgut, respectively. Midgut transcriptome analysis identified 82,905 unigenes, among which 64 genes putatively involved in digestion (11 genes, detoxification (37 genes and oxidative stress response (16 genes were found. Evaluation of gene expression following treatment with cycloxaprid further revealed that the selected genes (CYP6J1, CYP4C1, CYP6K1, Delta GST, alpha-amylase, beta-glucosidase and aminopeptidase were upregulated at least 2.0-fold at the transcriptional level, and four genes were upregulated more than 10.0-fold. An interesting finding was that three digestive enzymes positively responded to cycloxaprid application. Tissue expression profiles further showed that most of the selected genes were midgut-biased, with the exception of CYP6K1. The midgut microbiota composition was obtained via 16S rDNA pyrosequencing and was found to be mainly dominated by organisms from the Firmicutes phylum, among which Clostridiales, Lactobacillales and Burkholderiales were the main orders which might assist the host in the food digestion or detoxification of noxious compounds. The preponderant species, Clostridium cellulovorans, was previously reported to degrade lignocellulose efficiently in insects. The abundance of genes involved in digestion, detoxification and response to oxidative stress, and the diversity of microbiota in the midgut might provide P. americana high capacity to adapt to complex environments.

  17. Adipokinetic hormones control amylase activity in the cockroach (Periplaneta americana) gut.

    Science.gov (United States)

    Bodláková, Karolina; Jedlička, Pavel; Kodrík, Dalibor

    2017-04-01

    This study examined the biochemical characteristics of α-amylase and hormonal (adipokinetic hormone: AKH) stimulation of α-amylase activity in the cockroach (Periplaneta americana) midgut. We applied two AKHs in vivo and in vitro, then measured resultant amylase activity and gene expression, as well as the expression of AKH receptor (AKHR). The results revealed that optimal amylase activity is characterized by the following: pH: 5.7, temperature: 38.4 °C, K m (Michaelis-Menten constant): 2.54 mg starch/mL, and V max (maximum reaction velocity): 0.185 μmol maltose/mL/min. In vivo application of AKHs resulted in significant increase of amylase activity: by two-fold in the gastric caeca and 4-7 fold in the rest of the midgut. In vitro experiments supported results seen in vivo: a 24-h incubation with the hormones resulted in the increase of amylase activity by 1.4 times in the caeca and 4-9 times in the midgut. Further, gene expression analyses reveal that AKHR is expressed in both the caeca and the rest of the midgut, although expression levels in the former were 23 times higher than levels in the latter. A similar pattern was found for the amylase (AMY) gene. Hormonal treatment did not affect the expression of either gene. This study is the first to provide evidence indicating direct AKH stimulation of digestive enzyme activity in the insect midgut, supported by specific AKHR gene expression in this organ. © 2016 Institute of Zoology, Chinese Academy of Sciences.

  18. Pioglitazone is as effective as dexamethasone in a cockroach allergen-induced murine model of asthma

    Directory of Open Access Journals (Sweden)

    Lukacs Nicholas W

    2007-12-01

    Full Text Available Abstract Background While glucocorticoids are currently the most effective therapy for asthma, associated side effects limit enthusiasm for their use. Peroxisome proliferator-activated receptor-γ (PPAR-γ activators include the synthetic thiazolidinediones (TZDs which exhibit anti-inflammatory effects that suggest usefulness in diseases such as asthma. How the ability of TZDs to modulate the asthmatic response compares to that of glucocorticoids remains unclear, however, because these two nuclear receptor agonists have never been studied concurrently. Additionally, effects of PPAR-γ agonists have never been examined in a model involving an allergen commonly associated with human asthma. Methods We compared the effectiveness of the PPAR-γ agonist pioglitazone (PIO to the established effectiveness of a glucocorticoid receptor agonist, dexamethasone (DEX, in a murine model of asthma induced by cockroach allergen (CRA. After sensitization to CRA and airway localization by intranasal instillation of the allergen, Balb/c mice were challenged twice at 48-h intervals with intratracheal CRA. Either PIO (25 mg/kg/d, DEX (1 mg/kg/d, or vehicle was administered throughout the period of airway CRA exposure. Results PIO and DEX demonstrated similar abilities to reduce airway hyperresponsiveness, pulmonary recruitment of inflammatory cells, serum IgE, and lung levels of IL-4, IL-5, TNF-α, TGF-β, RANTES, eotaxin, MIP3-α, Gob-5, and Muc5-ac. Likewise, intratracheal administration of an adenovirus containing a constitutively active PPAR-γ expression construct blocked CRA induction of Gob-5 and Muc5-ac. Conclusion Given the potent effectiveness shown by PIO, we conclude that PPAR-γ agonists deserve investigation as potential therapies for human asthma.

  19. Final Report DE-SC0006634. Quantifying phenotypic and genetic diversity of Miscanthus sinensis as a resource for knowledge-based improvement of M. ×giganteus (M. sinensis × M. sacchariflorus)

    Energy Technology Data Exchange (ETDEWEB)

    Sacks, Erik [Univ. of Illinois, Urbana, IL (United States)

    2016-02-08

    Miscanthus is especially attractive as a bioenergy crop for temperate environments because it produces high yields, needs few inputs, and grows well during the cool weather of early spring and late fall when few warm-season grasses can. However, Miscanthus feedstock production for the emerging U.S. bioenergy industry and for existing demand in Europe is based on a single sterile, vegetatively propagated variety of M. ×giganteus. M. ×giganteus is an interspecific hybrid of the parental species M. sinensis and M. sacchariflorus. Prior to the current study, little information existed about the genetic diversity and breeding potential of either M. ×giganteus parental species. In the current project, we studied more than 600 accessions of M. sinensis from throughout its native range in China, Japan, and Korea, in addition to ornamental cultivars and U.S. naturalized populations. Using thousands of DNA markers, we identified seven geographically distinct genetic groups of M. sinensis. Notably, we found that the ornamental cultivars and U.S. naturalized populations were derived from only a subset of the Southern Japan group, indicating that our study greatly increased the genetic diversity available for breeding new biomass cultivars. Additionally, this new understanding of M. sinensis population structure could be used to predict which crosses may produce progeny with the greatest hybrid vigor. Replicated field trials were also established at multiple locations in North America and Asia. Data on traits of importance for biomass productivity, such as flowering time, yield and height, were taken. Analyses of the phenotypic data from the field trials along with the DNA markers allowed us to identify many marker-trait associations. These results will enable marker-assisted breeding, which will allow selection at the seedling stage rather than waiting two to three years to obtain phenotypic data. Thus, this study is expected to greatly increase the efficiency of breeding

  20. Pyrotag sequencing of the gut microbiota of the cockroach Shelfordella lateralis reveals a highly dynamic core but only limited effects of diet on community structure.

    Directory of Open Access Journals (Sweden)

    Christine Schauer

    Full Text Available Although blattid cockroaches and termites share a common ancestor, their diets are distinctly different. While termites consume a highly specialized diet of lignocellulose, cockroaches are omnivorous and opportunistic feeders. The role of the termite gut microbiota has been studied intensively, but little is known about the cockroach gut microbiota and its function in digestion and nutrition, particularly the adaptation to different diets. Our analyses of the bacterial gut microbiota of the blattid cockroach Shelfordella lateralis combining terminal restriction fragment length polymorphism of their 16S rRNA genes with physiological parameters (microbial metabolites, hydrogen and methane emission indicated substantial variation between individuals but failed to identify any diet-related response. Subsequent deep-sequencing of the 16S rRNA genes of the colonic gut microbiota of S. lateralis fed either a high- or a low-fiber diet confirmed the absence of bacterial taxa that responded to diet. Instead, we found a small number of abundant phylotypes that were consistently present in all samples and made up half of the community in both diet groups. They varied strongly in abundance between individual samples at the genus but not at the family level. The remaining phylotypes were inconsistently present among replicate batches. Our findings suggest that S. lateralis harbors a highly dynamic core gut microbiota that is maintained even after fundamental dietary shifts, and that any dietary effects on the gut community are likely to be masked by strong individual variations.

  1. Look at That!: Using Madagascar Hissing Cockroaches to Develop and Enhance the Scientific Inquiry Skill of Observation in Middle School Students

    Science.gov (United States)

    Wagler, Ron

    2011-01-01

    Middle school students can develop and enhance their observation skills by participating in teacher-guided scientific inquiry (NRC 1996) activities where they observe animals that tend to act in known, predictable ways. Madagascar hissing cockroaches ("Gromphadorhina portentosa") are one such animal. This article presents beginning, intermediate,…

  2. Purification and partial genome characterization of the bacterial endosymbiont Blattabacterium cuenoti from the fat bodies of cockroaches

    Directory of Open Access Journals (Sweden)

    Yamada Akinori

    2008-11-01

    Full Text Available Abstract Background Symbiotic relationships between intracellular bacteria and eukaryotes are widespread in nature. Genome sequencing of the bacterial partner has provided a number of key insights into the basis of these symbioses. A challenging aspect of sequencing symbiont genomes is separating the bacteria from the host tissues. In the present study, we describe a simple method of endosymbiont purification from complex environment, using Blattabacterium cuenoti inhabiting in cockroaches as a model system. Findings B. cuenoti cells were successfully purified from the fat bodies of the cockroach Panesthia angustipennis by a combination of slow- and fast-speed centrifugal fractionations, nylon-membrane filtration, and centrifugation with Percoll solutions. We performed pulse-field electrophoresis, diagnostic PCR and random sequencing of the shoutgun library. These experiments confirmed minimal contamination of host and mitochondrial DNA. The genome size and the G+C content of B. cuenoti were inferred to be 650 kb and 32.1 ± 7.6%, respectively. Conclusion The present study showed successful purification and characterization of the genome of B. cuenoti. Our methodology should be applicable for future symbiont genome sequencing projects. An advantage of the present purification method is that each step is easily performed with ordinary microtubes and a microcentrifuge, and without DNase treatment.

  3. Pharmacological characterization of the dopamine-sensitive adenylate cyclase in cockroach brain: evidence for a distinct dopamine receptor

    Energy Technology Data Exchange (ETDEWEB)

    Orr, G.L.; Gole, J.W.D.; Notman, H.J.; Downer, R.G.H.

    1987-12-21

    Dopamine increases cyclic AMP production in crude membrane preparations of cockroach brain with plateaus in cyclic AMP production occurring between 1-10 ..mu..M and 10 mM. Maximal production of cyclic AMP is 2.25 fold greater than that of control values. Octopamine also increases cyclic AMP production with a Ka of 1.4 ..mu..M and maximal production 3.5 fold greater than that of control. 5-Hydroxytryptamine does not increase cyclic AMP production. The effects of octopamine and dopamine are fully additive. The vertebrate dopamine agonists ADTN and epinine stimulate the dopamine-sensitive adenylate cyclase (AC) with Ka values of 4.5 and 0.6 ..mu..M respectively and with maximal effectiveness 1.7 fold greater than that of control. The selective D/sub 2/-dopamine agonist LY-171555 stimulates cyclic AMP production to a similar extent with a Ka of 50 ..mu..M. Other dopamine agonists have no stimulatory effects. With the exception of mianserin, /sup 3/H-piflutixol is displaced from brain membranes by dopamine antagonists with an order of potency similar to that observed for the inhibition of dopamine-sensitive AC. The results indicate that the octopamine- and dopamine-sensitive AC in cockroach brain can be distinguished pharmacologically and the dopamine receptors coupled to AC have pharmacological characteristics distinct from vertebrate D/sup 1/- and D/sup 2/-dopamine receptors. 33 references, 3 figures, 2 tables.

  4. Pharmacological characterization of the dopamine-sensitive adenylate cyclase in cockroach brain: evidence for a distinct dopamine receptor

    International Nuclear Information System (INIS)

    Orr, G.L.; Gole, J.W.D.; Notman, H.J.; Downer, R.G.H.

    1987-01-01

    Dopamine increases cyclic AMP production in crude membrane preparations of cockroach brain with plateaus in cyclic AMP production occurring between 1-10 μM and 10 mM. Maximal production of cyclic AMP is 2.25 fold greater than that of control values. Octopamine also increases cyclic AMP production with a Ka of 1.4 μM and maximal production 3.5 fold greater than that of control. 5-Hydroxytryptamine does not increase cyclic AMP production. The effects of octopamine and dopamine are fully additive. The vertebrate dopamine agonists ADTN and epinine stimulate the dopamine-sensitive adenylate cyclase (AC) with Ka values of 4.5 and 0.6 μM respectively and with maximal effectiveness 1.7 fold greater than that of control. The selective D 2 -dopamine agonist LY-171555 stimulates cyclic AMP production to a similar extent with a Ka of 50 μM. Other dopamine agonists have no stimulatory effects. With the exception of mianserin, 3 H-piflutixol is displaced from brain membranes by dopamine antagonists with an order of potency similar to that observed for the inhibition of dopamine-sensitive AC. The results indicate that the octopamine- and dopamine-sensitive AC in cockroach brain can be distinguished pharmacologically and the dopamine receptors coupled to AC have pharmacological characteristics distinct from vertebrate D 1 - and D 2 -dopamine receptors. 33 references, 3 figures, 2 tables

  5. RNA interference and functional characterization of a tergal gland alpha amylase in the German cockroach, Blattella germanica L.

    Science.gov (United States)

    Myers, A J; Gondhalekar, A D; Fardisi, M; Pluchar, K D; Saltzmann, K D; Bennett, G W; Scharf, M E

    2018-04-01

    German cockroach males possess tergal glands that secrete a combination of oligosaccharides, lipids and proteins. Four major proteins occur in the secretion, with one being the 63 kDa alpha-amylase Blattella germanica Tergal Gland protein-1 (BGTG-1). Denaturing and starch gel electrophoresis coupled with peptide sequencing verified amylase activity for the BGTG-1 protein. BGTG-1 gene expression profiles were determined by using quantitative real-time PCR to compare messenger RNA abundance among isolated tissues of males, females and gravid females. Differences in BGTG-1 gene expression occurred among male tissues, with tergal gland tissue showing the highest expression. Tissues of nongravid and gravid females had significantly lower expression in comparison with male tergal glands (gravid females lowest). RNA interference (RNAi) was used to silence BGTG-1 gene expression by injecting BGTG-1 homologous double-stranded RNA (dsRNA) into male cockroaches. Groups injected with BGTG-1 dsRNA showed ∼90% lower BGTG-1 gene and protein expression compared to controls, which correlated with lower amylase activity in colorimetric assays. However, behavioural assays comparing precopulatory behaviour and mating success between RNAi and control males did not reveal differences. These results connect amylase gene expression and activity in tergal gland tissue but suggest other factors, such as other tergal gland components, may contribute more strongly to mating success. © 2017 The Royal Entomological Society.

  6. Phylogeny in defining model plants for lignocellulosic ethanol production: a comparative study of Brachypodium distachyon, wheat, maize, and Miscanthus x giganteus leaf and stem biomass.

    Science.gov (United States)

    Meineke, Till; Manisseri, Chithra; Voigt, Christian A

    2014-01-01

    The production of ethanol from pretreated plant biomass during fermentation is a strategy to mitigate climate change by substituting fossil fuels. However, biomass conversion is mainly limited by the recalcitrant nature of the plant cell wall. To overcome recalcitrance, the optimization of the plant cell wall for subsequent processing is a promising approach. Based on their phylogenetic proximity to existing and emerging energy crops, model plants have been proposed to study bioenergy-related cell wall biochemistry. One example is Brachypodium distachyon, which has been considered as a general model plant for cell wall analysis in grasses. To test whether relative phylogenetic proximity would be sufficient to qualify as a model plant not only for cell wall composition but also for the complete process leading to bioethanol production, we compared the processing of leaf and stem biomass from the C3 grasses B. distachyon and Triticum aestivum (wheat) with the C4 grasses Zea mays (maize) and Miscanthus x giganteus, a perennial energy crop. Lambda scanning with a confocal laser-scanning microscope allowed a rapid qualitative analysis of biomass saccharification. A maximum of 108-117 mg ethanol·g(-1) dry biomass was yielded from thermo-chemically and enzymatically pretreated stem biomass of the tested plant species. Principal component analysis revealed that a relatively strong correlation between similarities in lignocellulosic ethanol production and phylogenetic relation was only given for stem and leaf biomass of the two tested C4 grasses. Our results suggest that suitability of B. distachyon as a model plant for biomass conversion of energy crops has to be specifically tested based on applied processing parameters and biomass tissue type.

  7. Shoot growth, radiation interception and dry matter production and partitioning during the establishment phase of Miscanthus sinensis 'Giganteus' grown at two densities in the UK

    International Nuclear Information System (INIS)

    Bullard, M.J.; Heath, M.C.; Nixon, P.M.I.

    1995-01-01

    Photosynthetic area index (PAI), radiation interception (I) and dry matter partitioning between shoots and roots were measured for Miscanthus sinensis‘Giganteus' grown from micro-propagated transplants on a fertile peaty loam soil in eastern England. In the establishment year, Miscanthus plants produced 35 and 70 shoots plant -1 at densities of 4.0 and 1.8 plants m -2 respectively. At the higher density, there were 140 shoots m -2 with the largest reaching a height of 1.8 m; these canopies attained a maximum PAI of 5.45, intercepting 94% of incident radiation. Leaf lamina contributed c. 90% of total photosynthetic area with stems contributing the remainder. At the lower density, maximum PAI and I values were 2.88 and 86% respectively. PAI was related to I by calculating attenuation coefficients (k); these indicated that Miscanthus canopies were more effective at intercepting radiation per unit PAI at the lower density (k= -0.31) compared with the higher density (k= -0.20). Radiation interception was related to dry matter accumulated by calculating conversion efficiencies (e). At 4 plants m -2 , × for shoot dry matter production was 1.17g MJ -1 . Miscanthus partitioned a relatively large amount of total dry matter into below-ground biomass. By plant senescence, c. 30% of total dry matter had been partitioned into root and rhizome; rhizome biomass contributed 80% of below-ground dry matter, × increased to 1.62 g MJ -1 when calculated on a total dry matter basis (shoot + root + rhizome). Total dry matter production was increased 68% by a 2.2-fold increase in plant density. (author)

  8. Phylogeny in Defining Model Plants for Lignocellulosic Ethanol Production: A Comparative Study of Brachypodium distachyon, Wheat, Maize, and Miscanthus x giganteus Leaf and Stem Biomass

    Science.gov (United States)

    Meineke, Till; Manisseri, Chithra; Voigt, Christian A.

    2014-01-01

    The production of ethanol from pretreated plant biomass during fermentation is a strategy to mitigate climate change by substituting fossil fuels. However, biomass conversion is mainly limited by the recalcitrant nature of the plant cell wall. To overcome recalcitrance, the optimization of the plant cell wall for subsequent processing is a promising approach. Based on their phylogenetic proximity to existing and emerging energy crops, model plants have been proposed to study bioenergy-related cell wall biochemistry. One example is Brachypodium distachyon, which has been considered as a general model plant for cell wall analysis in grasses. To test whether relative phylogenetic proximity would be sufficient to qualify as a model plant not only for cell wall composition but also for the complete process leading to bioethanol production, we compared the processing of leaf and stem biomass from the C3 grasses B. distachyon and Triticum aestivum (wheat) with the C4 grasses Zea mays (maize) and Miscanthus x giganteus, a perennial energy crop. Lambda scanning with a confocal laser-scanning microscope allowed a rapid qualitative analysis of biomass saccharification. A maximum of 108–117 mg ethanol·g−1 dry biomass was yielded from thermo-chemically and enzymatically pretreated stem biomass of the tested plant species. Principal component analysis revealed that a relatively strong correlation between similarities in lignocellulosic ethanol production and phylogenetic relation was only given for stem and leaf biomass of the two tested C4 grasses. Our results suggest that suitability of B. distachyon as a model plant for biomass conversion of energy crops has to be specifically tested based on applied processing parameters and biomass tissue type. PMID:25133818

  9. Seasonal nutrient dynamics and biomass quality of giant reed (Arundo donax L. and miscanthus (Miscanthus x giganteus Greef et Deuter as energy crops

    Directory of Open Access Journals (Sweden)

    Nicoletta Nassi o Di Nasso

    2011-08-01

    Full Text Available The importance of energy crops in displacing fossil fuels within the energy sector in Europe is growing. Among energy crops, the use of perennial rhizomatous grasses (PRGs seems promising owing to their high productivity and their nutrient recycling that occurs during senescence. In particular, nutrient requirements and biomass quality have a fundamental relevance to biomass systems efficiency. The objective of our study was to compare giant reed (Arundo donax L. and miscanthus (Miscanthus × giganteus Greef et Deuter in terms of nutrient requirements and cellulose, hemicelluloses and lignin content. This aim was to identify, in the Mediterranean environment, the optimal harvest time that may combine, beside a high biomass yield, high nutrient use efficiency and a good biomass quality for second generation biofuel production. The research was carried out in 2009, in San Piero a Grado, Pisa (Central Italy; latitude 43°41’ N, longitude 10°21’ E, on seven-year-old crops in a loam soil characterised by good water availability. Maximum above-ground nutrient contents were generally found in summer. Subsequently, a decrease was recorded; this suggested a nutrient remobilisation from above-ground biomass to rhizomes. In addition, miscanthus showed the highest N, P, and K use efficiency, probably related to its higher yield and its C4 pathway. Regarding biomass quality, stable values of cellulose (38%, hemicelluloses (25% and lignin (8% were reported from July onwards in both crops. Hence, these components appear not to be discriminative parameters in the choice of the harvest time in the Mediterranean environment. In conclusion, our results highlighted that, in our environment, a broad harvest period (from late autumn to winter seems suitable for these PRGs. However, further research is required to evaluate the role of rhizomes in nutrient storage and supply during the growing season, as well as ecological and productive performances in marginal

  10. Potential growth and biomass productivity of Miscanthus x giganteus as affected by plant density and N-fertilization in central Greece

    Energy Technology Data Exchange (ETDEWEB)

    Danalatos, Nicholas G. [Department of Envir. Studies, University of Aegean, University Hill, Mytilini 81100 (Greece); Department of Crop Production and Rural Environment, University of Thessaly, Fytoko 38446 Volos (Greece); Archontoulis, Sotiris V. [Department of Crop Production and Rural Environment, University of Thessaly, Fytoko 38446 Volos (Greece); Department of Plant Science, Crop and Weed Ecology Group, Wageningen University, Haarweg 235, 6709 RP Wageningen (Netherlands); Mitsios, Ioannis [Department of Crop Production and Rural Environment, University of Thessaly, Fytoko 38446 Volos (Greece)

    2007-02-15

    The potential growth and biomass productivity of Miscanthus x giganteus was investigated under constraint-free conditions during two years with appreciable different climatic conditions in central Greece, and under three different plant densities (0.66, 1, 2 pl m{sup -2}) and two different nitrogen dressings (N{sub 0}=50, N{sub 1}=100 kg N ha{sup -1}). The field experimental design was a 3 x 2 factorial split plot in four blocks. Plant height, tiller number, leaf area index and dry weight per plant component were measured in subsequent harvests throughout the growing periods of 2001 and 2002. It was found that fertilisation within the studied rates did not affect growth and biomass productivity of the crop, and no interaction between fertilization and plant density was observed in any of the samplings. Contrary to fertilization, a significant effect of plant density was found, with the denser populated plants (10,000-20,000 pl ha{sup -1}) performing growth rates of 250-350 kg ha{sup -1} d{sup -1} for large parts of the growing period, reaching maximum dry biomass yields in excess of 38 t ha{sup -1} in the more favorable year, 2002, and 28 t ha{sup -1} in the warmer and drier year 2001. Such high yield potentials were explained by the particularly great assimilation rates of this crop that were also measured under light saturation and optimum temperature and water regimes. With such biomass yields (11.2-15.2 t ha{sup -1} oil equivalent), obtainable particularly under modest fertilisation needs, Miscanthus sinensis should be considered as a very promising crop for biomass production in Greece in the near future. (author)

  11. Identification of differentially expressed genes in American cockroach ovaries and testes by suppression subtractive hybridization and the prediction of its miRNAs.

    Science.gov (United States)

    Chen, Wan; Jiang, Guo-Fang; Sun, Shu-Hong; Lu, Yong; Ma, Fei; Li, Bin

    2013-11-01

    Studies on the cockroach have contributed to our understanding of several important developmental processes, especially those that can be easily studied in the embryo. However, our knowledge on late events such as gonad differentiation in the cockroach is still limited. The major aim of the present study was to identify sex-specific genes between adult female and male Periplaneta americana. Two cDNA libraries were constructed using the suppression subtractive hybridization method; a total of 433 and 599 unique sequences were obtained from the forward library and the reverse library, respectively, by cluster assembly, and sequence alignment of 1,032 expressed sequence tags. The analysis of the differentially expressed gene functions allowed these genes to be categorized into three groups: biological process, molecular function, and cellular component. The differentially expressed genes were suggested to be related to the development of the gonads of P. americana. Twelve differentially expressed genes were randomly selected and verified using relative quantitative real-time polymerase chain reaction (qRT-PCR). Meanwhile, by adopting a range of filtering criteria, we predicted two potential microRNA sequences for P. americana, pam-miR100-3p and pam-miR7. To confirm the expression of potential microRNAs (miRNAs) in American cockroach, a qRT-PCR approach was also employed. The data presented here offer the insights into the molecular foundation of sex differences in American cockroach, and the first report for the miRNAs in this species. In addition, the results can be used as a reference for unraveling candidate genes associated with the sex and reproduction of cockroaches.

  12. Effects of Two Temperature Storage Regimes on the Efficacy of 3 Commercial Gel Baits against the German Cockroach, Blattella germanica L. (Dictyoptera: Blattellidae).

    Science.gov (United States)

    Oz, E; Cetin, H; Cilek, J E; Deveci, O; Yanikoglu, A

    2010-01-01

    To compare the effectiveness of 3 commercial gel bait formulations containing fipronil (Goliath(©) Cockroach Gel 0.05% AI), chlorpyrifos-A (Clean Bait(©) Gel, 2% AI), and chloropyrifos-B (Serpa(©) Gel 2% AI) against German cockroaches (Blattella germanica) when stored at 23(°)C and 30(°) C after treatment. Laboratory bioassays consisted of placing groups of fifteen cockroaches (a random combination of adult, mixed sex and large nymphs-stage 6) into a 5 L cylindrical plastic container with one drop of product (avg 0.10 g ± 0.01 g) applied to a 76 mm x 26 mm glass microscope slide affixed to the bottom of each container (one product tested per container). Cumulative mortality was assessed at 6 h, 1, 2, 3, 4, and 5 d after application. To determine the further effects of storage temperature after treatment on residual activity of the gels, a drop of each product was applied to separate glass microscope slides and stored at either 23(°) C (warm) or 30(°) C (hot) under dark conditions for 0, 1, 7, 14, 30, 45, 60 and 90 d after application. Freshly applied baits (day 0) containing fipronil provided complete cockroach mortality (100%) within 5 d whereas chloryrifos-A and chlorpyrifos-B provided ≈72% and 88% mortality, respectively. Generally, cockroach mortality was greater when gels were stored at 30(°)C compared with 23(°) C. The fipronil gel formulation proved to be as efficacious as the chlorpyrifos gels and in some instances surpased the latter formulations depending on storage time and temperature by providing ≈90% mortality at 90 d post treatment.

  13. Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis.

    Science.gov (United States)

    Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang

    2016-01-01

    Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea

  14. Evaluation of gamma irradiated essential oils to control stored-grain weevil, Sitophilus zeamais and cockroach, Blattella germanica

    International Nuclear Information System (INIS)

    Potenza, Marcos Roberto; Gomes, Davinni Habral Passini; Silvestre, Denise de Fatima; Da Silva, Rita de Cassia; Arthur, Valter

    2004-01-01

    Most of the essential oils have insecticidal activity and are alternatives to plant protection and urban pest control. The gamma radiation has been used to control microorganisms and insects in dehydrate herbs, spices, medicinal plants and other materials. This work aimed to evaluate the effect of irradiated essential oils as contact poison on Stored grain, weevil, Sitophilus zeamais and as stomach poison in cockroach, Blattella germanica. The bioassay with B. germanica demonstrated efficiency between 22.0 and 30.0% and between 30.0 and 42.0% respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation promoted changes in essential oils Eucalyptus citriodora and E. globulus and showed increased effectiveness on B. germanica nymphs besides a significative reduction of repellency. Gamma radiation thus interfered on behavior of some essential oils by increasing or reducing activating or inactivating their efficiency to pest control. (author)

  15. Catechol conjugation with hemolymph proteins and their incorporation into the cuticle of the American cockroach, Periplaneta americana

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, W.D.; Kimbrough, T.D.; Mills, R.R. [Department of Biology, Virginia Commonwealth University, Richmond, VA 23284-2012 (United States)

    1999-01-01

    Newly ecdysed American cockroaches, Periplaneta americana (six to last instar)were injected with radioactive dopamine. In addition, the reinjection of radiolabeled protein of any size resulted in the incorporation of the label into the newly sclerotized cuticle. Hemolymph proteins were synthesized in vivo using [{sup 14}C]leucine and subsequently double labeled in vivo with [{sup 3}H]dopamine. After sclerotization (7 h post-ecdysis) the cuticle was extirpated, hydrolyzed and counted. An identical ratio of {sup 14}C to {sup 3}H was found in cuticle extracts as in the double-labeled hemolymph proteins, suggesting that the phenol-bound protein was incorporated in the cuticle unchanged. It appears that the catechol bound to the proteins exists as a {beta}-glucoside. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  16. Folding wings like a cockroach: a review of transverse wing folding ensign wasps (Hymenoptera: Evaniidae: Afrevania and Trissevania.

