Burrowing and avoidance behaviour in marine organisms exposed to pesticide-contaminated sediment

DEFF Research Database (Denmark)

Møhlenberg, Flemming; Kiørboe, Thomas

1983-01-01

Behavioural effects of marine sediment contaminated with pesticides (6000 ppm parathion, 200 ppm methyl parathion, 200 ppm malathion) were studied in a number of marine organisms in laboratory tests and in situ. The burrowing behaviour in Macoma baltica, Cerastoderma edule, Abra alba, Nereis...

BMAA in shellfish from two Portuguese transitional water bodies suggests the marine dinoflagellate Gymnodinium catenatum as a potential BMAA source.

Science.gov (United States)

Lage, Sandra; Costa, Pedro Reis; Moita, Teresa; Eriksson, Johan; Rasmussen, Ulla; Rydberg, Sara Jonasson

2014-07-01

The neurotoxin β-N-methylamino-l-alanine (BMAA) and its putative role in multiple neurodegenerative diseases have been intensely studied since 2005 when the toxin was discovered to be produced by worldwide-distributed cyanobacterial species inhabiting terrestrial, marine, brackish, and freshwater ecosystems. Recently, BMAA production was also associated with one eukaryotic group, namely, diatoms, raising questions about its production by other phytoplanktonic groups. To test for BMAA bioavailability in ecosystems where abundant phytoplanktonic blooms regularly occur, samples of filter-feeding shellfish were collected in two Portuguese transitional water bodies. BMAA content in cockles (Cerastoderma edule) collected weekly between September and November 2009 from Ria de Aveiro and at least once a month from May to November from Ria Formosa, fluctuated from 0.079±0.055 to 0.354±0.066μg/g DW and from below the limit of detection to 0.434±0.110μg/g DW, respectively. Simultaneously to BMAA occurrence in cockles, paralytic shellfish toxins were detected in shellfish as a result of Gymnodinium catenatum blooms indicating a possible link between this marine dinoflagellate and BMAA production. Moreover, considerable high BMAA levels, 0.457±0.186μg/g DW, were then determined in a laboratory grown culture of G. catenatum. This work reveals for the first time the presence of BMAA in shellfish from Atlantic transitional water bodies and consubstantiate evidences of G. catenatum as one of the main sources of BMAA in these ecosystems. Copyright © 2014 Elsevier B.V. All rights reserved.

ENVIRONMENTAL-EFFECTS ON THE GROWTH-RATE OF INTERTIDAL INVERTEBRATES AND SOME IMPLICATIONS FOR FORAGING WADERS

NARCIS (Netherlands)

WANINK, JH; ZWARTS, L

1993-01-01

The paper describes effects of intertidal height and sediment type on growth rate of the bivalves Cerastoderma edule, Macoma balthica, Mya arenaria, Mytilus edulis and Scrobicularia plana, and of the worms Arenicola marina, Nephtys hombergii and Nereis diversicolor in the eastern part of the Dutch

A positive allelopathic effect of corn cockle, agrostemma githago, on wheat, triticum aestivum

DEFF Research Database (Denmark)

Søgaard, B.; Doll, H.

1992-01-01

The effect of com cockle on wheat was studied during germination and on adult plants in a growth chamber. Seedling length of wheat germinated together with corn cockle for 5 days increased 13%. Wheat growing together with corn cockle in pots to maturity had a statistically significant higher wheat...... biomass and grain production than wheat growing alone. However, two other experiments with adult plants harvested before wheat maturity showed no effect of corn cockle on wheat production per pot. Within the pots the presence of corn cockle influenced wheat in all three experiments. Wheat plants growing...... at the same position as a corn cockle plant were 20 to 50% larger than wheat plants standing alone....

RECONSTRUCTING DIET COMPOSITION ON THE BASIS OF FECES IN A MOLLUSK-EATING WADER, THE KNOT CALIDRIS-CANUTUS

NARCIS (Netherlands)

DEKINGA, A; PIERSMA, T

Methods are described to assess the molluscan diet of Knots feeding on intertidal flats in western Europe from their faecal output. The size distributions of two common bivalve prey, Macoma balthica and Cerastoderma edule, can be estimated from the heights of shell hinges retrieved from droppings.

Reconstructing diet composition on the basis of faeces in a mollusc-eating wader, the Knot Calidris canutus

NARCIS (Netherlands)

Dekinga, A.; Piersma, T.

1993-01-01

Methods are described to assess the molluscan diet of Knots feeding on intertidal flats in western Europe from their faecal output. The size distributions of two common bivalve prey, Macoma balthica and Cerastoderma edule, can be estimated from the heights of shell hinges retrieved from droppings.

Effects of suction-dredging for cockles on non-target fauna in the Wadden Sea

NARCIS (Netherlands)

Hiddink, JG

2003-01-01

Suction dredging for cockles removes large cockles from tidal flats and may also cause mortality of non-target fauna and make the habitat less suitable for some species. This study examines whether suction dredging for cockles on tidal flats of the Dutch Wadden Sea had affected densities of

Preliminary investigations into the aetiology and treatment of cockle, a sheep pelt defect.

Science.gov (United States)

Heath, A C; Cole, D J; Bishop, D M; Pfeffer, A; Cooper, S M; Risdon, P

1995-01-01

A defect of sheep pelts known as cockle, detectable after depilation, but usually first noted only in the pickled pelt or tanned stage of processing, was studied to establish causal factor(s) and effective treatments. In addition, data on the histology and seasonal prevalence of the disease were obtained. Samples collected soon after slaughter from pelts identified at the pickled pelt stage as having cockle, had a superficial dermatitis with infiltration of eosinophils. This may represent an immediate hypersensitivity reaction of the sheep to lice. Treatments of sheep with either insecticides, disinfectants or shearing showed that where biting lice (Bovicola ovis) were removed, cockle lesions had either disappeared or regressed on pickled pelts. In Trial 1 diazinon reduced cockle prevalence and severity substantially; cypermethrin had a less pronounced effect. In Trial 2 diazinon, cypermethrin, Hibitane and Savlon were equally effective in reducing biting louse numbers as shown by counts of lice at 35 and 63 days post-treatment. Reduction of cockle on pelts from sheep slaughtered at 39 days post-treatment was achieved best by both diazinon and shearing. Examination of other pelts at 67 days post-treatment showed diazinon and Hibitane to be equally effective in reducing cockle. Furthermore, shearing in the absence of insecticides reduced the severity and extent of lesions on cockled pelts. The diazinon excipient and zinc sulphate were consistently poor at removing lice and reducing cockle prevalence and severity. The results have important implications for the leather industry in that shearing and good dipping practice with appropriate chemicals at the right time can lead to improved pelt quality. However, an incentive scheme for farmers, and a means of identifying individual pelts to the farms or origin, are both necessary before a marked improvement is likely to occur.

Cockle Field Caging Experiment Data (2014)

Data.gov (United States)

U.S. Environmental Protection Agency — To determine whether differences in cockle density or qualitative burial depth observed during the 2014 field survey were affected by green macroalgal (GMA) mats, we...

Cockle Temperature Exposure Lab Experiment (2016)

Data.gov (United States)

U.S. Environmental Protection Agency — We carried out a lab experiment in which we exposed cockles to a range of air temperatures to simulate the physiological rigors of exposure to sunlight and air at...

[The chayote, Sechium edule Swartz (Cucurbitaceae)].

Science.gov (United States)

Flores, E M

1989-06-01

Sechium edule (chayote) is a cucurbitaceus species. A fast transition from domestic crop to exportation product, made evident the lack of adequate information about the plant and the cultivation techniques. This work summarizes, reinterprets or describes comprehensively several aspects related to the taxonomy, origin, morphology, physiology, ecology and culture of the species.

Cockle/Green Macroalgae Field Survey Data (2014)

Data.gov (United States)

U.S. Environmental Protection Agency — To quantify any spatial or temporal variability in cockle densities with respect to in situ GMA biomass in Yaquina Bay, OR, we conducted field surveys during...

Detection of Salmonella sp., Vibrio sp. and total plate count bacteria on blood cockle (Anadara granosa)

Science.gov (United States)

Ekawati, ER; Yusmiati, S. N. H.

2018-01-01

Blood cockle (Anadara granosa) has high level of zinc and protein, which is beneficial for therapeutic function for malnourished particularly stunting case in children. Zinc in animal foods is more absorbable than that from vegetable food. Blood cockle (Anadara granosa) is rich in nutrient and an excellent environment for the growth of microorganisms. This research aimed to identify the contamination of Salmonella sp., Vibrio sp. and total plate count bacteria on blood cockle (Anadara granosa). This was observation research with laboratory analysis. Salmonella sp. and Vibrio sp. were detected from blood cockle. Total plate count was determine of the total amount of the bacteria. Results detected from 20 samples of blood cockle showed that all samples were negative of Salmonella sp. and 1 sample positive Vibrio sp. The result of total plate count bacteria was < 5 x 105 colony/g sample.

Facile Synthesis of Calcium Carbonate Nanoparticles from Cockle Shells

Directory of Open Access Journals (Sweden)

Kh. Nurul Islam

2012-01-01

Full Text Available A simple and low-cost method for the synthesis of calcium carbonate nanoparticles from cockle shells was described. Polymorphically, the synthesized nanoparticles were aragonites which are biocompatible and thus frequently used in the repair of fractured bone and development of advanced drug delivery systems, tissue scaffolds and anticarcinogenic drugs. The rod-shaped and pure aragonite particles of 30±5 nm in diameter were reproducibly synthesized when micron-sized cockle shells powders were mechanically stirred for 90 min at room temperature in presence of a nontoxic and nonhazardous biomineralization catalyst, dodecyl dimethyl betaine (BS-12. The findings were verified using a combination of analytical techniques such as variable pressure scanning electron microscopy (VPSEM, transmission electron microscopy (TEM, Fourier transmission infrared spectroscopy (FT-IR, X-ray diffraction spectroscopy (XRD, and energy dispersive X-ray analyser (EDX. The reproducibility and low cost of the method suggested that it could be used in industry for the large scale synthesis of aragonite nanoparticles from cockle shells, a low cost and easily available natural resource.

Coastal oceanographic processes associated with blood cockle (Anadara granosa induce spawning season in Kapar, Selangor, Malaysia

Directory of Open Access Journals (Sweden)

Hadzley Harith

2016-12-01

Full Text Available Study on coastal processes in Kapar waters was conducted from 2008–2016. The aim of this study is to identify potential blood cockle (Anadara granosa induce spawning ground based on physical intermittency. A total of 132 sampling stations were recorded. A thermal power station situated 2km away is discharging treated warm water (3m MSL which prevents cockle farmers from harvesting due to their maximum of 3m long hand dredge. Thus, this information could be useful for cockle sustainable management plan in near future.

Utilization of molecular markers for the conservation of blood cockles, Anadara granosa (Arcidae).

Science.gov (United States)

Chee, S Y; Azizah, M N S; Devakie, M N

2011-06-28

We examined genetic variation in blood cockles in an effort to obtain information useful for the sustainability, management, and the stability of this species as a major commodity in the fisheries sector. Ten populations of cockles were sampled from the north to the south of the west coast of peninsular Malaysia. The cockles were collected in collaboration with the Fisheries Research Institute, Penang. The population genetic analysis of the cockles were studied via RAPD-PCR and mtDNA sequencing. Three hundred individuals were analyzed with RAPD-PCR experiments. High gene diversity over all loci was observed (Shannon index = 0.549 ± 0.056 and Nei's gene diversity = 0.4852 ± 0.0430 among 35 loci). The second method, mtDNA sequencing, was employed to complement the information obtained from RAPD-PCR. The gene selected for mtDNA sequencing was cytochrome c oxidase I (COI). One hundred and fifty individuals were sequenced, yielding a partial gene of 585 bp. Statistical analysis showed homogeneity in general but did reveal some degree of variability between the populations in Johor and the rest of the populations. The Mantel test showed a positive but nonsignificant correlation between geographic and genetic distances (r = 0.2710, P = 0.622), as in the RAPD analysis. We propose that the homogeneity between distant populations is caused by two factors: 1) the translocation of the spats; 2) larvae are carried by current movement from the north of the peninsula to the south. The different genetic composition found in Johor could be due to pollution, mutagenic substances or physical factors such as the depth of the water column. This population genetic study is the first for this species in peninsular Malaysia. The data from this study have important implications for fishery management, conservation of blood cockles and translocation policies for aquaculture and stock enhancement programs.

Properties of palm oil fuel ash cement sand brick containing pulverized cockle shell as partial sand replacement

Science.gov (United States)

Mat Aris, S.; Muthusamy, K.; Uzer, A.; Ahmad, S. Wan

2018-04-01

Environmental pollution caused by the disposal of solid wastes generated from both palm oil industry and cockle shell trade has motivated researches to explore the potential of these wastes. Integrating these wastes in production of construction material is one of the ways to reduce amount of waste thrown at dumping area. Thus, the present investigation investigates the performance of palm oil fuel ash (POFA) cement sand brick containing pulverized cockle shell as partial fine aggregate replacement. All mixes used contain 20% of POFA as partial cement replacement. Total of six mixes were prepared by adding a range of pulverized cockle shell that is 0%, 10%, 20%, 30%, 40% and 50% as partial sand replacement. The mixes were prepared in form of brick. All the water cured samples were tested for compressive strength and flexural strength until 28 days. Findings show that brick produced using 20% pulverized cockle shell exhibit the highest compressive strength and flexural strength also the lowest water absorption value.

DECOMPOSITION STUDY OF CALCIUM CARBONATE IN COCKLE SHELL

Directory of Open Access Journals (Sweden)

MUSTAKIMAH MOHAMED

2012-02-01

Full Text Available Calcium oxide (CaO is recognized as an efficient carbon dioxide (CO2 adsorbent and separation of CO2 from gas stream using CaO based adsorbent is widely applied in gas purification process especially at high temperature reaction. CaO is normally been produced via thermal decomposition of calcium carbonate (CaCO3 sources such as limestone which is obtained through mining and quarrying limestone hill. Yet, this study able to exploit the vast availability of waste resources in Malaysia which is cockle shell, as the potential biomass resources for CaCO3 and CaO. In addition, effect of particle size towards decomposition process is put under study using four particle sizes which are 0.125-0.25 mm, 0.25-0.5 mm, 1-2 mm, and 2-4 mm. Decomposition reactivity is conducted using Thermal Gravimetric Analyzer (TGA at heating rate of 20°C/minutes in inert (Nitrogen atmosphere. Chemical property analysis using x-ray fluorescence (XRF, shows cockle shell is made up of 97% Calcium (Ca element and CaO is produced after decomposition is conducted, as been analyzed by x-ray diffusivity (XRD analyzer. Besides, smallest particle size exhibits the highest decomposition rate and the process was observed to follow first order kinetics. Activation energy, E, of the process was found to vary from 179.38 to 232.67 kJ/mol. From Arrhenius plot, E increased when the particle size is larger. To conclude, cockle shell is a promising source for CaO and based on four different particles sizes used, sample at 0.125-0.25 mm offers the highest decomposition rate.

Evaluating health risks posed by heavy metals to humans consuming blood cockles (Anadara granosa) from the Upper Gulf of Thailand.

Science.gov (United States)

Sudsandee, Suntorn; Tantrakarnapa, Kraichat; Tharnpoophasiam, Prapin; Limpanont, Yanin; Mingkhwan, Ratchaneekorn; Worakhunpiset, Suwalee

2017-06-01

There is global concern about heavy metal contamination in the environment. Adverse health effects can be caused by heavy metals in contaminated food and water. Therefore, environmental monitoring studies and risk assessments should be conducted periodically. In this study, we measured levels of Cd, Cr, Cu, Hg, Mn, Ni, Pb, and Zn in blood cockles (Anadara granosa) collected from three locations in the Upper Gulf of Thailand. Hazard quotients and hazard indices were calculated to evaluate the health risks posed by heavy metals in consumed blood cockles. Heavy metal concentrations in all of the blood cockle samples were lower than the relevant food standards. The hazard quotients and hazard indices were heavy metals in blood cockles over a human lifetime.

Utilization of wasted cockle shell as a natural coagulant and a neutralizer of polluted water in Bangka Belitung islands, Indonesia

Science.gov (United States)

Tiandho, Y.; Aldila, H.; Mustari; Megiyo; Afriani, F.

2018-05-01

Bangka Belitung Islands is the largest tin producer in Indonesia. The high activity of tin mining caused the environmental damage which had an impact on the emergence of clean water crisis in some areas in this province. In this paper, a simple water quality improvement method based on wasted cockle shell was developed. Based on x-ray diffraction analysis it is known that calcination of cockle shell powder at 700°C will decompose the powder into calcium oxide compound. The addition of calcined cockle shell powder into acidic water from Merawang Sub-district will increase the pH of water through the process of forming hydroxide groups in the water. The calcined cockle shell powder can also coagulate pollutants in some polluted water from Koba Sub-district. The coagulation results were analyzed using SEM/EDS.

Mineral contents and their solubility on calcium carbonat calcite nanocrystals from cockle shell powder (Anadara granosa Linn)

Science.gov (United States)

Widyastuti, S.; Pramushinta, I. A.

2018-03-01

Prepared and characterized calcium carbonat calcite nanocrystals improves solubility. Calcium carbonat calcite nanocrystals were synthesized using precipitation method from the waste of blood clam cockle shells (Anadara granosa Linn). This study was conducted to analyze mineral composition of nanocrystals calcium carbonat calcite cockle (Anadara granosa) shell for calcium fortification of food applications and to evaluate the solubilities of Calsium and Phospor. The sample of nanocrystals from cockle shells was evaluated to determine the content of 11 macro-and micro-elements. These elements are Calcium (Ca), Magnesium (Mg), Sodium (Na), Phosphorus (P), Potassium (K), Ferrum (Fe), Copper (Cu), Nickel (Ni), Zink (Zn), Boron (B) and Silica (Si)). Cockleshell powders were found to contain toxic elements below detectable levels. The solubilities of Calcium and Phospor were p<0.05.

Blood Cockle Shells Waste as Renewable Source for the Production of Biogenic CaCO3 and Its Characterisation

Science.gov (United States)

Asmi, D.; Zulfia, A.