    Directory of Open Access Journals (Sweden)

    István Mikó

    Full Text Available We revise two relatively rare ensign wasp genera, whose species are restricted to Sub-Saharan Africa: Afrevania and Trissevania. Afrevania longipetiolata sp. nov., Trissevania heatherae sp. nov., T. hugoi sp. nov., T. mrimaensis sp. nov. and T. slideri sp. nov. are described, males and females of T. anemotis and Afrevania leroyi are redescribed, and an identification key for Trissevaniini is provided. We argue that Trissevania mrimaensis sp. nov. and T. heatherae sp. nov. populations are vulnerable, given their limited distributions and threats from mining activities in Kenya. We hypothesize that these taxa together comprise a monophyletic lineage, Trissevaniini, tr. nov., the members of which share the ability to fold their fore wings along two intersecting fold lines. Although wing folding of this type has been described for the hind wing of some insects four-plane wing folding of the fore wing has never been documented. The wing folding mechanism and the pattern of wing folds of Trissevaniini is shared only with some cockroach species (Blattodea. It is an interesting coincidence that all evaniids are predators of cockroach eggs. The major wing fold lines of Trissevaniini likely are not homologous to any known longitudinal anatomical structures on the wings of other Evaniidae. Members of the new tribe share the presence of a coupling mechanism between the fore wing and the mesosoma that is composed of a setal patch on the mesosoma and the retinaculum of the fore wing. While the setal patch is an evolutionary novelty, the retinaculum, which originally evolved to facilitate fore and hind wing coupling in Hymenoptera, exemplifies morphological exaptation. We also refine and clarify the Semantic Phenotype approach used in previous taxonomic revisions and explore the consequences of merging new with existing data. The way that semantic statements are formulated can evolve in parallel, alongside improvements to the ontologies themselves.

  17. Transcriptome analysis and RNA interference of cockroach phototransduction indicate three opsins and suggest a major role for TRPL channels

    Directory of Open Access Journals (Sweden)

    Andrew S French

    2015-07-01

    Full Text Available Our current understanding of insect phototransduction is based on a small number of species, but insects occupy many different visual environments. We created the retinal transcriptome of a nocturnal insect, the cockroach, Periplaneta americana to identify proteins involved in the earliest stages of compound eye phototransduction, and test the hypothesis that different visual environments are reflected in different molecular contributions to function. We assembled five novel mRNAs: two green opsins, one UV opsin, and one each TRP and TRPL ion channel homologs. One green opsin mRNA (pGO1 was 100-1000 times more abundant than the other opsins (pGO2 and pUVO, while pTRPL mRNA was 10 times more abundant than pTRP, estimated by transcriptome analysis or quantitative PCR (qPCR. Electroretinograms were used to record photoreceptor responses. Gene-specific in vivo RNA interference (RNAi was achieved by injecting long (596-708 bp double-stranded RNA into head hemolymph, and verified by qPCR. RNAi of the most abundant green opsin reduced both green opsins by more than 97% without affecting UV opsin, and gave a maximal reduction of 75% in ERG amplitude seven days after injection that persisted for at least 19 days. RNAi of pTRP and pTRPL genes each specifically reduced the corresponding mRNA by 90%. Electroretinogram reduction by pTRPL RNAi was slower than for opsin, reaching 75% attenuation by 21 days, without recovery at 29 days. pTRP RNAi attenuated ERG much less; only 30% after 21 days. Combined pTRP plus pTRPL RNAi gave only weak evidence of any cooperative interactions. We conclude that silencing retinal genes by in vivo RNAi using long dsRNA is effective, that visible light transduction in Periplaneta is dominated by pGO1, and that pTRPL plays a major role in cockroach phototransduction.

  18. Thermoregulation by kangaroos from mesic and arid habitats: influence of temperature on routes of heat loss in eastern grey kangaroos (Macropus giganteus) and red kangaroos (Macropus rufus).

    Science.gov (United States)

    Dawson, T J; Blaney, C E; Munn, A J; Krockenberger, A; Maloney, S K

    2000-01-01

    We examined thermoregulation in red kangaroos (Macropus rufus) from deserts and in eastern grey kangaroos (Macropus giganteus) from mesic forests/woodlands. Desert kangaroos have complex evaporative heat loss mechanisms, but the relative importance of these mechanisms is unclear. Little is known of the abilities of grey kangaroos. Our detailed study of these kangaroos' thermoregulatory responses at air temperatures (T(a)) from -5 degrees to 45 degrees C showed that, while some differences occur, their abilities are fundamentally similar. Both species show the basic marsupial characteristics of relatively low basal metabolism and body temperature (T(b)). Within the thermoneutral zone, T(b) was 36.3 degrees + or - 0.1 degrees C (X + or - SE) in both species, and except for a small rise at T(a) 45 degrees C, T(b) was stable over a wide range of T(a). Metabolic heat production was 25% higher in red kangaroos at T(a) -5 degrees C. At the highest T(a) (45 degrees C), both species relied on evaporative heat loss (EHL) to maintain T(b); both panting and licking were used. The eastern grey kangaroo utilised panting (76% of EHL) as the principal mode of EHL, and while this was so for red kangaroos, cutaneous evaporative heat loss (CEHL) was significant (40% of EHL). CEHL appeared to be mainly licking, as evidenced from surface temperatures. Both species utilised peripheral vascular adjustments to control heat flow, as indicated by changes in dry conductance (C(dry)). At lower temperatures, C(dry) was minimal, but it increased significantly at T(a) just below T(b) (33 degrees C); in these conditions, the C(dry) of red kangaroos was significantly higher than that of eastern grey kangaroos, indicating a greater reliance on dry heat loss. Under conditions where heat flows into the body from the environment (T(a) 45 degrees C), there was peripheral vasoconstriction to reduce this inflow; C(dry) decreased significantly from the values seen at 33 degrees C in both kangaroos. The

  19. Can the exceptional chilling tolerance of C4 photosynthesis found in Miscanthus × giganteus be exceeded? Screening of a novel Miscanthus Japanese germplasm collection.

    Science.gov (United States)

    Głowacka, Katarzyna; Jørgensen, Uffe; Kjeldsen, Jens B; Kørup, Kirsten; Spitz, Idan; Sacks, Erik J; Long, Stephen P

    2015-05-01

    A clone of the hybrid perennial C4 grass Miscanthus × giganteus (Mxg) is known for achieving exceptionally high rates of leaf CO2 uptake during chilling. This is a requisite of success in the early spring, as is the ability of the leaves to survive occasional frosts. The aim of this study was to search for genotypes with greater potential than Mxg for photosynthesis and frost survival under these conditions. A total of 864 accessions representing 164 local populations of M. sacchariflorus (Msa), M. sinensis (Msi) and M. tinctorius (Mti) collected across Japan were studied. Accessions whose leaves survived a natural late frost in the field were screened for high maximum photosystem II efficiency (Fv/Fm) following chilling weather, as an indicator of their capacity for light-limited photosynthesis. Those showing the highest Fv/Fm were transferred to a high-light-controlled environment and maintained at chilling temperatures, where they were further screened for their capacities for high-light-limited and light-saturated leaf uptake of CO2 (ΦCO2,max and Asat, respectively). For the first time, relatives of Mxg with significantly superior capacities for photosynthesis at chilling temperatures were identified. Msa accession '73/2' developed leaves in the spring that survived night-time frost, and during growth under chilling maintained a statistically significant 79 % higher ΦCO2,max, as a measure of light-limited photosynthesis, and a 70 % higher Asat, as a measure of light-saturated photosynthesis. A second Msa accession, '73/3' also showed significantly higher rates of leaf uptake of CO2. As remarkable as Mxg has proved in its chilling tolerance of C4 photosynthesis, this study shows that there is still value and potential in searching for yet more superior tolerance. Msa accession '73/2' shows rates of light-limited and light-saturated photosynthesis at chilling temperatures that are comparable with those of the most cold-tolerant C3 species. This adds

  20. Sensitivity to Pigment-Dispersing Factor (PDF) Is Cell-Type Specific among PDF-Expressing Circadian Clock Neurons in the Madeira Cockroach.

    Science.gov (United States)

    Gestrich, Julia; Giese, Maria; Shen, Wen; Zhang, Yi; Voss, Alexandra; Popov, Cyril; Stengl, Monika; Wei, HongYing

    2018-02-01

    Transplantation studies have pinpointed the circadian clock of the Madeira cockroach to the accessory medulla (AME) of the brain's optic lobes. The AME is innervated by approximately 240 adjacent neuropeptidergic neurons, including 12 pigment-dispersing factor (PDF)-expressing neurons anterior to the AME (aPDFMEs). Four of the aPDFMEs project contralaterally, controlling locomotor activity rhythms of the night-active cockroach. The present in vitro Ca 2+ imaging analysis focuses on contralaterally projecting AME neurons and their responses to PDF, GABA, and acetylcholine (ACh). First, rhodamine-dextran backfills from the contralateral optic stalk identified contralaterally projecting AME neurons, which were then dispersed in primary cell cultures. After characterization of PDF, GABA, and ACh responses, PDF immunocytochemistry identified ipsilaterally and contralaterally projecting PDFMEs. All PDF-sensitive clock neurons, PDF-immunoreactive clock neurons, and the majority of ipsilaterally and contralaterally projecting cells were excited by ACh. GABA inhibited all PDF-expressing clock neurons, and about half of other ipsilaterally projecting and most contralaterally projecting clock neurons. For the first time, we identified PDF autoreceptors in PDF-secreting cockroach circadian pacemakers. The medium-sized aPDFMEs and all other contralaterally projecting PDF-sensitive clock cells were inhibited by PDF. The ipsilaterally remaining small PDF-sensitive clock cells were activated by PDF. Only the largest aPDFME did not express PDF autoreceptors. We hypothesize that opposing PDF signaling generates 2 different ensembles of clock cells with antiphasic activity, regulating and maintaining a constant phase relationship between rest and activity cycles of the night-active cockroach.

  1. [Effect of population density on enzymatic activity of antioxidative and phenol oxidase systems of imagoes and nymphs of the marble cockroach Nauphoeta cinerea].

    Science.gov (United States)

    Murzagulov, G S; Saltykova, E S; Gaĭfullina, L R; Nikolenko, A G

    2013-01-01

    The work deals with effect of density of population on functional activity of components pf protective system of adult individuals and nymphs of the marble cockroach. The resistance of individuals has been noted to decrease both at individual maintenance and under conditions of overpopulation. Changes in activities of enzymes of antioxidative and phenoloxidase systems are studied ion the insect hemolymph and intestine. Possible consequences of isolation and overpopulation are discussed both for stability and for individual development.

  2. A behavioral syndrome linking courtship behavior toward males and females predicts reproductive success from a single mating in the hissing cockroach, Gromphadorhina portentosa

    OpenAIRE

    David M. Logue; Sandeep Mishra; David McCaffrey; Deborah Ball; William H. Cade

    2009-01-01

    Suites of correlated behaviors, or "behavioral syndromes," have been shown to occur throughout the animal kingdom. Behavioral syndromes involving sexual selection are expected to have significant evolutionary ramifications, but few studies have linked behavioral syndromes to sexual selection. We measured the behavior of male hissing cockroaches (Gromphadorhina portentosa) during male--male competition, female choice, and 3 other ecologically relevant contexts and quantified between-context co...

  3. High load of multi-drug resistant nosocomial neonatal pathogens carried by cockroaches in a neonatal intensive care unit at Tikur Anbessa specialized hospital, Addis Ababa, Ethiopia

    Directory of Open Access Journals (Sweden)

    Tilahun Birkneh

    2012-03-01

    Full Text Available Abstract Background Cockroaches have been described as potential vectors for various pathogens for decades; although studies from neonatal intensive care units are scarce. This study assessed the vector potential of cockroaches (identified as Blatella germanica in a neonatal intensive care unit setup in Tikur Anbessa Hospital, Addis Ababa, Ethiopia. Methods A total of 400 Blatella germanica roaches were aseptically collected for five consecutive months. Standard laboratory procedures were used to process the samples. Results From the external and gut homogenates, Klebsiella oxytoca, Klebsiella pneumoniae, Citrobacter spp. Enterobacter cloacae, Citrobacter diversus, Pseudomonas aeruginosa, Providencia rettgeri, Klebsiella ozaenae, Enterobacter aeruginosa, Salmonella C1, Non Group A streptococcus, Staphylococcus aureus, Escherichia coli, Acinetobacter spp. and Shigella flexneri were isolated. Multi-drug resistance was seen in all organisms. Resistance to up to all the 12 antimicrobials tested was observed in different pathogens. Conclusion Cockroaches could play a vector role for nosocomial infections in a neonatal intensive care unit and environmental control measures of these vectors is required to reduce the risk of infection. A high level of drug resistance pattern of the isolated pathogens was demonstrated.

  4. Brain-midgut cross-talk and autocrine metabolastat via the sNPF/CCAP negative feed-back loop in the American cockroach, Periplaneta americana.

    Science.gov (United States)

    Mikani, Azam; Watari, Yasuhiko; Takeda, Makio

    2015-12-01

    Immunohistochemical reactivities against short neuropeptide F (sNPF-ir) and crustacean cardioactive peptide (CCAP-ir) were detected in both the brain-subesophageal ganglion (Br-SOG) and midgut epithelial cells of the male American cockroach, Periplaneta americana. Four weeks of starvation increased the number of sNPF-ir cells and decreased the CCAP-ir cells in the Br-SOG, whereas refeeding reversed these effects. The contents of sNPF in the Br-SOG, midgut and hemolymph titer decreased in response to an injection of CCAP into the hemocoel of normally fed male cockroaches, while CCAP titers/contents decreased in response to an injection of sNPF. The results of a double-labeling experiment demonstrated that sNPF-ir co-existed in CCAP-ir cells in the pars intercerebralis (PI), dorsolateral region of protocerebrum (DL), deutocerebrum (De) and SOG. sNPF-ir and CCAP-ir were also colocalized in the midgut. sNPF and CCAP are neuropeptides and midgut factors that interact with each other. Since the two peptides are known to be secreted by identical cells that affect each other, this constitutes autocrine negative feedback regulation for a quick response to food accessibility/inaccessibility. These peptides not only constitute the switch in the digestive mechanism but also couple digestive adaptation with behavior. A CCAP injection suppressed locomotor activity when cockroaches were starved, whereas sNPF activated it when they were fed.

  5. High load of multi-drug resistant nosocomial neonatal pathogens carried by cockroaches in a neonatal intensive care unit at Tikur Anbessa specialized hospital, Addis Ababa, Ethiopia.

    Science.gov (United States)

    Tilahun, Birkneh; Worku, Bogale; Tachbele, Erdaw; Terefe, Simegn; Kloos, Helmut; Legesse, Worku

    2012-03-16

    Cockroaches have been described as potential vectors for various pathogens for decades; although studies from neonatal intensive care units are scarce. This study assessed the vector potential of cockroaches (identified as Blatella germanica) in a neonatal intensive care unit setup in Tikur Anbessa Hospital, Addis Ababa, Ethiopia. A total of 400 Blatella germanica roaches were aseptically collected for five consecutive months. Standard laboratory procedures were used to process the samples. From the external and gut homogenates, Klebsiella oxytoca, Klebsiella pneumoniae, Citrobacter spp. Enterobacter cloacae, Citrobacter diversus, Pseudomonas aeruginosa, Providencia rettgeri, Klebsiella ozaenae, Enterobacter aeruginosa, Salmonella C1, Non Group A streptococcus, Staphylococcus aureus, Escherichia coli, Acinetobacter spp. and Shigella flexneri were isolated. Multi-drug resistance was seen in all organisms. Resistance to up to all the 12 antimicrobials tested was observed in different pathogens. Cockroaches could play a vector role for nosocomial infections in a neonatal intensive care unit and environmental control measures of these vectors is required to reduce the risk of infection. A high level of drug resistance pattern of the isolated pathogens was demonstrated.

  6. Pleurotus giganteus (Berk. Karun & Hyde), the giant oyster mushroom inhibits NO production in LPS/H2O2 stimulated RAW 264.7 cells via STAT 3 and COX-2 pathways.

    Science.gov (United States)

    Baskaran, Asweni; Chua, Kek Heng; Sabaratnam, Vikineswary; Ravishankar Ram, Mani; Kuppusamy, Umah Rani

    2017-01-13

    Pleurotus giganteus (Berk. Karunarathna and K.D. Hyde), has been used as a culinary mushroom and is known to have medicinal properties but its potential as an anti-inflammatory agent to mitigate inflammation triggered diseases is untapped. In this study, the molecular mechanism underlying the protective effect of ethanol extract of P. giganteus (EPG) against lipopolysaccharide (LPS) and combination of LPS and hydrogen peroxide (H 2 O 2 )-induced inflammation on RAW 264.7 macrophages was investigated. The effect of EPG on nitric oxide (NO) production as an indicator of inflammation in RAW 264.7 macrophages was estimated based on Griess reaction that measures nitrite level. The expressions of inducible nitric oxide synthase (iNOS), cyclooxygenase-2 (COX-2), NF-kB activating protein (NKAP), signal transducer and activator of transcription 3 protein (STAT 3) and glutathione peroxidase (GPx) genes were assessed using real time reverse transcription polymerase chain reaction (RT-PCR) approach. EPG (10 μg/ml) showed the highest reduction in the LPS-induced NO production in RAW 264.7 macrophages and significantly suppressed (p < 0.05) the expression iNOS, STAT 3 and COX-2. There was a significant increase (p < 0.05) in combination of LPS and H 2 O 2 - induced iNOS production when compared to the LPS-induced iNOS production in RAW 264.7 macrophages and this concurred with the NO production which was attenuated by EPG at 10 μg/ml. A significant (p < 0.05) down regulation was observed in the combination of LPS and H 2 O 2 -induced iNOS and GPx expression by EPG. Our data suggest that the anti-inflammatory activity of EPG is mediated via the suppression of the STAT 3 and COX-2 pathways and can serve as potential endogenous antioxidant stimulant.

  7. Standard metabolic rate is associated with gestation duration, but not clutch size, in speckled cockroaches Nauphoeta cinerea.

    Science.gov (United States)

    Schimpf, Natalie G; Matthews, Philip G D; White, Craig R

    2012-12-15

    Metabolic rate varies significantly between individuals, and these differences persist even when the wide range of biotic and abiotic factors that influence metabolism are accounted for. It is important to understand the life history implications of variation in metabolic rate, but they remain poorly characterised despite a growing body of work examining relationships between metabolism and a range of traits. In the present study we used laboratory-bred families (one sire to three dams) of Nauphoeta cinerea (Olivier) (speckled cockroaches) to examine the relationship between standard metabolic rate (SMR) and reproductive performance (number of offspring and gestation duration). We show that SMR is negatively associated with female gestation duration. Age at mating is negatively associated with gestation duration for females, and mass is negatively associated with the average gestation duration of the females a male was mated with. In addition to the results in the current literature, the results from the present study suggest that the association between metabolism and life history is more complex than simple relationships between metabolism and various fitness traits. Future work should consider longitudinal, ontogenetic as well as selective and quantitative genetic breeding approaches to fully examine the associations between metabolism and fitness.

  8. Differences in susceptibility to German cockroach frass and its associated proteases in induced allergic inflammation in mice

    Directory of Open Access Journals (Sweden)

    Herman Nancy

    2007-12-01

    Full Text Available Abstract Background Cockroach exposure is a major risk factor for the development of asthma. Inhalation of fecal remnants (frass is the likely sensitizing agent; however isolated frass has not been tested for its ability to induce experimental asthma in mice. Methods Mice (Balb/c or C57Bl/6 were sensitized and challenged with GC frass or GC frass devoid of proteases and measurements of airway inflammation and hyperresponsiveness were performed (interleukin (IL-5, -13, and interferon gamma (IFNγ levels in bronchoalveolar lavage fluid, serum IgE levels, airway hyperresponsiveness, cellular infiltration, and mucin production. Results Sensitization and challenge of Balb/c mice with GC frass resulted in increased airway inflammation and hyperresponsiveness. C57Bl/6 mice were not susceptible to this model of sensitization; however they were sensitized to GC frass using a more aggressive sensitization and challenge protocol. In mice that were sensitized by inhalation, the active serine proteases in GC frass played a role in airway hyperresponsiveness as these mice had less airway hyperresponsiveness to acetylcholine and less mucin production. Proteases did not play a role in mediating the allergic inflammation in mice sensitized via intraperitoneal injection. Conclusion While both strains of mice were able to induce experimental asthma following GC frass sensitization and challenge, the active serine proteases in GC frass only play a role in airway hyperresponsiveness in Balb/c mice that were susceptible to sensitization via inhalation. The differences in the method of sensitization suggest genetic differences between strains of mice.

  9. Standard metabolic rate is associated with gestation duration, but not clutch size, in speckled cockroaches Nauphoeta cinerea

    Directory of Open Access Journals (Sweden)

    Natalie G. Schimpf

    2012-09-01

    Metabolic rate varies significantly between individuals, and these differences persist even when the wide range of biotic and abiotic factors that influence metabolism are accounted for. It is important to understand the life history implications of variation in metabolic rate, but they remain poorly characterised despite a growing body of work examining relationships between metabolism and a range of traits. In the present study we used laboratory-bred families (one sire to three dams of Nauphoeta cinerea (Olivier (speckled cockroaches to examine the relationship between standard metabolic rate (SMR and reproductive performance (number of offspring and gestation duration. We show that SMR is negatively associated with female gestation duration. Age at mating is negatively associated with gestation duration for females, and mass is negatively associated with the average gestation duration of the females a male was mated with. In addition to the results in the current literature, the results from the present study suggest that the association between metabolism and life history is more complex than simple relationships between metabolism and various fitness traits. Future work should consider longitudinal, ontogenetic as well as selective and quantitative genetic breeding approaches to fully examine the associations between metabolism and fitness.

  10. Group living enhances individual resources discrimination: the use of public information by cockroaches to assess shelter quality.

    Directory of Open Access Journals (Sweden)

    Stéphane Canonge

    Full Text Available In group-living organisms, consensual decision of site selection results from the interplay between individual responses to site characteristics and to group-members. Individuals independently gather personal information by exploring their environment. Through social interaction, the presence of others provides public information that could be used by individuals and modulates the individual probability of joining/leaving a site. The way that individual's information processing and the network of interactions influence the dynamics of public information (depending on population size that in turn affect discrimination in site quality is a central question. Using binary choice between sheltering sites of different quality, we demonstrate that cockroaches in group dramatically outperform the problem-solving ability of single individual. Such use of public information allows animals to discriminate between alternatives whereas isolated individuals are ineffective (i.e. the personal discrimination efficiency is weak. Our theoretical results, obtained from a mathematical model based on behavioral rules derived from experiments, highlight that the collective discrimination emerges from competing amplification processes relying on the modulation of the individual sheltering time without shelters comparison and communication modulation. Finally, we well demonstrated here the adaptive value of such decision algorithm. Without any behavioral change, the system is able to shift to a more effective strategy when alternatives are present: the modification of the spatio-temporal distributions of individuals leading to the collective selection of the best resource. This collective discrimination implying such parsimonious and widespread mechanism must be shared by many group living-species.

  11. Human β-defensin HBD3 binds to immobilized Bla g2 from the German cockroach (Blattella germanica).

    Science.gov (United States)

    Dietrich, Deborah E; Martin, Aaron D; Brogden, Kim A

    2014-03-01

    Human β-defensin 3 (HBD3) is a small, well-characterized peptide in mucosal secretions with broad antimicrobial activities and diverse innate immune functions. Among these functions is the ability of HBD3 to bind to antigens. In this study, we hypothesize that HBD3 binds to the allergen Bla g2 from the German cockroach (Blattella germanica). The ability of HBD1 (used as a control β-defensin) and HBD3 to bind to Bla g2 and human serum albumin (HSA, used as a control ligand) was assessed using the SensíQ Pioneer surface plasmon resonance (SPR) spectroscopy biosensor system. HBD1 was observed to bind weakly to Bla g2, while HBD3 demonstrated a stronger affinity for the allergen. HBD3 was assessed under two buffer conditions using 0.15 M and 0.3 M NaCl to control the electrostatic attraction of the peptide to the chip surface. The apparent K(D) of HBD3 binding Bla g2 was 5.9±2.1 μM and for binding HSA was 4.2±0.7 μM, respectively. Thus, HBD3, found in mucosal secretions has the ability to bind to allergens like Bla g2 possibly by electrostatic interaction, and may alter the ability of Bla g2 to induce localized allergic and/or inflammatory mucosal responses. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.

  12. Responsiveness of the adult cricket (Gryllus bimaculatus and Acheta domesticus) retrocerebral complex to allatostatin-1 from a cockroach, Diploptera punctata.

    Science.gov (United States)

    Neuhüser, T; Sorge, D; Stay, B; Hoffmann, K H

    1994-01-01

    Brain-retrocerebral complexes of female crickets, Gryllus bimaculatus and Acheta domesticus, treated with antibody to allatostatin-1 from a cockroach, Diploptera punctata, show extensive immunoreactivity. The results suggest that allostatins or allatostatin-like molecules are produced in neurosecretory cells of the brain and are delivered to the corpora allata through nervous connections and/or via haemolymph. Radiochemical measurements of juvenile hormone III biosynthesis by isolated corpora cardiaca-corpora allata complexes from adult G. bimaculatus have been used to demonstrate an in vitro sensitivity of these glands to allatostatin-1 from D. punctata. Allatostatin-1 is a relatively potent inhibitor of juvenile hormone III biosynthesis in corpora allata of both young adult females and males. In glands taken from 3-day virgin females, 50% inhibition of hormone biosynthesis is reached at ca. 3 nmol.l-1 allatostatin-1. The inhibitory action of allatostatin-1 is rapid, dose-dependent and reversible. Addition of 200 mumol.l-1 farnesol to the incubation medium prevents inhibition of juvenile hormone III biosynthesis by allatostatin-1. Juvenile hormone III biosynthesis by isolated corpora allata of 3-day female house crickets, A. domesticus, is also susceptible to inhibition by 1 mumol.l-1 allatostatin-1.

  13. First Report of German Cockroaches (Blattella germanica) as Reservoirs of CTX-M-15 Extended-Spectrum-β-Lactamase- and OXA-48 Carbapenemase-Producing Enterobacteriaceae in Batna University Hospital, Algeria.

    Science.gov (United States)

    Loucif, Lotfi; Gacemi-Kirane, Djamila; Cherak, Zineb; Chamlal, Naima; Grainat, Nadia; Rolain, Jean-Marc

    2016-10-01

    Here we report the isolation of extended-spectrum β-lactamase (ESBL)- and carbapenemase-producing Enterobacteriaceae from German cockroaches caught in the burn unit of Batna University Hospital in Algeria. Nine of 12 isolates harbored the blaCTX-M-15 ESBL gene. One Enterobacter cloacae isolate belonging to sequence type 528 coexpressed the blaOXA-48, blaCTX-M-15, and blaTEM genes. Our findings indicate that cockroaches may be one of the most dangerous reservoirs for ESBL and carbapenemase producers in hospitals. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  14. Dietary choice for a balanced nutrient intake increases the mean and reduces the variance in the reproductive performance of male and female cockroaches.

    Science.gov (United States)

    Bunning, Harriet; Bassett, Lee; Clowser, Christina; Rapkin, James; Jensen, Kim; House, Clarissa M; Archer, Catharine R; Hunt, John

    2016-07-01

    Sexual selection may cause dietary requirements for reproduction to diverge across the sexes and promote the evolution of different foraging strategies in males and females. However, our understanding of how the sexes regulate their nutrition and the effects that this has on sex-specific fitness is limited. We quantified how protein (P) and carbohydrate (C) intakes affect reproductive traits in male (pheromone expression) and female (clutch size and gestation time) cockroaches (Nauphoeta cinerea). We then determined how the sexes regulate their intake of nutrients when restricted to a single diet and when given dietary choice and how this affected expression of these important reproductive traits. Pheromone levels that improve male attractiveness, female clutch size and gestation time all peaked at a high daily intake of P:C in a 1:8 ratio. This is surprising because female insects typically require more P than males to maximize reproduction. The relatively low P requirement of females may reflect the action of cockroach endosymbionts that help recycle stored nitrogen for protein synthesis. When constrained to a single diet, both sexes prioritized regulating their daily intake of P over C, although this prioritization was stronger in females than males. When given the choice between diets, both sexes actively regulated their intake of nutrients at a 1:4.8 P:C ratio. The P:C ratio did not overlap exactly with the intake of nutrients that optimized reproductive trait expression. Despite this, cockroaches of both sexes that were given dietary choice generally improved the mean and reduced the variance in all reproductive traits we measured relative to animals fed a single diet from the diet choice pair. This pattern was not as strong when compared to the single best diet in our geometric array, suggesting that the relationship between nutrient balancing and reproduction is complex in this species.

  15. One antenna, two antennae, big antennae, small: total antennae length, not bilateral symmetry, predicts odor-tracking performance in the American cockroach Periplaneta americana.

    Science.gov (United States)

    Lockey, Jacob K; Willis, Mark A

    2015-07-01

    Determining the location of a particular stimulus is often crucial to an animal's survival. One way to determine the local distribution of an odor is to make simultaneous comparisons across multiple sensors. If the sensors detect differences in the distribution of an odor in space, the animal can then steer toward the source. American cockroaches, Periplaneta americana, have 4 cm long antennae and are thought to track odor plumes using a spatial sampling strategy, comparing the amount of odor detected between these bilateral sensors. However, it is not uncommon for cockroaches to lose parts of their antennae and still track a wind-borne odor to its source. We examined whether bilateral odor input is necessary to locate an odor source in a wind-driven environment and how the loss of increasing lengths of the antennae affects odor tracking. The tracking performances of individuals with two bilaterally symmetrical antennae of decreasing length were compared with antennal length-matched individuals with one antenna. Cockroaches with one antenna were generally able to track an odor plume to its source. In fact, the performances of unilaterally antennectomized individuals were statistically identical to those of their bilaterally symmetrical counterparts when the combined length of both antennae equaled the length of the single antenna of the antennectomized individuals. This suggests that the total length of available antennae influences odor tracking performance more than any specific piece of antenna, and that they may be doing something more complex than a simple bilateral comparison between their antennae. The possibility of an antenna-topic map is discussed. © 2015. Published by The Company of Biologists Ltd.

  16. Imidacloprid and thiacloprid neonicotinoids bind more favourably to cockroach than to honeybee α6 nicotinic acetylcholine receptor: insights from computational studies.