2017-11-01

The prowess to reuse and recycle of blood cockle shells for raw material in bio-ceramics applications is an attractive component of integrated waste management program. In this paper an attempt is made to introduce a simple process to manufacture biogenic CaCO3 powder from blood cockle shells waste. The biogenic CaCO3 powder was produced from rinsing of blood cockle shells waste using deionised water and oxalic acid for cleaning the dirt and stain on the shells, then drying and grinding followed by heat treatment at 500 and 800 °C for 5 h. The powder obtained was characterised by XRF, DTA/TG, SEM, FTIR, and XRD analysis. The amount of 97.1 % CaO was obtained from XRF result. The thermal decomposition of CaCO3 become CaO due to mass loss was observed in the TG curve. The SEM result shows the needle-like aragonite morphology of blood cockle shells powder transformed to cubic-like calcite after heat treated at 500 °C. These results were consistent with FTIR and XRD results.

Cadmium, Chromium, Copper, Lead, Ferum And Zinc Levels In The Cockles (Anadara Granosa) From Kuala Selangor, Malaysia

International Nuclear Information System (INIS)

Sabarina Md Yunus; Zaini Hamzah; Nik Azlin Nik Ariffin; Mohd Busairi Muslim

2014-01-01

The aim of this study is to provide information on the concentration of metals in cockles (Anadara granosa) from Kuala Selangor, Malaysia. Cockles in this study area were taken by local people as part of their diet, therefore necessary to determine metal concentrations in the cockles. Sample collection activity was conducted at Kuala Selangor (03degree20' N - 101degree15 ' E) between the month of March, and April 2012. About two kilograms of samples were purchased from local fish market at Kuala Selangor. The concentration of Cd, Cr, Cu, Pb, Fe and Zn in the samples were analysed using Inductively Coupled Plasma Optical Emission (ICP-OES). The observed mean concentration of Cd, Cr, Cu, Pb, Fe and Zn is 1.48±0.33, 1.43±0.91, 15.78±5.28, 1.11±0.46, 875.55±343.43 and 94.17±7.91 mg/ kg respectively. From the public health point of view, these metal concentrations were below the maximum permissible levels set by the Malaysian Food Act (1983) and Regulations (1985). Therefore, cockles from Kuala Selangor are safe for human consumption. (author)

Life Cycle Assessment of Cockles (Anadara granosa Farming: A Case Study in Malaysia

Directory of Open Access Journals (Sweden)

Siti Dina Razman Pahri

2016-07-01

Full Text Available Life cycle assessment (LCA was applied to evaluate the environmental performance of the cockle farming activity in Malaysia. The study was conducted by a mid-point approach following the ISO 14040 series of standard and CML-IA Baseline V3.01 method using SimaPro 8 software. A total of ten impact categories were selected namely abiotic depletion (ABD, global warming potential (GWP, ozone layer depletion (OLD, human toxicity (HT, freshwater ecotoxicity (FET, marine aquatic ecotoxicity (MET, terrestrial ecotoxicity (TET, photochemical oxidation (PO, acidification (ACD, and eutrophication (EUT. Capital goods dominate the impact of HT (82.20%, ABD (81.72%, EUT (81.36%, FET (79.3%, PO (79.02%, MET (75.06%, TET (59.8%, and GWP (53.15%. Operational goods dominate OLD at 80.24% and ACD at 53%. Fiberglass material dominated almost the entire environmental impact except for the eutrophication which was dominated by polypropylene. Harvesting process was identified as the main process contributed to the potential environmental impact in cockle farming. LCA is potentially expanded not only to the entire chain of cockle production, but also to put into practice other aquaculture systems in Malaysia.

Accumulation of Sellafield-derived radiocarbon ((14)C) in Irish Sea and West of Scotland intertidal shells and sediments.

Science.gov (United States)

Tierney, Kieran M; Muir, Graham K P; Cook, Gordon T; MacKinnon, Gillian; Howe, John A; Heymans, Johanna J; Xu, Sheng

2016-01-01

The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ((14)C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This (14)C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate (14)C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in (14)C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine (14)C-enriched material close to Sellafield. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

Identification of Listeria monocytogenes on Green Mussels and Cockle Shell

Directory of Open Access Journals (Sweden)

Winiati Puji Rahayu

2017-02-01

Full Text Available AbstractGreen mussel (Perna viridis and cockle shell (Anadara granosa are one of many sources of animal protein which is many cultivated in Indonesia because their price is relatively affordable. This study was conducted to identify the presence of Listeria monocytogenes in 27 samples of green mussels and 3 samples of cockle shells using real-time Polymerase Chain Reaction (real-time PCR and biochemical methods. The target gene for amplification in real-time PCR was an hlyA gene because this gene was a determinant of virulence genes that produce listeriolysin O. Primers used in this study were forward primer DG69 (GTG CCG GGT AAA AGA CCA TA and reverse primer DG74 (CGC CAC TGA GAT ACT AT and fluorescence signals indicator using SYBR Green I. The results of analysis using real-time PCR were negative Listeria monocytogenes in all samples, while using biochemical methods there was one of 30 samples contaminated by Listeria welshimeri.

Bioaccumulation of Trace Metals in Bloody Cockle (Anadara senilis) from Ghana: Biokinetics and Human Bioaccessibility Studies

International Nuclear Information System (INIS)

Kuranchie-Mensah, Harriet

2016-07-01

A series of experimental studies has been carried out to study the kinetic of accumulation and human exposure to trace metals using the bloody cockle (Anadara senilis) as a model organism. This species is of ecological and economic importance in Ghana and other parts of Western Africa where they are commonly found. Trace metals mainly Mn, Co, Zn, Ag and Cd were studied using both laboratory mesocosm and field investigations. The laboratory experiments were carried out through the use of radiotracers: "5"4Mn, "5"7Co, "6"5Zn, "1"1"0"mAg and "1"0"9Cd, to study the kinetics of metal accumulation in the cockle through 2 different exposure pathways. The variability of metal bioaccumulation in the bloody cockle as a function of environmental and physiological conditions was also investigated. Metal subcellular fractionation, tissue distribution and simulating human digestion through the use of in vitro methodology were incorporated to understand the processes governing metal accumulation and human health risk assessment from the consumption of contaminated shellfish. Following a 2-hour single feeding and a 28-day depuration period, metals ingested with food (Isochrysis galbana or Skeletonema costatum) were moderate to highly assimilated in the cockle (11 to 72%), although, the degree of assimilation was dependant on the type of phytoplankton strain, the studied metals and the size of the cockle. Retention of assimilated metals was metal dependant being described as weak for Ag (T_b_1_/_2 of 2 to 6 days), moderate for Mn, Co and Zn (T_b_1_/_2 of 13 to 47 days) and strong for Cd (T_b_1_/_2 ≥ 97 days). Over a 28-day dissolved exposure period, bioconcentration kinetics of metals in two size classes of bloody cockles studied under different exposure conditions (high and low salinity) generally were best described by a saturation model assuming an apparent steady state concentration. The results showed strong variability on the kinetics of metal uptake among different size

Uptake and Loss Kinetics of 57Co, 85Sr and 134Cs on Blood Cockle Anadara granosa

International Nuclear Information System (INIS)

Srisuksawad, K; Prasertchiewchan, N.; Tungkitjanukij, S.; Pakkong, P.

2005-02-01

Adult blood cockle (A. granosa) were exposed in the laboratory to 57 Co, 85 Sr, and 134 Cs in seawater at average +- s.e. stable activities of 0.725+-0.010 Bq/ml, 0.917+-0.066 Bq/ml and 1.37+-0.105 Bq/ml, respectively. The study aims to determine key contaminant bioaccumulation, retention and loss parameters for bio-indicator organisms used in assessment of the impact of the effluent discharge from nuclear and non-nuclear facilities on coastal area. Natural coastal water conditions in dry season with a salinity of 30 ppt, at 30οC and p H 8.1+-0.1 of the study area (Bang Pa Kong river basin) were simulated as far as practicable. 19 d uptake of radiotracers showed that blood cockle did not accumulate 134 Cs and 85 Sr but considerably accumulated 57 Co. Non-linear regression model fitting of a 1-compartment exponential uptake model derived overall weight concentration factors for the whole cockle at saturation of 687.6+-6.23 ml/g for 57 Co. 22 d loss experiment showed that 57 Co is tightly bounded in blood cockle and 63.2+-15.2% retained in the whole body. Loss of 57 Co displayed 2-compartment loss kinetic. The calculated half time for the short and long components of loss model was estimated 1.4 dand 41 d, respectively

Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram

OpenAIRE

Lalthansanga, James; Samanta, A. K.

2015-01-01

Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves...

Hemiuroid trematode sporocysts are undetected by hemocytes of their intermediate host, the ark cockle Anadara trapezia: potential role of surface carbohydrates in successful parasitism.

Science.gov (United States)

Kawasaki, Minami; Delamare-Deboutteville, Jerome; Dang, Cecile; Barnes, Andrew C

2013-12-01

In order to establish a successful relationship with their hosts, parasites must subvert or evade immune defences. Cockle Anadara trapezia and Sydney Rock oyster (SRO) Saccostrea glomerata live in the same location but only ark cockles are infected by sporocysts of hemiuroid trematode. This provides an opportunity to explore differing interactions between the parasite and the immune system of susceptible and refractive hosts. Rapid migration and encapsulation of sporocysts was observed by SRO hemocytes but not by cockle hemocytes. This migration/encapsulation was inhibited by N-acetylglucosamine or N-acetylgalactosamine but not by the other sugars, implicating specific surface carbohydrates in immune detection. Effector responses of hemocytes were investigated in vitro in terms of production of reactive oxygen production (ROS). Hemocytes of both species strongly reacted to Zymosan, but only SRO hemocytes responded to live sporocysts. Neither species' hemocytes produced ROS in the presence of dead/fixed sporocysts, and there was no suppression of Zymosan-induced respiratory burst by sporocysts. This suggests that immune escape is mediated by avoiding encapsulation, perhaps through molecular mimicry. Membrane-shaving with proteases indicated that sporocyst surface proteins are not a key factors in hemocytic detection. Surface carbohydrates of SRO and cockle hemocytes and of sporocysts were profiled with a panel of biotinylated lectins. This revealed substantial differences between cockle and SRO hemocytes, but greater similarity between cockle hemocytes and sporocysts. Results suggest that surface carbohydrates play an integral role in hemocyte immunorecognition and that surface carbohydrate molecular mimicry is a potential strategy for immune evasion in cockles by hemiuroid trematode sporocysts. Crown Copyright © 2013. Published by Elsevier Ltd. All rights reserved.

Assessment of arsenic and heavy metal contents in cockles (Anadara granosa) using multivariate statistical techniques

International Nuclear Information System (INIS)

Abbas Alkarkhi, F.M.; Ismail, Norli; Easa, Azhar Mat

2008-01-01

Cockles (Anadara granosa) sample obtained from two rivers in the Penang State of Malaysia were analyzed for the content of arsenic (As) and heavy metals (Cr, Cd, Zn, Cu, Pb, and Hg) using a graphite flame atomic absorption spectrometer (GF-AAS) for Cr, Cd, Zn, Cu, Pb, As and cold vapor atomic absorption spectrometer (CV-AAS) for Hg. The two locations of interest with 20 sampling points of each location were Kuala Juru (Juru River) and Bukit Tambun (Jejawi River). Multivariate statistical techniques such as multivariate analysis of variance (MANOVA) and discriminant analysis (DA) were applied for analyzing the data. MANOVA showed a strong significant difference between the two rivers in term of As and heavy metals contents in cockles. DA gave the best result to identify the relative contribution for all parameters in discriminating (distinguishing) the two rivers. It provided an important data reduction as it used only two parameters (Zn and Cd) affording more than 72% correct assignations. Results indicated that the two rivers were different in terms of As and heavy metal contents in cockle, and the major difference was due to the contribution of Zn and Cd. A positive correlation was found between discriminate functions (DF) and Zn, Cd and Cr, whereas negative correlation was exhibited with other heavy metals. Therefore, DA allowed a reduction in the dimensionality of the data set, delineating a few indicator parameters responsible for large variations in heavy metals and arsenic content. Taking into account of these results, it can be suggested that a continuous monitoring of As and heavy metals in cockles be performed in these two rivers

Preliminary investigations on a new method of retaining the colour of shucked cockles (Anadara granosa), and the extension of shelflife by gamma irradiation and vacuum packing

Energy Technology Data Exchange (ETDEWEB)

Chersiang Ng; Laikim Low; Chia, L.H.L.

1987-01-01

Live cockles were incubated in atmospheres containing different concentrations of carbon monoxide. The bright red colour of the stable HbCO is retained during storage, giving the desired colour to the cockles. Vacuum packing influenced the colour of the cockles with irradiation and with CO treatments. In non-CO treated, irradiated samples, the effect of vacuum packing was not obvious. In CO treated, irradiated samples, vacuum packing retarded the deterioration of colour. Odour developments were influenced by irradiation, vacuum packing and storage temperature, and were not influenced by CO treatments. The odour of shucked cockles was rejected within one day at room temperature (26-28/sup 0/C) while at 0/sup 0/C the odour of the shucked cockles was still acceptable after 10 days. Suitable chemical indices for quality are K value and TVBN. Vacuum packing produced the highest K values after 19 days storage (0/sup 0/C), while irradiated samples had higher K values than non-irradiated samples. The TVBN increased with storage and is an indicator of the odour development. The use of CO treatment extended the shelflife of the cockles based on appearance. A combination of CO treatment, vacuum packing, ice storage and irradiation extended the shelflife to beyond 18 days, based on odour, colour, and overall appearance.

Preliminary investigations on a new method of retaining the colour of shucked cockles (Anadara granosa), and the extension of shelflife by gamma irradiation and vacuum packing

International Nuclear Information System (INIS)

Chersiang Ng; Laikim Low; Chia, L.H.L.

1987-01-01

Live cockles were incubated in atmospheres containing different concentrations of carbon monoxide. The bright red colour of the stable HbCO is retained during storage, giving the desired colour to the cockles. Vacuum packing influenced the colour of the cockles with irradiation and with CO treatments. In non-CO treated, irradiated samples, the effect of vacuum packing was not obvious. In CO treated, irradiated samples, vacuum packing retarded the deterioration of colour. Odour developments were influenced by irradiation, vacuum packing and storage temperature, and were not influenced by CO treatments. The odour of shucked cockles was rejected within one day at room temperature (26-28 0 C) while at 0 0 C the odour of the shucked cockles was still acceptable after 10 days. Suitable chemical indices for quality are K value and TVBN. Vacuum packing produced the highest K values after 19 days storage (0 0 C), while irradiated samples had higher K values than non-irradiated samples. The TVBN increased with storage and is an indicator of the odour development. The use of CO treatment extended the shelflife of the cockles based on appearance. A combination of CO treatment, vacuum packing, ice storage and irradiation extended the shelflife to beyond 18 days, based on odour, colour, and overall appearance. (author)

Shellfish Fishery Severely Reduces Condition and Survival of Oystercatchers Despite Creation of Large Marine Protected Areas

Directory of Open Access Journals (Sweden)

Simon Verhulst

2004-06-01

Full Text Available Fisheries and other human activities pose a global threat to the marine environment. Marine protected areas (MPAs are an emerging tool to cope with such threats. In the Dutch Wadden Sea, large MPAs (covering 31% of all intertidal flats have been created to protect shellfish-eating birds and allow recovery of important habitats. Even though shellfish fishing is prohibited in these areas, populations of shellfish-eating birds in the Wadden Sea have declined sharply. The role of shellfish fisheries in these declines is hotly debated, therefore, we investigated the effectiveness of MPAs for protecting oystercatcher (Haematopus ostralegus populations. Shellfish stocks (cockles, Cerastoderma edule were substantially higher in the MPAs, but surprisingly this has not resulted in a redistribution of wintering oystercatchers. Oystercatchers in unprotected areas had less shellfish in their diet and lower condition (a combined measure of mass and haematological parameters, and their estimated mortality was 43% higher. It is likely, therefore, that shellfish fishing explains at least part of the 40% decline in oystercatcher numbers in recent years. Condition and mortality effects were strongest in males, and the population sex ratio was female biased, in agreement with the fact that males rely more on shellfish. The unprotected areas apparently function as an "ecological trap," because oystercatchers did not respond as anticipated to the artificial spatial heterogeneity in food supply. Consequently, the MPAs are effective on a local scale, but not on a global scale. Similar problems are likely to exist in terrestrial ecosystems, and distribution strategies of target species need to be considered when designing terrestrial and marine protected areas if they are to be effective.

Effect of picung (Pangium edule plant extracts as a botanical pesticide on mortality of coffee berry borer (Hypothenemus hampei

Directory of Open Access Journals (Sweden)

soekadar wiryadiputra

2014-12-01

Full Text Available Coffee pests known as coffe berry borer (CBB, Hypothenemus hampei were main pests which decreasing the productivity of Indonesian coffee. One of pests controlling was done by insecticides. Generally, plant uses for insecticide show high security level, because the breaking molecule was easy as not dangerous compound. Pangium edule contains of flavanoide, cyanide acid and saponin had potential as an botanical insecticide. The purpose of this research was to prove the potential extract of seed and leaves of picung (Pangium edule as an botanical insecticide for CBB. This research used a complete random design. There were 8 treatments with the concentration of the extract from leaves and seed of picung, one positive control treatment (Carbaril 0,02% formulation and one negative control treatment (aquades. The treatment was repeated four times and carried out observation on every day until six days. The concentrations leaf and seed extracts were 1.0%, 2.5% and 5.0%. The result of the research show that between concentration applied the were no significant different and at observation six days after application the mortality of CBB only around 35 -40% on both extracts (ewater and methanol. The result of the research also show that there were no real differentiation between leaves and seed of picung. LT-50 values were 1.25% and 0.96%, for leaves and seed extract in water for six day observation. From this observation could be concluded that picung tree (Pangium edule is not effective in the controlling CBB in the interval concentration applied and extraction method used. Key words: Botanical pesticide, picung tree, Pangium edule, mortality, Hypothenemus hampei, water extraction, methanol extraction.

Identification of Listeria monocytogenes on Green Mussels (Perna viridis and Cockle Shell (Anadara granosa

Directory of Open Access Journals (Sweden)

Winiati Puji Rahayu

2016-12-01

Full Text Available Green mussel (Perna viridis and cockle shell (Anadara granosa are one of many sources of animalprotein which is many cultivated in Indonesia because their price is relatively affordable. This study wasconducted to identify the presence of Listeria monocytogenes in 27 samples of green mussels and 3 samplesof cockle shells using real-time Polymerase Chain Reaction (real-time PCR and biochemical methods. Thetarget gene for amplification in real-time PCR was an hlyA gene because this gene was a determinant ofvirulence genes that produce listeriolysin O. Primers used in this study were forward primer DG69 (GTGCCG GGT AAA AGA CCA TA and reverse primer DG74 (CGC CAC TGA GAT ACT AT and fluorescencesignals indicator using SYBR Green I. The results of analysis using real-time PCR were negative Listeriamonocytogenes in all samples, while using biochemical methods there was one of 30 samples contaminatedby Listeria welshimeri.

Reproductive investment in the intertidal bivalve Macoma balthica

Science.gov (United States)

Honkoop, P. J. C.; Van der Meer, J.; Beukema, J. J.; Kwast, D.

1999-05-01

Bivalve eggs generally contain large amounts of lipids which, in comparison with proteins and carbohydrates, have high energy contents and are thus costly in energetic terms. As lipid contents vary between species, comparisons of reproductive investments should not only include numbers and sizes of eggs, but also their energy content. We estimated the investment in egg material of mature females of the Baltic tellin Macoma balthica (L.) in terms of both mass and energy content. All mass below a minimum body mass (below which no eggs are produced) was defined as structural mass. This threshold amounts to a body mass index (BMI) of 5.6 (ash-free dry mass per cubic shell length in mg cm -3). More than half (55%) of the mass above the structural mass was invested in egg material and 45% in extra somatic tissue and tissue for production and storage of gametes. This means that the amount of eggs spawned ranged from 0 (at BMI = 5.6 mg cm -3) to 33% of the total ash-free dry mass (at a high BMI value of 14 mg cm -3). Eggs contained a relatively large amount of lipids, about 30% of their ash-free dry mass, whereas non-egg material contained only about 7% lipids. Eggs of two other bivalves in the Wadden Sea, the cockle Cerastoderma edule and the mussel Mytilus edulis, were smaller and contained only about 11% and 20% lipids, respectively. Energy content of M. balthica eggs amounted to ˜0.006 J, in the other two species to ˜0.002 J. The function of the more expensive eggs in M. balthica may be related to its early spawning in spring, causing slower larval development until first feeding.

Conservación in vitro de chayote (Sechium edule)

OpenAIRE

Alvarenga-Venutolo, Silvana; Abdelnour-Esquivel, Ana; Villalobos-Aránbula, Víctor

2007-01-01

Conservación in vitro de chayote (Sechium edule). La técnica de conservación in vitro a mediano plazo fue examinada en chayote. Para ello se determinó la supervivencia de los brotes después de la adición de altas concentraciones de sacarosa (0, 30, 50, 60, 70 y 80 g/l) y ácido acetil salicílico (10-9, 10-6 y 10-3 M) al medio de cultivo, de disminuciones en la temperatura de crecimiento (16, 18, 20, 22 y 25ºC) y combinaciones de estos factores, en Costa Rica, en 1997. Se e...

Properties of cast films made of chayote (Sechium edule Sw.) tuber starch reinforced with cellulose nanocrystals

Science.gov (United States)

In this study, cellulose (C) and cellulose nanocrystals (CN) were blended with chayote tuber (Sechium edule Sw.) starch (CS) in formulations cast into films. The films were conditioned at different storage temperatures and relative humidity (RH), and analyzed by mechanical tests, X-ray diffraction, ...

The inhibitory effect of Mesembryanthemum edule (L.) bolus essential oil on some pathogenic fungal isolates

Science.gov (United States)

2014-01-01

Background Mesembryanthemum edule is a medicinal plant which has been indicated by Xhosa traditional healers in the treatment HIV associated diseases such as tuberculosis, dysentery, diabetic mellitus, laryngitis, mouth infections, ringworm eczema and vaginal infections. The investigation of the essential oil of this plant could help to verify the rationale behind the use of the plant as a cure for these illnesses. Methods The essential oil from M. edule was analysed by GC/MS. Concentration ranging from 0.005 - 5 mg/ml of the hydro-distilled essential oil was tested against some fungal strains, using micro-dilution method. The plant minimum inhibitory activity on the fungal strains was determined. Result GC/MS analysis of the essential oil resulted in the identification of 28 compounds representing 99.99% of the total essential oil. A total amount of 10.6 and 36.61% constituents were obtained as monoterpenes and oxygenated monoterpenes. The amount of sesquiterpene hydrocarbons (3.58%) was low compared to the oxygenated sesquiterpenes with pick area of 9.28%. Total oil content of diterpenes and oxygenated diterpenes detected from the essential oil were 1.43% and 19.24%. The fatty acids and their methyl esters content present in the essential oil extract were found to be 19.25%. Antifungal activity of the essential oil extract tested against the pathogenic fungal, inhibited C. albican, C. krusei, C. rugosa, C. glabrata and C. neoformans with MICs range of 0.02-0.31 mg/ml. the activity of the essential oil was found competing with nystatin and amphotericin B used as control. Conclusion Having accounted the profile chemical constituent found in M. edule oil and its important antifungal properties, we consider that its essential oil might be useful in pharmaceutical and food industry as natural antibiotic and food preservative. PMID:24885234

Synthesis and characterization of CaCO3 (calcite) nano particles from cockle shells (Anadara granosa Linn) by precipitation method

Science.gov (United States)

Widyastuti, Sri; Intan Ayu Kusuma, P.

2017-06-01

Calcium supplements can reduce the risk of osteoporosis, but they are not automatically absorbed in the gastrointestinal tract. Nanotechnology is presumed to have a capacity in resolving this problem. The preparation and characterization of calcium carbonate nano particle to improve the solubility was performed. Calcium carbonate nano particles were synthesized using precipitation method from cockle shells (Anadara granosa Linn). Samples of the cockle shells were dried in an oven at temperature of 50°C for 7 (seven) days and subsequently they were crushed and blended into fine powder that was sieved through 125-μm sieve. The synthesis of calcium carbonate nanocrystals was done by extracting using hydro chloride acid and various concentrations of sodium hydroxide were used to precipitate the calcium carbonate nano particles. The size of the nano particles was determined by SEM, XRD data, and Fourier transform infrared spectroscopy (FT-IR). The results of XRD indicated that the overall crystalline structure and phase purity of the typical calcite phase CaCO3 particles were approximately 300 nm in size. The method to find potential applications in industry to yield the large scale synthesis of aragonite nano particles by a low cost but abundant natural resource such as cockle shells is required.

Cockles in custody: the role of common property arrangements in the ecological sustainability of mangrove Fisheries on the Ecuadorian Coast

Directory of Open Access Journals (Sweden)

Christine M. Beitl

2011-09-01

Full Text Available Scholars of common property resource theory (CPR have long asserted that certain kinds of institutional arrangements based on collective action result in successful environmental stewardship, but feedback and the direct link between social and ecological systems remains poorly understood. This paper investigates how common property institutional arrangements contribute to sustainable mangrove fisheries in coastal Ecuador, focusing on the fishery for the mangrove cockle (Anadara tuberculosa and A. similis, a bivalve mollusk harvested from the roots of mangrove trees and of particular social, economic, and cultural importance for the communities that depend on it. Specifically, this study examines the emergence of new civil society institutions within the historical context of extensive mangrove deforestation for the expansion of shrimp farming, policy changes in the late 1990s that recognized “ancestral” rights of local communities to mangrove resources, and how custodias, community-managed mangrove concessions, affect the cockle fishery. Findings from interviews with shell collectors and analysis of catch-per-unit-effort (CPUE indicate that mangrove concessions as common property regimes promote community empowerment, local autonomy over resources, mangrove conservation and recovery, higher cockle catch shares, and larger shell sizes, but the benefits are not evenly distributed. Associations without custodias and independent cockle collectors feel further marginalized by the loss of gathering grounds, potentially deflecting problems of overexploitation to “open-access” areas, in which mangrove fisheries are weakly managed by the State. Using Ostrom’s Institutional Analysis and Development (IAD framework, the explicit link between social and ecological systems is studied at different levels, examining the relationship between collective action and the environment through quantitative approaches at the fishery level and qualitative

Sechium edule (Jacq. Swartz, a New Cultivar with Antiproliferative Potential in a Human Cervical Cancer HeLa Cell Line

Directory of Open Access Journals (Sweden)

Sandra Salazar-Aguilar

2017-07-01

Full Text Available The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC and column chromatography (CC, identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions. Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC50 1.85 µg·mL−1, but the lymphocytes were affected by the extract (IC50 30.04 µg·mL−1. Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL−1. Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.

Sechium edule (Jacq.) Swartz, a New Cultivar with Antiproliferative Potential in a Human Cervical Cancer HeLa Cell Line.

Science.gov (United States)

Salazar-Aguilar, Sandra; Ruiz-Posadas, Lucero Del Mar; Cadena-Iñiguez, Jorge; Soto-Hernández, Marcos; Santiago-Osorio, Edelmiro; Aguiñiga-Sánchez, Itzen; Rivera-Martínez, Ana Rocío; Aguirre-Medina, Juan Francisco

2017-07-25

The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC) and column chromatography (CC), identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC) were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions). Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC 50 1.85 µg·mL -1 ), but the lymphocytes were affected by the extract (IC 50 30.04 µg·mL -1 ). Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL -1 . Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.

Concentration of Mercury in Cockles (Anadara granosa and A. antiquata) Harvested from Estuaries of Western Lombok, Indonesia, and Potential Risks to Human Health.

Science.gov (United States)

Rahayu, Rachmawati Noviana; Irawan, Bambang; Soegianto, Agoes

2016-01-01

This study measured the levels of total mercury (tHg) in the whole tissues of cockles (Anadara granosa and A. antiquata) harvested from three estuaries of Western Lombok Island (WLI), Indonesia. This paper also evaluated the hazard level posed by the mercury in relation to the maximum residual limit for human consumption and to estimate the weekly intake and compare it with the provisional tolerable weekly intake (PTWI). The tHg concentrations in A. granosa ranged from 0.020 to 0.070 mg kg(-1), and those in A. antiquata were between 0.032 and 0.077 mg kg(-1) at all locations. All samples of cockles harvested from WLI contain tHg below the permissible limit for human consumption. The maximum weekly intakes for total mercury by coastal people range from 0.28 to 1.08 µg kg(-1) b.w., and they are below the recommended values of PTWI (5.6 µg kg(-1) b.w.). If it is assumed that 100% of the Hg in cockles is methyl mercury (MeHg), consumption of the indicated amounts at the measured values wouldn't exceed the MeHg PTWI (1.6 µg kg(-1) b.w.).

Cryopreservation of chayote (Sechium edule JACQ.SW.) zygotic embryos and shoot-tips from in vitroplantlets

OpenAIRE

Abdelnour-Esquivel, Ana; Engelmann, Florent

2002-01-01

This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM we...

Chemical analyses and in vitro and in vivo toxicity of fruit methanol extract of Sechium edule var. nigrum spinosum.

Science.gov (United States)

Aguiñiga-Sánchez, Itzen; Cadena-Íñiguez, Jorge; Santiago-Osorio, Edelmiro; Gómez-García, Guadalupe; Mendoza-Núñez, Víctor Manuel; Rosado-Pérez, Juana; Ruíz-Ramos, Mirna; Cisneros-Solano, Víctor Manuel; Ledesma-Martínez, Edgar; Delgado-Bordonave, Angel de Jesus; Soto-Hernández, Ramón Marcos

2017-12-01

Sechium edule (Jacq.) Sw. (Cucurbitaceae) is used in ethnomedicine, but the diversity of the varietal groups of this species has not often been considered. This is important because we previously reported that different variety of species exhibit different activities across different tumor cell lines. This study investigates the chemical composition and biological activities of extracts obtained from S. edule var. nigrum spinosum. The leukemia P388 cell line and mononuclear bone marrow cells (MNCBMs) were treated with the extract at a concentration ranging from 40 to 2370 μg/mL for cytotoxicity and viability assays. CD-1 mice were treated with 8-5000 mg/kg extract and monitored every hour for the first 24 h and subsequently for seven days for signs of toxicity (LD 50 ). In addition, the chromatographic profile of the extract was determined by HPLC. The extract inhibits the proliferation of both P388 cells and MNCBMs, with IC 50 values of 927 and 1911 μg/mL, respectively, but reduced the viability and induced the apoptosis of only leukemia cells. The LD 50 was higher than 5000 mg/kg, and this concentration did not alter the blood chemistry or cell count but doubled the mitotic index in the bone marrow. The HPLC showed the presence of cucurbitacins, phloridzin, naringenin, phloretin, apigenin, and gallic, chlorogenic, vanillic, p-hydroxybenzoic, caffeic, and p-coumaric acids. Sechium edule var. nigrum spinosum contains bioactive compounds that explain the antiproliferative and nutraceutical activities, and its lack of physiological side effects constitutes an added value to a widely consumed vegetable.

Paralytic shellfish poisoning due to ingestion of Gymnodinium catenatum contaminated cockles--application of the AOAC HPLC official method.

Science.gov (United States)

Rodrigues, Susana Margarida; de Carvalho, Mamede; Mestre, Tiago; Ferreira, Joaquim J; Coelho, Miguel; Peralta, Rita; Vale, Paulo

2012-04-01

The potent paralytic shellfish toxins (PSTs) produced by Gymnodinium catenatum have appeared irregularly since the onset in 1986 of a monitoring program aimed at preventing contaminated bivalves from the Portuguese coast to reaching the consumer. In years where high contamination levels were attained, sporadic episodes of human poisonings were also recorded, as in 1994. The reappearance of high contamination led to the appearance of new cases during 2007. This study reports details of toxin ingestion, symptomatology and toxin presence in the fluids of one of these victims, an adult male who ingested several kilograms of cockles. In cockle samples collected the week before and during the week when the intoxication took place, the major PSTs detected by the HPLC method based on AOAC Official Method 2005.06 belonged to the sulfamate (81-68 molar percent) and decarbamoyl groups (19-32 molar percent), comprising GTX5, GTX6, C1,2, C3,4, dcNeo, and dcSTX. In the patient urine sample sulfamate and decarbamoyl derivatives were also found, comprising by GTX5 (28%), GTX6 (25%), dcSTX (24%) and dcNeo (22%), but no C toxins and no dcGTX2,3 were detected. Compared to the cockle samples, there was an increase in the proportion of dcSTX, dcNeo and GTX5 (molar percentage) in the urine sample, but not of GTX6. Overall, compounds which had the presence of an O-sulfate at C11 were absent in urine while being relatively abundant in the bivalve (36.5-47.0 molar percent). In blood plasma PSTs were not detected. Copyright © 2012 Elsevier Ltd. All rights reserved.

Risk assessment for the daily intake of polycyclic aromatic hydrocarbons from the ingestion of cockle (Anadara granosa) and exposure to contaminated water and sediments along the west coast of Peninsular Malaysia.

Science.gov (United States)

Mirsadeghi, Seiedeh Aghileh; Zakari, Mohamad Pauzi; Yap, Chee Kong; Shahbazi, Azadeh

2011-01-01

The concentration of carcinogenic polycyclic aromatic hydrocarbons (c-PAHs) present in the sediment and water of Peninsular Malaysia as well as in the cockle Anadara granosa was investigated. Samples were extracted and analysed with gas chromatography-mass spectrometry. The concentrations of total carcinogenic polycyclic aromatic hydrocarbons (t-PAHs) were measured between 0.80 +/- 0.04 to 162.96 +/- 14.74 ng/g wet weight (ww) in sediment, between 21.85 +/- 2.18 to 76.2 +/- 10.82 ng/L in water samples and between 3.34 +/- 0.77 to 46.85 +/- 5.50 ng/g ww in the cockle tissue. The risk assessment of probable human carcinogens in the Group B2 PAHs was calculated and assessed in accordance with the standards of the United States Environmental Protection Agency (US EPA). Case I in the toxicity assessment analysed the cancer risk to consumers of Malaysian blood cockle. Case II assessed the risk of cancer from exposure to PAHs from multiple pathways. The average cancer risk of case I and case II were found to be classifiable as unsafe according to the US EPA standard. The cancer risk due to c-PAHs acquired by the ingestion of blood cockle was (8.82 +/- 0.54) x 10-6 to (2.67 +/- 0.06) x 10(-2), higher than the US EPA risk management criterion. The non-cancer risks associated with multiple pathways in Kuala Gula, Kuala Juru and Kuala Perlis were higher than the U.S. EPA safe level, but the non-cancer risk for eating blood cockle was below the level of U.S. EPA concern.

Accumulation of Sellafield-derived radiocarbon ("1"4C) in Irish Sea and West of Scotland intertidal shells and sediments

International Nuclear Information System (INIS)

Tierney, Kieran M.; Muir, Graham K.P.; Cook, Gordon T.; MacKinnon, Gillian; Howe, John A.; Heymans, Johanna J.; Xu, Sheng

2016-01-01

The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ("1"4C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This "1"4C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate "1"4C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in "1"4C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine "1"4C-enriched material close to Sellafield. - Highlights: • We measure "1"4C activity in shells and sediment at sites on the UK west coast. • Mussel shell activity varies in response to average "1"4C discharges from Sellafield. • Shell activities reflect species feeding habits and ecological niche. • NE Irish Sea inorganic sediment activity will gradually increase. • Increases in sediment activity will occur at remote sites on the Scottish west coast.

The human alimentary tract transfer and body retention of environmental polonium-210

International Nuclear Information System (INIS)

Hunt, G J; Rumney, H S

2007-01-01

This paper presents the results of a 4 year study to investigate the human alimentary tract transfer factor (f A value) and body retention of 210 Po in shellfish. In the first 3 years, mussels (Mytilus edulis L.), cockles (Cerastoderma edule L.) and brown meat from crab (Cancer pagurus L.) were successively studied. In each year five volunteers (from a pool of seven) ate a suitable portion of the shellfish and provided 24 h samples of excreta usually for 3 days before and for at least 7 days during and after eating. Subsamples of shellfish were analysed to determine the intakes of 210 Po. Faeces were analysed and the data used to assess apparent f A values. Urine samples were analysed in the mussel and crab studies to provide urinary excretion parameters. Pb-210 was also analysed during the mussel study; the levels were low, leading to large uncertainties, but confirming the negligible effect of radioactive decay to its granddaughter 210 Po in the main study. In the fourth year, larger samples of brown crab meat were eaten by five volunteers and faecal samples were taken at suitable times over periods of up to 43 days to study body retention of 210 Po. The first ∼7 days provided additional data on f A values. Pooled results for the apparent f A for the whole study lay in the range 0.15-0.65 with a mean of 0.46; corrections for endogenous excretion suggest a true f A value of ∼0.51, supporting the value of 0.5 currently used by the International Commission on Radiological Protection (ICRP). The retention data suggest a biological half-time of about 40 days, in broad consistency with the 50 days currently used by the ICRP. Thus there is no strong evidence from this study suggesting a change in dose coefficient for 210 Po. Full experimental data are provided to allow independent further interpretation

Effect of Body Size and Food Quality on the Assimilation of "6"5Zn and "1"1"0"mAg in Bloody Cockles (Anadara Senilis) from Ghana

International Nuclear Information System (INIS)

Kuranchie-Mensah, H.; Teyssie, J.-L.; Oberhaensli, F.; Metian, M.; Warnau, M.