    Science.gov (United States)

    Selvam, Balaji; Graton, Jérôme; Laurent, Adèle D; Alamiddine, Zakaria; Mathé-Allainmat, Monique; Lebreton, Jacques; Coqueret, Olivier; Olivier, Christophe; Thany, Steeve H; Le Questel, Jean-Yves

    2015-02-01

    The binding interactions of two neonicotinoids, imidacloprid (IMI) and thiacloprid (THI) with the extracellular domains of cockroach and honeybee α6 nicotinic acetylcholine receptor (nAChR) subunits in an homomeric receptor have been studied through docking and molecular dynamics (MD) simulations. The binding mode predicted for the two neonicotinoids is validated through the good agreement observed between the theoretical results with the crystal structures of the corresponding complexes with Ac-AChBP, the recognized structural surrogate for insects nAChR extracellular ligand binding domain. The binding site of the two insect α6 receptors differs by only one residue of loop D, a serine residue (Ser83) in cockroach being replaced by a lysine residue (Lys108) in honeybee. The docking results show very close interactions for the two neonicotinoids with both α6 nAChR models, in correspondence to the trends observed in the experimental neonicotinoid-Ac-AChBP complexes. However, the docking parameters (scores and energies) are not significantly different between the two insect α6 nAChRs to draw clear conclusions. The MD results bring distinct trends. The analysis of the average interaction energies in the two insects α6 nAChRs shows indeed better affinity of neonicotinoids bound to α6 cockroach compared to honeybee nAChR. This preference is explained by tighter contacts with aromatic residues (Trp and Tyr) of the binding pocket. Interestingly, the non-conserved residue Lys108 of loop D of α6 honeybee nAChR interacts through van der Waals contacts with neonicotinoids, which appear more favourable than the direct or water mediated hydrogen-bond interaction between the OH group of Ser83 of α6 cockroach nAChR and the electronegative terminal group of the two neonicotinoids (nitro in IMI and cyano in THI). Finally, in both insects nAChRs, THI is consistently found to bind more favourably than IMI. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Agonist actions of clothianidin on synaptic and extrasynaptic nicotinic acetylcholine receptors expressed on cockroach sixth abdominal ganglion.

    Science.gov (United States)

    Thany, Steeve H

    2009-11-01

    Clothianidin is new neonicotinoid insecticide acting selectively on insect nicotinic acetylcholine receptors (nAChRs). Its effects on nAChRs expressed on cercal afferent/giant interneuron synapses and DUM neurons have been studied using mannitol-gap and whole-cell patch-clamp techniques, respectively. Bath-application of clothianidin-induced dose-dependent depolarizations of cockroach cercal afferent/giant interneuron synapses which were not reversed after wash-out suggesting a strong desensitization of postsynaptic interneurons at the 6th abdominal ganglion (A6). Clothinidin activity on the nerve preparation was characterized by an increased firing rate of action potentials which then ceased when the depolarization reached a peak. Clothianidin responses were insensitive to all muscarinic antagonists tested but were blocked by co-application of specific nicotinic antagonists methyllicaconitine, alpha-bungarotoxin and d-tubocurarine. In a second round of experiment, clothianidin actions were tested on DUM neurons isolated from the A6. There was a strong desensitization of nAChRs which was not affected by muscarinic antagonists, pirenzepine and atropine, but was reduced with nicotinic antagonist alpha-bungarotoxin. In addition, clothianidin-induced currents were completely blocked by methyllicaconitine suggesting that (1) clothianidin acted as a specific agonist of nAChR subtypes and (2) a small proportion of receptors blocked by MLA was insensitive to alpha-bungarotoxin. Moreover, because clothianidin currents were blocked by d-tubocurarine and mecamylamine, we provided that clothianidin was an agonist of both nAChRs: imidacloprid-sensitive nAChR1 and -insensitive nAChR2 subtypes.

  18. Personality in the cockroach Diploptera punctata: Evidence for stability across developmental stages despite age effects on boldness.

    Science.gov (United States)

    Stanley, Christina R; Mettke-Hofmann, Claudia; Preziosi, Richard F

    2017-01-01

    Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research. Here we test for both differential consistency and age effects upon behavioural traits in the gregarious cockroach Diploptera punctata by testing the same behavioural traits in both juveniles and adults. In our sample, we find consistency in boldness, exploration and sociality within adults whilst only boldness was consistent in juveniles. Both boldness and exploration measures, representative of risk-taking behaviour, show significant consistency across discrete juvenile and adult stages. Age effects are, however, apparent in our data; juveniles are significantly bolder than adults, most likely due to differences in the ecological requirements of these life stages. Size also affects risk-taking behaviour since smaller adults are both bolder and more highly explorative. Whilst a behavioural syndrome linking boldness and exploration is evident in nymphs, this disappears by the adult stage, where links between other behavioural traits become apparent. Our results therefore indicate that differential consistency in personality can be maintained across life stages despite age effects on its magnitude, with links between some personality traits changing over ontogeny, demonstrating plasticity in behavioural syndromes.

  19. Distribution of serotonergic and dopaminergic nerve fibers in the salivary gland complex of the cockroach Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Kühnel Dana

    2002-06-01

    Full Text Available Abstract Background The cockroach salivary gland consists of secretory acini with peripheral ion-transporting cells and central protein-producing cells, an extensive duct system, and a pair of reservoirs. Salivation is controled by serotonergic and dopaminergic innervation. Serotonin stimulates the secretion of a protein-rich saliva, dopamine causes the production of a saliva without proteins. These findings suggest a model in which serotonin acts on the central cells and possibly other cell types, and dopamine acts selectively on the ion-transporting cells. To examine this model, we have analyzed the spatial relationship of dopaminergic and serotonergic nerve fibers to the various cell types. Results The acinar tissue is entangled in a meshwork of serotonergic and dopaminergic varicose fibers. Dopaminergic fibers reside only at the surface of the acini next to the peripheral cells. Serotonergic fibers invade the acini and form a dense network between central cells. Salivary duct segments close to the acini are locally associated with dopaminergic and serotonergic fibers, whereas duct segments further downstream have only dopaminergic fibers on their surface and within the epithelium. In addition, the reservoirs have both a dopaminergic and a serotonergic innervation. Conclusion Our results suggest that dopamine is released on the acinar surface, close to peripheral cells, and along the entire duct system. Serotonin is probably released close to peripheral and central cells, and at initial segments of the duct system. Moreover, the presence of serotonergic and dopaminergic fiber terminals on the reservoir indicates that the functions of this structure are also regulated by dopamine and serotonin.

  20. The physiological role of fat body and muscle tissues in response to cold stress in the tropical cockroach Gromphadorhina coquereliana.

    Directory of Open Access Journals (Sweden)

    Szymon Chowański

    Full Text Available Protective mechanisms against cold stress are well studied in terrestrial and polar insects; however, little is known about these mechanisms in tropical insects. In our study, we tested if a tropical cockroach Gromphadorhina coquereliana, possesses any protective mechanisms against cold stress. Based on the results of earlier studies, we examined how short-term (3 h cold (4°C influences biochemical parameters, mitochondrial respiration activity, and the level of HSPs and aquaporins expression in the fat body and leg muscles of G. coquereliana. Following cold exposure, we found that the level of carbohydrates, lipids and proteins did not change significantly. Nevertheless, we observed significant changes in mitochondrial respiration activity. The oxygen consumption of resting (state 4 and phosphorylating (state 3 mitochondria was altered following cold exposure. The increase in respiratory rate in state 4 respiration was observed in both tissues. In state 3, oxygen consumption by mitochondria in fat body was significantly lower compared to control insects, whereas there were no changes observed for mitochondria in muscle tissue. Moreover, there were cold-induced changes in UCP protein activity, but the changes in activity differed in fat body and in muscles. Additionally, we detected changes in the level of HSP70 and aquaporins expression. Insects treated with cold had significantly higher levels of HSP70 in fat body and muscles. On the other hand, there were lower levels of aquaporins in both tissues following exposure to cold. These results suggest that fat body play an important role in protecting tropical insects from cold stress.

  1. Cockroach Oothecal Parasitoid, Evania appendigaster (Hymenoptera: Evaniidae) Exhibits Oviposition Preference Towards Oothecal Age Most Vulnerable to Host Cannibalism.

    Science.gov (United States)

    Tee, Hui-Siang; Lee, Chow-Yang

    2017-12-05

    Many female parasitoid wasps optimize host selection to balance the benefits of high-quality hosts and the costs of predator- or hyperparasitoid-induced mortality risks to maximize their fitness. Cannibalism exists in many insect species and affects survival of parasitoid larvae developing in or on parasitized hosts. However, little is known about how parasitoid wasps resolve the fitness consequence of host cannibalism-induced mortality risk during host selection. We examined the effect of oothecal age on cannibalism in the American cockroach Periplaneta americana (L.) (Dictyoptera: Blattidae) and its effect on host age selection and fitness of its oothecal parasitoid Evania appendigaster (L.) (Hymenoptera: Evaniidae). P. americana differentially cannibalized 1-d-old (30‒60%) versus 10- to 40-d-old oothecae (parasitoid females did not avoid but still preferred to parasitize 1-d-old (45%) over 10- to 40-d-old oothecae (1.6‒20%). The parasitism rate was greater and the handling time was shorter on 1-d-old compared to older oothecae. For parasitoid progeny emerging from different-aged oothecae, regression analysis showed that development time increased and body size (measured as hind tibia length) and longevity decreased with oothecal age. These results demonstrate that reduced parasitoid progeny survival due to host cannibalism did not change the parasitoid's oviposition preference for newly laid oothecae, and that E. appendigaster females traded progeny survival for fitness gains for themselves and their progeny. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  2. Personality in the cockroach Diploptera punctata: Evidence for stability across developmental stages despite age effects on boldness

    Science.gov (United States)

    Mettke-Hofmann, Claudia; Preziosi, Richard F.

    2017-01-01

    Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research. Here we test for both differential consistency and age effects upon behavioural traits in the gregarious cockroach Diploptera punctata by testing the same behavioural traits in both juveniles and adults. In our sample, we find consistency in boldness, exploration and sociality within adults whilst only boldness was consistent in juveniles. Both boldness and exploration measures, representative of risk-taking behaviour, show significant consistency across discrete juvenile and adult stages. Age effects are, however, apparent in our data; juveniles are significantly bolder than adults, most likely due to differences in the ecological requirements of these life stages. Size also affects risk-taking behaviour since smaller adults are both bolder and more highly explorative. Whilst a behavioural syndrome linking boldness and exploration is evident in nymphs, this disappears by the adult stage, where links between other behavioural traits become apparent. Our results therefore indicate that differential consistency in personality can be maintained across life stages despite age effects on its magnitude, with links between some personality traits changing over ontogeny, demonstrating plasticity in behavioural syndromes. PMID:28489864

  3. Functions of corazonin and histamine in light entrainment of the circadian pacemaker in the Madeira cockroach, Rhyparobia maderae.

    Science.gov (United States)

    Arendt, Andreas; Baz, El-Sayed; Stengl, Monika

    2017-04-01

    The circadian pacemaker of the Madeira cockroach, Rhyparobia (Leucophaea) maderae, is located in the accessory medulla (AME). Ipsi- and contralateral histaminergic compound eyes are required for photic entrainment. Light pulses delay locomotor activity rhythm during the early night and advance it during the late night. Thus, different neuronal pathways might relay either light-dependent delays or advances to the clock. Injections of neuroactive substances combined with running-wheel assays suggested that GABA, pigment-dispersing factor, myoinhibitory peptides (MIPs), and orcokinins (ORCs) were part of both entrainment pathways, whereas allatotropin (AT) only delayed locomotor rhythms at the early night. To characterize photic entrainment further, histamine and corazonin were injected. Histamine injections resulted in light-like phase delays and advances, indicating that the neurotransmitter of the compound eyes participates in both entrainment pathways. Because injections of corazonin only advanced during the late subjective night, it was hypothesized that corazonin is only part of the advance pathway. Multiple-label immunocytochemistry in combination with neurobiotin backfills demonstrated that a single cell expressed corazonin in the optic lobes that belonged to the group of medial AME interneurons. It colocalized GABA and MIP but not AT or ORC immunoreactivity. Corazonin-immunoreactive (-ir) terminals overlapped with projections of putatively light-sensitive interneurons from the ipsi- and contralateral compound eye. Thus, we hypothesize that the corazonin-ir medial neuron integrates ipsi- and contralateral light information as part of the phase-advancing light entrainment pathway to the circadian clock. J. Comp. Neurol. 525:1250-1272, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  4. A sodium channel mutation identified in Aedes aegypti selectively reduces cockroach sodium channel sensitivity to type I, but not type II pyrethroids

    Science.gov (United States)

    Hu, Zhaonong; Du, Yuzhe; Nomura, Yoshiko; Dong, Ke

    2010-01-01

    Voltage-gated sodium channels are the primary target of pyrethroid insecticides. Numerous point mutations in sodium channel genes have been identified in pyrethroid-resistant insect species, and many have been confirmed to reduce or abolish sensitivity of channels expressed in Xenopus oocytes to pyrethroids. Recently, several novel mutations were reported in sodium channel genes of pyrethroid-resistant Aedes mosquito populations. One of the mutations is a phenylalanine (F) to cysteine (C) change in segment 6 of domain III (IIIS6) of the Aedes mosquito sodium channel. Curiously, a previous study showed that alanine substitution of this F did not alter the action of deltamethrin, a type II pyrethroid, on a cockroach sodium channel. In this study, we changed this F to C in a pyrethroid-sensitive cockroach sodium channel and examined mutant channel sensitivity to permethrin as well as five other type I or type II pyrethroids in Xenopus oocytes. Interestingly, the F to C mutation drastically reduced channel sensitivity to three type I pyrethroids, permethrin, NRDC 157 (a deltamethrin analogue lacking the α-cyano group) and bioresemthrin, but not to three type II pyrethroids, cypermethrin, deltamethrin and cyhalothrin. These results confirm the involvement of the F to C mutation in permethrin resistance, and raise the possibility that rotation of type I and type II pyrethroids might be considered in the control of insect pest populations where this particular mutation is present. PMID:20869441

  5. Insecticidal and acetylcholine esterase inhibition activity of Apiaceae plant essential oils and their constituents against adults of German cockroach (Blattella germanica).

    Science.gov (United States)

    Yeom, Hwa-Jeong; Kang, Jae Soon; Kim, Gil-Hah; Park, Il-Kwon

    2012-07-25

    We evaluated the insecticidal and acetylcholine esterase (AChE) inhibition activity of 11 Apiaceae plant essential oils and their constituents in adult male and female Blattella germanica. Of the 11 Apiaceae plant essential oils tested, dill (Anethum graveolens), carvi (Carum carvi), and cumin (Cuminum cyminum) demonstrated >90% fumigant toxicity against adult male German cockroaches at a concentration of 5 mg/filter paper. In a contact toxicity test, dill (Anethum graveolens), carvi (Carum carvi), cumin (Cuminum cyminum), and ajowan (Trachyspermum ammi) produced strong insecticidal activity against adult male and female German cockroaches. Among the test compounds, (S)-(+)-carvone, 1,8-cineole, trans-dihydrocarvone, cuminaldehyde, trans-anethole, p-cymene, and γ-terpinene demonstrated strong fumigant toxicity against adult male and female B. germanica. In a contact toxicity test, carveol, cuminaldehyde, (S)-(+)-carvone, trans-anethole, thymol, and p-cymene showed strong contact toxicity against adult male and female B. germanica. IC(50) values of α-pinene, carvacrol, and dihydrocarvone against female AChE were 0.28, 0.17, and 0.78 mg/mL, respectively. The toxicity of the blends of constituents identified in 4 active oils indicated that carvone, cuminaldehyde, and thymol were major contributors to the fumigant activity or contact toxicity of the artificial blend.

  6. The American Cockroach Peptide Periplanetasin-2 BlocksClostridium DifficileToxin A-Induced Cell Damage and Inflammation in the Gut.

    Science.gov (United States)

    Hong, Ji; Zhang, Peng; Yoon, I Na; Hwang, Jae Sam; Kang, Jin Ku; Kim, Ho

    2017-04-28

    Clostridium difficile , which causes pseudomembranous colitis, releases toxin A and toxin B. These toxins are considered to be the main causative agents for the disease pathogenesis, and their expression is associated with a marked increase of apoptosis in mucosal epithelial cells. Colonic epithelial cells are believed to form a physical barrier between the lumen and the submucosa, and abnormally increased mucosal epithelial cell apoptosis is considered to be an initial step in gut inflammation responses. Therefore, one approach to treating pseudomembranous colitis would be to develop agents that block the mucosal epithelial cell apoptosis caused by toxin A, thus restoring barrier function and curing inflammatory responses in the gut. We recently isolated an antimicrobial peptide, Periplanetasin-2 (Peri-2, YPCKLNLKLGKVPFH) from the American cockroach, whose extracts have shown great potential for clinical use. Here, we assessed whether Peri-2 could inhibit the cell toxicity and inflammation caused by C. difficile toxin A. Indeed, in human colonocyte HT29 cells, Peri-2 inhibited the toxin A-induced decrease in cell proliferation and ameliorated the cell apoptosis induced by this toxin. Moreover, in the toxin A-induced mouse enteritis model, Peri-2 blocked the mucosal disruption and inflammatory response caused by toxin A. These results suggest that the American cockroach peptide Peri-2 could be a possible drug candidate for addressing the pseudomembranous colitis caused by C. difficile toxin A.

  7. Structures of Two Major Allergens, Bla g 4 and Per a 4, From Cockroaches and Their IgE Binding Epitopes

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Y.; Chan, S; Ong, T; Yit, L; Tiong, Y; Chew, F; Sivaraman, J; Mok, Y

    2009-01-01

    Inhalant allergens from cockroaches are an important cause of asthma to millions of individuals worldwide. Here we report for the first time the structures of two major cockroach allergens, Bla g 4 and Per a 4, that adopt a typical lipocalin fold but with distinct structural features as compared with other known lipocalin allergens. Both Bla g 4 and Per a 4 contain two long-range disulfide bonds linking the N and C termini to a beta-barrel. The C-terminal helix of Bla g 4 is bent and greatly extended toward the N terminus. Bla g 4 is found to be a monomer, whereas Per a 4 exists as a dimer in solution with a novel dimeric interface involving residues from loops at the top and bottom of the beta-barrel. Putative ligand binding sites of both allergens are determined by docking of the juvenile hormone III inside the beta-barrel and found to interact with the ligand using non-conserved residues. Bla g 4 and Per a 4 are found to be cross-reactive in sera IgE binding, at least in the Singaporean Chinese population tested. A major IgE binding epitope unique to Per a 4 is found on the loops at the bottom of the beta-barrel that may aid the development of hypoallergens for immunotherapy.

  8. Isolation and identification of two novel attractant compounds from Chinese cockroach (Eupolyphaga sinensis Walker) by combination of HSCCC, NMR and CD techniques.

    Science.gov (United States)

    Jiang, Wei; Wu, Xiaodan; Wu, Bin

    2013-09-13

    High-speed counter-current chromatography (HSCCC) with a two-phase solvent system composed of n-hextane-ethyl acetate-methanol-water (1.5:1:1.5:1, v/v/v/v) was applied to the isolation and purification of attractants from Chinese cockroach, Eupolyphaga sinensis Walker. Two new attractants with attractant activity towards the male insects were obtained from the extract sample in a one-step separation. Their purities were determined by HPLC. Subsequent MS, NMR and CD analyses have led to the characterization of (R)-3-ethyl-6,8-dihydroxy-7-methyl-3,4-dihydroisochromen-1-one (1) and (R)-6,8-dihydroxy-3,7-dimethyl-3,4-dihydroisochromen-1-one (2), two novel isocumarin type attractants. Based on these results, it is concluded that HSCCC is a viable separation method option for purifying insect attractants, while effectively maintaining the attracting activity of the isolates. This is the first attempt to apply counter-current chromatography technique to separate attractants from Chinese cockroach.

  9. Isolation and Identification of Two Novel Attractant Compounds from Chinese Cockroach (Eupolyphaga sinensis Walker by Combination of HSCCC, NMR and CD Techniques

    Directory of Open Access Journals (Sweden)

    Bin Wu

    2013-09-01

    Full Text Available High-speed counter-current chromatography (HSCCC with a two-phase solvent system composed of n-hextane-ethyl acetate-methanol-water (1.5:1:1.5:1, v/v/v/v was applied to the isolation and purification of attractants from Chinese cockroach, Eupolyphaga sinensis Walker. Two new attractants with attractant activity towards the male insects were obtained from the extract sample in a one-step separation. Their purities were determined by HPLC. Subsequent MS, NMR and CD analyses have led to the characterization of (R-3-ethyl-6,8-dihydroxy-7-methyl-3,4-dihydroisochromen-1-one (1 and (R-6,8-dihydroxy-3,7-dimethyl-3,4-dihydroisochromen-1-one (2, two novel isocumarin type attractants. Based on these results, it is concluded that HSCCC is a viable separation method option for purifying insect attractants, while effectively maintaining the attracting activity of the isolates. This is the first attempt to apply counter-current chromatography technique to separate attractants from Chinese cockroach.

  10. MICROBIAL LOAD AND MULTIPLE DRUG RESISTANCE OF PATHOGENIC BACTERIA ISOLATED FROM FEACES AND BODY SURFACES OF COCKROACHES IN AN URBAN AREA OF SOUTHWESTERN NIGERIA

    Directory of Open Access Journals (Sweden)

    Monsuru Adebayo Adeleke

    2012-06-01

    Full Text Available This study investigates the microbial load and antibiotic susceptibility pattern of pathogenic bacteria isolated from the faeces and body surfaces of cockroaches in Osogbo, Southwestern Nigeria. The cockroaches collected from residential areas and hospital vicinities were screened for microbial load and antibiotic susceptibility pattern using standard protocols. A total of twenty- three microorganisms namely Klebsiella aerogenes, Bacillius cereus, Proteus spp, Staphyloccocus aureus, S. saprophyticus, Enteroccocus faecalis, Staphylococus epididermis, E. coli, Listeria monoctogene, Proteus mirabilis, Citrobacter species, Pseudomonas aeruginosa, Psuedomonas species, Seretia mensence, Candida albicans, Candida spp., Aspergilius spp., A. flavus, A. fumigates, Mucor species and Penicilium species were isolated. The microbial load of the microorganisms was significantly higher in the isolates from hospital as compared with the residential area (p<0.05 with the exception of Canidida species, Mucor and Penicillium which had higher or equal microbial load at the residential areas. All the pathogenic bacteria isolated had multiple resistance to antibiotics most importantly, Ampicillin, Augumentin, Amoxicillin and Septrin (30μg. Efforts geared towards controlling the insects will be indispensable in curbing the wide spread of multi-drug resistant pathogens in the study area.

  11. Enterobactérias isoladas de baratas (Periplaneta americana capturadas em um hospital brasileiro Enterobacteria isolated from cockroaches (Periplaneta americana captured in a Brazilian hospital

    Directory of Open Access Journals (Sweden)

    Marinésia A. Prado

    2002-02-01

    Full Text Available Objetivo. Isolar e identificar microrganismos em baratas capturadas em um hospital público e determinar o seu perfil de suscetibilidade antimicrobiana. Métodos. As baratas foram capturadas nos períodos matutino e noturno, colocadas em frascos desinfetados com álcool a 70%, transferidas para um frasco estéril e levadas ao laboratório. Consideraram-se as baratas íntegras e vivas, as quais foram colocadas em solução salina estéril (0,8% e homogeneizadas. Essa solução foi semeada nos meios de cultura ágar MacConkey, caldo nutriente, infusão de cérebro e coração (ágar BHI, ágar Sabouraud e ágar manitol. As culturas foram examinadas em um estereomicroscópio para a contagem das unidades formadoras de colônias. Para a determinação do perfil de suscetibilidade antimicrobiana utilizou-se o teste de difusão de disco. Resultados. Detectou-se prevalência de 56% de enterobactérias e de 18% de estafilococos coagulase negativos. Identificaram-se 15 espécies de enterobactérias. As mais freqüentes foram Klebsiella pneumoniae (17%; Enterobacter aerogenes (14%; Serratia marcescens (13%; Hafnia alvei (12%; Enterobacter gergoviae e Enterobacter cloacae (9%; e Serratia spp. (6%. Tanto as enterobactérias quanto os estafilococos coagulase negativos apresentaram uma resistência significativa aos antimicrobianos, inclusive à oxacilina. Conclusões. A prevalência de bactérias enteropatogênicas e de estafilococos coagulase negativos isolados de baratas Periplaneta americana no hospital estudado demonstra a fragilidade das condutas adotadas tanto para o controle de vetores quanto para o uso dos antimicrobianos. Os resultados demonstram a necessidade da implementação de um programa efetivo de saneamento ambiental e do uso racional dos antimicrobianos dentro das instituições de saúde.Objective. To isolate and identify microorganisms from cockroaches that were captured in a public hospital and to test the antimicrobial susceptibility of

  12. An important role of a pyrethroid-sensing residue F1519 in the action of the N-alkylamide insecticide BTG 502 on the cockroach sodium channel.

    Science.gov (United States)

    Du, Yuzhe; Khambay, Bhupinder; Dong, Ke

    2011-07-01

    Deltamethrin, a pyrethroid insecticide, and BTG 502, an alkylamide insecticide, target voltage-gated sodium channels. Deltamethrin binds to a unique receptor site and causes prolonged opening of sodium channels by inhibiting deactivation and inactivation. Previous (22)Na(+) influx and receptor binding assays using mouse brain synaptoneurosomes showed that BTG 502 antagonized the binding and action of batrachotoxin (BTX), a site 2 sodium channel neurotoxin. However, the effect of BTG 502 has not been examined directly on sodium channels expressed in Xenopus oocytes. In this study, we examined the effect of BTG 502 on wild-type and mutant cockroach sodium channels expressed in Xenopus oocytes. Toxin competition experiments confirmed that BTG 502 antagonizes the action of BTX and possibly shares a common receptor site with BTX. However, unlike BTX which causes persistent activation of sodium channels, BTG 502 reduces the amplitude of peak sodium current. A previous study showed that BTG 502 was more toxic to pyrethroid-resistant house flies possessing a super-kdr (knockdown resistance) mechanism than to pyrethroid-susceptible house flies. However, we found that the cockroach sodium channels carrying the equivalent super-kdr mutations (M918T and L1014F) were not more sensitive to BTG 502 than the wild-type channel. Instead, a kdr mutation, F1519I, which reduces pyrethroid binding, abolished the action of BTG 502. These results provide evidence the actions of alkylamide and pyrethroid insecticides require a common sodium channel residue. Copyright © 2011 Elsevier Ltd. All rights reserved.

  13. Deltamethrin-resistant German Cockroaches Are Less Sensitive to the Insect Repellents DEET and IR3535 than Non-resistant Individuals.

    Science.gov (United States)

    Mengoni, Sofía L; Alzogaray, Raúl A

    2018-02-05

    The German cockroach, Blattella germanica (L.) (Blattodea: Blattellidae), is a serious worldwide pest with a considerable economical and sanitary impact. It is mainly controlled by the application of synthetic insecticides, but repeated use of these substances has promoted the appearance of resistance in cockroach populations throughout the world. The aim of this study was to compare the behavior of deltamethrin-susceptible (CIPEIN colony) and deltamethrin-resistant (JUBA and VGBA colonies) first instar nymphs exposed to the repellents N,N-diethyl-3-methylbenzamide (DEET) and ethyl 3-[acetyl(butyl)amino]propanoate (IR3535). Firstly, the behavior of the nymphs was assessed in an experimental arena in the absence of repellents. The parameters Distance Traveled, Velocity, Mobility Time, and Time Spent (in each half of the arena) were quantified using an image analyser, and showed that the behavior elicited by the three colonies was similar. After this, the behavior of the nymphs was quantified in an arena, half of which had been treated with repellent. The repellency of DEET increased as a linear function of log concentration for the three colonies. DEET elicited repellency as from a concentration of 97.49 µg/cm2 for the CIPEIN and JUBA colonies and 194.98 µg/cm2 for the VGBA colony. The repellency of IR3535 was weaker and started at a concentration of 389.96 µg/cm2 for the CIPEIN colony, 779.92 μg/cm2 for JUBA, and 1559.84 μg/cm2 for VGBA . Finally, nymphs were exposed to 3:1, 1:1, and 1:3 DEET:IR3535 mixtures, and a synergistic effect was observed only in the CIPEIN colony. © The Author(s) 2018. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  14. Evaluation of Some Plant Essential Oils against the Brown-Banded Cockroach, Supella longipalpa (Blattaria: Ectobiidae): A Mechanical Vector of Human Pathogens

    Science.gov (United States)

    Sharififard, Mona; Safdari, Farhad; Siahpoush, Amir; Kassiri, Hamid

    2016-01-01

    Background: Essential oils, as secondary plant compounds, present a safer alternative to conventional insecticides in insect control programs. So five essential oils including eucalyptus, mint, yarrow, oregano and rosemary oils were evaluated against the brown-banded cockroach Supella longipalpa. Methods: Evaluation was done against the 3rd and 4th instar nymphs using three bioassay methods; continuous contact toxicity, fumigant toxicity and repellent activity. The study was done in the laboratory of medical entomology, during April 2012 to September 2013. Results: Mortality rates by the lowest concentration (2.5%) of rosemary, oregano, yarrow, eucalyptus and mint oils were 100%, 62.2%, 45 %, 36.2% and 5.2% at 24 h after exposure respectively. Rosemary oil was determined as the most toxic oil because of 100 % mortality rate at the concentration range of 2.5% to 30%. The lowest fumigation effect using 50 μl/L air was recorded from mint oil with 97.2 % mortality after 24 h, while the other oils caused 100% mortality. The most repel activity was related to oregano oil which showed 96.5–99.1% repellency at the concentration range of 2.5–30% with a residual effect lasting at least a week after treatment. Conclusion: Oregano oil could be used as a potential repellent against S. longipalpa. Also, all five essential oils could be used as the safe compounds for surface treating or fumigation in cockroach control programs while rosmary and oregano oils exhibited the most toxicity. PMID:28032105

  15. Evaluation of Some Plant Essential Oils against the Brown-banded Cock-roach, Supella longipalpa (Blattaria: Ectobiidae, A Mechanical Vector of Human Pathogens

    Directory of Open Access Journals (Sweden)

    Mona Sharififard

    2016-10-01

    Full Text Available Background: Essential oils, as secondary plant compounds, present a safer alternative to conventional insecticides in insect control programs. So five essential oils including eucalyptus, mint, yarrow, oregano and rosemary oils were evaluated against the brown-banded cockroach Supella longipalpa.Methods: Evaluation was done against the 3rd and 4th instar nymphs using three bioassay methods; continuous con­tact toxicity, fumigant toxicity and repellent activity. The study was done in the laboratory of medical entomology, during April 2012 to September 2013.Results: Mortality rates by the lowest concentration (2.5% of rosemary, oregano, yarrow, eucalyptus and mint oils were 100%, 62.2%, 45 %, 36.2% and 5.2% at 24 h after exposure respectively. Rosemary oil was determined as the most toxic oil because of 100 % mortality rate at the concentration range of 2.5% to 30%. The lowest fumigation effect using 50 µl /L air was recorded from mint oil with 97.2 % mortality after 24 h, while the other oils caused 100% mortality. The most repel activity was related to oregano oil which showed 96.5–99.1% repellency at the con­centration range of 2.5–30% with a residual effect lasting at least a week after treatment.Conclusion: Oregano oil could be used as a potential repellent against S. longipalpa. Also, all five essential oils could be used as the safe compounds for surface treating or fumigation in cockroach control programs while rosmary and oregano oils exhibited the most toxicity.

  16. A cockroach for victory

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    From 1 – 5 July, CERN had the pleasure of welcoming Céline, Fanny and Ophélia, the three winners of the special EIROforum prize donated by CERN in the EU Competition for Young Scientists 2012 (EUCYS). Between visits to the installations and meetings, the young French women had a memorable week.   Fanny Risbourg, Ophélia Bolmin and Céline Lay (from left to right), alongside their CERN guide, Marc Goulette. The rules of EUCYS, organised by the EU since 1989, require all candidates to have first won a scientific prize in their own country. That’s easily said… and done for these young scientists, who have won two! After coming first in France’s Engineering Science Olympiad in 2011, they then took home the top prize in the C. Génial competition the following year. “It all started three years ago, with our travaux personnels encadrés (supervised project),” Fanny explained...

  17. Inhibition of PaCaMKII-E isoform in the dorsal unpaired median neurosecretory cells of cockroach reduces nicotine- and clothianidin-induced currents.

    Science.gov (United States)

    List, Olivier; Calas-List, Delphine; Taillebois, Emiliane; Juchaux, Marjorie; Heuland, Emilie; Thany, Steeve H

    2014-08-01

    Cellular responses to Ca(2+) require intermediary proteins such as calcium/calmodulin-dependent protein kinase II (CaMKII), which transduces the signal into downstream effects. We recently demonstrated that the cockroach genome encodes five different CaMKII isoforms, and only PaCaMKII-E isoform is specifically expressed in the dorsal unpaired median neurosecretory cells. In the present study, using antisense oligonucleotides, we demonstrated that PaCaMKII-E isoform inhibition reduced nicotine-induced currents through α-bungarotoxin-sensitive and -insensitive nicotinic acetylcholine receptor subtypes. Specifically, PaCaMKII-E isoform is sufficient to repress nicotinic current amplitudes as a result of its depression by antisense oligonucleotides. Similar results were found using the neonicotinoid insecticide clothianidin, which acted as a full agonist of dorsal unpaired median neuron nicotinic acetylcholine receptors. Clothianidin current amplitudes are strongly reduced under bath application of PaCaMKII-E antisense oligonucleotides but no significant results are found with α-bungarotoxin co-applied, demonstrating that CaMKII-E isoform affects nicotine currents through α-bungarotoxin-sensitive and -insensitive receptor subtypes whereas clothianidin currents are reduced via α-bungarotoxin-insensitive receptors. In addition, we found that intracellular calcium increase induced by nicotine and clothianidin were reduced by PaCaMKII-E antisense oligonucleotides, demonstrating that intracellular calcium increase induced by nicotine and clothianidin are affected by PaCaMKII-E inhibition. Cellular responses to Ca(2+) require intermediary proteins such as calcium/calmodulin-dependent protein kinase II (CaMKII). We recently demonstrated that the cockroach genome encodes five different CaMKII isoforms and only PaCaMKII-E isoform was specifically expressed in the dorsal unpaired median neurosecretory cells. Here we show that specific inhibition of PaCaMKII-E isoform is

  18. Insect-specific irreversible inhibitors of acetylcholinesterase in pests including the bed bug, the eastern yellowjacket, German and American cockroaches, and the confused flour beetle.

    Science.gov (United States)

    Polsinelli, Gregory A; Singh, Sanjay K; Mishra, Rajesh K; Suranyi, Robert; Ragsdale, David W; Pang, Yuan-Ping; Brimijoin, Stephen

    2010-09-06

    Insecticides directed against acetylcholinesterase (AChE) are facing increased resistance among target species as well as increasing concerns for human toxicity. The result has been a resurgence of disease vectors, insects destructive to agriculture, and residential pests. We previously reported a free cysteine (Cys) residue at the entrance to the AChE active site in some insects but not higher vertebrates. We also reported Cys-targeting methanethiosulfonate molecules (AMTSn), which, under conditions that spared human AChE, caused total irreversible inhibition of aphid AChE, 95% inhibition of AChE from the malaria vector mosquito (Anopheles gambia), and >80% inhibition of activity from the yellow fever mosquito (Aedes aegypti) and northern house mosquito (Culex pipiens). We now find the same compounds inhibit AChE from cockroaches (Blattella germanica and Periplaneta americana), the flour beetle (Tribolium confusum), the multi-colored Asian ladybird beetle (Harmonia axyridis), the bed bug (Cimex lectularius), and a wasp (Vespula maculifrons), with IC(50) values of approximately 1-11muM. Our results support further study of Cys-targeting inhibitors as conceptually novel insecticides that may be free of resistance in a range of insect pests and disease vectors and, compared with current compounds, should demonstrate much lower toxicity to mammals, birds, and fish. Copyright (c) 2010 Elsevier Ireland Ltd. All rights reserved.

  19. Ereboglobus luteus gen. nov. sp. nov. from cockroach guts, and new insights into the oxygen relationship of the genera Opitutus and Didymococcus (Verrucomicrobia: Opitutaceae).

    Science.gov (United States)

    Tegtmeier, Dorothee; Belitz, Alexandra; Radek, Renate; Heimerl, Thomas; Brune, Andreas

    2018-03-01

    We isolated a novel member of the phylum Verrucomicrobia from the hindgut of the cockroach Shelfordella lateralis. Strain Ho45 is a yellow-pigmented, motile coccus that represents a new genus-level lineage with less than 93% sequence similarity to the 16S rRNA genes of other species in the family Opitutaceae. Ultrastructural analysis revealed a Gram-negative cell envelope with an outer membrane and a periplasmic space. In its ability to ferment sugars to propionate and acetate as major products, strain Ho45 resembles its closest relative, Opitutus terrae. However, the strains differed in their relationship to oxygen. Although strain Ho45 grew and consumed oxygen at sub-atmospheric concentrations (1-4%), both growth rate and cell yield decreased strongly with increasing oxygen concentration in the headspace. By contrast, O. terrae, previously described as an obligate anaerobe, proved to be facultatively aerobic, with highest growth rates and cell yields at 2% and 16% oxygen, respectively. Also the closely related Didymococcus (Diplosphaera) colitermitum, previously described as an obligately aerobic microaerophile, showed a fermentative metabolism under anoxic conditions, forming the same products from glucose as strain Ho45 and O. terrae. Based on phenotypic and phylogenetic evidence, we propose strain Ho45 as the type strain of a novel genus, Ereboglobus luteus gen. nov. sp. nov., and provide an emended description of the family Opitutaceae and the genera Opitutus and Didymococcus. Copyright © 2017 Elsevier GmbH. All rights reserved.

  20. Plasticizer, di(2-ethylhexyl)phthalate (DEHP) enhances cockroach allergen extract-driven airway inflammation by enhancing pulmonary Th2 as well as Th17 immune responses in mice.

    Science.gov (United States)

    Alfardan, Ali S; Nadeem, Ahmed; Ahmad, Sheikh F; Al-Harbi, Naif O; Al-Harbi, Mohammad M; AlSharari, Shakir D

    2018-03-19

    In recent decades, there has been a gradual increase in the prevalence of asthma. Various factors including environmental pollutants have contributed to this phenomenon. Plasticizer, di(2-ethylhexyl)phthalate (DEHP) is one of the commonest environmental pollutants due to its association with plastic products. DEHP gets released from plastic products easily leading to respiratory exposure in humans. As a consequence, DEHP is associated with allergic asthma in humans and animals. DEHP is reported to act as an adjuvant in ovalbumin-induced mouse models of asthma at high doses. However, these studies mostly looked into the role of DEHP on Th2 cytokines/eosinophilic inflammation without investigating the role of airway epithelial cells (AECs)/dendritic cells (DCs)/Th17 cells. Its adjuvant activity with natural allergens such as cockroach allergens at tolerable daily intake needs to be explored. Cockroach allergens and DEHP may be inhaled together due to their coexistence in work place as well as household environments. Therefore, effect of DEHP was assessed in cockroach allergens extract (CE)-induced mouse model of asthma. Airway inflammation, histopathology, mucus secretion, and immune responses related to Th2/Th17/DCs and AECs were assessed in mice with DEHP exposure alone and in combination with CE. Our study shows that DEHP converts CE-induced eosinophilic inflammation into mixed granulocytic inflammation by promoting Th2 as well as Th17 immune responses. This was probably due to downregulation of E-cadherin in AECs, and enhancement of costimulatory molecules (MHCII/CD86/CD40)/pro-inflammatory cytokines (IL-6/MCP-1) in DCs by DEHP. This suggests that DEHP facilitates development of mixed granulocytic airway inflammation in the presence of a natural allergen. Copyright © 2018 Elsevier Inc. All rights reserved.

  1. Alanine to valine substitutions in the pore helix IIIP1 and linker-helix IIIL45 confer cockroach sodium channel resistance to DDT and pyrethroids.

    Science.gov (United States)

    Chen, Mengli; Du, Yuzhe; Nomura, Yoshiko; Zhu, Guonian; Zhorov, Boris S; Dong, Ke

    2017-05-01

    Pyrethroid insecticides exert toxic effects by prolonging the opening of voltage-gated sodium channels. More than 20 sodium channel mutations from arthropod pests and disease vectors have been confirmed to confer pyrethroid resistance. These mutations have been valuable in elucidating the molecular interaction between pyrethroids and sodium channels, including identification of two pyrethroid receptor sites. Previously, two alanine to valine substitutions, one in the pore helix IIIP1 and the other in the linker-helix connecting S4 and S5 in domain III (IIIL45), were found in Drosophila melanogaster mutants that are resistant to DDT and deltamethrin (a type II pyrethroid with an α-cyano group at the phenylbenzyl alcohol position, which is lacking in type I pyrethroids), but their role in target-site-mediated insecticide resistance has not been functionally confirmed. In this study, we functionally examined the two mutations in cockroach sodium channels expressed in Xenopus laevis oocytes. Both mutations caused depolarizing shifts in the voltage dependence of activation, conferred DDT resistance and also resistance to two Type I pyrethroids by almost abolishing the tail currents induced by Type I pyrethroids. In contrast, neither mutation reduced the amplitude of tail currents induced by the Type II pyrethroids, deltamethrin or cypermethrin. However, both mutations accelerated the decay of Type II pyrethroid-induced tail currents, which normally decay extremely slowly. These results provided new insight into the molecular basis of different actions of Type I and Type II pyrethroids on sodium channels. Computer modeling predicts that both mutations may allosterically affect pyrethroid binding. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Adhesion and friction of the smooth attachment system of the cockroach Gromphadorhina portentosa and the influence of the application of fluid adhesives

    Directory of Open Access Journals (Sweden)

    Oliver Betz

    2017-05-01

    Full Text Available Two different measurement techniques were applied to study the attachment of the smooth foot pads of the Madagascar hissing cockroach Gromphadorhina portentosa. The attachment of the non-manipulated adhesive organs was compared with that of manipulated ones (depletion or substitution by artificial secretions. From measurements of the friction on a centrifuge, it can be concluded that on nanorough surfaces, the insect appears to benefit from employing emulsions instead of pure oils to avoid excessive friction. Measurements performed with a nanotribometer on single attachment organs showed that, in the non-manipulated euplantulae, friction was clearly increased in the push direction, whereas the arolium of the fore tarsus showed higher friction in the pull direction. The surface of the euplantulae shows an imbricate appearance, whereupon the ledges face distally, which might contribute to the observed frictional anisotropy in the push direction. Upon depletion of the tarsal adhesion-mediating secretion or its replacement by oily fluids, in several cases, the anisotropic effect of the euplantula disappeared due to the decrease of friction forces in push-direction. In the euplantulae, adhesion was one to two orders of magnitude lower than friction. Whereas the tenacity was slightly decreased with depleted secretion, it was considerably increased after artificial application of oily liquids. In terms of adhesion, it is concluded that the semi-solid consistence of the natural adhesion-mediating secretion facilitates the detachment of the tarsus during locomotion. In terms of friction, on smooth to nanorough surfaces, the insects appear to benefit from employing emulsions instead of pure oils to avoid excessive friction forces, whereas on rougher surfaces the tarsal fluid rather functions in improving surface contact by keeping the cuticle compliable and compensating surface asperities of the substratum.

  3. Colocalization of allatotropin and tachykinin-related peptides with classical transmitters in physiologically distinct subtypes of olfactory local interneurons in the cockroach (Periplaneta americana).

    Science.gov (United States)

    Fusca, Debora; Schachtner, Joachim; Kloppenburg, Peter

    2015-07-01

    In the insect antennal lobe different types of local interneurons mediate complex excitatory and inhibitory interactions between the glomerular pathways to structure the spatiotemporal representation of odors. Mass spectrometric and immunohistochemical studies have shown that in local interneurons classical neurotransmitters are likely to colocalize with a variety of substances that can potentially act as cotransmitters or neuromodulators. In the antennal lobe of the cockroach Periplaneta americana, gamma-aminobutyric acid (GABA) has been identified as the potential inhibitory transmitter of spiking type I local interneurons, whereas acetylcholine is most likely the excitatory transmitter of nonspiking type IIa1 local interneurons. This study used whole-cell patch clamp recordings combined with single-cell labeling and immunohistochemistry to test if the GABAergic type I local interneurons and the cholinergic type IIa1 local interneurons express allatotropin and tachykinin-related neuropeptides (TKRPs). These are two of the most abundant types of peptides in the insect antennal lobe. GABA-like and choline acetyltransferase (ChAT)-like immunoreactivity were used as markers for GABAergic and cholinergic neurons, respectively. About 50% of the GABA-like immunoreactive (-lir) spiking type I local interneurons were allatotropin-lir, and ∼ 40% of these neurons were TKRP-lir. About 20% of nonspiking ChAT-lir type IIa1 local interneurons were TKRP-lir. Our results suggest that in subpopulations of GABAergic and cholinergic local interneurons, allatotropin and TKRPs might act as cotransmitters or neuromodulators. To unequivocally assign neurotransmitters, cotransmitters, and neuromodulators to identified classes of antennal lobe neurons is an important step to deepen our understanding of information processing in the insect olfactory system. © 2015 Wiley Periodicals, Inc.

  4. Transforming insect electromyograms into pneumatic muscle control

    Science.gov (United States)

    Rutter, Brandon; Mu, Laiyong; Ritzmann, Roy; Quinn, Roger

    2006-05-01

    Robots can serve as hardware models for testing biological hypotheses. Both for this reason and to improve the state of the art of robotics, we strive to incorporate biological principles of insect locomotion into robotic designs. Previous research has resulted in a line of robots with leg designs based on walking and climbing movements of the cockroach Blaberus discoidalis. The current version, Robot V, uses muscle-like Braided Pneumatic Actuators (BPAs). In this paper, we use recorded electromyograms (EMGs) to drive robot joint motion. A muscle activation model was developed that transforms EMGs recorded from behaving cockroaches into appropriate commands for the robot. The transform is implemented by multiplying the EMG by an input gain thus generating an input pressure signal, which is used to drive a one-way closed loop pressure controller. The actuator then can be modeled as a capacitance with input rectification. The actuator exhaust valve is given a leak rate, making the transform a leaky integrator for air pressure, which drives the output force of the actuator. We find parameters of this transform by minimizing the difference between the robot motion produced and that observed in the cockroach. Although we have not reproduced full-amplitude cockroach motion using this robot, results from evaluation on reduced-amplitude cockroach angle data strongly suggest that braided pneumatic actuators can be used as part of a physical model of a biological system.

  5. amylase from cockroach, Periplaneta americana

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... The enzyme was stable up to 55°C and its pH stability was in range of 5.6 - 6.6. .... acrylamide gel and by gel filtration chromatography. Gel filtration .... Activity at 55 °C. Figure 8. Thermic inactivation at 37°C and 55°C of Periplaneta americana α-amylase. Thermal stability of the enzyme was followed for 1 h.

  6. On the ecology and conservation status of Cordylus giganteus A ...

    African Journals Online (AJOL)

    1988-11-08

    Nov 8, 1988 ... During a survey of the distribution of reptiles and amphibians of the Transvaal, particular attention was paid to establishing the existance of the species in the. Transvaal. This led to extensive farm-to-farm surveys in the south-eastern Transvaal from where verbal accounts of its presence had been received.

  7. Vigas de concreto armadas com taliscas de bambu Dendrocalamus Giganteus

    OpenAIRE

    Gisleiva Cristina dos Santos Ferreira

    2007-01-01

    Resumo: A utilização do bambu como elemento estrutural vem sendo estudada há dezenas de anos, apresentando excelentes resultados em relação às suas características físicas e mecânicas. Assim, alguns pesquisadores iniciaram nas últimas décadas estudos para viabilizar a aplicação do bambu como armadura em elementos de concreto. Neste sentido, este trabalho pretende apresentar soluções ao principal problema de utilização do bambu como armadura em elementos estruturais de concreto, um modelo de d...

  8. Does lunisolar gravitational tide affect the activity of animals?

    Science.gov (United States)

    Deshcherevskii, A. V.; Sidorin, A. Ya.

    2010-12-01

    Multiyear time series obtained by the continuous instrumental monitoring of the electrical activity (EA) of weakly electric fish Gnathonemus leopoldianus and the motor activity (MA) of the freshwater catfish Hoplosternum thoracatum and the cockroach Blaberus craniifer are compared to the parameters of the lunisolar gravitational tide. These curves are observed to be very similar for a large number of time intervals. However, a more detailed analysis shows this to be only a superficial resemblance caused by the closeness of the periods of diurnal and semidiurnal rhythms of bioindicator activity (the dominant rhythms in EA and MA patterns) and the periods of main gravitational tidal waves. It is concluded that the lunisolar gravitational tide has no significant effect on animal behavior in our experiment.

  9. Neuroimaging in cockroach phobia: An experimental study

    Directory of Open Access Journals (Sweden)

    Francisco Rivero

    2017-01-01

    Full Text Available Antecedentes/Objetivo: En este estudio se exploran las características en neuroimagen de personas con fobia específica a peque ̃ nos animales (cucarachas, para determinar si existen diferencias en la actividad cerebral entre personas con y sin fobia a las cucarachas, bajo condi- ciones de estimulación fóbica y no fóbica. Método : Se estudiaron 24 adultos (12 con fobia. El diagnóstico de fobia específica se obtuvo mediante una entrevista estructurada y cuestionarios. Todos fueron expuestos a una presentación en video 3D durante una sesión de RMNf. Resultados: El grupo con fobia mostró activaciones diferenciales significativas, que fueron congruentes con el modelo de doble ruta en el procesamiento del miedo, a través del tálamo- amígdala (ruta I, y tálamo-corteza entorrinal-hipocampo-subículo-amígdala (ruta II. Además, se encontraron activaciones diferenciales en el globo pálido, en el giro hipocampal, ínsula, y en los pars orbitalis, triangularis y opercularis. Con respecto al grupo control, no se observaron activaciones de la ínsula ni el cingulado. Conclusiones: Parece evidenciarse un modelo de doble ruta en el procesamiento de estímulos fóbicos. Este doble proceso puede tener implicaciones para el tratamiento psicológico de las fobias específicas.

  10. Cryptochrome 2 mediates directional magnetoreception in cockroaches

    Czech Academy of Sciences Publication Activity Database

    Bazalová, Olga; Kvíčalová, M.; Válková, T.; Slabý, P.; Bartoš, P.; Netušil, R.; Tomanová, K.; Braeunig, P.; Lee, H.-J.; Šauman, Ivo; Damulewicz, Milena; Provazník, Jan; Pokorný, R.; Doležel, David; Vácha, M.

    2016-01-01

    Roč. 113, č. 6 (2016), s. 1660-1665 ISSN 0027-8424 R&D Projects: GA MŠk LH14029; GA ČR(CZ) GC13-11908J; GA ČR(CZ) GC206/07/J041 Institutional support: RVO:60077344 Keywords : magnetoreception * cryptochrome * light spectrum Subject RIV: CE - Biochemistry Impact factor: 9.661, year: 2016

  11. Buckling failures in insect exoskeletons.

    Science.gov (United States)

    Parle, Eoin; Herbaj, Simona; Sheils, Fiona; Larmon, Hannah; Taylor, David

    2015-12-17

    Thin walled tubes are often used for load-bearing structures, in nature and in engineering, because they offer good resistance to bending and torsion at relatively low weight. However, when loaded in bending they are prone to failure by buckling. It is difficult to predict the loading conditions which cause buckling, especially for tubes whose cross sections are not simple shapes. Insights into buckling prevention might be gained by studying this phenomenon in the exoskeletons of insects and other arthropods. We investigated the leg segments (tibiae) of five different insects: the locust (Schistocerca gergaria), American cockroach (Periplaneta americana), death's head cockroach (Blaberus discoidalis), stick insect (Parapachymorpha zomproi) and bumblebee (Bombus terrestris audax). These were tested to failure in cantilever bending and modelled using finite element analysis (FEA). The tibiae of the locust and the cockroaches were found to be approximately circular in shape. Their buckling loads were well predicted by linear elastic FEA, and also by one of the analytical solutions available in the literature for elastic buckling. The legs of the stick insect are also circular in cross section but have several prominent longitudinal ridges. We hypothesised that these ridges might protect the legs against buckling but we found that this was not the case: the loads necessary for elastic buckling were not reached in practice because yield occurred in the material, causing plastic buckling. The legs of bees have a non-circular cross section due to a pollen-carrying feature (the corbicula). We found that this did not significantly affect their resistance to buckling. Our results imply that buckling is the dominant failure mode in the tibia of insects; it likely to be a significant consideration for other arthropods and any organisms with stiff exoskeletons. The interactions displayed here between material properties and cross sectional geometry may provide insights for the

  12. A new species of Cryptosporidium (Apicomplexa: Cryptosporidiidae) from eastern grey kangaroos (Macropus giganteus).

    Science.gov (United States)

    Power, Michelle L; Ryan, Una M

    2008-10-01

    Cryptosporidium macropodum n. sp is described. Oocysts of C. macropodum from the feces of kangaroos (Macropus spp.) are morphologically indistinguishable from other mammalian Cryptosporidium species, including C. parvum, C. hominis, C. suis, and C. canis. The oocysts are fully sporulated on excretion, lack sporocysts, and have an average width of 4.9 microm (4.5-6.0), a length of 5.4 microm (5.0-6.0), and a length:width ratio of 1.1. Phylogenetic analyses of the 18S ribosomal RNA, actin, and heat shock protein 70 (HSP70) loci demonstrate that C. macropodum is genetically distinct from all described Cryptosporidium species, including others found in marsupials. The parasite seems to be highly host-specific, because it has been found only in marsupials to date. Therefore, based on biological and molecular data, we consider C. macropodum a new species.

  13. Observation of a novel Babesia spp. in Eastern Grey Kangaroos (Macropus giganteus) in Australia

    Science.gov (United States)

    Dawood, Kaiser E.; Morgan, Jess A.T.; Busfield, Frances; Srivastava, Mukesh; Fletcher, Taryn I.; Sambono, Jacqueline; Jackson, Louise A.; Venus, Bronwyn; Philbey, Adrian W.; Lew-Tabor, Ala E.

    2012-01-01

    The roles and epidemiological features of tick-borne protozoans are not well elicited in wildlife. Babesia spp. are documented in many domestic animals, including cattle, horses, pigs, dogs and cats. Three cases affecting eastern grey kangaroos are described. The kangaroos exhibited neurological signs, depression and marked anaemia, and microscopic examination of blood smears revealed intraerythrocytic piroplasms. One to seven intraerythrocytic spherical, oval, pyriform and irregularly-shaped parasites consistent with Babesia spp. were seen in the blood smears and the percentage of infected erythrocytes was estimated to be approximately 7% in each case. Data suggest that the tick vector for this kangaroo Babesia sp. is a Haemaphysalis species. For Case 2, ultrastructural examination of the erythrocytes of the renal capillaries showed parasites resembling Babesia spp. and 18 of 33 erythrocytes were infected. DNA sequencing of the amplified 18S rDNA confirmed that the observed intraerythrocytic piroplasms belong to the genus Babesia. The phylogenetic position of this new kangaroo Babesia sp. (de novo Babesia macropus), as a sister species to the new Australian woylie Babesia sp., suggests a close affinity to the described Afro–Eurasian species Babesia orientalis and Babesia occultans suggesting perhaps a common ancestor for the Babesia in kangaroos. PMID:24533316

  14. Immunocontraception of Eastern Grey kangaroos (Macropus giganteus) with recombinant brushtail possum (Trichosurus vulpecula) ZP3 protein.

    Science.gov (United States)

    Kitchener, Anne L; Harman, Amanda; Kay, David J; McCartney, Carmen A; Mate, Karen E; Rodger, John C

    2009-01-01

    This study examined the potential of a recombinant marsupial zona pellucida 3 protein as a contraceptive vaccine for the Eastern Grey kangaroo, a marsupial that is locally overabundant in several regions of eastern Australia. First, a pilot study using porcine zona pellucidae (PZP) demonstrated that ZP proteins, primarily the ZP3 component of PZP, are highly immunogenic in the grey kangaroo and produce a long-lasting humoral response to a single immunisation, as found in other marsupials. Immunisation with 300 microg of a non-glycosylated recombinant brushtail possum ZP3 (recBP-ZP3) protein in complete Freund's adjuvant produced a similar, significant and sustained antibody response, and none of the immunised kangaroos (n=7) produced offspring during the following breeding season compared with four out of the six control animals. An epitope analysis of the B-cell response to recBP-ZP3 using a brushtail possum ZP3 identified numerous B-cell epitope regions clustered around the N- and C-terminal regions of the protein. Two regions of interest for further fertility vaccine development based on their immunogenicity and fertility trials and functional studies in other species were found to be immunogenic. These results suggest that immunocontraception based on targeting the ZP3 protein within the zona pellucida may be an effective strategy for fertility reduction in Eastern Grey kangaroos.

  15. A Reproductive Management Program for an Urban Population of Eastern Grey Kangaroos (Macropus giganteus)

    Science.gov (United States)

    Tribe, Andrew; Hanger, Jon; McDonald, Ian J.; Loader, Jo; Nottidge, Ben J.; McKee, Jeff J.; Phillips, Clive J. C.

    2014-01-01

    Simple Summary We designed a programme to control free-ranging kangaroos on a Queensland golf course, using contraceptive implants in females and vasectomisation or testicle removal in males. This reduced the numbers of pouch young to about one half of pre-intervention levels and controlled the population over a 2–4 year period. However, the necessary darting caused a mortality rate of 5–10% of captured animals, mainly due to complications before and after anaesthesia. It is concluded that population control is possible but careful management of kangaroos around the time of anaesthesia induction and recovery is important in such programmes to minimise losses. Abstract Traditionally, culling has been the expedient, most common, and in many cases, the only tool used to control free-ranging kangaroo populations. We applied a reproductive control program to a population of eastern grey kangaroos confined to a golf course in South East Queensland. The program aimed to reduce fecundity sufficiently for the population to decrease over time so that overgrazing of the fairways and the frequency of human–animal conflict situations were minimised. In 2003, 92% of the female kangaroos above 5 kg bodyweight were implanted with the GnRH agonist deslorelin after darting with a dissociative anaesthetic. In 2007, 86% of the females above 5 kg were implanted with deslorelin and also 87% of the males above 5 kg were sterilised by either orchidectomy or vasectomy. In 2005, 2008 and 2009, the population was censused to assess the effect of each treatment. The 2003 deslorelin program resulted in effective zero population growth for approximately 2.5 years. The combined deslorelin–surgery program in 2007 reduced the birth rate from 0.3 to 0.06%/year for 16 months, resulting in a 27% population reduction by November 2009. The results were consistent with implants conferring contraception to 100% of implanted females for at least 12 months. The iatrogenic mortality rates for each program were 10.5% and 4.9%, respectively, with 50% of all mortalities due to darting-related injuries, exertional myopathy/hyperthermia or recovery misadventure. The short term sexual and agonistic behaviour of the males was assessed for the 2007 program: no significant changes were seen in adult males given the vasectomy procedure, while sexual behaviours’ were decreased in adult males given the orchidectomy procedure. It is concluded that female reproduction was effectively controlled by implantation with deslorrelin and male reproductive behaviour was reduced by orchidectomy, which together achieved population control. PMID:26480325

  16. Plasma endotoxin activity in Eastern grey kangaroos (Macropus giganteus) with lumpy jaw disease.

    Science.gov (United States)

    Sotohira, Yukari; Suzuki, Kazuyuki; Otsuka, Marina; Tsuchiya, Masakazu; Shimamori, Toshio; Nishi, Yasunobu; Tsukano, Kenji; Asakawa, Mitsuhiko

    2017-06-29

    Progressive pyogranulomatous osteomyelitis involving the mandible or maxilla of captive macropods, referred to as "Lumpy jaw disease (LJD)", is one of the most significant causes of illness and death in captive macropods. The aim of the present study was to evaluate the relationship between the severity of LJD and plasma endotoxin activity in kangaroos. Plasma samples obtained from moderate (n=24) and severe LJD (n=12), and healthy kangaroos (n=46), were diluted 1:20 in endotoxin-free water and heated to 80°C for 10 min. Plasma endotoxin activity was measured using the Limulus amebocyte lysate (LAL)-kinetic turbidimetric (KT) assay. Plasma endotoxin activity was higher in kangaroos with severe LJD (0.199 ± 0.157 EU/ml) than in those with moderate LJD (0.051 ± 0.012 EU/ml, P<0.001) and healthy controls (0.057 ± 0.028 EU/ml, P<0.001). Our results suggest that the severity of LJD in captive macropods may be related to the plasma endotoxin activity.