2015-01-01

In coastal ecosystems where bivalves are often exposed to metal contamination, dietary exposure has been recognised as a dominant uptake pathway of trace metals in bivalves. The present study employed radiotracers ("6"5Zn and "1"1"0"mAg) to assess the assimilation efficiency (AE) of the two elements in Bloody cockles (Anadara senilis) from Narkwa Lagoon, Ghana. AE is an important parameter in determining bioavailability of trace elements from food. Zn and Ag bioavailabilty was assessed using single-feeding approach, followed by a 28–day depuration period, with two species of phytoplankton (Isochrysis galbana and Skelotonema costatum) used as food, and two different size groups of Bloody Cockles. Results indicate that AE of "6"5Zn and "1"1"0"mAg were influenced by the phytoplankton species used as food whereas, for both algal species, AE increased slightly with increasing cockle body size. Once taken up, "6"5Zn was relatively strongly retained in cockle’s flesh (biological half-live: ≈40 days) whereas "1"1"0"mAg was rapidly released (biological halflive: ≈5 days). A complementary experiment -using subcellular partitioning and in vitro digestion method- was performed to provide additional information on the proportion of "6"5Zn and "1"1"0mAg in the bloody cockle that is available for transfer to next trophic levels. Overall, this work highlighted that trace metal accumulation in marine filter feeders does depend on the metal bioavailability in food as well as on other biological factors, such as body size. (author)

Preparation and characterization of cockle shell aragonite nanocomposite porous 3D scaffolds for bone repair

Directory of Open Access Journals (Sweden)

Saffanah Khuder Mahmood

2017-07-01

Full Text Available The demands for applicable tissue-engineered scaffolds that can be used to repair load-bearing segmental bone defects (SBDs is vital and in increasing demand. In this study, seven different combinations of 3 dimensional (3D novel nanocomposite porous structured scaffolds were fabricated to rebuild SBDs using an extraordinary blend of cockle shells (CaCo3 nanoparticles (CCN, gelatin, dextran and dextrin to structure an ideal bone scaffold with adequate degradation rate using the Freeze Drying Method (FDM and labeled as 5211, 5400, 6211, 6300, 7101, 7200 and 8100. The micron sized cockle shells powder obtained (75 µm was made into nanoparticles using mechano-chemical, top-down method of nanoparticles synthesis with the presence of the surfactant BS-12 (dodecyl dimethyl bataine. The phase purity and crystallographic structures, the chemical functionality and the thermal characterization of the scaffolds’ powder were recognized using X-Ray Diffractometer (XRD, Fourier transform infrared (FTIR spectrophotometer and Differential Scanning Calorimetry (DSC respectively. Characterizations of the scaffolds were assessed by Scanning Electron Microscopy (SEM, Degradation Manner, Water Absorption Test, Swelling Test, Mechanical Test and Porosity Test. Top-down method produced cockle shell nanoparticles having averagely range 37.8±3–55.2±9 nm in size, which were determined using Transmission Electron Microscope (TEM. A mainly aragonite form of calcium carbonate was identified in both XRD and FTIR for all scaffolds, while the melting (Tm and transition (Tg temperatures were identified using DSC with the range of Tm 62.4–75.5 °C and of Tg 230.6–232.5 °C. The newly prepared scaffolds were with the following characteristics: (i good biocompatibility and biodegradability, (ii appropriate surface chemistry and (iii highly porous, with interconnected pore network. Engineering analyses showed that scaffold 5211 possessed 3D interconnected homogenous

Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

International Nuclear Information System (INIS)

Ballestra, S.; Gastaud, J.; Lopez, J.J.; Parsi, P.; Vas, D.

1993-08-01

The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for 40 K, 60 Co, 137 Cs, and 2 39+240 Pu (Reference date: 1 January 1992). Information values for 90 Sr, 106 Ru, 125 Sb, 134 Cs, 154 Eu, 155 Eu, 210 Pb, 210 Po, 226 Ra, 228 Ra, 228 Th, 230 Th, 232 Th, 234 U, 235 U, 238 U, 238 Pu and 241 Am are also reported. All the following values are expressed in Bq kg -1 (dry weight). (author)

Short-term fluctuations in bivalve larvae compared with some environmental factors in a coastal lagoon (South Portugal

Directory of Open Access Journals (Sweden)

Luis M.Z. Chícaro

2000-12-01

Full Text Available In this study, short-term fluctuations in bivalve larvae were compared with some triggering factors for a period of sixteen months. Data on the abundance of planktonic larvae, collected two to three times a week were related to water temperature, salinity, wind velocity, tidal amplitude and chlorophyll a. Higher densities of planktonic bivalve larvae were caught between May and August, but intense fluctuations in abundance were observed. Planktonic bivalve larvae of eighteen taxa were identified. Larvae of Mytilus galloprovincialis, Cerastoderma edule, Ruditapes decussates and Venerupis spp. were the most abundant. The seasonal fluctuations of bivalve abundance seem to be controlled by temperature, the major factor in the timing of the reproduction of bivalves. Nevertheless, advection may be also a key factor during the planktonic life of bivalve species in coastal systems, such as the Ria Formosa.

Cadmium and lead in blood cockle (Anadara granosa) from Asajaya, Sarawak, Malaysia.

Science.gov (United States)

Hossen, Md Faruk; Hamdan, Sinin; Rahman, Md Rezaur

2014-01-01

The concentrations were ranged from 1.35 ± 0.16 to 2.22 ± 0.34 µg/g (dry weight) and 2.65 ± 0.34 to 4.36 ± 0.53 µg/g (dry weight) for Cd and Pb, respectively, in blood cockle Anadara granosa from four sites of Sabang River, namely, Kampung Sambir, Kampung Tambirat, Beliong Temple, and Kampung Tanjung Apong, which are located at Asajaya, Sarawak, Malaysia. All values exceeded safety limits set by Malaysian Food Regulation (1985). It may be the cause of serious human health problems after long term consumption. Thus, consumer should have consciousness about such type of seafood from mentioned sites and need further investigation.

Cadmium and Lead in Blood Cockle (Anadara granosa from Asajaya, Sarawak, Malaysia

Directory of Open Access Journals (Sweden)

Md. Faruk Hossen

2014-01-01

Full Text Available The concentrations were ranged from 1.35±0.16 to 2.22±0.34 µg/g (dry weight and 2.65±0.34 to 4.36±0.53 µg/g (dry weight for Cd and Pb, respectively, in blood cockle Anadara granosa from four sites of Sabang River, namely, Kampung Sambir, Kampung Tambirat, Beliong Temple, and Kampung Tanjung Apong, which are located at Asajaya, Sarawak, Malaysia. All values exceeded safety limits set by Malaysian Food Regulation (1985. It may be the cause of serious human health problems after long term consumption. Thus, consumer should have consciousness about such type of seafood from mentioned sites and need further investigation.

Chemical composition profiling and antifungal activity of the essential oil and plant extracts of Mesembryanthemum edule (L.) bolus leaves.

Science.gov (United States)

Omoruyi, Beauty Etinosa; Afolayan, Anthony Jide; Bradley, Graeme

2014-01-01

Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could help to verify the efficacy of the plant in the management or treatment of these illnesses. Various concentrations of the hydro-distilled essential oil, ranging from 0.005-5 mg/ml, were tested against some fungal strains, using the micro-dilution method. Minimum inhibitory activity was compared with four other different crude extracts of hexane, acetone, ethanol and aqueous samples from the same plant. The chemical composition of the essential oil, hexane, acetone and ethanol extracts was determined using GC-MS. GC/MS analysis of the essential oil resulted in the identification of 28 compounds, representing 99.99% of the total oil. Phytoconstituents of hexane, acetone and ethanol extracts yielded a total peak chromatogram of fifty nine compounds. A total amount of 10.6% and 36.61% of the constituents were obtained as monoterpenes and oxygenated monoterpenes. Sesquiterpene hydrocarbons (3.58%) were relatively low compared to the oxygenated sesquiterpenes (9.28%), while the major concentrated diterpenes and oxygenated diterpenes were 1.43% and 19.24 %, respectively and phytol 12.41%. Total amount of fatty acids and their methyl esters content, present in the oil extract, were found to be 19.25 %. Antifungal activity of the oil extract and four solvent extracts were tested against five pathogenic fungal strains. The oil extract showed antifungal activity against Candida albican, Candida krusei, Candida rugosa, Candida glabrata and Cryptococcus neoformans with MIC ranges of 0.02 0.31 mg/ml. Hexane extract was active against the five fungal strains with MICs ranging between 0.02-1.25 mg/ml. Acetone extracts were active against C. krusei only at 0.04mg/ml. No

Conservación in vitro de chayote (Sechium edule

Directory of Open Access Journals (Sweden)

Silvana Alvarenga-Venutolo

2007-01-01

Full Text Available Conservación in vitro de chayote (Sechium edule. La técnica de conservación in vitro a mediano plazo fue examinada en chayote. Para ello se determinó la supervivencia de los brotes después de la adición de altas concentraciones de sacarosa (0, 30, 50, 60, 70 y 80 g/l y ácido acetil salicílico (10-9, 10-6 y 10-3 M al medio de cultivo, de disminuciones en la temperatura de crecimiento (16, 18, 20, 22 y 25ºC y combinaciones de estos factores, en Costa Rica, en 1997. Se encontró que los brotes mantuvieron altos porcentajes de viabilidad después de ser conservados durante seis meses en los tratamientos evaluados. Debido a la apariencia más vigorosa y a la coloración más verde que presentaron las plántulas, se consideró que el mejor tratamiento fue la adición de 60 g/l de sacarosa al medio de cultivo combinado con la incubación a 16ºC.

Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

Science.gov (United States)

Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

2006-02-01

Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

Energy Technology Data Exchange (ETDEWEB)

Ballestra, S; Gastaud, J; Lopez, J J; Parsi, P; Vas, D

1993-08-01

The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for {sup 40}K, {sup 60}Co, {sup 137}Cs, and 2{sup 39+240}Pu (Reference date: 1 January 1992). Information values for {sup 90}Sr, {sup 106}Ru, {sup 125}Sb, {sup 134}Cs, {sup 154}Eu, {sup 155}Eu, {sup 210}Pb, {sup 210}Po, {sup 226}Ra, {sup 228}Ra, {sup 228}Th, {sup 230}Th, {sup 232}Th, {sup 234}U, {sup 235}U, {sup 238}U, {sup 238}Pu and {sup 241}Am are also reported. All the following values are expressed in Bq kg{sup -1} (dry weight). (author)

Waste cockle shell as natural catalyst for biodiesel production from jatropha oil

Science.gov (United States)

Hadi, Norulakmal Nor; Idrus, Nur Afini; Ghafar, Faridah; Salleh, Marmy Roshaidah Mohd

2017-12-01

Due to the increasing of industrialization and modernization of the world, the demand of petroleum has risen rapidly. The increasing demand for energy and environmental awareness has prompted many researches to embark on alternative fuel platforms that are environmentally acceptable. In this study, jatropha oil was used to produce biodiesel by a new transesterification routine in which cockle shell was used as source of heterogeneous catalyst. The investigation showed the catalyst that was calcined at temperature of 800 °C has the optimum capability to produce high yield. The highest yield of biodiesel production of 93.20 % were obtained by using 1.5 wt% of catalyst. The reaction was conducted at a temperature of 65 °C with the optimum methanol to oil ratio of 6:1. It was found that the physical properties of the biodiesel produced were significant to ASTM standard of fatty acid methyl ester (FAME).

Study of copper (Cu) contents in blood cockles (Anadara sp.) at Surabaya coastal waters

Science.gov (United States)

Alfionita, S.; Pursetyo, K. T.; Sahidu, A. M.

2018-04-01

Heavy metal pollution categorized as harmful effect on the environment. This study aims to determine the content and the rate of accumulation of heavy metals copper (Cu) in the mussel of cockles (Anadara sp.) This study uses observation method with descriptive analysis. The test results Cu in sea water was pollution classification 49.98 mg Cu/kg. The results of shells fur Cu on Wonokromo was 1.833 mg/kg and Dadapan was 1.352 mg/kg. According to the MOH Decree No.0375/B/SK/1989 about Quality Standard Biota Consumption of Metals to the maximum limit of the existing Cu concentrations in marine biota was 20 ppm or 20 mg / kg so that the content of Cu in shellfish feathers still below the limit of existing quality standards.

The Effect of Body Size in Mercury Accumulation Biokinetic of Cockle Shell (Anadara Granosa)

International Nuclear Information System (INIS)

Wahyu Retno Prihatiningsih

2007-01-01

Accumulation of mercury biokinetic in cockle shell (Anadara granosa) through water pathway has been investigated under laboratory condition. The objective of research is to find the effect of body size in mercury biokinetic of Anadara granosa and to find bioindicator based on biokinetic parameter. The research shows that body size of Anadara granosa give an effect to concentration factor and could barrier mercury contaminant. Concentration factor for size 1.9, 2.5 and 3.9 cm of biota moving high and reach steady state condition after 24 days. Concentration factor of Anadara granosa in size 1.9, 2.5 and 3.9 is 0.1476, 0.1645 and 0.2573 day. Based on mechanism of mercury biokinetic process, it was proof that Anadara granosa is an ideal invertebrate for bioindicator. (author)

Mesocosm validation of the marine No Effect Concentration of dissolved copper derived from a species sensitivity distribution.

Science.gov (United States)

Foekema, E M; Kaag, N H B M; Kramer, K J M; Long, K

2015-07-15

The Predicted No Effect Concentration (PNEC) for dissolved copper based on the species sensitivity distribution (SSD) of 24 marine single species tests was validated in marine mesocosms. To achieve this, the impact of actively maintained concentrations of dissolved copper on a marine benthic and planktonic community was studied in 18 outdoor 4.6m(3) mesocosms. Five treatment levels, ranging from 2.9 to 31μg dissolved Cu/L, were created in triplicate and maintained for 82days. Clear effects were observed on gastropod and bivalve molluscs, phytoplankton, zooplankton, sponges and sessile algae. The most sensitive biological endpoints; reproduction success of the bivalve Cerastoderma edule, copepod population development and periphyton growth were significantly affected at concentrations of 9.9μg Cu/L and higher. The No Observed Effect Concentration (NOEC) derived from this study was 5.7μg dissolved Cu/L. Taking into account the DOC concentration of the mesocosm water this NOEC is comparable to the PNEC derived from the SSD. Copyright © 2015. Published by Elsevier B.V.

Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram.

Science.gov (United States)

Lalthansanga, James; Samanta, A K

2015-07-01

This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves at the ratio 4:1) on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4). Chayote meal was used to replace standard CM (pig grower ration) at 0% (G1), 20% (G2), 30% (G3), and 40% (G4). During the feeding trial of 90 days, it was found that the dry matter (DM) intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg) was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05) among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05), although the ether extract digestibility in G1 was significantly low (pChayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

Development and Characterization of Novel Porous 3D Alginate-Cockle Shell Powder Nanobiocomposite Bone Scaffold

Directory of Open Access Journals (Sweden)

B. Hemabarathy Bharatham

2014-01-01

Full Text Available A novel porous three-dimensional bone scaffold was developed using a natural polymer (alginate/Alg in combination with a naturally obtained biomineral (nano cockle shell powder/nCP through lyophilization techniques. The scaffold was developed in varying composition mixture of Alg-nCP and characterized using various evaluation techniques as well as preliminary in vitro studies on MG63 human osteoblast cells. Morphological observations using SEM revealed variations in structures with the use of different Alg-nCP composition ratios. All the developed scaffolds showed a porous structure with pore sizes ideal for facilitating new bone growth; however, not all combination mixtures showed subsequent favorable characteristics to be used for biological applications. Scaffolds produced using the combination mixture of 40% Alg and 60% nCP produced significantly promising results in terms of mechanical strength, degradation rate, and increased cell proliferation rates making it potentially the optimum composition mixture of Alg-nCP with future application prospects.

Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule

Directory of Open Access Journals (Sweden)

Sergio Espíndola Mateos

2015-10-01

Full Text Available β-Glucosidase (EC 3.2.1.21 is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1, in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results. One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min−1. The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule).

Science.gov (United States)

Mateos, Sergio Espíndola; Cervantes, Carlos Alberto Matías; Zenteno, Edgar; Slomianny, Marie-Christine; Alpuche, Juan; Hernández-Cruz, Pedro; Martínez-Cruz, Ruth; Canseco, Maria Del Socorro Pina; Pérez-Campos, Eduardo; Rubio, Manuel Sánchez; Mayoral, Laura Pérez-Campos; Martínez-Cruz, Margarito

2015-10-23

β-Glucosidase (EC 3.2.1.21) is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule) was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1), in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results). One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min(-1). The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

Development of nanoantibiotic delivery system using cockle shell-derived aragonite nanoparticles for treatment of osteomyelitis

Directory of Open Access Journals (Sweden)

Saidykhan L

2016-02-01

Full Text Available Lamin Saidykhan,1 Md Zuki Bin Abu Bakar,2 Yaya Rukayadi,1,3 Aminu Umar Kura,4 Saiful Yazan Latifah5 1Microbiology Unit, Laboratory of Natural Products, Institute of Bioscience, 2Laboratory of Anatomy and Histology, Department of Veterinary Preclinical Sciences, Faculty of Veterinary Medicine, 3Department of Food Science, Faculty of Food Science and Technology, 4Vaccine and Immunotherapeutics Laboratory Unit, Institute of Bioscience, 5Department of Biomedical Science, Faculty of Medicine and Health Sciences, Universiti Putra Malaysia, Serdang, Selangor Darul Ehsan, Malaysia Abstract: A local antibiotic delivery system (LADS with biodegradable drug vehicles is recognized as the most effective therapeutic approach for the treatment of osteomyelitis. However, the design of a biodegradable LADS with high therapeutic efficacy is too costly and demanding. In this research, a low-cost, facile method was used to design vancomycin-loaded aragonite nanoparticles (VANPs with the aim of understanding its potency in developing a nanoantibiotic bone implant for the treatment of osteomyelitis. The aragonite nanoparticles (ANPs were synthesized from cockle shells by a hydrothermal approach using a zwitterionic surfactant. VANPs were prepared using antibiotic ratios of several nanoparticles, and the formulation (1:4 with the highest drug-loading efficiency (54.05% was used for physicochemical, in vitro drug release, and biological evaluation. Physiochemical characterization of VANP was performed by using transmission electron microscopy, Fourier transform infrared spectroscopy, X-ray powder diffraction, and Zetasizer. No significant differences were observed between VANP and ANP in terms of size and morphology as both samples were cubic shaped with sizes of approximately 35 nm. The Fourier transform infrared spectroscopy of VANP indicated a weak noncovalent interaction between ANP and vancomycin, while the zeta potential values were slightly increased from -19

Assessing the role of benthic filter feeders on phytoplankton production in a shellfish farming site: Mont Saint Michel Bay, France

Science.gov (United States)

Cugier, Philippe; Struski, Caroline; Blanchard, Michel; Mazurié, Joseph; Pouvreau, Stéphane; Olivier, Frédéric; Trigui, Jihane R.; Thiébaut, Eric

2010-07-01

The macrobenthic community of Mont Saint Michel Bay (English Channel, France) is mainly dominated by filter feeders, including cultivated species (oysters and mussels). An ecological model of the bay was developed, coupling a 2D hydro-sedimentary model and two biological models for primary production and filter-feeder filtration. The filter-feeder model includes three cultivated species ( Mytilus edulis, Crassostrea gigas and Ostrea edulis), one invasive species ( Crepidula fornicata) and eight wild native species ( Abra alba, Cerastoderma edule, Glycymeris glycymeris, Lanice conchilega, Macoma balthica, Paphia rhomboides, Sabellaria alveolata, andSpisula ovalis). For cultivated and invasive species, the production of biodeposits was computed to assess their role in restimulating primary production. Chlorophyll a concentrations appeared to be strongly controlled by the filter feeders. When the pressure of each benthic compartment on phytoplankton was estimated separately wild species and the invasive slipper limpet C.fornicata were shown to be key elements in the control of primary production. Conversely, the role of cultivated species, particularly oysters, was weaker. Feedback due to the mineralization of biodeposits also appears to be crucial to fully evaluate the role of filter feeders in primary production.