  17. Concrete beams reinforced with Dendrocalamus giganteus bamboo. II: modeling and design criterions

    OpenAIRE

    Lima Júnior, Humberto C.; Willrich, Fábio L.; Fabro, Gilmar

    2005-01-01

    Este trabalho corresponde à segunda parte de uma publicação sobre o comportamento estrutural de vigas de concreto reforçadas com bambu, na qual se apresenta e discute a modelagem dessas estruturas para, em seguida, serem apresentadas sugestões e hipóteses para o dimensionamento desses elementos estruturais. Para tanto, utilizou-se um modelo computacional baseado no Método dos Elementos Finitos, ao qual foram incorporadas sub-rotinas com as leis constitutivas do bambu e do concreto. Para calib...

  18. Kinetics of levulinic acid and furfural production from Miscanthus × giganteus.

    Science.gov (United States)

    Dussan, K; Girisuta, B; Haverty, D; Leahy, J J; Hayes, M H B

    2013-12-01

    This study investigated the kinetics of acid hydrolysis of the cellulose and hemicellulose in Miscanthus to produce levulinic acid and furfural under mild temperature and high acid concentration. Experiments were carried out in an 8L-batch reactor with 9%-wt. biomass loading, acid concentrations between 0.10 and 0.53 M H2SO4, and at temperatures between 150 and 200°C. The concentrations of xylose, glucose, furfural, 5-hydroxymethylfurfural and levulinic acid were used in two mechanistic kinetic models for the prediction of the performance of ideal continuous reactors for the optimisation of levulinic acid and the concurrent production of furfural. A two-stage arrangement was found to maximise furfural in the first reactor (PFR - 185°C, 0.5M H2SO4, 27.3%-mol). A second stage leads to levulinic acid yields between 58% and 72%-mol at temperatures between 160 and 200°C. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. A Reproductive Management Program for an Urban Population of Eastern Grey Kangaroos (Macropus giganteus

    Directory of Open Access Journals (Sweden)

    Andrew Tribe

    2014-09-01

    Full Text Available Traditionally, culling has been the expedient, most common, and in many cases, the only tool used to control free-ranging kangaroo populations. We applied a reproductive control program to a population of eastern grey kangaroos confined to a golf course in South East Queensland. The program aimed to reduce fecundity sufficiently for the population to decrease over time so that overgrazing of the fairways and the frequency of human–animal conflict situations were minimised. In 2003, 92% of the female kangaroos above 5 kg bodyweight were implanted with the GnRH agonist deslorelin after darting with a dissociative anaesthetic. In 2007, 86% of the females above 5 kg were implanted with deslorelin and also 87% of the males above 5 kg were sterilised by either orchidectomy or vasectomy. In 2005, 2008 and 2009, the population was censused to assess the effect of each treatment. The 2003 deslorelin program resulted in effective zero population growth for approximately 2.5 years. The combined deslorelin–surgery program in 2007 reduced the birth rate from 0.3 to 0.06%/year for 16 months, resulting in a 27% population reduction by November 2009. The results were consistent with implants conferring contraception to 100% of implanted females for at least 12 months. The iatrogenic mortality rates for each program were 10.5% and 4.9%, respectively, with 50% of all mortalities due to darting-related injuries, exertional myopathy/hyperthermia or recovery misadventure. The short term sexual and agonistic behaviour of the males was assessed for the 2007 program: no significant changes were seen in adult males given the vasectomy procedure, while sexual behaviours’ were decreased in adult males given the orchidectomy procedure. It is concluded that female reproduction was effectively controlled by implantation with deslorrelin and male reproductive behaviour was reduced by orchidectomy, which together achieved population control.

  20. Terradynamically streamlined shapes in animals and robots enhance traversability through densely cluttered terrain.

    Science.gov (United States)

    Li, Chen; Pullin, Andrew O; Haldane, Duncan W; Lam, Han K; Fearing, Ronald S; Full, Robert J

    2015-06-22

    Many animals, modern aircraft, and underwater vehicles use fusiform, streamlined body shapes that reduce fluid dynamic drag to achieve fast and effective locomotion in air and water. Similarly, numerous small terrestrial animals move through cluttered terrain where three-dimensional, multi-component obstacles like grass, shrubs, vines, and leaf litter also resist motion, but it is unknown whether their body shape plays a major role in traversal. Few ground vehicles or terrestrial robots have used body shape to more effectively traverse environments such as cluttered terrain. Here, we challenged forest-floor-dwelling discoid cockroaches (Blaberus discoidalis) possessing a thin, rounded body to traverse tall, narrowly spaced, vertical, grass-like compliant beams. Animals displayed high traversal performance (79 ± 12% probability and 3.4 ± 0.7 s time). Although we observed diverse obstacle traversal strategies, cockroaches primarily (48 ± 9% probability) used a novel roll maneuver, a form of natural parkour, allowing them to rapidly traverse obstacle gaps narrower than half their body width (2.0 ± 0.5 s traversal time). Reduction of body roundness by addition of artificial shells nearly inhibited roll maneuvers and decreased traversal performance. Inspired by this discovery, we added a thin, rounded exoskeletal shell to a legged robot with a nearly cuboidal body, common to many existing terrestrial robots. Without adding sensory feedback or changing the open-loop control, the rounded shell enabled the robot to traverse beam obstacles with gaps narrower than shell width via body roll. Such terradynamically 'streamlined' shapes can reduce terrain resistance and enhance traversability by assisting effective body reorientation via distributed mechanical feedback. Our findings highlight the need to consider body shape to improve robot mobility in real-world terrain often filled with clutter, and to develop better locomotor-ground contact models to understand

  1. Modelling active antennal movements of the American cockroach

    DEFF Research Database (Denmark)

    Pequeno-Zurro, Alejandro; Nitschke, Jahn; Szyszka, Paul

    2017-01-01

    and the spatial properties of encountered odorant concentrations. Video recordings reveal that the animal’s antennae exhibit systematic movements in the presence of behaviourally relevant odorants. We hypothesise a dynamic coupling between the left and right antenna modulated by odour stimulation. To test this we...

  2. Activity of boric acid on German cockroaches: Analysis of residues ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-02-18

    Feb 18, 2009 ... mance and its economic and medical importance. (Gordon, 1996; Grandcolas, 1998). Thus, many conventional pesticides have been replaced by newer biorational or low risk insecticides with novel mode of action like insect growth regulators and biopesticides (Horowitz and Ishaaya, 2002; Dhadialla et.

  3. Parasites of Periplaneta americana linnaeus "domestic cockroach" from Ica.

    Directory of Open Access Journals (Sweden)

    Mary Fernádez B.

    2014-06-01

    Full Text Available 244 specimens of Periplaneta americana Linnaeus from 13 localities of Ica were studied. Nematodes and protozoa were identified. They are Lophomonas blattarum, Leptomonas sp., Leidynema appendiculatum and Hammerschmidtiella diesingi. Also, parasites of man were found, three of which are pathogenic: Giardia lamblia, Blastocystis hominis and Cryptosporidium sp.

  4. Vigas de concreto reforçadas com bambu Dendrocalamus giganteus. II: modelagem e critérios de dimensionamento Concrete beams reinforced with Dendrocalamus giganteus bamboo. II: modeling and design criterions

    Directory of Open Access Journals (Sweden)

    Humberto C. Lima Júnior

    2005-12-01

    Full Text Available Este trabalho corresponde à segunda parte de uma publicação sobre o comportamento estrutural de vigas de concreto reforçadas com bambu, na qual se apresenta e discute a modelagem dessas estruturas para, em seguida, serem apresentadas sugestões e hipóteses para o dimensionamento desses elementos estruturais. Para tanto, utilizou-se um modelo computacional baseado no Método dos Elementos Finitos, ao qual foram incorporadas sub-rotinas com as leis constitutivas do bambu e do concreto. Para calibração do modelo lançou-se mão dos dados experimentais de oito vigas de concreto reforçadas com bambu. Os resultados obtidos com o modelo computacional foram comparados com os experimentais, observando-se grande concordância. Finalmente, sugerem-se critérios de dimensionamento, os quais foram aplicados em um exemplo prático.This paper corresponds to the second part of a publication concerning the structural behaviour of concrete beams reinforced with bamboo. Modelling of concrete beams reinforced with bamboo-splint are presented and discussed. In addition, some design suggestions and hypotheses are presented. To perform the study, a Finite Element Program was used and some procedures were programmed and linked to it. The program was calibrated with the experimental data of eight concrete beams reinforced with bamboo-splint, whose results presented great accuracy. Finally, some design procedures were suggested and a practical example is given.

  5. Collection and short-term preservation of semen from free-ranging eastern grey kangaroos (Macropus giganteus: Macropodidae).

    Science.gov (United States)

    Johnston, S D; Blyde, D; Gamble, J; Higgins, D; Field, H; Cooper, J

    1997-09-01

    To evaluate electro-ejaculation of free-range eastern grey kangaroos in the field and assess the efficacy of four diluents to preserve sperm motility over a 48-h period at 5 degrees C. PROCEDURE AND DESIGN: Under gaseous anaesthesia, 25 free-range kangaroos were electro-ejaculated and characteristics of the ejaculate noted. Spermatozoa obtained from eight ejaculates were diluted in phosphate buffered saline containing various combinations of egg yolk and glucose and refrigerated at 5 degrees C for 48 h. Spermatozoa were recovered from 24 of 28 ejaculates. Mean (+/- SEM) semen volume (mL) and pH were 25.0 +/- 1.9 and 7.1 +/- 0.1 respectively. The forward motility (%), rate of movement of sperm (0 to 5) and sperm concentration (x 10(6)/mL) were 77.4 +/- 1.5, 3.8 +/- 0.9 and 31.2 +/- 7.3 respectively. There was no significant difference between the four diluents in their ability to maintain forward motility of spermatozoa over 48 h. However, rate of movement over the same period was significantly (P kangaroos. Preliminary attempts at short-term preservation showed that the motility of kangaroo spermatozoa could be adequately stored for 24 h and that the addition of egg yolk to the semen diluent was beneficial for improving the rate of sperm movement.

  6. The Effects of Land-Use Change from Grassland to Miscanthus x giganteus on Soil N2O Emissions

    Directory of Open Access Journals (Sweden)

    Michael Williams

    2013-09-01

    Full Text Available A one year field trial was carried out on three adjacent unfertilised plots; an 18 year old grassland, a 14 year old established Miscanthus crop, and a 7 month old newly planted Miscanthus crop. Measurements of N2O, soil temperature, water filled pore space (WFPS, and inorganic nitrogen concentrations, were made every one to two weeks. Soil temperature, WFPS and NO3− and NH4+ concentrations were all found to be significantly affected by land use. Temporal crop effects were also observed in soil inorganic nitrogen dynamics, due in part to C4 litter incorporation into the soil under Miscanthus. Nonetheless, soil N2O fluxes were not significantly affected by land use. Cumulative yearly N2O fluxes were relatively low, 216 ± 163, 613 ± 294, and 377 ± 132 g·N·ha−1·yr−1 from the grassland, newly planted Miscanthus, and established Miscanthus plots respectively, and fell within the range commonly observed for unfertilised grasslands dominated by perennial ryegrass (Lolium perenne. Higher mean cumulative fluxes were measured in the newly planted Miscanthus, which may be linked to a possible unobserved increase immediately after establishment. However, these differences were not statistically significant. Based on the results of this experiment, land-use change from grassland to Miscanthus will have a neutral impact on medium to long-term N2O emissions.

  7. Vigas de concreto reforçadas com bambu Dendrocalamus giganteus. II: modelagem e critérios de dimensionamento

    OpenAIRE

    Lima Júnior,Humberto C.; Willrich,Fábio L.; Fabro,Gilmar

    2005-01-01

    Este trabalho corresponde à segunda parte de uma publicação sobre o comportamento estrutural de vigas de concreto reforçadas com bambu, na qual se apresenta e discute a modelagem dessas estruturas para, em seguida, serem apresentadas sugestões e hipóteses para o dimensionamento desses elementos estruturais. Para tanto, utilizou-se um modelo computacional baseado no Método dos Elementos Finitos, ao qual foram incorporadas sub-rotinas com as leis constitutivas do bambu e do concreto. Para calib...

  8. Cross-reactive IgE antibody responses to tropomyosins from Ascaris lumbricoides and cockroach

    NARCIS (Netherlands)

    Santos, Ana Beatriz R.; Rocha, Gutemberg M.; Oliver, Constance; Ferriani, Virgínia P. L.; Lima, Rodrigo C.; Palma, Mário S.; Sales, Valéria S. F.; Aalberse, Rob C.; Chapman, Martin D.; Arruda, L. Karla

    2008-01-01

    Evidence indicates that infection with Ascaris lumbricoides may promote development of allergy and asthma. To study the role of tropomyosin, a pan-allergen in invertebrates, in IgE responses to A lumbricoides. Recombinant A lumbricoides and Periplaneta americana tropomyosins were expressed in Pichia

  9. Tissue damage after acute intoxication by polychlorinated biphenyls (PCBs in cockroaches Blattella germanica

    Directory of Open Access Journals (Sweden)

    S Lambiase

    2009-06-01

    Full Text Available It is common knowledge that polychlorinated biphenyls (PCBs represent a serious threat to the health of both vertebrates and invertebrates. As far as the former are concerned, especially as regards human beings, a broad literature describes the direct and indirect effects induced by the PCBs on their systems and organs. Among invertebrates, the information available is mostly related to arthropods and is, however, very scarce. The aim of this work was to evaluate the effects of polychlorinated biphenyls (PCBs on tissues and organs of individuals belonging to a species of Blattaria (Blattella germanica treated with various doses of this toxic material. The pathologies found became more serious as the dosage increased and were present throughout the entire digestive system, in the fat body and in the male gonads: in these areas cell and tissue breakdown and severely damaged spermiogenesis were observed. In particular, the testicles, Malpighian tubules and fat body accumulated an amorphous basophilic PAS-positive substance. Furthermore, the NOS-dependent NADPH diaphorase activity pattern in the retina and optic lobes was more evident in the treated than in the control insects.

  10. Rats, cockroaches and people like us : views of humanity and human right

    NARCIS (Netherlands)

    G. ter Haar

    2000-01-01

    textabstractMany people appear to believe that there are a growing number of religious conflicts in the world, particularly since the end of the Cold War. On closer examination, however, it seems that the number of conflicts of the type which are today often labelled 'ethnic' or' 'religious' has in

  11. Peptidase inhibitors from the salivary glands of the cockroach Nauphoeta cinerea

    Czech Academy of Sciences Publication Activity Database

    Taranushenko, Yuliya; Vinokurov, Konstantin; Kludkiewicz, Barbara; Kodrík, Dalibor; Sehnal, František

    2009-01-01

    Roč. 39, č. 12 (2009), s. 920-930 ISSN 0965-1748 R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50070508 Keywords : kazal inhibitors * subtilisin * proteinase K Subject RIV: CE - Biochemistry Impact factor: 3.117, year: 2009

  12. The Use of Genetic Mechanisms and Behavioral Characteristics to Control Natural Populations of the German Cockroach.

    Science.gov (United States)

    1982-03-01

    supported by this Contract, Brian L. Bret (M.S. thesis research, directed by M. H. Ross). The experiment was conducted in glass acquaria measuring 32 cm x 22...harborages were supplied for each replicate. The acquaria were washed thoroughly after each use. -2- The statistical analysis was done with the help of Dr...corner of the acquaria or in cracks betweenthe shelters. However, within the shelter, their aggregation was clearly related to that of other components

  13. Adipokinetic hormones control amylase activity in the cockroach (Periplaneta americana) gut

    Czech Academy of Sciences Publication Activity Database

    Bodláková, K.; Jedlička, Pavel; Kodrík, Dalibor

    2017-01-01

    Roč. 24, č. 2 (2017), s. 259-269 ISSN 1672-9609 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : AKH * AKH receptor * amylase * enzyme * gene expression * midgut Subject RIV: ED - Physiology OBOR OECD: Entomology; Biochemistry and molecular biology (BC-A) Impact factor: 2.026, year: 2016

  14. Regulation of the corpora allata in male larvae of the cockroach Diploptera punctata

    Energy Technology Data Exchange (ETDEWEB)

    Paulson, C.R.

    1986-01-01

    The regulation of corpora allata was studied in final instar males of Diploptera punctata. The glands were manipulated in vivo and removed to determine the effect by in vitro radiochemical assay for juvenile hormone synthesis. Corpora allata were also treated with putative regulatory factors in vitro. During the final stadium the corpora allata were inhibited both by nerves and by humoral factors. Neural inhibition was shown by an increase in juvenile hormone synthesis following denervation of the corpora allata. This operation elicited an extra larval instar. Humoral inhibition was shown by the decline in juvenile hormone synthesis of adult female corpora allata following transplantation into final instar larval hosts, and conversely the increase in juvenile hormone synthesis by larval corpora allata following implantation into adult females. Humoral inhibition was prevented by decapitation of larvae prior to the head critical period for molting and restored by implantation of a larval brain, showing that the brain is the source of this inhibition.

  15. Cockroaches as pollinators of Clusia aff. sellowiana (Clusiaceae) on inselbergs in French Guiana

    Czech Academy of Sciences Publication Activity Database

    Vlasáková, B.; Kalinová, Blanka; Gustafsson, M. H. G.; Teichert, H.

    2008-01-01

    Roč. 102, č. 3 (2008), s. 295-304 ISSN 0305-7364 Grant - others:GA ČR(CZ) GD206/03/H137 Program:GD Institutional research plan: CEZ:AV0Z40550506 Keywords : insect-plant pollination * plant volatiles * cochroach sex pheromones Subject RIV: EF - Botanics Impact factor: 2.755, year: 2008

  16. Further studies on the multiple effects of carbon dioxide anesthesia in the German cockroach, Blattella germanica

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, A.

    Effects of repeated carbon dioxide anesthesia during particular instars on the number of molts, larval duration and the body size of resulting adults were investigated. Concentration of carbon dioxide administered was 70%, and each anesthesia lasted for 5 min. Anesthesia was repeated four times during a particular instar. Anesthesia administered during the 1st, 2nd, or 3rd instar increased the number of instars required to reach maturity. When larvae were anesthetized during both the 1st and 2nd instar, the number of instars was greatly increased. However, anesthesia during the 4th instar scarcely influenced the number of instars. On the other hand, repeated anesthesia prolonged larval duration whenever administered from the 1st instar through the 4th. The body size of resulting adults remained almost the same as that for controls after the repeated carbon dioxide anesthesia during larval life. Detailed analyses of adult sizes, however, revealed that tibia length was more affected with the gas than femur length. The ratio of tibia length to femur length was also influenced by the experience of extra molt(s).

  17. Proteinase, amylase, and proteinase-inhibitor activities in the gut of six cockroach species

    Czech Academy of Sciences Publication Activity Database

    Vinokurov, Konstantin; Taranushenko, Yuliya; Krishnan, Natraj; Sehnal, František

    2007-01-01

    Roč. 53, - (2007), s. 794-802 ISSN 0022-1910 R&D Projects: GA ČR(CZ) GA522/06/1591; GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50070508 Keywords : amylases * Blattodea * gut pH Subject RIV: CE - Biochemistry Impact factor: 2.294, year: 2007

  18. Think Like a Cockroach: How I Survived an Extinction Event in Biological Research

    Energy Technology Data Exchange (ETDEWEB)

    Wiley, H. S.

    2008-02-01

    Some young biologists might think that getting NIH funding has never been harder than it is now, but those of us who have been around for a while can remember a period in the early 90’s when NIH funding seemed to all but disappear. I’m talking 7% paylines at some institutions. I went through a period where I submitted 12 unsuccessful proposals in a row. Somehow I survived along with many of my colleagues, so excuse me if I don’t quite feel yet that the apocalypse is upon us. At the time, however, many of us felt exactly that way. We called the dramatic drop in funding “the asteroid strike”, in honor of the recently discovered impact site of the asteroid thought to be responsible for the extinction of the dinosaurs at the end of the Cretaceous period.

  19. Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis

    OpenAIRE

    Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang

    2016-01-01

    Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained fro...

  20. Isolation and Purification of an Antibacterial Protein from Immune Induced Haemolymph of American Cockroach, Periplaneta americana

    OpenAIRE

    Hamid Reza Basseri; Amir Dadi-Khoeni; Ronak Bakhtiari; Mandan Abolhassani; Reza Hajihosseini-Baghdadabadi

    2016-01-01

    Background: Antimicrobial peptides play a role as effectors substances in the immunity of vertebrate and inverte­brate hosts. In the current study, antimicrobial peptide was isolated from the haemolymph of the American cock­roach, Periplaneta americana.Methods: Micrococcus luteus as Gram-positive bacteria and Escherichia coli as Gram-negative bacteria were candi­date for injection. Induction was done by injecting both bacteria into the abdominal cavity of two groups of cock­roaches separately...

  1. Regulation of the corpora allata in male larvae of the cockroach Diploptera punctata

    International Nuclear Information System (INIS)

    Paulson, C.R.

    1986-01-01

    The regulation of corpora allata was studied in final instar males of Diploptera punctata. The glands were manipulated in vivo and removed to determine the effect by in vitro radiochemical assay for juvenile hormone synthesis. Corpora allata were also treated with putative regulatory factors in vitro. During the final stadium the corpora allata were inhibited both by nerves and by humoral factors. Neural inhibition was shown by an increase in juvenile hormone synthesis following denervation of the corpora allata. This operation elicited an extra larval instar. Humoral inhibition was shown by the decline in juvenile hormone synthesis of adult female corpora allata following transplantation into final instar larval hosts, and conversely the increase in juvenile hormone synthesis by larval corpora allata following implantation into adult females. Humoral inhibition was prevented by decapitation of larvae prior to the head critical period for molting and restored by implantation of a larval brain, showing that the brain is the source of this inhibition

  2. The Madagascar Hissing Cockroach: A New Model for Learning Insect Anatomy

    Science.gov (United States)

    Heyborne, William H.; Fast, Maggie; Goodding, Daniel D.

    2012-01-01

    Teaching and learning animal anatomy has a long history in the biology classroom. As in many fields of biology, decades of experience teaching anatomy have led to the unofficial selection of model species. However, in some cases the model may not be the best choice for our students. Our struggle to find an appropriate model for teaching and…

  3. Immunochemical detection of the crustacean cardioactive peptide in the cephalic ganglia cockroaches (Blattodea: Blattidae)

    Czech Academy of Sciences Publication Activity Database

    Gladysz, M.; Guzik, J.; Sehadová, Hana; Baran, B.; Bembenek, J.; Dolezych, B.

    2015-01-01

    Roč. 112, č. 2 (2015), s. 235-244 ISSN 1210-5759 Institutional support: RVO:60077344 Keywords : Blattodea * Periplaneta americana * Gromphadorhina portentosa Subject RIV: ED - Physiology Impact factor: 0.975, year: 2014 http://www.eje.cz/corproof.php?tartkey=eje-000000-0111#.VRVB0PmG8mM

  4. Can the exceptional chilling tolerance of C4 photosynthesis found in Miscanthus × giganteus be exceeded? Screening of a novel Miscanthus Japanese germplasm collection

    DEFF Research Database (Denmark)

    Glowacka, Katarzyna; Jørgensen, Uffe; Kjeldsen, Jens Bonderup

    2015-01-01

    of this study was to search for genotypes with greater potential than Mxg for photosynthesis and frost survival under these conditions. Methods A total of 864 accessions representing 164 local populations of M. sacchariflorus (Msa), M. sinensis (Msi) and M. tinctorius (Mti) collected across Japan were studied...

  5. Reconstructing temporal variation of fluoride uptake in eastern grey kangaroos (Macropus giganteus) from a high-fluoride area by analysis of fluoride distribution in dentine.

    Science.gov (United States)

    Kierdorf, Horst; Rhede, Dieter; Death, Clare; Hufschmid, Jasmin; Kierdorf, Uwe

    2016-04-01

    Trace element profiling in the incrementally formed dentine of mammalian teeth can be applied to reconstruct temporal variation of incorporation of these elements into the tissue. Using an electron microprobe, this study analysed fluoride distribution in dentine of first and third mandibular molars of free-ranging eastern grey kangaroos inhabiting a high-fluoride area, to assess temporal variation in fluoride uptake of the animals. Fluoride content in the early-formed dentine of first molars was significantly lower than in the late-formed dentine of these teeth, and was also lower than in both, the early and the late-formed dentine of third molars. As early dentine formation in M1 takes place prior to weaning, this finding indicates a lower dentinal fluoride uptake during the pre-weaning compared to the post-weaning period. This is hypothetically attributed to the action of a partial barrier to fluoride transfer from blood to milk in lactating females and a low bioavailability of fluoride ingested together with milk. Another factor contributing to lower plasma fluoride levels in juveniles compared to adults is the rapid clearance of fluoride from blood plasma in the former due to their intense skeletal growth. The combined action of these mechanisms is considered to explain why in kangaroos from high-fluoride areas, the (early-formed) first molars are not affected by dental fluorosis while the (later-formed) third and fourth molars regularly exhibit marked to severe fluorotic lesions. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Erythrocyte osmotic fragility of red (Macropus rufus) and grey (Macropus fuliginosus and Macropus giganteus) kangaroos and free-ranging sheep of the arid regions of Australia.

    Science.gov (United States)

    Buffenstein, R; McCarron, H C; Dawson, T J

    2001-02-01

    The mean corpuscular fragility (MCF) of erythrocytes may reflect phylogenetic characteristics as well as an animal's ability to respond to the osmotic challenges associated with cyclic dehydration and rehydration. This type of ecophysiological stress is commonly encountered by animals living in arid regions and low MCF may contribute to their ability to survive and thrive in these xeric habitats. The eastern grey kangaroo has only in recent times extended its range into the arid zone, and is considered a more mesic inhabitant than the red kangaroo. We therefore compared the ability of eastern grey kangaroos and red kangaroos to handle prolonged periods of water restriction, as well as the MCF of the erythrocytes of free-ranging red, eastern grey and western grey kangaroos found at the Fowlers Gap field station. In addition, the MCF of free-ranging sheep inhabiting the same pastures were used as an experimental control; they are phylogenetically unrelated yet are subjected to the same acclimatisation stresses. While red kangaroos exhibited greater tolerance of dehydration compared to eastern grey kangaroos, the MCF of all three kangaroo species was similar and more resilient to osmotic stresses (MCF, 130 mosmol/kg) than erythrocytes of sheep (MCF, 220 mosmol/kg). The MCF did not change with water restriction, however, the erythrocytes of long-term captive populations fed a comparatively better quality diet were more resistant to osmotic shock than the free-ranging animals. Phylogenetic commonality rather than ecophysiological responses to life in the arid zone appeared to influence MCF. The MCF values of sheep corresponded to that of other ovines; similarly the MCF of kangaroos concurred regardless of their preferred habitats. ecological history and differential success in the arid zone.

  7. Unilateral failure of development of mandibular premolars and molars in an Eastern Grey kangaroo (Macropus giganteus) and its effects on molar progression.

    Science.gov (United States)

    Barber, D; Campbell, J; Davey, J; Luke, T; Agren, E; Beveridge, I

    2008-01-01

    An adult male Eastern Grey kangaroo from a wildlife reserve near Melbourne was submitted for necropsy examination and was discovered to have abnormal dentition. There was no evidence that any premolars or molars had ever been present on the right mandible, whilst the incisors were normal. The age of the kangaroo was estimated to be 1 year 9 months using the right maxillary molars and 2 years 4 months old using the contralateral side, presumably due to the asymmetry of the dental arcades. 'Lumpy jaw', a common periodontal disease of kangaroos, from which Bacteroides sp was cultured, was present on the base of the vertical ramus of the left mandible. Complete unilateral absence of premolar and molar teeth in the mandible of a kangaroo has not been described. This condition affected molar progression in both sets of maxillary molars.

  8. Combined effects of fungal inoculants and the cytokinin-like growth regulator thidiazuron on growth, phytohormone contents and endophytic root fungi in Miscanthus × giganteus

    Czech Academy of Sciences Publication Activity Database

    Schmidt, Christoph Stephan; Mrnka, Libor; Frantík, Tomáš; Motyka, Václav; Dobrev, Petre; Vosátka, Miroslav

    2017-01-01

    Roč. 120, č. 9 (2017), s. 120-131 ISSN 0981-9428 R&D Projects: GA TA ČR TE01020080; GA ČR(CZ) GA16-14649S Institutional support: RVO:67985939 Keywords : Miscanthus * symbiotic fungi * phytohormones Subject RIV: EF - Botanics; EB - Genetics ; Molecular Biology (UEB-Q) OBOR OECD: Plant sciences, botany; Biochemistry and molecular biology (UEB-Q) Impact factor: 2.724, year: 2016

  9. An integrated neuromechanical model of insect locomotion

    Science.gov (United States)

    Kukillaya, Raghavendra

    We develop a biologically-plausible feedforward neuromechanical model for running insects that includes a simplified hexapedal leg geometry with agonist-antagonist muscle pairs actuating each leg joint. It is driven by a neural network modeling the central pattern generator (CPG) and the motoneurons which activate the muscles. This final goal is achieved in three stages. First, a relatively simple mechanical hexapedal model is constructed in which the joint torques are produced via actuated linear torsional springs with constant stiffness. In the second stage, this system is upgraded to a muscle-actuated hexapedal model in which each joint is actuated by a pair of agonist-antagonist Hill-type muscles. Muscles are driven by stylized action potentials that are characteristic of fast motoneurons, and modeled using an activation function and nonlinear length and shortening velocity dependence. In the final stage, the full neuromechanical model is obtained by integrating the above muscle-actuated hexapedal model with a CPG-motoneuron complex, feedforward input to the muscles now being supplied by action potentials from motoneurons. Restricting to dynamics in the horizontal plane and neglecting leg masses, we reduce the model (at each stage) to three degrees of freedom describing translational and yawing motions of the body. Collectively for all the models, parameter values are based on measurements from depressor motoneurons and muscles, and observations of kinematics and dynamics of the cockroach Blaberus discoidalis. Specifically, actuation inputs for the mechanical and muscle-actuated models are chosen to approximately achieve joint torques that are consistent with measured ground reaction forces. This is done by optimizing the time-dependent torque-free joint angles in the first model, and by optimizing motoneuronal outputs and muscle force levels in the second and third models. We show that the model (at each stage) has stable double-tripod gaits over the animal

  10. An investigation into the chemical composition of alternative invertebrate prey

    NARCIS (Netherlands)

    Oonincx, D.G.A.B.; Dierenfeld, E.S.