Effect of feeding chayote (Sechium edule meal on growth performance and nutrient utilization in indigenous pig (Zovawk of Mizoram

Directory of Open Access Journals (Sweden)

James Lalthansanga

2015-07-01

Full Text Available Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule meal by replacing standard concentrate mixture (CM on the growth parameters such as feed intake, body weight gain, average daily gain (ADG and feed conversion ratio (FCR, and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk were used to study the effect of feeding chayote (Sechium edule meal (fruits and leaves at the ratio 4:1 on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4. Chayote meal was used to replace standard CM (pig grower ration at 0% (G1, 20% (G2, 30% (G3, and 40% (G4. Results: During the feeding trial of 90 days, it was found that the dry matter (DM intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05 among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05, although the ether extract digestibility in G1 was significantly low (p<0.01 as compared to G2, G3, and G4. Conclusion: Chayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

Heavy metal stabilization in contaminated soil by treatment with calcined cockle shell.

Science.gov (United States)

Islam, Mohammad Nazrul; Taki, Golam; Nguyen, Xuan Phuc; Jo, Young-Tae; Kim, Jun; Park, Jeong-Hun

2017-03-01

In several previous studies, the efficacy of various liming waste materials on the immobilization of heavy metals has been tested and it was found that soils contaminated with heavy metals can be stabilized using this technique. Since lime (CaO) has been identified as the main phase of calcined cockle shell (CCS), it was hypothesized that CCS could be used as a soil amendment to immobilize heavy metals in soil. However, to date, no studies have been conducted using CCS. In this study, the effectiveness of CCS powder on the immobilization of Cd, Pb, and Zn in mine tailing soil was evaluated. After 28 days of incubation, the treated soil samples were exposed to weathering (four cycles of freezing-thawing and four cycles of wetting-drying) for 8 days before being subjected to a leaching test. The results of this study revealed that the soil pH increased from 7.5 to 12.2 with the addition of 5% CCS. A similar soil pH was obtained when the soil was amended with 5% pure CaO. By leaching with 0.1 M HCl, extracted Cd, Pb, and Zn were reduced by up to 85, 85, and 91%, respectively. Therefore, CCS is suggested as a low-cost lime-based soil amendment for stabilizing heavy metals in abandoned mining sites.

VALORACIÓN DE LA CIDRA PAPA (Sechium edule COMO ALTERNATIVA DE ALIMENTACIÓN Y RECUPERACIÓN DE VÍNCULOS CON EL CAMPO VALORAÇÃO DA Sechium edule COMO ALTERNATIVA DE ALIMENTAÇÃO E RECUPERAÇÃO DOS VINCULOS COM O CAMPO VALUATION OF Sechium edule AS AN ALIMENTARY ALTERNATIVE AND RECUPERATION OF BONDS TO THE COUNTRY

Directory of Open Access Journals (Sweden)

CONSUELO MONTES R

2011-12-01

Full Text Available El objetivo de la investigación, fue valorar la cidra papa (Sechium edule como alternativa de alimentación para familias en desplazamiento que viven en asentamientos urbano marginales de Popayán, con el fin de contribuir a la recuperación del conocimiento tradicional asociado al uso y manejo, identificar ecotipos, identificar el significado sociocultural como alternativa para mantener los vínculos con el campo, evaluar productividad y posibilidades de manejo en espacios urbano marginales. El proceso se desarrolló mediante 'investigación participativa', donde los actores participaron en dinámicas recreativas, talleres de sensibilización y socialización, giras de intercambio de saberes, de semillas y generación de conocimientos, lo que permitió obtener información, y la apropiación del proceso. Se definieron como áreas de estudio 3 comunas de Popayán, se seleccionaron 4 asentamientos, se aplicaron 116 encuestas, se realizaron visitas mensuales por asentamiento, entablando diálogos informales con las familias participantes. Se conocieron las posibilidades de manejo de la planta, se incentivó la siembra de la misma aplicando el concepto de agricultura urbana donde se asoció la planta con otras hortalizas. Se pudo constatar que plantas como la cidra se adaptan a las condiciones que ofrecen los asentamientos y que son fuente alternativa para la alimentación de estas poblaciones, se fomentó el consumo de especies sub utilizadas, se hizo intercambio de saberes y se generaron espacios para motivar la conservación de ecotipos y especies de plantas como la cidra, que pueden resistir a las condiciones de marginalidad.0 objetivo da pesquisa, foi avaliar a cidra papa (Sechium edule como alternativa de alimentação para familias deslocadas que moram nos perímetros da cidade de Popayán, com o proposito de contribuir na recuperação do conhecimento tradicional relacionado com a utilização e manejo, identificação de ecotipos e o

Sclerochronological study of a dog cockle (Glycymeris glycymeris L.) population from the Madeira Islands

Science.gov (United States)

Németh, Alexandra; Kern, Zoltán

2017-04-01

The use of the annual increments in the shell of the abundant dog cockle (Glycymeris glycymeris L.) in sclerochronological studies has been demonstrated to be a valid method to reconstruct oceanographic variability in the North Atlantic region [1,2]. However, the sclerochronological potential of the species has not been investigated at the southern limit of its distribution, at the southern North East Atlantic. Therefore the first aim of our study was to analyse growth patterns of G. glycymeris specimens collected around the Madeira Islands to understand which environmental variable has the strongest limiting effect on their growth. The second aim was to find out whether G. glycymeris could be used to build chronologies for sea surface temperature (SST) reconstruction for the region. In 2013 a group of dead shells were collected near the Desertas Islands, Madeira, at 80-300 m water depth range, together with two living specimens. The live collected shells were relatively young (Madeira (n=18) samples could be collected into a robust chronology: between 1950 and 2000 the value of the expressed population signal EPS was found to be higher than 0.8. In this time interval their composite chronology exhibited negative correlation (r=-0.6, pMadeira. At the same time, it correlated positively (r>0.8) with the averaged February satellite derived Chlorophyll (Chl) concentrations in the region, although this data was available only between 1998 and 2012. Our results suggest that the relationship between shell growth of G. glycymeris and SST is complex and not direct. In contrast with the northern populations the low water temperature was not a limiting environmental factor for the shells. Chl concentration of the surface water around the Madeira Islands usually exhibits a maximum in February or March (spring phytoplankton bloom) when vertical mixing is the most intensive and SST is the lowest during the year. This could explain the negative correlation between the shell

Study of flavonoids of Sechium edule (Jacq) Swartz (Cucurbitaceae) different edible organs by liquid chromatography photodiode array mass spectrometry.

Science.gov (United States)

Siciliano, Tiziana; De Tommasi, Nunziatina; Morelli, Ivano; Braca, Alessandra

2004-10-20

A liquid chromatography-mass spectrometry (LC-MS)-based method was developed for the characterization of flavonoids from Sechium edule (Jacq) Swartz (Cucurbitaceae) edible organs, a plant cultivated since pre-Colombian times in Mexico where the fruit is called chayote. Chayote is used for human consumption in many countries; in addition to the fruits, stems, leaves and the tuberous part of the roots are also eaten. Eight flavonoids, including three C-glycosyl and five O-glycosyl flavones, were detected, characterized by nuclear magnetic resonance spectroscopic data, and quantified in roots, leaves, stems, and fruits of the plant by LC-photodiode array-MS. The aglycone moieties are represented by apigenin and luteolin, while the sugar units are glucose, apiose, and rhamnose. The results indicated that the highest total amount of flavonoids was in the leaves (35.0 mg/10 g of dried part), followed by roots (30.5 mg/10 g), and finally by stems (19.3 mg/10 g). Copyright 2004 American Chemical Society

Synthesis, characterization, and cytocompatibility of potential cockle shell aragonite nanocrystals for osteoporosis therapy and hormonal delivery

Directory of Open Access Journals (Sweden)

Jaji AZ

2017-01-01

Full Text Available Alhaji Zubair Jaji,1,2 Md Zuki Bin Abu Bakar,1,3 Rozi Mahmud,4 Mohamad Yusof Loqman,5 Mohamad Noor Mohamad Hezmee,1 Tijani Isa,3 Fu Wenliang,3 Nahidah Ibrahim Hammadi1 1Department of Veterinary Pre-Clinical Science, Universiti Putra Malaysia, Serdang, Selangor, Malaysia; 2Department of Veterinary Anatomy, Faculty of Veterinary Medicine, University of Ilorin, Ilorin, Kwara, Nigeria; 3Molecular Biomedicine Laboratory, Institute of Bioscience, Universiti Putra Malaysia, Serdang, Selangor, Malaysia; 4Department of Imaging, Faculty of Medicine and Health Science, Universiti Putra Malaysia, Serdang, Selangor, Malaysia; 5Department of Companion Animal Medicine and Surgery, Universiti Putra Malaysia, Serdang, Selangor, Malaysia Abstract: Calcium carbonate is a porous inorganic nanomaterial with huge potential in biomedical applications and controlled drug delivery. This study aimed at evaluating the physicochemical properties and in vitro efficacy and safety of cockle shell aragonite calcium carbonate nanocrystals (ANC as a potential therapeutic and hormonal delivery vehicle for osteoporosis management. Free and human recombinant parathyroid hormone 1-34 (PTH 1-34-loaded cockle shell aragonite calcium carbonate nanocrystals (PTH-ANC were synthesized and evaluated using standard procedures. Transmission electron microscopy and field emission scanning electron microscopy results demonstrated highly homogenized spherical-shaped aragonite nanocrystals of 30±5 nm diameter. PTH-ANC had a zeta potential of −27.6 ± 8.9 mV. The encapsulation efficiency of the formulation was found to be directly proportional to the concentrations of the drug fed. The X-ray diffraction patterns revealed strong crystallizations with no positional change of peaks before and after PTH-ANC synthesis. Fourier transform infrared spectroscopy demonstrated no detectable interactions between micron-sized aragonite and surfactant at molecular level. PTH-ANC formulation was stabilized

Cryopreservation of chayote (Sechium edule JACQ. SW.) zygotic embryos and shoot-tips from in vitro plantlets.

Science.gov (United States)

Abdelnour-Esquivel, Ana; Engelmann, Florent

2002-01-01

This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM were successfully cryopreserved using a vitrification technique. Optimal conditions included the culture of mother-plants for 22 days on medium containing 0.3 M sucrose, culture of excised apices on the same medium for 1 day, loading of apices for 20 min with 2M glycerol + 0.4M glycerol, treatment with a series of diluted PVS2 solution (60 % PVS2 followed by 80 % PVS2 solution for 15 min (cultivar Cocoro Blanco [CB]) or 30 min (cultivars CN and Cl) at each concentration), rapid freezing and thawing, washing of shoot-tips with a 1.2 M sucrose solution, followed by recovery on media with progressively decreasing sucrose concentrations until the standard concentration of 0.1 M was reached. The highest survival percentages achieved ranged between 17 and 38 %, depending on the cultivar.

Nutraceutic Characteristics of the Extracts and Juice of Chayote (Sechium edule (Jacq. Sw. Fruits

Directory of Open Access Journals (Sweden)

María de la Luz Riviello-Flores

2018-05-01

Full Text Available Fruits of chayote [Sechium edule (Jacq. Swartz] are a non-traditional vegetable widely consumed in Latin America, with the state of Veracruz, México being the world’s main producer, but little is known about the nutraceutical potential. This study aimed to determine the chemical compositions and antioxidant activities from the juice fruits from two commercial varieties of chayote cultivated in Mexico, as well as a proposal for the elaboration of chayote juices with stevia leaves and pineapple juice. The physicochemical properties of juice from virens levis (VL and nigrum spinosum (NS varieties were determined using standard methods. The juice of the two varieties differ significantly regarding the concentrations of total soluble solids and total sugars, but not vitamin C. The total concentration of phenolics in NS extracts was slightly higher than in VL (1005 and 856 mg 100 g−1 dry-weight, respectively, but the total flavonoid contents were similar (27 and 26 mg 100 g−1 dry-weight, respectively. Cucurbitacin D was predominant in both varieties. The radical scavenging capacities of VL and NS extracts varied slightly (IC50 = 0.45 to 0.65 mg mL−1, while the antioxidant activities were similar (~80%. The NS variety is particularly promising regarding nutraceutical application. The chayote juice combined with stevia and pineapple maintained the original nutraceutical characteristics of the fruit, but enhanced the organoleptic characteristics like density and sugar/acidity balance.

Fabrication, Characterization and Cytotoxicity of Spherical-Shaped Conjugated Gold-Cockle Shell Derived Calcium Carbonate Nanoparticles for Biomedical Applications

Science.gov (United States)

Kiranda, Hanan Karimah; Mahmud, Rozi; Abubakar, Danmaigoro; Zakaria, Zuki Abubakar

2018-01-01

The evolution of nanomaterial in science has brought about a growing increase in nanotechnology, biomedicine, and engineering fields. This study was aimed at fabrication and characterization of conjugated gold-cockle shell-derived calcium carbonate nanoparticles (Au-CSCaCO3NPs) for biomedical application. The synthetic technique employed used gold nanoparticle citrate reduction method and a simple precipitation method coupled with mechanical use of a Programmable roller-ball mill. The synthesized conjugated nanomaterial was characterized for its physicochemical properties using transmission electron microscope (TEM), field emission scanning electron microscope (FESEM) equipped with energy dispersive X-ray (EDX) and Fourier transform infrared spectroscopy (FTIR). However, the intricacy of cellular mechanisms can prove challenging for nanomaterial like Au-CSCaCO3NPs and thus, the need for cytotoxicity assessment. The obtained spherical-shaped nanoparticles (light-green purplish) have an average diameter size of 35 ± 16 nm, high carbon and oxygen composition. The conjugated nanomaterial, also possesses a unique spectra for aragonite polymorph and carboxylic bond significantly supporting interactions between conjugated nanoparticles. The negative surface charge and spectra absorbance highlighted their stability. The resultant spherical shaped conjugated Au-CSCaCO3NPs could be a great nanomaterial for biomedical applications.

Micropropagación de chayote (sechium edule jacq. Sw. a partir de brotes vegetativos

Directory of Open Access Journals (Sweden)

Ana Abdelnour

2002-01-01

Full Text Available El chayote (Sechium edule es una importante fuente de divisas para los países exportadores, entre los que Costa Rica mantiene el liderazgo mundial. Entre los factores más limitantes para su producci ón se encuentra el material de siembra, tradicionalmente la semilla, que por su naturaleza no permite la obtención de una producción morfológicamente homogénea de frutos (color, forma y textura de la epidermis motivo de los altos porcentajes de rechazo en las plantas empacadoras. El establecimiento de una metodología de propagación vegetativa de la especie ayudaría a resolver los problemas de heterogeneidad. Por lo anterior, la presente investigación se dirigió a desarrollar un método de micropropagación a partir de brotes vegetativos. Se evaluó el efecto de varios desinfectantes y concentraciones de reguladores de crecimiento en las etapas de establecimiento, multiplicación y enraizamiento de dos cultivares comerciales. Se observó que una desinfección con hipoclorito de calcio al 4% permitió el mayor porcentaje de explantes establecidos asépticamente bajo condiciones in vitro (49%. También se observó que durante las etapas posteriores de la micropropagación, los requerimientos de reguladores de crecimiento fueron muy bajos (0,1 mgL-1 de BA en la etapa de brotación de yemas y de 0,1 a 0,2 mgL-1 de AIB durante el enraizamiento o no se requirieron (etapa de multiplicaci ón de microestacas.

Shifting baselines in the Ems Dollard estuary: A comparison across three decades reveals changing benthic communities

Science.gov (United States)

Compton, Tanya J.; Holthuijsen, Sander; Mulder, Maarten; van Arkel, Maarten; Schaars, Loran Kleine; Koolhaas, Anita; Dekinga, Anne; ten Horn, Job; Luttikhuizen, Pieternella C.; van der Meer, Jaap; Piersma, Theunis; van der Veer, Henk W.

2017-09-01

At a time when there is a growing discussion about the natural state of estuaries, a comparison of macrozoobenthos communities from two surveys conducted 30 years apart in the Ems Dollard estuary, in the eastern Wadden Sea, The Netherlands, provides a unique opportunity to compare changes over time. As expected, our comparison revealed a gradient in species composition from land (the Dollard) to sea (the Outer Ems) at both points in time, with brackish species in the Dollard and more marine species in the Outer Ems (Wadden Sea). Total richness increased over time; however, this mainly reflected the immigration of new species and sampling differences. In the Dollard, total biomass declined over time, most likely reflecting de-eutrophication in this area. Strikingly, at the meeting point between the sea and the brackish Dollard, i.e. the Inner Ems, the community composition changed from one dominated by bivalves (1970s) to one dominated by worms (since 2009). This change involved a reduction in total biomass, mainly of Mya arenaria, and immigration of polychaete worms (Marenzellaria viridis and Alitta succinea). In the Outer Ems, an increase in total biomass was observed, associated with the recent successful recruitment of Cerastoderma edule. This comparison highlights that historical data provides useful insights at large spatial scales. However, a full understanding of the complex dynamics of estuaries requires an analysis of continuous long-term monitoring series.

Effects of IAA and IBA on the in vitro rooting of stem cuttings of Sechium edule (Jacq. Sw

Directory of Open Access Journals (Sweden)

José García García

2015-01-01

Full Text Available This investigation was carried out with the objective of evaluating the response of shoots of chayote [S. edule (Jacq. Sw.] to the application of indole-3-butyric acid (IBA and indole-3-acetic acid (IAA on the in vitro rooting phase. The effect of three culture media, modified from the proposed of Murashige and Skoog (MS was studied: 1- 65% MS salt base, 2- 65% MS salt base + 0.05 mg l-1 of indolebutyric acid (AIB and 3- 65% MS salt base + 3.0 mg l-1-3-indole acetic acid (IAA. The variables evaluated were: number of roots, length and number of shoots per in vitro seedling. The best result were obtained when using 65% MS salt base with 3.0 mg l-1 of IAA. Significant differences (P<0.05 among treatments containing growth regulators was obtained for the variables number of roots and length of in vitro plantlets. In the UNA-730 accession root induction was obtained in a 65% MS salt base culture medium without growth regulators; however, when IAA and IBA was added the induction was 100%. The differences identified in this work with regards to the root induction were probably the combined result of genotype and specific culture conditions. Key words: auxins, chayote, growth regulators, in vitro culture

Feeding current characteristics of three morphologically different bivalve suspension feeders, Crassostrea gigas, Mytilus edulis and Cerastoderma edule, in relation to food competition

NARCIS (Netherlands)

Troost, K.; Stamhuis, E.J.; van Duren, L.A; Wolff, W.J.

Introduced Pacific oysters (Crassostrea gigas) have shown rapid expansion in the Oosterschelde estuary, while stocks of native bivalves declined slightly or remained stable. This indicates that they might have an advantage over native bivalve filter feeders. Hence, at the scale of individual

Feeding current characteristics of three morphologically different bivalve suspension feeders, Crassostrea gigas Mytilus edulis and Cerastoderma edule , in relation to food competition

NARCIS (Netherlands)

Troost, K.; Stamhuis, E.J.; Duren, L.A.; Wolff, W.

2009-01-01

Introduced Pacific oysters (Crassostrea gigas) have shown rapid expansion in the Oosterschelde estuary, while stocks of native bivalves declined slightly or remained stable. This indicates that they might have an advantage over native bivalve filter feeders. Hence, at the scale of individual

Criterios locales para selección de semillas de chayote (Sechium edule Jacq. Sw. en zonas rurales de Chiapas, México

Directory of Open Access Journals (Sweden)

Francisco Guevara Hernández

2015-04-01

Full Text Available En el estudio se identificaron y analizaron los criterios socio-antropológicos fundamentados en etnoagronomía y etnobotánica de los productores para seleccionar semillas de chayote (Sechium edule Jacq. Sw. en zonas rurales de los municipios Villa Corzo y Villaflores (Chiapas, México. En entrevistas semi-estructuradas realizadas a 60 productores se describieron los criterios locales para seleccionar las semillas de esta hortaliza, considerando características de color, tamaño y presencia de espinas en los frutos, así como la obtención de variedades y recomendaciones para la siembra. Sin considerar la procedencia de los productores, el cultivo del chayote se realiza independientemente del tamaño, el color o la presencia de espinas en los frutos. Más de 60% de los productores entrevistados compra las semillas y prefieren aquellas variedades que posean frutos con espinas debido a su sabor agradable. Se confirmó la validez de los estudios socio-antropológicos en sistemas agrícolas tradicionales en la zona, particularmente en etnobotánica, para entender las relaciones sociales y productivas a nivel local, y para definir sistemas productivos sostenibles a partir de los criterios propios de las familias campesinas, lo que permite documentar, analizar, validar y entender multi-criterios relacionados con la producción familiar de chayote y su posible mejoramiento.

HONGOS CAUSANTES DE ENFERMEDADES POSTCOSECHA EN CHAYOTE (Sechium edule (Jacq. SW. Y SU CONTROL IN VITRO

Directory of Open Access Journals (Sweden)

Siul D. Romero-Velazquez

2015-01-01

Full Text Available El fruto de chayote (Sechium edule (Jaqc. Sw. es una hortaliza de exportación de importancia para México y Costa Rica. El proceso comercial exige cumplir con estándares de calidad, que implican frutos sanos y libres de defectos. Sin embargo, debido a las condiciones de alta humedad que se desarrollan en los frutos empacados en películas plásticas, se han presentado rechazos en el mercado de exportación, por la presencia de enfermedades fungosas. El objetivo de este trabajo fue identificar morfológica (microscopía óptica y electrónica de barrido y molecularmente (PCR: Polimerase Chain Reaction las especies de hongos causales de las principales enfermedades postcosecha de chayote en frutos infectados procedentes de huertas comerciales para exportación, así como probar in vitro la efectividad de diversos productos comerciales en la inhibición del crecimiento de dichos hongos. Los resultados mostraron a Didymella bryoniae como el causante de “gomosis de las cucurbitáceas” y a Fusarium oxysporum y F. solani como causales de fusariosis o ahogamiento de guías; estos patógenos dañan la parte basal y media de frutos comerciales, además de Chaetomium globosum, un asociado al proceso infeccioso de Fusarium sp., como saprófito no patógeno. La inoculación con Bacillus subtilis presentó una inhibición efectiva (0,01 mg.l-1 i.a en las pruebas in vitro contra Didymella bryoniae, Fusarium oxysporum y F. solani; el fungicida más efectivo contra los 2 primeros fue Tebuconazole-trifloxystrobin, con una DL50 de 0,0116 y 0,0106 mg.l-1 respectivamente; no así contra F. solani, cuyo mayor control fue registrado con procloraz, con DL50 de 0,0042 mg.l-1. Estos resultados contribuyen al reconocimiento de las enfermedades fungosas más importantes en chayote y su perspectiva de control durante el manejo postcosecha de frutos para exportación.

Hongos causantes de enfermedades postcosecha en chayote (Sechium edule(Jacq. SW. y su control in vitro

Directory of Open Access Journals (Sweden)

Siul D. Romero Velazquez

2015-11-01

Full Text Available El fruto de chayote (Sechium edule (Jaqc. Sw. es una hortaliza de exportación de importancia para México y Costa Rica. El proceso comercial exige cumplir con estándares de calidad, que implican frutos sanos y libres de defectos. Sin embargo, debido a las condiciones de alta humedad que se desarrollan en los frutos empacados en películas plásticas, se han presentado rechazos en el mercado de exportación, por la presencia de enfermedades fungosas. El objetivo de este trabajo fue identificar morfológica (microscopía óptica y electrónica de barrido y molecularmente (PCR: Polimerase Chain Reaction las especies de hongos causales de las principales enfermedades postcosecha de chayote en frutos infectados procedentes de huertas comerciales para exportación, así como probar in vitro la efectividad de diversos productos comerciales en la inhibición del crecimiento de dichos hongos. Los resultados mostraron a Didymella bryoniae como el causante de “gomosis de las cucurbitáceas” y a Fusarium oxysporum y F. solani como causales de fusariosis o ahogamiento de guías; estos patógenos dañan la parte basal y media de frutos comerciales, además de Chaetomium globosum, un asociado al proceso infeccioso de Fusariumsp., como saprófito no patógeno. La inoculación con Bacillus subtilis presentó una inhibición efectiva (0,01 mg.l-1 i.a en las pruebas in vitro contra Didymella bryoniae, Fusarium oxysporum y F. solani; el fungicida más efectivo contra los 2 primeros fue Tebuconazole-trifloxystrobin, con una DL50 de 0,0116 y 0,0106 mg.l-1 respectivamente; no así contra F. solani, cuyo mayor control fue registrado con procloraz, con DL50 de 0,0042 mg.l-1. Estos resultados contribuyen al reconocimiento de las enfermedades fungosas más importantes en chayote y su perspectiva de control durante el manejo postcosecha de frutos para exportación.

Are metallothioneins equally good biomarkers of metal and oxidative stress?

Science.gov (United States)

Figueira, Etelvina; Branco, Diana; Antunes, Sara C; Gonçalves, Fernando; Freitas, Rosa

2012-10-01

Several researchers investigated the induction of metallothioneins (MTs) in the presence of metals, namely Cadmium (Cd). Fewer studies observed the induction of MTs due to oxidizing agents, and literature comparing the sensitivity of MTs to different stressors is even more scarce or even nonexistent. The role of MTs in metal and oxidative stress and thus their use as a stress biomarker, remains to be clearly elucidated. To better understand the role of MTs as a biomarker in Cerastoderma edule, a bivalve widely used as bioindicator, a laboratory assay was conducted aiming to assess the sensitivity of MTs to metal and oxidative stressors. For this purpose, Cd was used to induce metal stress, whereas hydrogen peroxide (H2O2), being an oxidizing compound, was used to impose oxidative stress. Results showed that induction of MTs occurred at very different levels in metal and oxidative stress. In the presence of the oxidizing agent (H2O2), MTs only increased significantly when the degree of oxidative stress was very high, and mortality rates were higher than 50 percent. On the contrary, C. edule survived to all Cd concentrations used and significant MTs increases, compared to the control, were observed in all Cd exposures. The present work also revealed that the number of ions and the metal bound to MTs varied with the exposure conditions. In the absence of disturbance, MTs bound most (60-70 percent) of the essential metals (Zn and Cu) in solution. In stressful situations, such as the exposure to Cd and H2O2, MTs did not bind to Cu and bound less to Zn. When organisms were exposed to Cd, the total number of ions bound per MT molecule did not change, compared to control. However the sort of ions bound per MT molecule differed; part of the Zn and all Cu ions where displaced by Cd ions. For organisms exposed to H2O2, each MT molecule bound less than half of the ions compared to control and Cd conditions, which indicates a partial oxidation of thiol groups in the cysteine

Accumulation of Trace Metals in Anadara granosa and Anadara inaequivalvis from Pattani Bay and the Setiu Wetlands.

Science.gov (United States)

Pradit, Siriporn; Shazili, Noor Azhar Mohamed; Towatana, Prawit; Saengmanee, Wuttipong

2016-04-01

This study was undertaken to assess the levels of trace metals (As, Cd, Cu, Pb, and Zn) in two common species of cockles (Anadara granosa and Anadara inaequivalvis) from two coastal areas in Thailand (Pattani Bay) and Malaysia (the Setiu Wetlands). A total of 350 cockles were collected in February and September 2014. Trace metals were determined by Inductively Coupled Plasma Mass Spectrometry. We observed that cockles in both areas had a higher accumulation of metals in September. Notably, the biota-sediment accumulation (BSAF) of Cd was highest in both areas. A strong positive correlation of Cd with the length of the cockles at Pattani Bay (r(2) = 0.597) and the Setiu Wetlands (r(2) = 0.675) was noted. It was suggested that As could be a limiting element (BSAF Malaysia Food Regulations, mean values of As, Cd, Cu, Pb, and Zn were within acceptable limits, but the maximum values of Cd and Pb exceeded the limits for both areas. Regular monitoring of trace metals in cockles from both areas is suggested for more definitive contamination determination.

Translations on Environmental Quality, Number 156.

Science.gov (United States)

1978-01-06

MALAYSIA Industrial Effluents Killing Fish, Cockles (NEW STRAITS TIMES, 6, 7 Oct 77) 3 Fishermen Hit Twice, by Christopher Butterworth Action...Afghanistan a parad- ise for bird watchers from all over the world. CSO: 5000 MALAYSIA INDUSTRIAL EFFLUENTS KILLING FISH, COCKLES Fishermen Hit...that this hinders the oxidation of carbohydrates, consequently leading to obesity and skin problems. Ozdenoglu also added that the healthy

Ecology of megabenthic bivalve communities from sandy beaches on the south coast of Portugal

Directory of Open Access Journals (Sweden)

Marta M. Rufino

2010-03-01

Cardiidae (except Acanthocardia tuberculata and Cerastoderma edule included mostly species occurring in deeper waters. Bathymetric sequence of species distribution within some families was observed.

Multiscale patterns in the diversity and organization of benthic intertidal fauna among French Atlantic estuaries

Science.gov (United States)

Blanchet, Hugues; Gouillieux, Benoît; Alizier, Sandrine; Amouroux, Jean-Michel; Bachelet, Guy; Barillé, Anne-Laure; Dauvin, Jean-Claude; de Montaudouin, Xavier; Derolez, Valérie; Desroy, Nicolas; Grall, Jacques; Grémare, Antoine; Hacquebart, Pascal; Jourde, Jérôme; Labrune, Céline; Lavesque, Nicolas; Meirland, Alain; Nebout, Thiebaut; Olivier, Frédéric; Pelaprat, Corine; Ruellet, Thierry; Sauriau, Pierre-Guy; Thorin, Sébastien

2014-07-01

Based on a parallel sampling conducted during autumn 2008, a comparative study of the intertidal benthic macrofauna among 10 estuarine systems located along the Channel and Atlantic coasts of France was performed in order to assess the level of fauna similarity among these sites and to identify possible environmental factors involved in the observed pattern at both large (among sites) and smaller (benthic assemblages) scales. More precisely this study focused on unraveling the observed pattern of intertidal benthic fauna composition and diversity observed at among-site scale by exploring both biotic and abiotic factors acting at the among- and within-site scales. Results showed a limited level of similarity at the among-site level in terms of intertidal benthic fauna composition and diversity. The observed pattern did not fit with existing transitional water classification methods based on fish or benthic assemblages developed in the frame of the European Water Framework Directive (WFD). More particularly, the coastal plain estuaries displayed higher among-site similarity compared to ria systems. These coastal plain estuaries were characterized by higher influence of river discharge, lower communication with the ocean and high suspended particulate matter levels. On the other hand, the ria-type systems were more dissimilar and different from the coastal plain estuaries. The level of similarity among estuaries was mainly linked to the relative extent of the intertidal "Scrobicularia plana-Cerastoderma edule" and "Tellina tenuis" or "Venus" communities as a possible consequence of salinity regime, suspended matter concentrations and fine particles supply with consequences on the trophic functioning, structure and organization of benthic fauna. Despite biogeographical patterns, the results also suggest that, in the context of the WFD, these estuaries should only be compared on the basis of the most common intertidal habitat occurring throughout all estuarine systems

The Upper Miocene of the Rostov Dome (Eastern Paratethys: Implication of the chronostratigraphy and bivalvia-based biostratigraphy

Directory of Open Access Journals (Sweden)

Ruban Dmitry A.

2005-01-01

Full Text Available The Rostov Dome is located in the south of the Russian Platform. In the Late Miocene this area was embraced by the Eastern Paratethys. The implications of a recently developed Neogene chronostratigraphy to the studied area are discussed. The Sarmatian regional stage corresponds to the upper part of the Langhian, the entire Serravalian and the lower part of the Tortonian global stages; the Maeotian regional stage corresponds to the upper part of the Tortonian and the lowermost horizons of the Messinian global stages; the Pontian regional stage corresponds to most of the Messinian and the lowermost Zanclean global stages. A first Bivalvia-based bio-stratigraphic framework is proposed for the territory of the Rostov Dome. Five biozones were established within the Serravalian-Messinian: Tapes vitalianus, Cerastoderma fittoni-Cerastoderma subfittoni, Congeria panticapaea, Congeria amygdaloides navicula and Monodacna pseudocatillus-Prosodacna schirvanica.

Distribution of sup 14 C-lindane (γ-BHC) insecticide in a simulative mudflat microecosystem

International Nuclear Information System (INIS)

Nashriyah Mat; Burhanuddin Ahmad; Abdul Khalik Wood; Zaleha Hashim; Sabri Junoh; Zaharudin Ahmad

1997-01-01

Organochlorinated pesticide such as Lindane is very persistent in the marine environment. The distribution of sup 14 C-lindane in a simulative mudflat micro-ecosystem; in sea water, sediment and cockle (Anadara granosa) compartments was studied for a period of 10 weeks under aeration. Cockle bioconcentrated 2808.4 Bq/g tissue one day after exposure, which was gradually reduced to 1754.5 Bq/g tissue six days later. Lindane was probably slowly depurated by cockle following its migration to deeper-sediment layer within one week of exposure. Sediment absorption of sup 14 C-lindane was observed in the first and second weeks, reaching 595.4 Bq/g sediment at 15 days after exposure. A steady decline of its concentration was shown between 2-10 weeks of exposure to 216.7 Bq/g sediment possibly due to sediment desorption. The sup 14 C-lindane level in sea water was shown to steeply drop from 53.3 Bq/ml to 24.8 Bq/ml within 2 weeks exposure, followed by a steady decline to 0.47 Bq/ml between 2-10 weeks of exposure. The unaccounted radioactivity could have been lost in the form of volatilized lindane

Comité Scientifique de la Revue des Sciences et de la Technologie ...

African Journals Online (AJOL)

MICROSIM

croissance du mollusque Cerastoderma glaucum dans trois stations sur les berges (profondeur < 1.50 m) de la lagune Mellah. .... biométriques, peut être ramenée à la loi d'allométrie ..... Ces densités élevées dans ce secteur seraient en.

Выборы как предвестник перемен / Айн Тоотс

Index Scriptorium Estoniae

Тоотс, Айн, 1944-

2009-01-01

Kohalike omavalitsuste volikogude valimiste tulemustest. Endise Tallinna linnapea Hardo Aasmäe sõnul võib Keskerakonna võit kohalikel valimistel sillutada teed Edgar Savisaare edule 2011. a. presidendivalimistel

Baltic leaders who returned from West to East

Index Scriptorium Estoniae

2006-01-01

Artiklis tutvustatakse kolme Balti riigi presidentide sarnast minevikku eksiilis ning nenditakse, et varasem demokraatlikus riigis elamise kogemus on kindlasti kaasa aidanud Eesti, Läti ja Leedu majanduslikule ning välispoliitilisele edule

Gull Foraging Field Survey Data (2015)

Data.gov (United States)

U.S. Environmental Protection Agency — We conducted a predation study to determine whether emergence from the sediment affected cockle survival or physiological condition. We performed a field survey of...

BKR 27(1) pp. xx-xx (Dick et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... Antibiotic sensitivity profiles of the bacteria (Escherichia coli, Vibrio sp. and Salmonella sp.) ..... of Vibrio parahaemolyticus isolated from cockles in Padang, ... potentially pathogenic Halophilic Vibrios isolated from seafood.