    2012-01-01

    The aim of this study was to determine the chemical composition of eight invertebrate species and evaluate their suitability as alternative prey. The species selected were rusty red cockroaches (Blatta lateralis), six-spotted cockroaches (Eublaberus distanti), Madagascar hissing cockroaches

  11. Standard metabolic rate is associated with gestation duration, but not clutch size, in speckled cockroaches Nauphoeta cinerea

    OpenAIRE

    Schimpf, Natalie G.; Matthews, Philip G. D.; White, Craig R.

    2012-01-01

    Summary Metabolic rate varies significantly between individuals, and these differences persist even when the wide range of biotic and abiotic factors that influence metabolism are accounted for. It is important to understand the life history implications of variation in metabolic rate, but they remain poorly characterised despite a growing body of work examining relationships between metabolism and a range of traits. In the present study we used laboratory-bred families (one sire to three ...

  12. Density dependence in flower visitation rates of cockroach-pollinated Clusia blattophila on the Nouragues inselberg, French Guiana

    Czech Academy of Sciences Publication Activity Database

    Vlasáková, Blanka

    2015-01-01

    Roč. 31, Part 1 (2015), s. 95-98 ISSN 0266-4674 R&D Projects: GA ČR GPP505/12/P039 Institutional support: RVO:67985939 Keywords : Clusia * ockroach * density dependence Subject RIV: EF - Botanics Impact factor: 0.975, year: 2015

  13. A New Approach for the Control of Cockroaches Utilizing the Entomophilic Nematode DD-136 in Conjunction with Attractants.

    Science.gov (United States)

    1981-10-01

    Ethanol 2 0.5 Caprylic Acid Ethanol 2 0.5 Myristic Acid Ethanol 2 0.5 Lauric Acid Ethanol 2 0.5 Palmitic Acid Ethanol 2 0.5 Stearic Acid Ethanol < 1...more response: oleyl alcohol, palmitic acid and an ethanol extract of finigreek seed. Of interest was the difference in response to oleyl alcohol and...oleic acid , which are quite similar in structure--the alcohol form being first in attraction in this .test, whereas the acid form ranked next to last

  14. Chilling-injury and disturbance of ion homeostasis in the coxal muscle of the tropical cockroach (Nauphoeta cinerea)

    Czech Academy of Sciences Publication Activity Database

    Košťál, Vladimír; Yanagimoto, M.; Bastl, J.

    2006-01-01

    Roč. 143, č. 2 (2006), s. 171-179 ISSN 1096-4959 R&D Projects: GA ČR(CZ) GA206/03/0099 Institutional research plan: CEZ:AV0Z50070508 Keywords : chill tolerance * cold-acclimation * ion gradients Subject RIV: ED - Physiology Impact factor: 1.532, year: 2006

  15. New record of the cockroach genus Pseudophoraspis (Blaberidae, Epilamprinae from China with descriptions of three new species

    Directory of Open Access Journals (Sweden)

    Zongqing Wang

    2013-02-01

    Full Text Available ThegenusPseudophoraspisKirby,1903withthree newspecies, Pseudophoraspis clavellata sp. n., Pseudophoraspis recurvata sp. n. and Pseudophoraspis incurvata sp. n.,arereportedfromChina forthefirsttime.This extends the range of this genus northward from Vietnam. Species studied in the present paper are illustrated and described, and a key to these species based on males is provided.

  16. Identification of the cockroach neuropeptide Pea-CAH-II as a second adipokinetic hormone in the firebug Pyrrhocoris apterus

    Czech Academy of Sciences Publication Activity Database

    Kodrík, Dalibor; Šimek, Petr; Lepša, L.; Socha, Radomír

    2002-01-01

    Roč. 23, č. 23 (2002), s. 585-587 ISSN 0196-9781 R&D Projects: GA MŠk ME 417; GA ČR GA206/99/0068 Institutional research plan: CEZ:AV0Z5007907 Keywords : bug * electrospray mass spectrometry Subject RIV: CE - Biochemistry Impact factor: 2.635, year: 2002

  17. Venom and Dufour's glands of the emerald cockroach wasp Ampulex compressa (Insecta, Hymenoptera, Sphecidae): structural and biochemical aspects.

    Science.gov (United States)

    Gnatzy, Werner; Michels, Jan; Volknandt, Walter; Goller, Stephan; Schulz, Stefan

    2015-09-01

    The digger wasp species Ampulex compressa produces its venom in two branched gland tubules. They terminate in a short common duct, which is bifurcated at its proximal end. One leg is linked with the venom reservoir, the other one extends to the ductus venatus. Each venom gland tubule possesses, over its entire length, a cuticle-lined central duct. Around this duct densely packed class 3 gland units each composed of a secretory cell and a canal cell are arranged. The position of their nuclei was demonstrated by DAPI staining. The brush border of the secretory cells surrounds the coiled end-apparatus. Venom is stored in a bladder like reservoir, which is surrounded by a thin reticulated layer of muscle fibres. The reservoir as a whole is lined with class 3 gland units. The tubiform Dufour's gland has a length of about 350 μm (∅ 125 μm) only and is surrounded by a network of pronounced striated muscle fibres. The glandular epithelium is mono-layered belonging to the class 1 type of insect epidermal glands. The gland cells are characterized by conspicuous lipid vesicles. Secretion of material via the gland cuticle into the gland lumen is apparent. Analysis of the polypeptide composition demonstrated that the free gland tubules and the venom reservoir contain numerous proteins ranging from 3.4 to 200 kDa. The polypeptide composition of the Dufour's gland is completely different and contains no lectin-binding glycoproteins, whereas a dominant component of the venom droplets is a glycoprotein of about 80 kDa. Comparison of the venom reservoir contents with the polypeptide pattern of venom droplets revealed that all of the major proteinaceous constituents are secreted. The secreted venom contains exclusively proteins present in the soluble contents of the venom gland. The most abundant compound class in the Dufour's gland consisted of n-alkanes followed by monomethyl-branched alkanes and alkadienes. Heptacosane was the most abundant n-alkane. Furthermore, a single volatile compound, 2-methylpentan-3-one, was identified in various concentrations in the lipid extract of the Dufour's gland. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. A New Approach for the Control of Cockroaches Utilizing the Entomophilic Nematode DD-136 in Conjunction with Attractants.

    Science.gov (United States)

    1982-08-01

    or products of fermentation (Dethier 1947; Tsuji 1965, 1966). Prevalent among the compounds named by these authors are fatty acids, esters, and...Coackroaches in a typewritig room. Jap. Jour. Sanit. Zool. 12:118. - 19- Ogata, K. and M. Mihara, 1962. Observations on the so called " butter trap" in

  19. Seasonal variation in stomach contents and diet composition in the ...

    African Journals Online (AJOL)

    Seasonal variation in stomach contents and diet composition in the large girdled lizard, Cordylus giganteus (Reptilia: Cordylidae) in the Highveld grasslands of the northeastern Free State, South Africa.

  20. Anti-inflammatory and analgesic activities: Chemical constituents of ...

    African Journals Online (AJOL)

    Anti-inflammatory and analgesic activities: Chemical constituents of essential oils of Ocimum gratissimum , Eucalyptus citriodora and Cymbopogon giganteus inhibited lipoxygenase L-1 and cyclooxygenase of PGHS.

  1. Medicinal formulations of a Kanda tribal healer – a tribe on the verge ...

    African Journals Online (AJOL)

    Besides medicinal plants, the Kanda healer also used the body hairs of the Asiatic black bear (Ursus thibetanus) and bats (Pteropus giganteus giganteus) in one of his formulation for treatment of fever with shivering. The ailments treated by the Kanda healer were fairly common ailments like cuts and wounds, skin diseases, ...

  2. Emergence, development, and maturity of the gonad of two species of chitons "sea cockroach" (Mollusca: Polyplacophora through the early life stages.

    Directory of Open Access Journals (Sweden)

    Omar Hernando Avila-Poveda

    Full Text Available This study describes and recognises, using histological and microscopical examinations on a morphometrical basis, several gonad traits through the early life stages of Chiton articulatus and C. albolineatus. Gonadal ontogenesis, gonad development stages, sexual differentiation, onset of the first sexual maturity, and growth sequences or "early life stages" were determined. In addition, allometry between lengths and body weight pooled for both sexes per each chiton were calculated using equation Y = aX(b . A total of 125 chitons (4≤TL≤40 mm, in total length "TL" were used. All allometric relations showed a strong positive correlation (r, close to 1, with b-values above three, indicating an isometric growth. Gonadal ontogenesis and gonad development stages were categorised into three periods ("Pw" without gonad, "Pe" gonad emergence, and "Pf" gonadal sac formed and four stages ("S0" gametocytogenesis, "S1" gametogenesis, "S2" mature, and "S3" spawning, respectively. Compound digital images were attained for each process. Periods and stages are overlapped among them and between species, with the following overall confidence intervals in TL: Pw 6.13-14.32 mm, Pe 10.32-16.93 mm, Pf 12.99-25.01 mm, S0 16.08-24.34 mm (females and 19.51-26.60 mm (males, S1 27.15-35.63 mm (females and 23.45-32.27 mm (males, S2 24.48-40.24 mm (females and 25.45-32.87 mm (males. Sexual differentiation (in S0 of both chitons occurs first as a female then as a male; although, males reach the onset of the first sexual maturity earlier than females, thus for C. articulatus males at 17 mm and females at 32 mm, and for C. albolineatus males at 23.5 mm and females at 28 mm, all in TL. Four early life stages (i.e., subjuvenile, juvenile, subadult, and adult are described and proposed to distinguish growth sequences. Our results may be useful to diverse disciplines, from developmental biology to fisheries management.

  3. Distinct localization of FMRFamide- and bovine pancreatic polypeptide-like material in the brain, retrocerebral complex and suboesophageal ganglion of the cockroach Periplaneta americana L

    DEFF Research Database (Denmark)

    Verhaert, P; Grimmelikhuijzen, C J; De Loof, A

    1985-01-01

    One bovine pancreatic polypeptide (BPP) antiserum and two FMRFamide antisera were applied in the peroxidase-antiperoxidase (PAP) immunohistochemical technique on a complete series of sections of brains, suboesophageal ganglia (SOG), corpora cardiaca (CC) and corpora allata of Periplaneta american...

  4. Enterobactérias isoladas de baratas (Periplaneta americana) capturadas em um hospital brasileiro Enterobacteria isolated from cockroaches (Periplaneta americana) captured in a Brazilian hospital

    OpenAIRE

    Marinésia A. Prado; Fabiana C. Pimenta; Miyeko Hayashid; Paula R. Souza; Milca S. Pereira; Elucir Gir

    2002-01-01

    Objetivo. Isolar e identificar microrganismos em baratas capturadas em um hospital público e determinar o seu perfil de suscetibilidade antimicrobiana. Métodos. As baratas foram capturadas nos períodos matutino e noturno, colocadas em frascos desinfetados com álcool a 70%, transferidas para um frasco estéril e levadas ao laboratório. Consideraram-se as baratas íntegras e vivas, as quais foram colocadas em solução salina estéril (0,8%) e homogeneizadas. Essa solução foi semeada nos meios de cu...

  5. Crystal Structure of Cockroach Allergen Bla g 2, an Unusual Zinc Binding Aspartic Protease with a Novel Mode of Self-inhibition

    Energy Technology Data Exchange (ETDEWEB)

    Gustchina, Alla; Li, Mi; Wunschmann, Sabina; Chapman, Martin D.; Pomes, Anna; Wlodawer, Alexander (INDOOR Bio.); (NIH)

    2010-07-19

    The crystal structure of Bla g 2 was solved in order to investigate the structural basis for the allergenic properties of this unusual protein. This is the first structure of an aspartic protease in which conserved glycine residues, in two canonical DTG triads, are substituted by different amino acid residues. Another unprecedented feature revealed by the structure is the single phenylalanine residue insertion on the tip of the flap, with the side-chain occupying the S1 binding pocket. This and other important amino acid substitutions in the active site region of Bla g 2 modify the interactions in the vicinity of the catalytic aspartate residues, increasing the distance between them to {approx}4 {angstrom} and establishing unique direct contacts between the flap and the catalytic residues. We attribute the absence of substantial catalytic activity in Bla g 2 to these unusual features of the active site. Five disulfide bridges and a Zn-binding site confer stability to the protein, which may contribute to sensitization at lower levels of exposure than other allergens.

  6. Three new species of cockroach genus Symploce Hebard, 1916 (Blattodea, Ectobiidae, Blattellinae with redescriptions of two known species based on types from Mainland China

    Directory of Open Access Journals (Sweden)

    Zongqing Wang

    2013-09-01

    Full Text Available Three new species of Symploce Hebard from China are described: Symploce sphaerica sp. n., Symploce paramarginata sp. n. and Symploce evidens sp. n. Two known species are redescribed and illustrated based on types. A key is given to identify all species of Symploce from mainland China.

  7. The microfiber texture in a specialized plastic cuticle area within a sensillum field on the cockroach maxillary palp as revealed by freeze fracturing.

    Science.gov (United States)

    Altner, H

    1975-12-29

    A field of sensilla extends across the ventral surface of the terminal segment of the maxillary palps of Periplaneta americana. The sensilla project from a sheet of pliable cuticle. Ultrathin sections of the cuticle in this area reveal a clear-cut parabolic microfiber pattern. Microfibers can also be seen from freeze fracture faces running parallel to the cuticular surface. These microfibers have a diameter of 80 A and may consist of chitin crystallites surrounded by a matrix coat. The number of straight parallel microfibers visible in a fracture face increases the more closely parallel to the surface the fracture runs. This result suggests a helicoidal texture, as the model of Bouligand would demand. The layer-to-layer rotational displacement of the microfibers is about 12 degrees. This texture can be regarded as typical for flexible cuticles in general. Other structural properties such as the continuation of the epicuticular dense layer into deeper cuticular layers around the enveloping cells of sensilla can be interpreted as specializations connected with the function of the sensillum field.

  8. Emergence, development, and maturity of the gonad of two species of chitons "sea cockroach" (Mollusca: Polyplacophora) through the early life stages.

    Science.gov (United States)

    Avila-Poveda, Omar Hernando; Abadia-Chanona, Quetzalli Yasú

    2013-01-01

    This study describes and recognises, using histological and microscopical examinations on a morphometrical basis, several gonad traits through the early life stages of Chiton articulatus and C. albolineatus. Gonadal ontogenesis, gonad development stages, sexual differentiation, onset of the first sexual maturity, and growth sequences or "early life stages" were determined. In addition, allometry between lengths and body weight pooled for both sexes per each chiton were calculated using equation Y = aX(b) . A total of 125 chitons (4≤TL≤40 mm, in total length "TL") were used. All allometric relations showed a strong positive correlation (r), close to 1, with b-values above three, indicating an isometric growth. Gonadal ontogenesis and gonad development stages were categorised into three periods ("Pw" without gonad, "Pe" gonad emergence, and "Pf" gonadal sac formed) and four stages ("S0" gametocytogenesis, "S1" gametogenesis, "S2" mature, and "S3" spawning), respectively. Compound digital images were attained for each process. Periods and stages are overlapped among them and between species, with the following overall confidence intervals in TL: Pw 6.13-14.32 mm, Pe 10.32-16.93 mm, Pf 12.99-25.01 mm, S0 16.08-24.34 mm (females) and 19.51-26.60 mm (males), S1 27.15-35.63 mm (females) and 23.45-32.27 mm (males), S2 24.48-40.24 mm (females) and 25.45-32.87 mm (males). Sexual differentiation (in S0) of both chitons occurs first as a female then as a male; although, males reach the onset of the first sexual maturity earlier than females, thus for C. articulatus males at 17 mm and females at 32 mm, and for C. albolineatus males at 23.5 mm and females at 28 mm, all in TL. Four early life stages (i.e., subjuvenile, juvenile, subadult, and adult) are described and proposed to distinguish growth sequences. Our results may be useful to diverse disciplines, from developmental biology to fisheries management.

  9. Surface properties correlate to the digestibility of hydrothermally pretreated lignocellulosic Poaceae biomass feedstocks

    DEFF Research Database (Denmark)

    Tristan Djajadi, Demi; Hansen, Aleksander R.; Jensen, Anders

    2017-01-01

    in response to hydrothermal pretreatment at different severities are still not sufficiently understood. Results: Potentially important lignocellulosic feedstocks for biorefining, corn stover (Zea mays subsp. mays L.), stalks of Miscanthus × giganteus, and wheat straw (Triticum aestivum L.) were systematically...

  10. anti-inflammatory and analgesic activities: chemical constituents of ...

    African Journals Online (AJOL)

    a

    *Corresponding author. E-mail: bedisag@yahoo.fr. ANTI-INFLAMMATORY AND ANALGESIC ACTIVITIES: CHEMICAL CONSTITUENTS OF ESSENTIAL OILS OF OCIMUM GRATISSIMUM,. EUCALYPTUS CITRIODORA AND CYMBOPOGON GIGANTEUS INHIBITED. LIPOXYGENASE L-1 AND CYCLOOXYGENASE OF ...

  11. Application of irradiation in bait production to the control of crawling insects in urban areas

    Energy Technology Data Exchange (ETDEWEB)

    Migdal, W.; Owczarczyk, H.B.; Swietoslawski, J.; Swietoslawski, J

    2000-03-01

    The efficiency and palatability of two baits were studied to the control of crawling insects in urban areas: 'Cockroach Kill Gel' for control of cockroaches and Faratox B for control of ants. Ionizing energy was used in producing the baits. It was concluded, that after irradiation the palatability of Faratox B improved and palatability of Cockroach Kill Gel did not change.

  12. EFEKTIVITAS MINYAK ATSIRI SERAI WANGI (Combypogon nardus SEBAGAI INSEKTISIDA ALAMI UNTUK KECOA AMERIKA (Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Anindita Riesti Retno Arimurti

    2017-12-01

      Cockroaches are one of the most common types of insects around our neighborhood, and it is one of the most dangerous insects because some species of cockroaches are known to transmit disease in humans such as tuberculosis, typhoid, asthma, cholera, and hepatitis. Eradication of cockroaches can be done physically and chemically, the use of chemical-based insecticides can cause respiratory problems. In an insecticide drug containing natural ingredients contain essential oils, the content of essential oil compounds serve as an anti-insect drug on citronella. This study aimed to determine the effect of essential oils of citronella fragrance to cockroaches. This type of research was experimental. The population in this study were cockroaches (Periplaneta americana obtained from the houses of villagers of Tanjung, Sampang, Madura. The total sample was 32 adult stage cockroaches. Data analysis was using free T test with error rate of  5% or 0,05. The results showed that cockroaches stopped moving with an average of 15.75. Based on T test results showed the significant results of 0.00 which was smaller than 0.05 then H0 was rejected Ha was accepted. It can be concluded that the essential oils of citronella fragrance have an effect on the death of cockroaches.   Keywords: Cockroach, Essential Oil Of Citronella Fragrance (Cymbopogon nardus

  13. Identifying the core microbial community in the gut of fungus-growing termites

    DEFF Research Database (Denmark)

    Otani, Saria; Mikaelyan, Aram; Nobre, Tânia

    2014-01-01

    with specific termite genus-level ecological niches. Finally, we show that gut communities of fungus-growing termites are similar to cockroaches, both at the bacterial phylum level and in a comparison of the core Macrotermitinae taxa abundances with representative cockroach, lower termite, and higher non...

  14. Pest control in Albania: an example of collaboration in technical and scientific development in public health

    Directory of Open Access Journals (Sweden)

    Enkelejda Velo

    2010-03-01

    Full Text Available In September 2007, a severe cockroach (Blattella germanica infestation was reported on the premises of the Scutari Regional Hospital. The hospital was infested by cockroaches despite regular insecticide treatment by local pest control officers. The failure of treatment required a careful evaluation of the problem. It also created the opportunity for a more complete analysis of pest control in Albania.

  15. Vasoconstrictive effect of Xinmailong injection in rat aorta | Yang ...

    African Journals Online (AJOL)

    Background: Cockroach has been traditionally utilized in China for the therapy of cardiovascular disorders, such as heart failure. The present study was aimed to assess the vasoconstrictive effect of Xinmailong Injection (XML), a bioactive composite from American cockroach. Methodology: The isometric tensions of rat aortic ...

  16. Download this PDF file

    African Journals Online (AJOL)

    Proff.Adewunmi

    Background: Cockroach has been traditionally utilized in China for the therapy of cardiovascular disorders, such as heart failure. The present study was aimed to assess the vasoconstrictive effect of Xinmailong Injection (XML), a bioactive composite from American cockroach. Methodology: The isometric tensions of rat aortic ...

  17. Bacteriological analysis of Periplaneta americana L. (Dictyoptera ...

    African Journals Online (AJOL)

    The results indicate that the amounts of bacteria were different between the districts. Moreover, the bacteria isolated from body of American cockroaches differed from those of the houseflies. These findings show that American cockroaches and houseflies may carry pathogenic bacteria in the urban areas of Tangier.

  18. Phytochemical Composition And Effect Of Aqueous Extract Of ...

    African Journals Online (AJOL)

    Phytochemical Composition And Effect Of Aqueous Extract Of Struchium sparganophora (L) On Cockroach Crude Extract – Induced Airway Inflammatory ... Similarly, mean percentages of neutrophils, lymphyocytes, and eosinophils in cockroach crude extract-induced rats administered with S. sparganophora crude extract ...

  19. The thin green line: sustainable bioenergy feedstocks or invaders in waiting

    Directory of Open Access Journals (Sweden)

    Larissa L. Smith

    2015-04-01

    Full Text Available Numerous fast growing and highly competitive exotic crops are being selected for production of renewable bioenergy. Tolerance of poor growing conditions with minimal inputs are ideal characteristics for bioenergy feedstocks, but have attracted concern for their potential to become invasive. Miscanthus × giganteus is one of the most promising bioenergy crops in the US, but grower adoption is hindered by high establishment costs due to sterility. Newly developed fertile tetraploid M. × giganteus may streamline cultivation while reducing establishment costs. However, fertile seed dramatically increases the potential propagule pressure, and thus probability of off-site plant establishment. To empirically evaluate the invasive potential of fertile M. × giganteus in the Southeastern US, we compared fitness and spread potential relative to ten grass species comprising 19 accessions under both high and low levels of competition and disturbance. We chose species known to be invasive in the US (positive controls: Arundo donax, naturalized M. sinensis, M. sacchariflorus, Phalaris arundinacea, Sorghum halepense and non-invasive (negative controls; Andropogon gerardii, ornamental M. sinensis, Panicum virgatum, Sorghum bicolor, Saccharum spp.. This novel design allows us to make relative comparisons of risk among species with varying invasiveness. After three years of establishment and growth in Blacksburg, Virginia, neither aboveground disturbance nor interspecific weed competition influenced fitness for fertile M. × giganteus or our positive and negative control groups. Fertile M. × giganteus produced 346% and 283% greater aboveground biomass than our positive and negative species, respectively. However, fertile M. × giganteus produced 74% fewer inflorescences m-2 than our positive controls and 7% and 51% fewer spikelets inflorescence-1 than the positive and negative control species. After 18 months of growth, we observed the vegetative and seedling

  20. The interactions between gut microbiota and entomopathogenic fungi: a potential approach for biological control of Blattella germanica (L.).

    Science.gov (United States)

    Zhang, Fan; Sun, Xiao X; Zhang, Xian C; Zhang, Shuo; Lu, Jie; Xia, Yong M; Huang, Yan H; Wang, Xue J

    2018-02-01

    Metarhizium anisopliae and Beauveria bassiana mainly infect insects through the cuticle; gut infection occasionally occurs. Micro-organisms existing in the gut may play a crucial role in the evolution and ecology of host defenses against fungal pathogens. To evaluate whether the gut bacteria participate in antifungal activity, and to determine their role in host protection, the interactions between gut bacteria and M. anisopliae and the diversity of gut microbiota in cockroaches were studied. An oral feeding test showed that the mortality of conventional cockroaches was significantly lower than that of germ-free cockroaches; both gut homogenates and aqueous fecal extracts showed antifungal activity, but the samples from germ-free cockroaches did not. Twenty-two bacterial strains with antifungal activity and siderophore-producing ability were isolated from the gut and feces of cockroaches. Using high-throughput sequencing techniques, a total of 23 different phyla and 212 genera were detected. The composition of the microbiota of the hindgut was vastly different from those of the foregut and midgut; higher diversity and abundance of Bacteroides and Pseudomonas were found in the hindgut. The gut microbiota of German cockroaches may play a critical role in protecting cockroaches from fungal invasion and colonization. Removing certain bacteria from the B. germanica microbiota may facilitate microbial control using fungal pathogens. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  1. Avaliação quantitativa da massa fibrosa e vazios em colmos de bambu Quantitative evaluation of fibrous material and hollows of bamboo culms

    Directory of Open Access Journals (Sweden)

    Anísio Azzini

    1990-01-01

    Full Text Available Em colmos de Bambusa tuldoides Munro, Bambusa vulgaris Schrad e Dendrocalamus giganteus Munro, determinaram-se as dimensões quanto à altura e ao diâmetro basal, além dos teores de nó, massa fibrosa e vazios ("ocos" dos internódios. Os teores de nó, em relação ao peso úmido do colmo, foram de 6,32, 11,70 e 13,41%, respectivamente, para S. tuidoides, D. giganteus e B. vulgaris. Em volume, os teores de massa fibrosa no colmo de bambu variaram de 46,09%, para D. giganteus, a 61,19%, para B. tuldoides, sendo de 53,32% o valor intermediário para B. vulgaris. Este estudo foi efetuado no Centro Experimental de Campinas (IAC em 1988.Culms of Bambusa tuidoides Munro, Bambusa vulgaris Schrad and Dendrocalamus giganteus Munro, were studied and the following variables were determined: height and basal diameter, content of nodes, fibrous material and intemode hollows. The node contents, regarding the fresh weight, were 6.32, 11.70 and 13.41%, respectively for B. tuldoides, D. giganteus and B. vulgaris. Regarding the culm volume, the fibrous material contents ranged from 46.09% for D. giganteus to 61.19% for B. tuidoides. The intermediate value was 53.32% for B. vulgaris. This study was carried out in 1988 at the Instituto Agronômico de Campinas in State of São Pauto, Brazil.

  2. Modeling long-term yield trends of Miscanthusxgiganteus using experimental data from across Europe

    DEFF Research Database (Denmark)

    Lesur, Claire; Jeuffroy, Marie-Hélène; Makowski, David

    2013-01-01

    . giganteus is known to have an establishment phase during which annual yields increased as a function of crop age, followed by a ceiling phase, the duration of which is unknown. We built a database including 16 European long-term experiments (i) to describe the yield evolution during the establishment...... and the ceiling phases and (ii) to determine whether M. giganteus ceiling phase is followed by a decline phase where yields decrease across years. Data were analyzed through comparisons between a set of statistical growth models. The model that best fitted the experimental data included a decline phase...

  3. STUDYING IMMUNOBIOLOGICAL FEATURES OF PREPARED WATER_SALT EXTRACTS OF INSECT ALLERGENS

    Directory of Open Access Journals (Sweden)

    O.V. Radikova

    2008-01-01

    Full Text Available Through the indirect degranulation of mast cells, anaphylaxis test, solid phase immune enzyme analysis, the researchers evaluated the immuno biological features of serum of 20 patients suffering from atopic mild and moderate bronchial asthma with domestic sensitization. All received water salt extracts of insects (cockroach, black beetle, American cock roach, ash gray cockroach, cricket, fly, moth, mealworm, weevil, billbug demonstrated specific activity. An immune enzyme analysis has revealed more intensive allergic features of substances extracted from black beetle, cockroach, fly and moth.Key words: insect allergens, allergen specific immunotherapy, immuno biological features of allergic extracts, Ige anti bodies.

  4. Prussakas on kõva hammustaja

    Index Scriptorium Estoniae

    2015-01-01

    Artikkel "Fast and Powerful: Biomechanics and Bite Forces of the Mandibles in the American Cockroach Periplaneta americana" on ilmunud ajakirjas PLOS ONE November 11, 2015 DOI: 10.1371/journal.pone.0141226

  5. ORF Alignment: NT_033779 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n-like protein CL3 [Periplaneta americana] ... Length = 128 ... Query: 1 ... MVLDNQEDKLLTTTFLKSMGLSFTQSWHH... NT_033779 gi|21357645 >1qddA 26 143 127 254 1e-07 ... dbj|BAA82266.1| Cockroach lecti

  6. Cetirizine

    Science.gov (United States)

    ... allergy to other substances (such as dust mites, animal dander, cockroaches, and molds). These symptoms include sneezing; ... the tongue; wheezing; drooling; dizziness; or loss of consciousness. These may be symptoms of a life-threatening ...

  7. 76 FR 4690 - Menthol and Propetamphos; Registration Review Proposed Decisions; Notice of Availability

    Science.gov (United States)

    2011-01-26

    ... may be of interest to a wide range of stakeholders including environmental, human health, farm worker... insects, primarily, ants, cockroaches, and fleas. Propetamphos acts as a contact and stomach action poison...

  8. Asthma and Allergy Foundation of America

    Science.gov (United States)

    ... at School Allergies Types of Allergies Drug Allergy Food Allergy Insect Allergy Cockroach Allergy Dust Mite Allergy Latex ... Climate and Health Epinephrine in Schools Healthy Settings Food Allergies National Asthma Control Program Patient and Family Engagement ...

  9. Allergy Capitals

    Science.gov (United States)

    ... at School Allergies Types of Allergies Drug Allergy Food Allergy Insect Allergy Cockroach Allergy Dust Mite Allergy Latex ... Climate and Health Epinephrine in Schools Healthy Settings Food Allergies National Asthma Control Program Patient and Family Engagement ...

  10. Hives (Urticaria)

    Science.gov (United States)

    ... at School Allergies Types of Allergies Drug Allergy Food Allergy Insect Allergy Cockroach Allergy Dust Mite Allergy Latex ... Climate and Health Epinephrine in Schools Healthy Settings Food Allergies National Asthma Control Program Patient and Family Engagement ...

  11. Duration of Fipronil and Imidacloprid Gel Baits Toxicity against Blattella germanica Strains of Iran

    Directory of Open Access Journals (Sweden)

    H Nasirian

    2007-12-01

    Full Text Available The current study was conducted to investigate the duration of fipronil and imidacloprid gel baits toxicity against Ger-man cockroach strains in Iran during 2003-2004. In order to conduct this study, nine German cockroach strains were used. Newly emerged adult male German cockroaches starved for one scotophase (12 h, and ingested fipronil and imidacloprid gel baits for 2 h. After the given time was over, the bait was removed and replaced with mouse pellet. Mortality was re-corded at 12 intervals for 144 h (6 days. Mortality data of the replicates were pooled and was tested using probit analysis. Both gel baits were toxic to adult male German cockroaches. In the ingested bait method, the susceptible strain showed LT50 of 47.1 and 11.3 h for fipronil and imidacloprid gel baits, respectively, and the average LT90 was 74.2 and 19.3 h, respec¬tively. LT50 of the feral German cockroach strains varied 14.9 h from 30.5 to 45.4 h and 4.4 h from 12.4 to 16.8 h for fipronil and imidacloprid gel baits, respectively. All German cockroach strains showed a similar susceptibility to fipronil and imidacloprid gel baits, compared with the susceptible laboratory strain. The steep slopes of ingested bait mortality curves indicated that the feral German cockroach strains were homogenous to fipronil and imidacloprid ingested gel baits. These results suggest that fipronil and imidacloprid gel baits appear to have considerable potential as a bait for insecticide-resistant strains of German cockroach.

  12. Mouse sensitivity is an independent risk factor for rhinitis in children with asthma

    Science.gov (United States)

    Sedaghat, Ahmad R.; Matsui, Elizabeth C.; Baxi, Sachin N.; Bollinger, Mary E.; Miller, Rachel; Perzanowski, Matthew; Phipatanakul, Wanda

    2015-01-01

    Background Although mouse and cockroach allergy are known to be important in urban children with asthma, the independent association of mouse and cockroach sensitization with rhinitis in these children is unknown. Objective To determine the association of mouse and cockroach sensitization with rhinitis in urban children with asthma. Methods As part of the Mouse Allergen and Asthma Intervention Trial, 499 urban children (5–17yr) with persistent asthma underwent spirometry, skin prick testing to 14 common environmental allergens, serology for mouse-specific IgE. In 269 subjects, cockroach-specific IgE serology was also obtained. Patient/parent-reported rhinitis in the last two weeks and one year were the primary outcome measures. Mouse/cockroach exposure was measured by reported frequency of sightings. Mouse allergen settled bedroom dust samples were also measured in mouse-sensitized children. Results Rhinitis was reported in 49.9% and 70.2% of participants within the last 2 weeks and last one year, respectively. Serum mouse IgE level ≥0.35IU/mL was associated with rhinitis in the past two weeks (ORadj=2.15, 95%CI= 1.02–4.54, P=0.04) and the past year (ORadj=2.40, 95%CI =1.12–5.1, P=0.02) after controlling for age, race, gender, the presence of any smokers at home, primary caregiver education level, number of allergen sensitivities, cockroach IgE level ≥0.35IU/mL and study site (Boston or Baltimore). Measures of home mouse exposure were not associated with rhinitis, regardless of mouse sensitivity. Cockroach sensitivity was not associated with rhinitis regardless of sensitization to other allergens. Conclusions In urban asthmatic children, increased mouse-, but not cockroach-, IgE in the sera (mouse IgE ≥0.35IU/mL) may be associated independently with rhinitis. PMID:26441149

  13. Multifaceted Defense against Antagonistic Microbes in Developing Offspring of the Parasitoid Wasp Ampulex compressa (Hymenoptera, Ampulicidae)

    OpenAIRE

    Weiss, Katharina; Parzefall, Christopher; Herzner, Gudrun

    2014-01-01

    Effective antimicrobial strategies are essential adaptations of insects to protect themselves, their offspring, and their foods from microbial pathogens and decomposers. Larvae of the emerald cockroach wasp, Ampulex compressa, sanitize their cockroach hosts, Periplaneta americana, with a cocktail of nine antimicrobials comprising mainly (R)-(-)-mellein and micromolide. The blend of these antimicrobials has broad-spectrum antimicrobial activity. Here we explore the spatio-temporal pattern of d...

  14. Multifaceted defense against antagonistic microbes in developing offspring of the parasitoid wasp Ampulex compressa (Hymenoptera, Ampulicidae).

    Science.gov (United States)

    Weiss, Katharina; Parzefall, Christopher; Herzner, Gudrun

    2014-01-01

    Effective antimicrobial strategies are essential adaptations of insects to protect themselves, their offspring, and their foods from microbial pathogens and decomposers. Larvae of the emerald cockroach wasp, Ampulex compressa, sanitize their cockroach hosts, Periplaneta americana, with a cocktail of nine antimicrobials comprising mainly (R)-(-)-mellein and micromolide. The blend of these antimicrobials has broad-spectrum antimicrobial activity. Here we explore the spatio-temporal pattern of deployment of antimicrobials during the development from egg to adult as well as their physico-chemical properties to assess how these aspects may contribute to the success of the antimicrobial strategy. Using gas chromatography/mass spectrometry (GC/MS) we show that larvae start sanitizing their food as soon as they have entered their host to feed on its tissue. Subsequently, they impregnate the cockroach carcass with antimicrobials to create a hygienic substrate for cocoon spinning inside the host. Finally, the antimicrobials are incorporated into the cocoon. The antimicrobial profiles on cockroach and wasp cocoon differed markedly. While micromolide persisted on the cockroaches until emergence of the wasps, solid-phase microextraction sampling and GC/MS analysis revealed that (R)-(-)-mellein vaporized from the cockroaches and accumulated in the enclosed nest. In microbial challenge assays (R)-(-)-mellein in the headspace of parasitized cockroaches inhibited growth of entomopathogenic and opportunistic microbes (Serratia marcescens, Aspergillus sydowii, Metarhizium brunneum). We conclude that, in addition to food sanitation, A. compressa larvae enclose themselves in two defensive walls by impregnating the cocoon and the cockroach cuticle with antimicrobials. On top of that, they use vaporous (R)-(-)-mellein to sanitize the nest by fumigation. This multifaceted antimicrobial defense strategy involving the spatially and temporally coordinated deployment of several antimicrobials

  15. A Re-Examination of Neuropsychological Functioning in Persian Gulf War Era Veterans

    Science.gov (United States)

    2003-08-01

    consequences. Spitzer, R. L., Williams, J. B. W., Gibbon, M., & First, M. B. (1990). Antimicrobial Agents in Chemotherapy, 38 (1), 1-6. Structured...Insecticides against cockroaches 20.4 Direct combat activities 19.7 Bathing in or drinking contaminated water (fumes, oil, chemicals) 12.8 Gave aid to...observed when comparing the GW- cockroaches ; diesel fuel, kerosene, or other fumes; evapo- deployed group with a low number of symptoms to that rated

  16. Medical Services: Preventive Medicine

    Science.gov (United States)

    1990-10-15

    antimicrobial agents by analyzing and using significant sur- veillance data and antimicrobial susceptibility test data. (8) Recommend to the hospital...an MTF. Pest management in food service areas is addressed in paragraph 10–9. Cockroach infestations in portable food carts are difficult to control...items.Technical assistance in controlling cockroaches in food carts may be obtained from USAEHA. 10–11. Pest management of military subsistence and stored

  17. Multifaceted defense against antagonistic microbes in developing offspring of the parasitoid wasp Ampulex compressa (Hymenoptera, Ampulicidae.

    Directory of Open Access Journals (Sweden)

    Katharina Weiss

    Full Text Available Effective antimicrobial strategies are essential adaptations of insects to protect themselves, their offspring, and their foods from microbial pathogens and decomposers. Larvae of the emerald cockroach wasp, Ampulex compressa, sanitize their cockroach hosts, Periplaneta americana, with a cocktail of nine antimicrobials comprising mainly (R-(--mellein and micromolide. The blend of these antimicrobials has broad-spectrum antimicrobial activity. Here we explore the spatio-temporal pattern of deployment of antimicrobials during the development from egg to adult as well as their physico-chemical properties to assess how these aspects may contribute to the success of the antimicrobial strategy. Using gas chromatography/mass spectrometry (GC/MS we show that larvae start sanitizing their food as soon as they have entered their host to feed on its tissue. Subsequently, they impregnate the cockroach carcass with antimicrobials to create a hygienic substrate for cocoon spinning inside the host. Finally, the antimicrobials are incorporated into the cocoon. The antimicrobial profiles on cockroach and wasp cocoon differed markedly. While micromolide persisted on the cockroaches until emergence of the wasps, solid-phase microextraction sampling and GC/MS analysis revealed that (R-(--mellein vaporized from the cockroaches and accumulated in the enclosed nest. In microbial challenge assays (R-(--mellein in the headspace of parasitized cockroaches inhibited growth of entomopathogenic and opportunistic microbes (Serratia marcescens, Aspergillus sydowii, Metarhizium brunneum. We conclude that, in addition to food sanitation, A. compressa larvae enclose themselves in two defensive walls by impregnating the cocoon and the cockroach cuticle with antimicrobials. On top of that, they use vaporous (R-(--mellein to sanitize the nest by fumigation. This multifaceted antimicrobial defense strategy involving the spatially and temporally coordinated deployment of several

  18. Characterization of Robotic Tail Orientation as a Function of Platform Position for Surf-Zone Robots

    Science.gov (United States)

    2009-06-01

    Laboratory. The motion of Whegs™ concept was inspired by the mobility of hexapods, specifically the cockroach , to take advantage 2 of the insect’s...inherent stability and mobility over a variety of terrain. The principals of cockroach motion are that it stands and moves using six legs. It walks using a...wheel-legs machined from single pieces of hard, polyvinyl chloride plastic pictured in Figure 5. Each Wheg™ consists of four, 3.5” long spokes around

  19. Walking Machine Control Programming

    Science.gov (United States)

    1983-08-31

    ANECDOTE #1: Students at Carnegie-Mellon University have named the machine "The Trojan Cockroach ." BACKGROUND This paper is about the operational...motion in a pair of smaall plastic tubes. The fluid connection transmits the commands to the pumps, returns the control loading forces to the driver...takes a full minute might better be described otherwise, and offered the following eight lines: The Trojan Cockroach fliggledy Piggledy Ivan E

  20. Benefits versus risks of growing biofuel crops: the case of Miscanthus

    DEFF Research Database (Denmark)

    Jørgensen, Uffe

    2011-01-01

    , however, only the case for the triploid and sterile species M. × giganteus, while great caution should be taken with the production of the seed-setting species of the genus. M. sinensis has already spread into nature from ornamental use in several parts of the world, where it is considered a serious...

  1. African Zoology - Vol 35, No 1 (2000)

    African Journals Online (AJOL)

    Seasonal variation in stomach contents and diet composition in the large girdled lizard, Cordylus giganteus (Reptilia: Cordylidae) in the Highveld grasslands of the northeastern Free State, South Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. J.H. van Wyk, 9-27.

  2. Microscale modeling of gas exchange during C4 photosythesis

    NARCIS (Netherlands)

    Retta, Moges

    2017-01-01

    Improving the efficiency of photosynthesis could contribute to better food security under an unprecedented rise in global population and climate-change. The photosynthesis pathway in C4 plants, such as maize (Zea mays L.), Miscanthus (Miscanthus x giganteus), and sugarcane (Saccharum officinarum

  3. Miscanthus productivity and nutrient export on 22 producer fields

    Science.gov (United States)

    On-farm assessments of Miscanthus × giganteus growth and nutrition across a wide range of management and environmental conditions are needed to determine and model how this crop performs and where it should be placed on the landscape. Therefore, Miscanthus growth and nutrition were monitored during ...

  4. 1439-IJBCS-Article-Guy Alain Alitonou

    African Journals Online (AJOL)

    hp

    The chemical composition of essential oils obtained from the leaves of Cymbopogon giganteus Chiov. ..... schoenanthus are listed in Table 1. A total of .... Huiles essentielles extraites de plantes aromatiques acclimatées au Bénin: étude chimique, évaluation biologique et applications potentielles. Thèse de doctorat des.

  5. A new stage in the evolution of the mole rats (Rodentia, Spalacinae) from the Early Miocene of northern Greece

    NARCIS (Netherlands)

    de Bruijn, Hans

    2017-01-01

    The cheek teeth of Debruijnia kostakii n. sp. from the Early Miocene of Karydia are only slightly smaller than those of the largest extant species of the Spalacinae (Spalax giganteus), but show characteristics that are reminiscent of its Paleogene cricetid ancestor. The peculiar combination of large

  6. Microscale modeling of gas exchange during C4 photosythesis

    NARCIS (Netherlands)

    Retta, Moges

    2017-01-01

    Improving the efficiency of photosynthesis could contribute to better food security under an unprecedented rise in global population and climate-change. The photosynthesis pathway in C4 plants, such as maize (Zea mays L.), Miscanthus (Miscanthus x giganteus), and

  7. Morphometric Analysis of the Host Effect on Phenotypical Variation of Belminus ferroae (Hemiptera: Triatominae

    Directory of Open Access Journals (Sweden)

    Claudia Magaly Sandoval Ramirez

    2015-01-01

    Full Text Available The Triatominae subfamily includes hematophagous insects, well known for their role as vectors for the Trypanosoma cruzi parasite, etiologic agent of Chagas’ disease. Belminus ferroae is a triatomine that showed an increased demographic fitness when cockroaches were used as hosts. Here we compare the centroid size (CS and wing shape between B. ferroae parents and three successive generations (O1, O2, and O3 of their offspring fed on cockroaches or mice under laboratory conditions. Morphometric analysis of the wings bugs fed on cockroaches showed a significant reduction in CS in both sexes among all generations. Sexual size dimorphism (SSD was observed in the insects fed on cockroaches (O2 and O3, as well as those bugs fed on mice (O2. Differences in the shape of wings were observed between parental and offspring wings when fed on mice, but not in males (O1, O2, and O3 or females (O1 and O2 fed on cockroaches. There was a greater wing shape similarity between the cockroach-fed offspring and their parents according to the Mahalanobis distances. Our results support the idea of higher adaptation of this Triatominae with arthropod hosts.

  8. Pathogenic Fungal Species Associated with Digestive System of Periplaneta americana (Blattaria: Blattidae Trapped from Residential Dwellings in Ahvaz City, Southwestern Iran

    Directory of Open Access Journals (Sweden)

    Hamid Kassiri

    2018-03-01

    Full Text Available Background: Cockroaches are the most prevalent domestic pests of a worldwide distribution. They were recognized as possible vectors of pathogenic bacteria, viruses, fungi and parasites in residential dwellings and hospital environ­ments. The present study isolated and identified yeasts and filamentous fungi from digestive tract of American cock­roaches, collected from three different residential regions of Iran.Methods: Seventy cockroaches were sampled using direct collection (hand catch, vacuum cleaner and sticky traps in Ahvaz, Iran in 2009–2010. Their medically important fungal microorganisms were isolated from digestive tract using standard mycological methods. Filamentous fungi were identified by macroscopic and microscopic examina­tion. Yeasts were identified by API ID32C-32100 kit.Results: A high percentage of cockroaches (88.6% were detected to carry fungi of medical importance. Overall, 23 fungi species/genera were isolated from the American cockroaches' alimentary tract. The fungi isolated from cock­roaches, from the residential regions were species of Aspergillus, Rhizopus, Penicillium, Mucorales, Alternaria, Cladosporium, Mycelia, Chrysosporium, Candida, Rhodotorula, Zygosaccharomyces, and Debaryomyces. Candida spp. (41.4%, Aspergillus spp. (37.1% and Rhodotorula spp (27.1% were the most common fungi recovered on cockroaches. Candida albicans and Candida glabrata were the commonest species of the genus Candida. In addi­tion, Aspergillus niger and A. flavus were the most frequent species of the genus Aspergillus.Conclusion: American cockroaches may carry pathogenic fungi in the urban areas of Ahvaz.

  9. Activity syndromes and metabolism in giant deep-sea isopods

    Science.gov (United States)

    Wilson, Alexander D. M.; Szekeres, Petra; Violich, Mackellar; Gutowsky, Lee F. G.; Eliason, Erika J.; Cooke, Steven J.

    2017-03-01

    Despite growing interest, the behavioural ecology of deep-sea organisms is largely unknown. Much of this scarcity in knowledge can be attributed to deepwater animals being secretive or comparatively 'rare', as well as technical difficulties associated with accessing such remote habitats. Here we tested whether two species of giant marine isopod (Bathynomus giganteus, Booralana tricarinata) captured from 653 to 875 m in the Caribbean Sea near Eleuthera, The Bahamas, exhibited an activity behavioural syndrome across two environmental contexts (presence/absence of food stimulus) and further whether this syndrome carried over consistently between sexes. We also measured routine metabolic rate and oxygen consumption in response to a food stimulus in B. giganteus to assess whether these variables are related to individual differences in personality. We found that both species show an activity syndrome across environmental contexts, but the underlying mechanistic basis of this syndrome, particularly in B. giganteus, is unclear. Contrary to our initial predictions, neither B. giganteus nor B. tricarinata showed any differences between mean expression of behavioural traits between sexes. Both sexes of B. tricarinata showed strong evidence of an activity syndrome underlying movement and foraging ecology, whereas only male B. giganteus showed evidence of an activity syndrome. Generally, individuals that were more active and bolder, in a standard open arena test were also more active when a food stimulus was present. Interestingly, individual differences in metabolism were not related to individual differences in behaviour based on present data. Our study provides the first measurements of behavioural syndromes and metabolism in giant deep-sea isopods.

  10. Dehydration, with and without heat, in kangaroos from mesic and arid habitats: different thermal responses including varying patterns in heterothermy in the field and laboratory.

    Science.gov (United States)

    Dawson, Terence J; Blaney, Cyntina E; McCarron, Hugh C K; Maloney, Shane K

    2007-10-01

    Field data showing the daily patterns in body temperature (T(b)) of kangaroos in hot, arid conditions, with and without water, indicate the use of adaptive heterothermy, i.e. large variation in T(b). However, daily T(b) variation was greater in the Eastern Grey Kangaroo (Macropus giganteus), a species of mesic origin, than in the desert-adapted Red Kangaroo (Macropus rufus). The nature of such responses was studied by an examination of their thermal adjustments to dehydration in thermoneutral temperatures (25 degrees C) and at high temperature (45 degrees C) via the use of tame, habituated animals in a climate chamber. At the same level of dehydration M. rufus was less impacted, in that its T(b) changed less than that for M. giganteus while it evaporated significantly less water. At a T(a) of 45 degrees C with water restriction T(b) reached 38.9 +/- 0.3 degrees C in M. rufus compared with 40.2 +/- 0.4 degrees C for M. giganteus. The ability of M. rufus to reduce dry conductance in the heat while dehydrated was central to its superior thermal control. While M. giganteus showed more heterothermy, i.e. its T(b) varied more, this seemed due to a lower tolerance of dehydration in concert with a strong thermal challenge. The benefits of heterothermy to M. giganteus were also limited because of thermal (Q(10)) effects on metabolic heat production and evaporative heat loss. The impacts of T(b) on heat production were such that low morning T(b)'s seen in the field may be associated with energy saving, as well as water saving. Kangaroos respond to dehydration and heat similarly to many ungulates, and it is apparent that the accepted notions about adaptive heterothermy in large desert mammals may need revisiting.

  11. Thought-Controlled Nanoscale Robots in a Living Host

    Science.gov (United States)

    Giron, Jonathan; Ben-Ami, Lee; Amir, Yaniv; Hel-Or, Yacov; Friedman, Doron; Bachelet, Ido

    2016-01-01

    We report a new type of brain-machine interface enabling a human operator to control nanometer-size robots inside a living animal by brain activity. Recorded EEG patterns are recognized online by an algorithm, which in turn controls the state of an electromagnetic field. The field induces the local heating of billions of mechanically-actuating DNA origami robots tethered to metal nanoparticles, leading to their reversible activation and subsequent exposure of a bioactive payload. As a proof of principle we demonstrate activation of DNA robots to cause a cellular effect inside the insect Blaberus discoidalis, by a cognitively straining task. This technology enables the online switching of a bioactive molecule on and off in response to a subject’s cognitive state, with potential implications to therapeutic control in disorders such as schizophrenia, depression, and attention deficits, which are among the most challenging conditions to diagnose and treat. PMID:27525806

  12. Thought-Controlled Nanoscale Robots in a Living Host.

    Directory of Open Access Journals (Sweden)

    Shachar Arnon

    Full Text Available We report a new type of brain-machine interface enabling a human operator to control nanometer-size robots inside a living animal by brain activity. Recorded EEG patterns are recognized online by an algorithm, which in turn controls the state of an electromagnetic field. The field induces the local heating of billions of mechanically-actuating DNA origami robots tethered to metal nanoparticles, leading to their reversible activation and subsequent exposure of a bioactive payload. As a proof of principle we demonstrate activation of DNA robots to cause a cellular effect inside the insect Blaberus discoidalis, by a cognitively straining task. This technology enables the online switching of a bioactive molecule on and off in response to a subject's cognitive state, with potential implications to therapeutic control in disorders such as schizophrenia, depression, and attention deficits, which are among the most challenging conditions to diagnose and treat.

  13. Comparison of carbon balance in Mediterranean pilot constructed wetlands vegetated with different C4 plant species.

    Science.gov (United States)

    Barbera, Antonio C; Borin, Maurizio; Cirelli, Giuseppe L; Toscano, Attilio; Maucieri, Carmelo

    2015-02-01

    This study investigates carbon dioxide (CO2) and methane (CH4) emissions and carbon (C) budgets in a horizontal subsurface flow pilot-plant constructed wetland (CW) with beds vegetated with Cyperus papyrus L., Chrysopogon zizanioides (L.) Roberty, and Mischantus × giganteus Greef et Deu in the Mediterranean basin (Sicily) during the 1st year of plant growing season. At the end of the vegetative season, M. giganteus showed the higher biomass accumulation (7.4 kg m(-2)) followed by C. zizanioides (5.3 kg m(-2)) and C. papyrus (1.8 kg m(-2)). Significantly higher emissions of CO2 were detected in the summer, while CH4 emissions were maximum during spring. Cumulative CO2 emissions by C. papyrus and C. zizanioides during the monitoring period showed similar trends with final values of about 775 and 1,074 g m(-2), respectively, whereas M. giganteus emitted 3,395 g m(-2). Cumulative CH4 bed emission showed different trends for the three C4 plant species in which total gas release during the study period was for C. papyrus 12.0 g m(-2) and ten times higher for M. giganteus, while C. zizanioides bed showed the greatest CH4 cumulative emission with 240.3 g m(-2). The wastewater organic carbon abatement determined different C flux in the atmosphere. Gas fluxes were influenced both by plant species and monitored months with an average C-emitted-to-C-removed ratio for C. zizanioides, C. papyrus, and M. giganteus of 0.3, 0.5, and 0.9, respectively. The growing season C balances were positive for all vegetated beds with the highest C sequestered in the bed with M. giganteus (4.26 kg m(-2)) followed by C. zizanioides (3.78 kg m(-2)) and C. papyrus (1.89 kg m(-2)). To our knowledge, this is the first paper that presents preliminary results on CO2 and CH4 emissions from CWs vegetated with C4 plant species in Mediterranean basin during vegetative growth.

  14. Demographic fitness of Belminus ferroae (Hemiptera: Triatominae on three different hosts under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Claudia Magaly Sandoval

    2013-11-01

    Full Text Available Triatominae are widely recognised for their role as vectors of Trypanosoma cruzi. One of the main biological characteristics of this subfamily is their obligate haematophagous condition. However, previous studies on Belminus herreri and Belminus ferroae suggested that cockroaches are their principal hosts in domiciles. Due to this peculiar behaviour, the aim of this study was to analyse several demographic and reproductive parameters of B. ferroae fed on three different hosts (mice, cockroaches and Rhodnius prolixus and relate B. ferroae fitness to these alternative hosts. The cohorts were reared under constant conditions. The egg hatching rate was similar for cohorts fed on cockroaches (69.4% and R. prolixus (63.8%, but was much lower for the cohort fed on mice (16%. The development time from the nymph to adult stage and the average age of first reproduction (α presented lower values in the cohort fed on cockroaches, which is consistent with the higher population growth rate associated with this host. Demographic parameters [intrinsic rate of natural increase, finite rate of population growth, net reproductive rate and damping ratio] showed statistically significant differences between the cohorts. Analysis of the life history of B. ferroae revealed a higher fitness related to the cockroach. The implications of these results for the origin of the subfamily are discussed.

  15. Demographic fitness of Belminus ferroae (Hemiptera: Triatominae) on three different hosts under laboratory conditions.

    Science.gov (United States)

    Sandoval, Claudia Magaly; Medone, Paula; Nieves, Elsa Evelia; Jaimes, Diego Alexander; Ortiz, Nelcy; Rabinovich, Jorge Eduardo

    2013-11-01

    Triatominae are widely recognised for their role as vectors of Trypanosoma cruzi. One of the main biological characteristics of this subfamily is their obligate haematophagous condition. However, previous studies on Belminus herreri and Belminus ferroae suggested that cockroaches are their principal hosts in domiciles. Due to this peculiar behaviour, the aim of this study was to analyse several demographic and reproductive parameters of B. ferroae fed on three different hosts (mice, cockroaches and Rhodnius prolixus) and relate B. ferroae fitness to these alternative hosts. The cohorts were reared under constant conditions. The egg hatching rate was similar for cohorts fed on cockroaches (69.4%) and R. prolixus (63.8%), but was much lower for the cohort fed on mice (16%). The development time from the nymph to adult stage and the average age of first reproduction (α) presented lower values in the cohort fed on cockroaches, which is consistent with the higher population growth rate associated with this host. Demographic parameters [intrinsic rate of natural increase, finite rate of population growth, net reproductive rate and damping ratio] showed statistically significant differences between the cohorts. Analysis of the life history of B. ferroae revealed a higher fitness related to the cockroach. The implications of these results for the origin of the subfamily are discussed.

  16. Enzymatic Hydrolysis of Wheat Arabinoxylan by a Recombinant "Minimal" Enzyme Cocktail Containing beta-Xylosidase and Novel endo-1,4-beta-Xylanase and alpha-L-Arabinofuranosidase Activities

    DEFF Research Database (Denmark)

    Sørensen, Hanne R.; Pedersen, Sven; Jørgensen, Christel T.

    2007-01-01

    This study describes the identification of the key enzyme activities required in a "minimal" enzyme cocktail able to catalyze hydrolysis of water-soluble and water-insoluble wheat arabinoxylan and whole vinasse, a fermentation effluent resulting from industrial ethanol manufacture from wheat......: (i) one GH51 enzyme from Meripilus giganteus and (ii) one GH51 enzyme from Humicola insolens, both able to catalyze arabinose release from singly substituted xylose; and (iii) one GH43 enzyme from H. insolens able to catalyze the release of arabinose from doubly substituted xylose. Treatment of water......-soluble and water-insoluble wheat arabinoxylan with an enzyme cocktail containing a 20%:20%:20%:40% mixture and a 25%:25%:25%:25% mixture, respectively, of the GH43 alpha-L-arabinofuranosidase from H. insolens (Abf II), the GH51 alpha-L-arabinofuranosidase from M. giganteus (Abf III), a GH10 endo-1,4-beta...

  17. The effect of harvest time, dry matter content and mechanical pretreatments on anaerobic digestion and enzymatic hydrolysis of miscanthus

    DEFF Research Database (Denmark)

    Frydendal-Nielsen, Susanne; Hjorth, Maibritt; Baby, Sanmohan

    2016-01-01

    Miscanthus x giganteus was harvested as both green and mature biomass and the dry matter content of the driest harvest was artificially decreased by adding water in two subsamples, giving a total of five dry matter contents. All five biomass types were mechanically pretreated by roller-milling, e......Miscanthus x giganteus was harvested as both green and mature biomass and the dry matter content of the driest harvest was artificially decreased by adding water in two subsamples, giving a total of five dry matter contents. All five biomass types were mechanically pretreated by roller......-milling, extrusion or grinding and accumulated methane production and enzymatically-accessible sugars were measured. Accumulated methane production was studied using sigmoid curves that allowed comparison among the treatments of the rate of the methane production and ultimate methane yield. The green biomass gave...

  18. Miscanthus as energy crop: Environmental assessment of a miscanthus biomass production case study in France

    DEFF Research Database (Denmark)

    Morandi, Fabiana; Perrin, A.; Østergård, Hanne

    2016-01-01

    The cultivation of miscanthus (Miscanthus x Giganteus) as biomass for energy production has increased year by year due to its agronomical performances. In particular, in France, miscanthus is cultivated in the Bourgogne region and it is used as feedstock to produce pellet. In this paper, emergy a...... an experimental miscanthus field in Italy. However, this implied a trade-off for the net energy production of about 50%.......The cultivation of miscanthus (Miscanthus x Giganteus) as biomass for energy production has increased year by year due to its agronomical performances. In particular, in France, miscanthus is cultivated in the Bourgogne region and it is used as feedstock to produce pellet. In this paper, emergy...... assessment of different logistic (harvesting) strategies for miscanthus production in the Bourgogne region is presented. Emergy assessment is a particular methodology suited to quantify the resource use of a process and to estimate the percentage of renewability of products or services. The case study...

  19. Parasitic macrofungi (Basidiomycetes on fruit shrubs and trees in the Tarnów town (S Poland

    Directory of Open Access Journals (Sweden)

    Marcin Piątek

    2014-08-01

    Full Text Available Results of 6 years of research carried out in the Tarnów town, southern Poland, are presented. Total number of 27 species of Basidiomycetes were recorded on 7 species of fruit shrubs and trees. Some of them were found on hosts new for Poland, on Malus domestica - Abortiporus biennis, Ganoderma australe, Meripilus giganteus, Stereum hirsutum and Volvariella bombycina; on Juglans regia - Ganoderma applanalum and Hineola auricula-judae.