Kultuuritegelaste luhtunud katse ajalugu korrata / Ando Leps

Index Scriptorium Estoniae

Leps, Ando, 1935-

2003-01-01

Kultuuritegelaste pöördumine nelja erakonna poole üritas olla signaaliks nelja partei lähenemisele ja ühisele koostöövandele seista vastu Keskerakonna arvatavale edule Riigikogu valimistel. Võrdlus 1980. aasta 40 kirjaga

A tale of two fjords – en analyse af bundfauna samfund i Odense og Roskilde Fjord

DEFF Research Database (Denmark)

Banta, Gary Thomas; Delefosse, Matthieu; Canal Vergés, Paula

gravende muslinger (f.eks. Cerastoderma spp.) mens Odense Fjord (OF) havde flere orme. Ligeledes så vi mange tubificide orme i den indre del af OF. I den indre del af RF så vi i stedet mange dansemyggelarver (Chironomidae). Af de undersøgte miljøvariable var vanddybde og salinitet (både niveauet og...

Concentration of selected heavy metals in water of the Juru River ...

African Journals Online (AJOL)

HP

2012-04-24

Apr 24, 2012 ... Key words: Heavy metals, pollution, river, inductively couple plasma. INTRODUCTION ... the community especially in the fishing industry and a source of ... most productive mudflats for cockle farming in Peninsular. Malaysia ...

India hiilgav viletsus / Andrei Hvostov

Index Scriptorium Estoniae

Hvostov, Andrei, 1963-

2006-01-01

Hiinat nimetatakse maailma töökojaks, Indiat aga bürooks (back office), võrdlus põhineb India IT-firmade edul - kõik tegevused, mida saab teha arvutite abil, kipuvad kolima Indiasse. Tulevikuriik India on hädas keskaegsete tavadega

Edukaks töö ja arengu kaudu / Ketlin Priilinn

Index Scriptorium Estoniae

Priilinn, Ketlin, 1982-

2005-01-01

Ilmunud ka: Delovõje Vedomosti 2. veebr. lk. 11. TOP-i 2. koht. Ehituse, kaevetööde ja kinnisvaraga tegeleva Malkati Kaubanduse OÜ juhatuse liikme Indrek Puhalaineni sõnul on ettevõtet edule aidanud aktiivne töö. Diagramm

Phenolic Content, and Antioxidant and Antimicrobial Activities of ...

African Journals Online (AJOL)

Erah

Methods: The content of total phenols, flavonoids and anthocyanins of the alcohol, hydroalcohol and aqueous extracts of ... Keywords: Crataegus oxyacantha L.; Natural phenolic compounds; Antioxidant and antimicrobial activity, Southeast Serbia. ..... Antioxidant activities of Sechium edule (Jacq.) Swart extracts, Food ...

How the food supply harvestable by waders in the Wadden Sea depends on the variation in energy density, body weight, biomass, burying depth and behaviour of tidal-flat invertebrates

Science.gov (United States)

Zwarts, Leo; Wanink, Jan H.

For several reasons, waders in the Wadden Sea face a large seasonal and annual variation in their food supply. Observations on a tidal flat in the Dutch Wadden Sea have shown that: - (1) The average energy density of ten invertebrate prey species varies between 21 and 23 kJ·g -1 AFDW. In Scrobicularia plana and Mya arenaria, but not in Macoma balthica, the energy density is 10% lower in winter than in summer. - (2) Depending on the species, body weights of prey of similar size are 30 to 60% lower in winter than in summer. - (3) The year-to-year fluctuation in standing-crop biomass is larger in some species than in others, the difference depending mainly on the frequency of successful recruitment. The overall biomass of the macrobenthos in winter is half of that in summer, but the timing of the peak biomass differs per species. - (4) The burying depth varies per species: Cerastoderma edule live just beneath the surface, while M. balthica, S. plana, M. arenaria, Arenicola marina and Nereis diversicolor bury more deeply and the majority of these prey live out of reach of the bird's bill. In all six species, burying depth increases with size. There is no seasonal variation in depth of C. edule and M. arenaria, but the four other species live at most shallow depth in early summer and most deeply in midwinter. Burying depths in winter vary from year to year, but are unrelated to temperature. Neither has temperature any effect on depth within months. For knot Calidris canutus feeding on M. balthica, the fluctuation in the accessible fraction was the main source of variation in the biomass of prey that is actually harvestable, i.e. the biomass of prey of suitable size that is accessible. Accordingly, the paper reviews the available data on the temporal variations in accessibility, detectability, ingestibility, digestibility and profitability of prey for waders. Only a small part of the prey is harvestable since many accessible prey are ignored because of their low

Interkultuurilised võimalused ja ohud turunduses / Kristel Kaljund

Index Scriptorium Estoniae

Kaljund, Kristel

2002-01-01

Kasut. kirj. lk. 27. - Kokkuvõte ingl. k. lk. 28. Artiklis põhjendatakse kultuuritausta mõju majanduslikule edule ning tuuakse ära kõige sagedasemad vigade põhjused ning pakutakse välja, kuidas Eesti majandusspetsialistidel oleks võimalik neid vigu vältida

Chemical composition profiling and antifungal activity of the ...

African Journals Online (AJOL)

Background: Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could ...

Maritime Halophyte Species from Southern Portugal as Sources of Bioactive Molecules

DEFF Research Database (Denmark)

Rodrigues, Maria João; Gangadhar, Katkam N.; Vizetto-Duarte, Catarina

2014-01-01

-ethylbenzothiazoline-6-sulphonic acid) (ABTS) radical was obtained in the ether extract of J. acutus (IC50 = 0.4 mg/mL) and H. portulacoides (IC50 = 0.9 mg/mL). The maximum total phenolic content (TPC) was found in the methanol extract of M. edule (147 mg gallic acid equivalents (GAE)/g) and in the ether extract of J......,1-diphenyl-2-picrylhydrazyl (DPPH) radical were the methanol extracts of M. edule (IC50 = 0.1 mg/mL) and J. acutus (IC50 = 0.4 mg/mL), and the ether extracts of J. acutus (IC50 = 0.2 mg/mL) and A. macrostachyum (IC50 = 0.3 mg/mL). The highest radical scavenging activity (RSA) against the 2,2'-azino-bis (3...... activity and selectivity was obtained with the ether extract of J. acutus. Juncunol was identified as the active compound and for the first time was shown to display selective in vitro cytotoxicity towards various human cancer cells....

Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica.

Science.gov (United States)

Castro, Ruth M; Moreira, Lisela; Rojas, María R; Gilbertson, Robert L; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

2013-09-01

Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere.

Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica

Directory of Open Access Journals (Sweden)

Ruth M. Castro

2013-09-01

Full Text Available Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1 was obtained from a chayote (S. edule leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV and Pepper golden mosaic virus (PepGMV were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV infecting chayote in the Western Hemisphere.

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 151 ... Vol 17, No 2 (2013), Hydatidosis of cattle and sheep, its economic importance and ... skin quality after treatment with diazinon against cockle, Abstract PDF ... Vol 16, No 1 (2012), Incidence rate of clinical bovine mastitis in ...

Ultrasound-Assisted Extraction: Effect of Extraction Time and Solvent ...

African Journals Online (AJOL)

Purpose: To investigate the influence of extraction conditions assisted by ultrasound on the quality of extracts obtained from Mesembryanthemum edule shoots. Methods: The extraction procedure was carried out in an ultrasonic bath. The effect of two solvents (methanol and ethanol) and two extraction times (5 and 10 min) ...

Mööblifirmade trump a la carte-teenuses / Heli Lehtsaar

Index Scriptorium Estoniae

Lehtsaar, Heli, 1976-

2008-01-01

Mööblitootjad on muutuvas majandusolukorras hakanud seeriatootmise asemel pöörama rohkem tähelepanu eritellimustele. Vt. samas: Aktiivne müük ja likviidne käibevara aitavad madalseisu ajal elus püsida. Ain Alvela. Edule pürgiv mööblitootja peab moevooludega kaasa sörkima

PRODUKSI BIODIESEL MELALUI REAKSI TRANSESTERIFIKASI MINYAK JELANTAH DENGAN KATALIS CANGKANG KERANG DARAH (Anadara granosa HASIL DEKOMPOSISI

Directory of Open Access Journals (Sweden)

Aldes Lesbani

2013-11-01

Full Text Available Biodisel telah diproduksi dari minyak jelantah melalui reaksi transesterifikasi menggunakan katalis hasil dekomposisi kerang darah. Kerang darah didekomposisi pada berbagai temperatur dimulai dari 600-1100oC pada kondisi udara terbuka menggunakan furnace.Produk dekomposisi dianalisa menggunakan difraktometer X-Ray.Hasil penelitian menunjukkan temperatur optimum dekomposisi kerang darah terjadi pada temperatur 900oC.Pola XRD produk dekomposisi pada 900 oC mirip dengan pola XRD kalsium oksida standar. Penggunaan katalis hasil dekomposisi untuk produksi biodiesel menghasilkan viskositas dan densitas biodiesel sebesar 5,81 mm2/s dan 0,87 g/cm3. Hasil ini sesuai dengan standar biodiesel dari SNI yakni viskositas dan densitas yang disyaratkan SNI sebesar 2,3-6,0 mm2/s dan 0,85-0,89 g/cm3.   Biodiesel was produced from waste cooking oil by transestrification reaction using decomposed cockle shell as catalyst. Cockle shell was decomposed at various temperatures ranging from 600-1100oC in open air condition using furnace. The decomposed product was analyzed using X-Ray diffractometer. The results showed that the optimum temperature for decomposition of cockle shell was at 900 oC. The XRD pattern of decomposed product at 900oC was similar with XRD pattern of calcium oxide standard. The use of decomposed shell to produce biodiesel resulted viscosity and density of biodiesel 5.81 mm2/s and 0.87 g/cm3, respectively. These results are appropriate with biodiesel standard form SNI where the viscosity and density of biodiesel from SNI value were 0.85-0.89 g/cm3 and 2.3-6.0 mm2/s.

Nutritional composition and antioxidant activities of Curculigo pilosa ...

African Journals Online (AJOL)

ajl yemi

2011-11-28

Nov 28, 2011 ... Phenolic, flavonoids and proanthocyanidin contents were 65.17, 23.17 and 4.23 mg/g .... The total phenol content in the extract was determined by the modified Folin-Ciocalteu method (Wolfe et al., 2003). 0.5 ml ( ..... activities of Sechium edule (Jacq.) Swart extracts. Food Chem. 97: 452–458. Palazzino G ...

An Analysis of Estimated Versus Actual Development Costs for an Electronics State-of-the-Art (SOA) Extension.

Science.gov (United States)

1987-12-01

DOWNGPAONG SC-EDULE distributiJ-_ _ . 1.,1J=.ted 4 PERFORMING ORGANZA ;ON REPORT NuMBERIS) S MONiTORING ORGANIZATION REP(CRT %L%𔄂ERS, 6a NAME OF PERFORMING...process. It is the one where assistance of other technical experts may be required. It may also require some restructuring of the program merely to

Improvement of sheep skin quality after treatment with diazinon ...

African Journals Online (AJOL)

Cockle, otherwise known as ekek locally, has been economically the most important skin defect among the tanneries in Ethiopia for the last three decades. The disease has been experimented on since 1996 when FAO sponsored the trials on sheep and goat skin improvement trial (TCP/ETH/4558&6712) and found that ...

Environmental Impact Research Program. Ruffed Grouse (Bonasa umbellus) Section 4.1.1, US Army Corps of Engineers Wildlife Resources Management Manual.

Science.gov (United States)

1986-07-01

tors in most populations (Edminster 1954, Gullion and Marshall 1968). However, hunting may depress grouse numbers on areas that receive intensive...in the diversity of ruffed grouse diets. Clover and other green leafy material and the fruits of Arctostaphylos, cranberry , and meadow rue contribute...Christmas fern Polystichum acrostichoides Clover Trifoliwn spp. Cranberry Viburnum edule Dandelion Taraxaum spp. Dogwood Corfus spp. Douglas fir Pseudotsuga

Venemaa ja Georgia sõda : suurvõimu lõks / Ivan Krastev ; tõlk. Triinu Pakk

Index Scriptorium Estoniae

Krastev, Ivan

2008-01-01

Autor kirjutab, et Venemaa-Gruusia konflikti puhul on tegemist 19. sajandi sõjaga 21. sajandi Euroopas, millele on iseloomulik võimukonfrontatsioon ilma laiema ideoloogilise polarisatsioonita. Konflikt näitas kolmekordset nurjumist: Gruusia presidendil Mihheil Saakashvilil ei õnnestunud taastada riigi territoriaalset terviklikkust, USA administratsioon näitas oma võimetust strateegilise liitlase abistamisel ning vaatamata sõjalisele edule, ei õnnestunud Venemaal mõjutada Euroopa poliitikat

Chayote (Sechium edule) causing hypokalemia in pregnancy.

Science.gov (United States)

Jensen, L P; Lai, A R

1986-11-01

A case of severe hypokalemia in pregnancy is presented. Chayote, a subtropical vegetable with potent diuretic action, is implicated, as the potassium level returned to normal, without recurrence of hypokalemia, once the ingestion was stopped.

Source and impact of lead contamination on {delta}-aminolevulinic acid dehydratase activity in several marine bivalve species along the Gulf of Cadiz

Energy Technology Data Exchange (ETDEWEB)

Company, R.; Serafim, A.; Lopes, B.; Cravo, A. [CIMA, University of Algarve, Campus de Gambelas, 8005-139 Faro (Portugal); Kalman, J.; Riba, I.; DelValls, T.A. [Catedra UNESCO/UNITWIN/WiCop, Department of Physical-Chemistry, Faculty Marine and Environmental Sciences, University of Cadiz, 11510 Puerto Real, Cadiz (Spain); Blasco, J. [Instituto Ciencias Marinas Andalucia (CSIC), Campus Rio San Pedro, 11510 Puerto Real, Cadiz (Spain); Delgado, J. [Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Sarmiento, A.M. [Catedra UNESCO/UNITWIN/WiCop, Department of Physical-Chemistry, Faculty Marine and Environmental Sciences, University of Cadiz, 11510 Puerto Real, Cadiz (Spain); Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Nieto, J.M. [Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Shepherd, T.J.; Nowell, G. [Department of Earth Sciences, University of Durham, Science Laboratories, Durham DH1 3LE (United Kingdom); Bebianno, M.J., E-mail: mbebian@ualg.pt [CIMA, University of Algarve, Campus de Gambelas, 8005-139 Faro (Portugal)

2011-01-17

Coastal areas and estuaries are particularly sensitive to metal contamination from anthropogenic sources and in the last few decades the study of space-time distribution and variation of metals has been extensively researched. The Gulf of Cadiz is no exception, with several rivers draining one of the largest concentrations of sulphide deposits in the world, the Iberian Pyrite Belt (IPB). Of these rivers, the Guadiana, one of the most important in the Iberian Peninsula, together with smaller rivers like the Tinto and Odiel, delivers a very high metal load to the adjacent coastal areas. The purpose of this work was to study the source and impact of lead (Pb) drained from historical or active mining areas in the IPB on the activity of a Pb inhibited enzyme ({delta}-aminolevulinic acid dehydratase, ALAD) in several bivalve species along the Gulf of Cadiz. Seven marine species (Chamelea gallina, Mactra corallina, Donax trunculus, Cerastoderma edule, Mytilus galloprovincialis, Scrobicularia plana and Crassostrea angulata) were collected at 12 sites from Mazagon, near the mouth of the rivers Tinto and Odiel (Spain), to Cacela Velha (Ria Formosa lagoon system, Portugal). Lead concentrations, ALAD activity and lead isotope ratios ({sup 206}Pb/{sup 204}Pb, {sup 207}Pb/{sup 204}Pb and {sup 208}Pb/{sup 204}Pb) were determined in the whole soft tissues. The highest Pb concentrations were determined in S. plana (3.50 {+-} 1.09 {mu}g g{sup -1} Pb d.w.) and D. trunculus (1.95 {+-} 0.10 {mu}g g{sup -1} Pb d.w.), while M. galloprovincialis and C. angulata showed the lowest Pb levels (<0.38 {mu}g g{sup -1} Pb d.w.). In general, ALAD activity is negatively correlated with total Pb concentration. However this relationship is species dependent (e.g. linear for C. gallina ALAD = -0.36[Pb] + 0.79; r = 0.837; or exponential for M. galloprovincialis ALAD = 2.48e{sup -8.3[Pb]}; r = 0.911). This indicates that ALAD activity has considerable potential as a biomarker of Pb and moreover, in

Source and impact of lead contamination on δ-aminolevulinic acid dehydratase activity in several marine bivalve species along the Gulf of Cadiz

International Nuclear Information System (INIS)

Company, R.; Serafim, A.; Lopes, B.; Cravo, A.; Kalman, J.; Riba, I.; DelValls, T.A.; Blasco, J.; Delgado, J.; Sarmiento, A.M.; Nieto, J.M.; Shepherd, T.J.; Nowell, G.; Bebianno, M.J.

2011-01-01

Coastal areas and estuaries are particularly sensitive to metal contamination from anthropogenic sources and in the last few decades the study of space-time distribution and variation of metals has been extensively researched. The Gulf of Cadiz is no exception, with several rivers draining one of the largest concentrations of sulphide deposits in the world, the Iberian Pyrite Belt (IPB). Of these rivers, the Guadiana, one of the most important in the Iberian Peninsula, together with smaller rivers like the Tinto and Odiel, delivers a very high metal load to the adjacent coastal areas. The purpose of this work was to study the source and impact of lead (Pb) drained from historical or active mining areas in the IPB on the activity of a Pb inhibited enzyme (δ-aminolevulinic acid dehydratase, ALAD) in several bivalve species along the Gulf of Cadiz. Seven marine species (Chamelea gallina, Mactra corallina, Donax trunculus, Cerastoderma edule, Mytilus galloprovincialis, Scrobicularia plana and Crassostrea angulata) were collected at 12 sites from Mazagon, near the mouth of the rivers Tinto and Odiel (Spain), to Cacela Velha (Ria Formosa lagoon system, Portugal). Lead concentrations, ALAD activity and lead isotope ratios ( 206 Pb/ 204 Pb, 207 Pb/ 204 Pb and 208 Pb/ 204 Pb) were determined in the whole soft tissues. The highest Pb concentrations were determined in S. plana (3.50 ± 1.09 μg g -1 Pb d.w.) and D. trunculus (1.95 ± 0.10 μg g -1 Pb d.w.), while M. galloprovincialis and C. angulata showed the lowest Pb levels ( -1 Pb d.w.). In general, ALAD activity is negatively correlated with total Pb concentration. However this relationship is species dependent (e.g. linear for C. gallina ALAD = -0.36[Pb] + 0.79; r = 0.837; or exponential for M. galloprovincialis ALAD = 2.48e -8.3[Pb] ; r = 0.911). This indicates that ALAD activity has considerable potential as a biomarker of Pb and moreover, in marine bivalve species with different feeding habits. Lead isotope data

The impact of extreme flooding events and anthropogenic stressors on the macrobenthic communities’ dynamics

Science.gov (United States)

Cardoso, P. G.; Raffaelli, D.; Lillebø, A. I.; Verdelhos, T.; Pardal, M. A.