  20. Foraging in groups allows collective predator detection in a mammal species without alarm calls

    OpenAIRE

    Olivier Pays; Guy Beauchamp; Alecia J. Carter; Anne W. Goldizen

    2013-01-01

    Although collective detection plays a key role in determining individual survival, few studies have carefully examined the collective process of detection. We investigated collective detection in the eastern grey kangaroo (Macropus giganteus), a species that forages in temporary groups and rarely produces auditory alarm signals on detection. In experimental trials, we exposed one group member to a predation threat (a python, Morelia spilota) that its companions could only detect indirectly by...

  1. PHYSICO-CHEMICAL PROPERTIES OF THE SOLID AND LIQUID WASTE PRODUCTS FROM THE HEAVY METAL CONTAMINATED ENERGY CROPS GASIFICATION PROCESS

    Directory of Open Access Journals (Sweden)

    Sebastian Werle

    2017-02-01

    Full Text Available The paper presents the results of basic physico-chemical properties of solid (ash and liquid (tar waste products of the gasification process of the heavy metal contaminated energy crops. The gasification process has carried out in a laboratory fixed bed reactor. Three types of energy crops: Miscanthus x giganteus, Sida hermaphrodita and Spartina Pectinata were used. The experimental plots were established on heavy metal contaminated arable land located in Bytom (southern part of Poland, Silesian Voivodship.

  2. Production et analyse d'huiles essentielles de plantes aromatiques et médicinales de Madagascar. Caractérisation par RMN13C, CPG(Ir) et CPG-SM

    OpenAIRE

    Rabehaja Rakotondragaby, Delphin Justin,

    2013-01-01

    This study was conducted under an agreement of co-supervision between the Universities of Antananarivo (Madagascar) and Corsica (France). It contributed to the characterization of five malagasy plants through the chemical composition of their essential oils (EO). Four aromatic and medicinal plants: Cymbopogon giganteus var. madagascariensis, Tana bojeriana, Croton kimosorum and Croton sp. grow wild in the south-western region of Madagascar (Toliara) whereas the species Vepris madagascarica is...

  3. Hydrothermal Liquefaction of Enzymatic Hydrolysis Lignin: Biomass Pretreatment Severity Affects Lignin Valorization

    DEFF Research Database (Denmark)

    Jensen, Mads M.; Djajadi, Demi T.; Torri, Cristian

    2018-01-01

    Alkalinehydrothermal liquefaction (HTL) of lignin-rich enzymatichydrolysis residues (EnzHR) from wheat straw and Miscanthusx giganteus was performed at 255, 300, and 345 °C to investigate valorization of this side-stream from second-generation bioethanol production. The EnzHR were from biomass...... contributed with additional chemical information as well as confirming trends seen from quantified monomers. This work is relevant for future lignin valorization in biorefineries based on current second-generation bioethanol production....

  4. Adaptive contraction of diet breadth affects sexual maturation and specific nutrient consumption in an extreme generalist omnivore.

    Science.gov (United States)

    Jensen, K; Schal, C; Silverman, J

    2015-04-01

    Animals balance their intake of specific nutrients, but little is known about how they do so when foraging in an environment with toxic resources and whether toxic foods promote adaptations that affect life history traits. In German cockroach (Blattella germanica) populations, glucose aversion has evolved in response to glucose-containing insecticidal baits. We restricted newly eclosed glucose-averse (GA) and wild-type (WT) female cockroaches to nutritionally defined diets varying in protein-to-carbohydrate (P : C) ratio (3 : 1, 1 : 1, or 1 : 3) or gave them free choice of the 3 : 1 and 1 : 3 diets, with either glucose or fructose as the sole carbohydrate source. We measured consumption of each diet over 6 days and then dissected the females to measure the length of basal oocytes in their ovaries. Our results showed significantly lower consumption by GA compared to WT cockroaches when restricted to glucose-containing diets, but also lower fructose intake by GA compared to WT cockroaches when restricted to high fructose diets or given choice of fructose-containing diets. Protein intake was regulated tightly regardless of carbohydrate intake, except by GA cockroaches restricted to glucose-containing diets. Oocyte growth was completely suppressed in GA females restricted to glucose-containing diets, but also significantly slower in GA than in WT females restricted to fructose-containing diets. Our findings suggest that GA cockroaches have adapted to reduced diet breadth through endocrine adjustments which reduce requirements for energetic fuels. Our study illustrates how an evolutionary change in the chemosensory system may affect the evolution of other traits that govern animal life histories. © 2015 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2015 European Society For Evolutionary Biology.

  5. How the use of nitrogen fertiliser may switch plant suitability for aphids: the case of Miscanthus, a promising biomass crop, and the aphid pest Rhopalosiphum maidis.

    Science.gov (United States)

    Bogaert, Florent; Chesnais, Quentin; Catterou, Manuella; Rambaud, Caroline; Doury, Géraldine; Ameline, Arnaud

    2017-08-01

    The use of nitrogen fertiliser in agrosystems can alter plant nitrogen and consequently improve nutrient availability for herbivores, potentially leading to better performance for herbivores and higher pest pressure in the field. We compared, in laboratory conditions, the effects of nitrogen fertilisation on a promising biomass crop, Miscanthus × giganteus, and its parents M. sinensis and M. sacchariflorus. The plant-mediated effects were compared on the second trophic level, the green corn leaf aphid Rhopalosiphum maidis. Results showed that the biomass and leaf C:N ratio of M. sinensis plants treated with nitrogen fertiliser were significantly greater than those of non-treated plants. As regards M. × giganteus and M. sacchariflorus, the only reported change was a significantly smaller leaf C:N ratio for treated M. sacchariflorus compared with non-treated plants. Surprisingly, nitrogen fertilisation had opposite effects on plant-herbivore interactions. Following nitrogen treatments, M. sinensis was less suitable in terms of intrinsic rate of increase for R. maidis, the feeding behaviour of which was negatively affected, while M. sacchariflorus and M. × giganteus exhibited greater suitability in terms of aphid weight. Nitrogen fertilisation had contrasting effects on the three species of Miscanthus plants. These effects cascaded up to the second trophic level, R. maidis aphid pests, either through a modification of their weight or demographic parameters. The implications of these results were discussed in the context of agricultural sustainability and intensive production practices. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  6. INFLUÊNCIAS DA ESPÉCIE, TRATAMENTO PRESERVATIVO E ADESIVOS NAS PROPRIEDADES FÍSICAS DO BAMBU LAMINADO COLADO

    Directory of Open Access Journals (Sweden)

    Rafael Amorim Rosa

    2016-01-01

    Full Text Available ABSTRACT This work aimed to evaluate the physical properties of laminated bamboo lumber - LBL in relation to species, preservative treatments and adhesive employed. Laths of Dendrocalamus giganteus and Bambusa vulgaris bamboos older than three years were produced cross-linked polyvinil acetate (PVAc the other in solution of disodium octaborate tetrahydrate (Na 2 B 8 O 13 4H 2 O - Timbor, with 2% concentration, during 15 days. After treated and air season, the laths were transformed into strips with dimensions of 0.5 x 3.0 x 45 cm (thickness x width x length and employed in the manufacture of laminated bamboo lumbers. The adhesives used for gluing the strips were the basis of polymer isocyanate emulsion (PIE, melamine urea formaldehyde (MUF, polyvinyl acetate cross (PVAc and resorcinol formaldehyde (RF. The preservative treatments and the adhesives did not influence the densities of LBLs manufactured with Dendrocalamus giganteus . For the Bambusa vulgaris, the densities of LBLs were affected by the type of adhesive. It was observed that the LBLs manufactured with Dendrocalamus giganteus had a higher dimensional stability than those produced with the Bambusa vulgaris . The MUF and RF adhesives have given greater dimensional stability to the BLCs produced with both species of bamboo. The LBLs adhered with EPI or PVA had greater delamination, regardless the species of bamboo and the preservative treatment, not being suitable for external uses.

  7. Bacterial community composition shifts in the gut of Periplaneta americana fed on different lignocellulosic materials.

    Science.gov (United States)

    Bertino-Grimaldi, Danielle; Medeiros, Marcelo N; Vieira, Ricardo P; Cardoso, Alexander M; Turque, Aline S; Silveira, Cynthia B; Albano, Rodolpho M; Bressan-Nascimento, Suzete; Garcia, Elói S; de Souza, Wanderley; Martins, Orlando B; Machado, Ednildo A

    2013-01-01

    Cockroaches are insects that can accommodate diets of different composition, including lignocellulosic materials. Digestion of these compounds is achieved by the insect's own enzymes and also by enzymes produced by gut symbionts. The presence of different and modular bacterial phyla on the cockroach gut tract suggests that this insect could be an interesting model to study the organization of gut bacterial communities associated with the digestion of different lignocellulosic diets. Thus, changes in the diversity of gut associated bacterial communities of insects exposed to such diets could give useful insights on how to improve hemicellulose and cellulose breakdown systems. In this work, through sequence analysis of 16S rRNA clone libraries, we compared the phylogenetic diversity and composition of gut associated bacteria in the cockroach Periplaneta americana collected in the wild-types or kept on two different diets: sugarcane bagasse and crystalline cellulose. These high fiber diets favor the predominance of some bacterial phyla, such as Firmicutes, when compared to wild-types cockroaches. Our data show a high bacterial diversity in P. americana gut, with communities composed mostly by the phyla Bacteroidetes, Firmicutes, Proteobacteria and Synergistetes. Our data show that the composition and diversity of gut bacterial communities could be modulated by diet composition. The increased presence of Firmicutes in sugarcane bagasse and crystalline cellulose-fed animals suggests that these bacteria are strongly involved in lignocellulose digestion in cockroach guts. Cockroaches are omnivorous animals that can incorporate in their diets food of different composition, including lignocellulosic materials. Digestion of these compounds is achieved by the insect's own enzymes and also by enzymes produced by gut symbiont. However, the influence of diet with different fiber contents on gut bacterial communities and how this affects the digestion of cockroaches is still

  8. Recent development in insect pheromone research, in particular in the Netherlands

    NARCIS (Netherlands)

    Ritter, F.J.; Persoons, C.J.

    1975-01-01

    A review is given of recent pheromone work carried out in the Netherlands on Lepidoptera, cockroaches, pharaoh's ants and termites, special emphasis being given to isolation and identification aspects. The sex pheromones of three leaf roller moths (Tortricidae) have been isolated, identified and

  9. Sensory cues involved in social facilitation of reproduction in Blattella germanica females.

    Science.gov (United States)

    Uzsák, Adrienn; Schal, Coby

    2013-01-01

    Cockroaches, like many other animal species, form aggregations in which social stimuli from conspecifics can alter the physiology, morphology, or behavior of individuals. In adult females of the German cockroach, Blattella germanica, social isolation slows oocyte development, sexual maturation, and sexual receptivity, whereas social interactions as minimal as between just two females accelerate reproduction; however, the sensory modalities and pathways that mediate these physiological and behavioral changes are poorly understood. We explored the roles of visual, olfactory, and tactile cues in the reproductive physiology of German cockroach females, and whether their effects are species-specific and related to circadian time. Our results show that tactile cues are the primary sensory input associated with social conditions--with no evidence for involvement of the visual and olfactory systems--and that the antennae play an important role in the reception of these tactile cues. This conclusion is supported by the observation that interactions with other insect species of similar or larger size and with similar antennal morphology also stimulate oocyte development in B. germanica. Social facilitation of reproduction is expected to be influenced by the circadian timing system, as females engage in more social contact during the day when they shelter in aggregations with conspecifics. Surprisingly, however, the female's reproductive rate was unresponsive to social interactions during the photophase, whereas social interactions as short as two hours during the scotophase were sufficient to induce faster reproduction.We discuss the adaptive significance of these sensory-neuroendocrine responses in the German cockroach.

  10. Applicator Training Manual for: Industrial, Institutional, Structural and Health-Related Pest Control.

    Science.gov (United States)

    Christensen, Christian M.; Scheibner, R. A.

    This manual gives descriptions and diagrams for identification of the following types of pests: four species of cockroach; ants; bees and wasps; parasitic pests of man such as bedbugs, fleas, and ticks; occasional invaders such as flies and millipedes; silverfish and firebrats; beetles; termites; moths; fungi; and vertebrates including rodents,…

  11. Identification of four Drosophila allatostatins as the cognate ligands for the Drosophila orphan receptor DAR-2

    DEFF Research Database (Denmark)

    Lenz, C; Williamson, M; Hansen, G N

    2001-01-01

    to be the receptor for an intrinsic Drosophila A-type (cockroach-type) allatostatin. Here, we have permanently expressed DAR-2 in CHO cells and found that it is the cognate receptor for four Drosophila A-type allatostatins, the drostatins-A1 to -A4. Of all the drostatins, drostatin-A4 (Thr...

  12. Toxoplasmosis in a colony of New World monkeys

    DEFF Research Database (Denmark)

    Dietz, H.H.; Henriksen, P.; Bille-Hansen, Vivi

    1997-01-01

    In a colony of New World monkeys five tamarins (Saguinus oedipus, Saguinus labiatus and Leontopithecus rosal. rosal.), three marmosets (Callithrix jacchus and Callithrix pygmaea) and one saki (Pithecia pithecia) died suddenly. The colony comprised 16 marmosets, 10 tamarins and three sakis. The ma...... layer of the cages, on cockroach extermination, and on freezing of raw meat....

  13. The hammock: a reservoir of allergens

    Directory of Open Access Journals (Sweden)

    Francisca X. M. Rego

    2011-01-01

    Full Text Available INTRODUCTION: Asthma affects approximately 10% of the world's population. Sensitization to allergens is an important risk factor, and exposure to allergens is associated with disease severity. METHODS: We performed skin tests to evaluate allergen sensitization to mites, cockroaches, cats, dogs, and molds in 73 asthmatic patients. Enzyme Linked Immunosorbent Assay was used to assay the mite and cockroach allergens found in dust from the bedding, hammocks, bedroom floors, living rooms, and kitchens of 29 patients and 14 controls. RESULTS: Fifty patients (68.5% had positive skin test responses. There were positive responses to D. pteronyssinus (52.0%, B. tropicalis (53.4%, T. putrescentiae (15.0%, E. maynei (12.3%, L. destructor (8.2%, B. germanica (20.5%, P. americana (21.9%, Felis catus (10.9%, C. herbarium (2.7%, A. alternata (4.1%, and P. notatun (1.3%. The exposure to mite and cockroach allergens was similar in the patients and the controls. The Dermatophagoides pteronyssinus Group 1 levels were highest in the beds and hammocks. The Blattella germanica Group 1 levels were highest in the kitchens, living rooms and hammocks. DISCUSSION: The positive skin tests to mites, cockroaches and cats were consistent with previous studies. D pteronyssinus was the most prevalent home dust mite, and hammocks were a source of allergens. To improve asthma prophylaxis, it is important to determine its association with mite allergen exposure in hammocks.

  14. The Invisible Worlds of Religion and Economy

    NARCIS (Netherlands)

    G. ter Haar

    2012-01-01

    textabstractTwelve years ago I accepted my Chair at ISS with an inaugural lecture entitled Rats, Cockroaches and People Like Us, in which I discussed the relation between people’s views of humanity and actual human rights. In it I made a plea for an intelligent use of the wide range of religious and

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 401 - 450 of 513 ... Vol 38, No 2 (2017), Selected food-borne parasites associated with cockroaches and houseflies in Ignatius Ajuru University of Education, Port Harcourt, Abstract. K Elele, L.B.B. Gboeloh ... Vol 37, No 2 (2016), Sero-prevalence of swine toxoplasmosis in Ogun State, Nigeria, Abstract. F.A. Akande, M.D. ...

  16. Public Health Pest Control Category Manual.

    Science.gov (United States)

    Bowman, James S.; Turmel, Jon P.

    This manual provides information needed to meet the standards for pesticide applicator certification. It presents pest control guidelines for those organisms of public health significance. Fact sheets with line drawings discuss pests such as cockroaches, bedbugs, lice, ants, beetles, bats, birds, and rodents. (CS)

  17. COMPARATIVE ASPECTS OF PLANT-CELL WALL DIGESTION IN INSECTS

    NARCIS (Netherlands)

    PRINS, RA; KREULEN, DA

    Although many phytophagous and wood-eating invertibrates form their own cellulases, there is an overwhelming variety of symbioses between plant- and wood-utilising insects and microorganisms. In one type of symbiosis (endosymbiosis), insects (rhinoceros beetle, cockroach, lower termites) host

  18. Nigerian Journal of Parasitology - Vol 32, No 2 (2011)

    African Journals Online (AJOL)

    The Role of Cockroaches (Blatta Orientalis and Periplaneta Americana) in Mechanical Transmission of Parasites in Households in Owerri, South East Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CMU Ajero, CN Ukaga, C Ebirim ...

  19. African Journal of Biotechnology - Vol 3, No 10 (2004)

    African Journals Online (AJOL)

    Synergism of cockroach (Periplaneta americana) α-amylase and α-glucosidase hydrolysis of starches · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Lucien Patrice Kouame, Edmond Dué Ahipo, Sebastien Lamine Niamke, Françoise Akissi Kouame, Alphonse ...

  20. The comparative insecticidal and residual efficacy of sniper and ...

    African Journals Online (AJOL)

    Otoigiakih

    Chemical control is still the main approach for urban pest control (Castle et al., 1999; Rozendaal, 1997; Marrs,. 1993; Lee and Yap, 2003; Tidwell et al., 1994). The use of insecticides is seen as the most effective tool in cockroach control program (WHO, 1996; Chavasse and. Yap, 1997; Lee and Yap, 2003; Tidwell et al., ...

  1. Molecular cloning, genomic organization, and expression of a C-type (Manduca sexta-type) allatostatin preprohormone from Drosophila melanogaster

    DEFF Research Database (Denmark)

    Williamson, M; Lenz, C; Winther, A M

    2001-01-01

    ). Chemically, the allatostatins can be subdivided into three different peptide groups: the large group of A-type (cockroach-type) allatostatins, which have the common C-terminal sequence Y/FXFGLamide; the B-type (cricket-type) allatostatins, which have the C-terminal sequence W(X(6))Wamide in common...

  2. Carbohydrate Chemistry from Fischer to Now

    Indian Academy of Sciences (India)

    field of natural products chemistry is presented with appro- ..... of the group classified as modified monosaccharides. Its. N-acetyl derivative is the sole constituent of the polysaccharide, chitin, which occurs in the shell of the lobster, the cockroach ..... One of the earliest carbohydrate-based drugs to be used in clinical practice ...

  3. Status of and Future Research on Thermosensory Processing.

    Science.gov (United States)

    Mizunami, Makoto; Nishino, Hiroshi; Yokohari, Fumio

    2016-01-01

    Thermosensation is critically important for survival of all animals. In the cockroach Periplaneta americana, thermoreceptor neurons on antennae and thermosensory interneurons in the antennal lobe have been characterized electrophysiologically, and recent studies using advanced transgenic technologies in the fruit fly Drosophila melanogaster have added much to the knowledge of these neurons, enabling us to discuss common principles of thermosensory processing systems in insects. Cockroaches and many other insects possess only one type of thermoreceptor neurons on antennae that are excited by cooling and inhibited by warming. In contrast, the antennae of fruit flies and other dipterans possess oppositely responding warm and cold receptor neurons. Despite differences in their thermoreceptive equipment, central processing of temperature information is much the same in flies and cockroaches. Axons of thermoreceptor neurons project to the margin of the antennal lobe and form glomeruli, from which cold, warm and cold-warm projection neurons originate, the last neurons being excited by both cooling and warming. Axons of antennal lobe thermosensory projection neurons of the antennal lobe terminate in three distinct areas of the protocerebrum, the mushroom body, lateral horn and posterior lateral protocerebrum, the last area also receiving termination of hygrosensory projection neurons. Such multiple thermosensory pathways may serve to control multiple forms of thermosensory behavior. Electrophysiological studies on cockroaches and transgenic approaches in flies are encouraged to complement each other for further elucidating general principles of thermosensory processing in the insect brain.

  4. Synthèses enzymatiques de néoglucoconjugués catalysées par l'alpha-glucosidase purifiée de la blatte Periplaneta americana (Linnaeus

    Directory of Open Access Journals (Sweden)

    Kamenan A.

    2005-01-01

    Full Text Available Enzymatic synthesis of neoglucoconjugates by purified α-glucosidase from cockroach Periplaneta americana (Linnaeus. Cockroach Periplaneta americana (Linnaeus contains in his digestive tract an acid (pH 5,0 and mesophile (50°C α-glucosidase. This enzyme, purified to homogeneity, hydrolyses highly maltose, sucrose and p-nitrophenyl-α-Dglucopyranoside. The ability of α-glucosidase from cockroach purified to homogeneity to catalyse transglucosylation reactions was tested using maltose and saccharose as glucosyl donors and 2-phenylethanol and phenol as acceptors. The experimental conditions were optimized in relation to the time course of the reaction, pH and concentrations of glucosyl donors and acceptors. The yields in transglucosylation reactions at 37 °C were very high and could attain 67% and 48% with 2-phenylethanol and phenol respectively as glucosyl acceptors. This α-glucosidase hydrolyzed the products formed. It seems that the products formed were the phenylethyl-α-D-glucoside and phenyl-α-D-glucoside. These results suggest that α- glucosidase from cockroach is an exoglucosidase which catalyse the splitting of the α-glucosyl residue from the non reducing terminal of the substrate to liberate α-glucose. This comportment indicates that this enzyme operated by a mechanism involving the retention of the anomeric configuration. On the basis of this work, α-glucosidase from P. americana appears to be a valuable tool for the preparation of α-neoglucoconjugates.

  5. Status of and future research on thermosensory processing

    Directory of Open Access Journals (Sweden)

    Makoto eMizunami

    2016-04-01

    Full Text Available Thermosensation is critically important for survival of all animals. In the cockroach Periplaneta americana, thermoreceptor neurons on antennae and thermosensory interneurons in the antennal lobe have been characterized electrophysiologically, and recent studies using advanced transgenic technologies in the fruit fly Drosophila melanogaster have added much to the knowledge of these neurons, enabling us to discuss common principles of thermosensory processing systems in insects. Cockroaches and many other insects possess only one type of thermoreceptor neurons on antennae that are excited by cooling and inhibited by warming. In contrast, the antennae of fruit flies and other dipterans possess oppositely responding warm and cold receptor neurons. Despite differences in their thermoreceptive equipment, central processing of temperature information is much the same in flies and cockroaches. Axons of thermoreceptor neurons project to the margin of the antennal lobe and form glomeruli, from which cold, warm and cold-warm projection neurons originate, the last neurons being excited by both cooling and warming. Axons of antennal lobe thermosensory projection neurons of the antennal lobe terminate in three distinct areas of the protocerebrum, the mushroom body, lateral horn and posterior lateral protocerebrum, the last area also receiving termination of hygrosensory projection neurons. Such multiple thermosensory pathways may serve to control multiple forms of thermosensory behavior. Electrophysiological studies on cockroaches and transgenic approaches in flies are encouraged to complement each other for further elucidating general principles of thermosensory processing in the insect brain.

  6. Author Details

    African Journals Online (AJOL)

    Nwachukwu, MO. Vol 36, No 2 (2015) - Articles The epidemiological implications of cockroaches (Periplaneta americana) in the dissemination of human diseases in Owerri, south-east, Nigeria Abstract. ISSN: 1117-4145. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...

  7. Author Details

    African Journals Online (AJOL)

    A Review on the Adaptation Strategies to the Impact of Climate Change on Health: A Key to Achieving Millennium Development Goals Abstract · Vol 32, No 2 (2011) - Articles The Role of Cockroaches (Blatta Orientalis and Periplaneta Americana) in Mechanical Transmission of Parasites in Households in Owerri, South East ...

  8. Foreign Bodies in the Ear as Seen at Kigali University Teaching ...

    African Journals Online (AJOL)

    Background: Foreign bodies (FB) lodged in the ear is a common complaint at emergency departments. FBs range from vegetable such as seeds and grains, non-vegetable such as beads, batteries, cotton wool, toys, stones, folded paper and animate FBs such as ants and cockroaches. A prospective study was carried out in ...

  9. Protease-Activated Receptor-2 Activation Contributes to House Dust Mite-Induced IgE Responses in Mice

    NARCIS (Netherlands)

    Post, Sijranke; Heijink, Irene; Petersen, A H; de Bruin, Harold G.; van Oosterhout, Antoon J. M.; Nawijn, Martijn C.

    2014-01-01

    Aeroallergens such as house dust mite (HDM), cockroach, and grass or tree pollen are innocuous substances that can induce allergic sensitization upon inhalation. The serine proteases present in these allergens are thought to activate the protease-activated receptor (PAR)-2, on the airway epithelium,

  10. An integrated pest management program as a pests control strategy ...

    African Journals Online (AJOL)

    Phukubje, Justice

    and document analysis tools. The findings of the survey revealed a significant ..... equipment, materials and know- how, cockroach control can be a ... and birds. • They go through the four life cycle stages of egg, larva, pupa, and imago (adult). • Always do a thorough inspection of collection; fleas can hide under mats with fur.

  11. Ecological studies of some insects associated with Bedouin ...

    African Journals Online (AJOL)

    Ecological studies of some insects associated with Bedouin settlements in St Katherine Protectorate, South Sinai, Egypt. ... Cockroaches were very abundant in houses, peaking in August, and reaching a minimum in winter. The abundance of Vespa orientalis has important implications for wild bees, and the huge numbers ...

  12. Untitled

    Indian Academy of Sciences (India)

    central nervous system. Scharrer (1941) has described the neurosecretory centres of the sub-oesophageal mass of the cockroach, Day (1940) has described the neurosecretory cells of the abdominal ganglia of Lepidoptera, and Nayar (1953) has observed the presence of these in the metathoracic ganglion of the bug Iphia ...

  13. Once in Contact, Always in Contact: Contagious Essence and Conceptions of Purification in American and Hindu Indian Children

    Science.gov (United States)

    Hejmadi, Ahalya; Rozin, Paul; Siegal, Michael

    2004-01-01

    Cultural and age differences in responses to contamination and conceptions of purification were examined in Hindu Indian (N = 125) and American (N = 106) 4- to 5-year-olds and 8-year-olds, who were provided with stories of juice contaminated by contact with a cockroach, a human hair, and a stranger (via sipping). Children who rejected the juice as…

  14. Contamination Sensitivity in Young Children.

    Science.gov (United States)

    Siegal, Michael; Share, David L.

    1990-01-01

    Revealed that children were able to indicate that an apparently safe substance such as juice may be contaminated by contact with a foreign body such as a cockroach. Supported the hypothesis that early sensitivity to substances that contain invisible contaminates may be guided by knowledge of a distinction between appearance and reality. (RH)

  15. Changing Perceptions of Unpopular Animals through Facts, Poetry, Crafts, and Puppet Plays

    Science.gov (United States)

    Rule, Audrey C.; Zhbanova, Ksenia S.

    2012-01-01

    Today's children are often separated from the natural world, developing fear and aversion to wild creatures. This humane education program used curriculum-blended science lessons that focused on eight generally disliked animals: bat, skunk, snake, mouse, spider, centipede, cockroach, and mosquito. First and second grade students participated in 6…

  16. Repellency of Dettol, a Commercial Cleaning Product, Against Adult ...

    African Journals Online (AJOL)

    acer

    When cockroaches run over food, they may leave filth or oily liquid that has offensive and sickening odour which ruin food or render it unacceptable ..... The protozoan fauna living in the digestive system of. Periplaneta americana in Kolkata, West. Bengal,. India. Journal of. Parasitic Diseases, 30 (1):76-80. Hahn, J. (2003).

  17. The single kinin receptor signals to separate and independent physiological pathways in Malpighian tubules of the yellow fever mosquito

    Science.gov (United States)

    In the past we have used the leucokinins, the kinins of the cockroach Leucophaea, to evaluate the mechanism of diuretic action of kinin peptides in Malpighian tubules of the yellow fever mosquito Aedes aegypti. Now using aedeskinins, the kinins of Aedes, are available, we find that in isolated Aede...

  18. The insecticidal effect of diatomaceous earth against adults and nymphs of Blattella germanica.

    Science.gov (United States)

    Hosseini, Seyyed Akbar; Bazrafkan, Sahar; Vatandoost, Hassan; Abaei, Mohammad Reza; Ahmadi, Mussa Soleimani; Tavassoli, Maryam; Shayeghi, Mansoreh

    2014-05-01

    To evaluate the insecticidal effect of diatomaceous earth (DE) against adults and nymphs of Blattella germanica. This cross sectional study has been done on the laboratory strain of German cockroaches. Two stages, nymph and adult, were exposed to six dose rates of the DE, 2.5, 5, 10, 15, 20 and 25 g/m(2), at 24, 48 and 72 h exposure period. Mortality (number of dead cockroaches) was assessed after 24 h. Other exposed specimens were transferred to the beakers contained food and water for counting the retard mortality rate after 1 week. Increasing in dose rates of DE increased mortality rate, so that the lowest and highest mortality rates were observed in 2.5 and 25 g/m(2), respectively. The results of the statistical analysis showed no significant difference in the lethality of 50% of DE plus water on the German cockroach nymphs. Due to the resistance of German cockroach against organochloride, organophosphorus, carbamate and pyrethriodes insecticides, it is suggested to use DE for insect's control.

  19. A Model of Political Violence

    Science.gov (United States)

    2015-01-01

    resources such as weapons and finances , and the ability to mobilize personnel. Of course, a group’s ability to develop capability is partially...targets as cockroaches. A contemporary example of religious manipulation is the Islamic State’s claims that their targets are apostates or infidels

  20. Meandering into astrophysics

    Indian Academy of Sciences (India)

    Lawrence

    they taught, and instinctively emphasised process over outcome, whether it was puzzling out a maths problem, classifying a plant, measuring the Sodium doublet or dissecting a cockroach. A love for empirical work, in fact not seeing it as inferior to or even dis- parate from theoretical work, is an ethos I certainly imbibed in my.