2008-02-01

, heavy flooding in the Mondego region during the recovery process had more severe effects on these assemblages than expected, effectively re-setting the recovery clock, with significant socio-economic impacts (e.g. high mortality of fish in fish farms, and a large decline of economically important species, such as the bivalves Scrobicularia plana and Cerastoderma edule). The frequency and magnitude of these extreme events is predicted to increase in future years [IPCC WGI, 2001. Climate change 2001: the scientific basis, contribution of working group I to the third assessment report of the Intergovernmental Panel on Climate Change (IPCC). In: Houghton, J.T., Ding, Y., Griggs, D.J., Noguer, M., van der Linden, P.J., Xiaosu, D. (Eds.), Cambridge University Press, UK, 944 p.] and there is a risk that impacted ecosystems will never recover fully, with far-reaching consequences for human well being.

Installation Restoration Program. Site Investigation Report. 147th Fighter Interceptor Group, Texas Air National Guard, Ellington, Field, Houston, Texas

Science.gov (United States)

1991-01-01

N4.L.....-I~C1 01AME TER ...... SACKS OF TON’O 4-1At AN SCH4EDULE 40PVC SAK pTA rEINO 8LANK VLT TRAP I o GALLONS OF GVOUT USED SOTTOM WELL CAP POUNDS...and fungi on leaf surfaces and in soil. Many of these microorganisms play key roles in the decomposer food chain. Cases of lead poisoning have been

Environmental Assessment: 13th Street Bridge Emergency Repair and Retrofit Vandenberg Air Force Base California

Science.gov (United States)

2003-06-23

project site. • Biological hazards, including vegetation (i.e., poison oak and stinging nettle ), animals (i.e., insects , spiders, and snakes), and 4-18...channel, and in dryer areas of the site. Herbaceous species in the understory include stinging nettle (Urtica dioica), California blackberry (Rubus...Nightshade FAC/FACU Poison oak Nightshade FAC/FACU Stinging nettle FACW Cockle-bur FAC+ COMMENTS Likely C. Canadensis Most E/eocharis spp

Selenium accumulation in the cockle Anadara trapezia

International Nuclear Information System (INIS)

Jolley, Dianne F.; Maher, William A.; Kyd, Jennelle

2004-01-01

An extensive study on Se accumulation in a population of Anadara trapezia from a marine lake is reported. The effects of organism mass, gender, reproductive cycle, and season on Se accumulation and tissue distribution were investigated. Analyses showed that gender and reproductive cycle had no significant effect on Se accumulation. A. trapezia showed a strong positive correlation between Se burden and tissue mass. Constant Se concentrations were observed within individual populations but varied spatially with sediment Se concentrations. Se concentrations in tissues decreased from gills > gonad/intestine > mantle > muscle > foot, which remained constant over 12 months, however, significantly lower concentrations were observed in the summer compared to winter. A. trapezia is a good biomonitor for Se, as gender and size do not effect concentration, however, season of collection must be reported if changes in Se bioavailability are to be identified in short term studies, or during intersite comparisons. - Capsule: The marine bivalve Anadara trapezia is a good bioindicator for marine selenium contamination

Surveillance of hepatitis A and E viruses contamination in shellfish in Thailand.

Science.gov (United States)

Namsai, A; Louisirirotchanakul, S; Wongchinda, N; Siripanyaphinyo, U; Virulhakul, P; Puthavathana, P; Myint, K S; Gannarong, M; Ittapong, R

2011-12-01

To survey for hepatitis A virus (HAV) and hepatitis E virus (HEV) contamination in edible bivalve shellfish. A total of 213 shellfish (52 oysters, 69 cockles and 92 mussels) collected from a culture farm and two retailed markets were investigated for HAV and HEV contamination by reverse transcription-polymerase chain reaction (RT-PCR) assay using HA2-HA1 (capsid region) and HE366-HE363 (ORF2/3 overlapping region) primers, respectively. It was found that 3.8% of the shellfish and 2.9 and 6.5% of the cockle and mussel, respectively, showed positive for HAV detection. Nucleotide sequencing of all the 8 HAV-positive shellfish revealed 97-100% similarity to HAV subgenotype IA. Interestingly, viruses were found more frequently in the gills than in digestive tissue (4.5%vs 0.5%, P = 0.045). All the shellfish were negative for HEV. Significant contamination of HAV in edible bivalve shellfish was observed. Beside digestive tissue, gills are one of the important samples for viral genome detection. HAV-contaminated shellfish can play a role as reservoirs and/or vehicles in faecal-oral transmission in Thailand, and further monitoring of such a contamination is required. © 2011 The Authors. Letters in Applied Microbiology © 2011 The Society for Applied Microbiology.

Desafios à cogestão: os impactos da Via Expressa Sul sobre o extrativismo na RESEX Marinha do Pirajubaé

Directory of Open Access Journals (Sweden)

Juliana Lima Spínola

2014-12-01

Full Text Available This article focuses on the case of the environmental impacts generated by the installation of the Southern Expressway, an enterprise of the State Government of Santa Catarina, on the extraction of berbigão (cockles; Anomalocardia brasiliana in the Marine Extractive Reserve (RESEX, in the Portuguese acronym Pirajubaé, in Florianópolis (SC. The project caused significant impacts on the marine environment of this RESEX, including the loss of about half of the cockle bank, and hence on extractive practices and their management. The socio-environmental changes resulting from the construction of the Southern Expressway led to a situation of deregulation in the use of fisheries resources, resulting in use conflicts and establishing a situation of open access to resources in the area. In the case of Pirajubaé, when interests of dominant social groups in conflict with the goals of the RESEX were imposed, its institutional arrangement proved unable to secure the rights of the local users or gatherers on the use of natural resources in its territory, which should be the main objective of this kind of Conservation Unit. This leads us to question the effectiveness of the RESEX as an institutional arrangement to ensure shared management and conservation of natural resources in a given territory.

Interaction between birds and macrofauna within food webs of six intertidal habitats of the Wadden Sea.

Science.gov (United States)

Horn, Sabine; de la Vega, Camille; Asmus, Ragnhild; Schwemmer, Philipp; Enners, Leonie; Garthe, Stefan; Binder, Kirsten; Asmus, Harald

2017-01-01

The determination of food web structures using Ecological Network Analysis (ENA) is a helpful tool to get insight into complex ecosystem processes. The intertidal area of the Wadden Sea is structured into diverse habitat types which differ in their ecological functioning. In the present study, six different intertidal habitats (i.e. cockle field, razor clam field, mud flat, mussel bank, sand flat and seagrass meadow) were analyzed using ENA to determine similarities and characteristic differences in the food web structure of the systems. All six systems were well balanced between their degree of organization and their robustness. However, they differed in their detailed features. The cockle field and the mussel bank exhibited a strong dependency on external imports. The razor clam field appeared to be a rather small system with low energy transfer. In the mud flat microphytobenthos was used as a main food source and the system appeared to be sensitive to perturbations. Bird predation was the most pronounced in the sand flat and the seagrass meadow and led to an increase in energy transfer and parallel trophic cycles in these habitats. Habitat diversity appears to be an important trait for the Wadden Sea as each subsystem seems to have a specific role in the overall functioning of the entire ecosystem.

The Use of Tailored Testing with Instructional Programs.

Science.gov (United States)

1986-03-01

AVAILABILITY OF REPORT Approved for public release: distribution un- t~X DWNCADNGSCHiEDULE li-mited. Reproduction in whole or in part is...of Education ,-’ Washington, DC 20V 0 Chicago, IL r06𔄁 Air Force Human Resources Lab Cdt. Arnold Bohrer . AFHRL/MPD Sectie Psychologisch Cnderzoek...University of Texas-Austin Univ-ir-tat Puss-ldorf Measurement and Evalu-,tion Er zi, gswi ssensch;ftl iches Cpnter Un ivf rsit ’tsst r. 1 Austin, TX 787

Atmospheric Triatomic Molecular Studies.

Science.gov (United States)

1980-11-17

ADORE.SS(Jf dlII.,.nt tra 05), tivl 15, SECURITY CLA’.SS. (of this rwpofl) __ 1 P7 jl / 15&. DECLASSJFI CAT DJGft*114I1 -J SCmEDULE If- DiSTRIBUT ION...work in Table I are given in Appendix I. I (3) 41 S. - I + t/n LU ) *C14~ & c .) a)Z. W i 0 0 uL a) NCDNN N 0 4-3 0) cl b -4 cu a x of acca Lm %- a

Thresholds of motion of shell debris under unidirectional flow: influence of faunal composition

Science.gov (United States)

Rieux, A.; Weill, P.; Mouazé, D.; Poirier, C.; Tessier, B.

2017-12-01

Quantifying bottom sediment erodibility is necessary to refine understanding of coastal processes and fossil records. Coastal sediments are partly composed of biogenic particles, which shape and density differ from rounded quartz grain and vary between species. Numerous studies have investigated the hydrodynamic behaviour of bioclastic sediments derived from reef-dwelling organisms, but research focusing on "cool-water carbonate" bioclastic particles (i.e. mollusc shell debris, calcareous algae, …) are rare. The present study aims in characterizing the influence of faunal composition on the entrainment threshold of mollusc shell debris from temperate regions. Shells have been sampled on shelly ridges in the southern coast of the Mont-Saint-Michel bay (NW France), before being ground and separated into individual sieve fractions. Eight species, representative of the local faunal composition, have been studied: four wild (cockle, furrow shell, saddle oyster, flat oyster), three reared (japanese oyster, mussel, manila clam) and one introduced (slipper limpet) species. Experiments for defining the threshold of motion of all samples were conducted in a small recirculating flume, under unidirectional current, and using an Acoustic Doppler Velocimeter Profiler. Critical bed shear stress values (τcr) were derived from velocity profiles in the boundary layer, by a logarithmic regression of the "law of the wall". Depending on the species, the evolution of τcr with increasing grain diameters follows either an asymptotic or a more linear trend. Differences between species can be discerned: saddle oyster, japanese oyster and flat oyster show the smallest τcr, slipper limpet, furrow shell and mussel have an intermediate τcr and cockle and manila clam the highest τcr. For the 2-3.15 mm fraction, τcr ranges from 0.38 N.m-2 (saddle oyster) to 2.13 N.m-2 (cockle). Oyster shells (japanese and flat oysters) are composed of foliated sheets of calcite, interbedded with soft

From oysters to cockles at Hjarnø Sund

DEFF Research Database (Denmark)

Larsen, Johan Sandvang; Philippsen, Bente; Skriver, Claus

2018-01-01

Recent archaeological fieldwork at Hjarnø Sund, on the present-day island of Hjarnø in Horsens Fjord (eastern Jutland, Denmark), have explored a large eroding Mesolithic site. Two large shell middens have been identified at this locality. Emergency underwater excavations have targeted the one tha...... have been ultimately caused by the effects of local shoreline displacements, and consequent increases in sedimentation, resulting from drops in relative sea level....

Ammonia, phosphate, phenol, and copper(II) removal from aqueous solution by subsurface and surface flow constructed wetland.

Science.gov (United States)

Mojiri, Amin; Ahmad, Zakiah; Tajuddin, Ramlah Mohd; Arshad, Mohd Fadzil; Gholami, Ali

2017-07-01

Water pollution is a global problem. During current study, ammonia, phosphate, phenol, and copper(II) were removed from aqueous solution by subsurface and surface flow constructed wetland. In current investigation, distilled water was polluted with four contaminants including ammonia, phosphate, copper (Cu), and phenol. Response surface methodology and central composite design were applied to optimize pollutant removal during treatment by subsurface flow constructed wetland (SSFCW). Contact time (12 to 80 h) and initial pollutant concentration (20 to 85 mg/L) were selected as independent factors; some upper and lower ranges were also monitored for accuracy. In SSFCW, water hyacinth transplanted in two substrate layers, namely zeolite and cockle shell. SSFCW removed 87.7, 81.4, 74.7, and 54.9% of ammonia, phosphate, Cu, and phenol, respectively, at optimum contact time (64.5 h) and initial pollutant concentration (69.2 mg/L). Aqueous solution was moved to a surface flow constructed wetland (SFCW) after treating via SSFCW at optimum conditions. In SFCW, Typha was transplanted to a fixed powdered substrate layer, including bentonite, zeolite, and cockle shell. SFCW could develop performance of this combined system and could improve elimination efficacy of the four contaminants to 99.99%. So this combined CW showed a good performance in removing pollutants. Graphical abstract Wetlands arrangement for treating aqueous solution in current study.

Recent innovation in microbial source tracking using bacterial real-time PCR markers in shellfish

International Nuclear Information System (INIS)

Mauffret, A.; Mieszkin, S.; Morizur, M.; Alfiansah, Y.; Lozach, S.; Gourmelon, M.

2013-01-01

Highlights: ► DNA extraction from intravalvular liquid is promising for microbial source tracking in oysters. ► Host-associated bacterial markers in shellfish digestive tissues were difficult to assess with real-time PCR. ► DNA extracts from shellfish flesh appeared to have low inhibitor levels but low marker levels. ► Protocol transfer from one shellfish species to another does not appear possible. -- Abstract: We assessed the capacity of real-time PCR markers to identify the origin of contamination in shellfish. Oyster, cockles or clams were either contaminated with fecal materials and host-associated markers designed from Bacteroidales or Catellicoccus marimammalium 16S RNA genes were extracted from their intravalvular liquid, digestive tissues or shellfish flesh. Extraction of bacterial DNA from the oyster intravalvular liquid with FastDNA spin kit for soil enabled the selected markers to be quantified in 100% of artificially contaminated samples, and the source of contamination to be identified in 13 out of 38 naturally contaminated batches from European Class B and Class C areas. However, this protocol did not enable the origin of the contamination to be identified in cockle or clam samples. Although results are promising for extracts from intravalvular liquid in oyster, it is unlikely that a single protocol could be the best across all bacterial markers and types of shellfish

Caracterização Morfológica de Três Espécies de Broca-da-Haste em Chuchuzeiro (Coleoptera: Cerambycidae, Lamiinae)

OpenAIRE

SOUZA FILHO, MIGUEL F. DE; GABRIEL, DALVA; AZEVEDO FILHO, JOAQUIM A. DE

2001-01-01

A ocorrência simultânea de Adetus analis (Haldeman), Adetus fuscoapicalis Breuning e Plerodia syrinx (Bates) (Coleoptera: Cerambycidae, Lamiinae), broqueando ramos de chuchuzeiro Sechium edule (Jaqc.) Sw., é relatada. A. analis é sinônima de A. muticus (Thomson), que foi referida por diversos autores no Brasil. A. analis e A. fuscoapicalis são muito semelhantes quanto aos aspectos morfológicos e etológicos. Assim foi realizada uma descrição detalhada e ilustrações de ambas espécies a fim de p...

Infrared thermography for examination of paper structure

Science.gov (United States)

Kiiskinen, Harri T.; Pakarinen, Pekka I.

1998-03-01

The paper industry has used IR cameras primarily for troubleshooting, where the most common examples include the examination of the condition of dryer fabrics and dryer cylinders and the analysis of moisture variations in a paper web. Another application extensively using IR thermography is non-destructive testing of composite materials. This paper presents some recently developed laboratory methods using an IR camera to examine paper structure. Specific areas include cockling, moisture content, thermal uniformity, mechanism of failure, and an analysis of the copying process.

Infrared thermography examination of paper structure

International Nuclear Information System (INIS)

Kiiskinen, H.T.; Kukkonen, H.K.; Pakarinen, P.I.; Laine, A.J.

1997-01-01

The paper industry has used IR cameras primarily for troubleshooting, where the most common examples include the examination of the condition of dryer fabrics and dryer cylinders and the analysis of moisture variations in a paper web. Another application extensively using IR thermography is non-destructive testing of composite materials. This paper presents some recently developed laboratory methods using an IR camera to examine paper structure. Specific areas include cockling, moisture content, thermal uniformity, mechanism of failure, and an analysis of the copying process. (author)

Prevalence of potentially pathogenic Vibrio species in the seafood marketed in Malaysia.

Science.gov (United States)

Elhadi, Nasreldin; Radu, Son; Chen, Chien-Hsien; Nishibuchi, Mitsuaki

2004-07-01

Seafood samples obtained in seafood markets and supermarkets at 11 sites selected from four states in Malaysia were examined for the presence of nine potentially pathogenic species from the genus Vibrio between July 1998 and June 1999. We examined 768 sample sets that included shrimp, squid, crab, cockles, and mussels. We extensively examined shrimp samples from Selangor State to determine seasonal variation of Vibrio populations. Eight potentially pathogenic Vibrio species were detected, with overall incidence in the samples at 4.6% for V. cholerae, 4.7% for V. parahaemolyticus, 6.0% for V. vulnificus, 11% for V. alginolyticus, 9.9% for V. metschnikovii, 1.3% for V. mimicus, 13% for V. damsela, 7.6% for V. fluvialis, and 52% for a combined population of all of the above. As many as eight Vibrio species were detected in shrimp and only four in squid and peel mussels. The overall percent incidence of any of the eight vibrios was highest (82%) in cockles (Anadara granosa) among the seafoods examined and was highest (100%) in Kuching, Sarawak State, and lowest (25%) in Penang, Pulau Penang State, among the sampling sites. Of 97 strains of V. cholerae isolated, one strain belonged to the O1 serotype and 14 to the O139 serotype. The results indicate that the various seafood markets in Malaysia are contaminated with potentially pathogenic Vibrio species regardless of the season and suggest that there is a need for adequate consumer protection measures.

Promoción positiva de vegetales en preescolares costarricenses empleando el Kamishibai

OpenAIRE

Chacón-Villalobos, Alejandro; Molina Angulo, Ruth; Ruíz-González, María José

2015-01-01

Este artículo presenta la evaluación de la promoción positiva de los vegetales chayóte (Sechium edule) y brócoli (Brassica olerácea L), al emplear la estrategia de animación a la lectura conocida como Kamishibai. Durante el año 2012 en San José, se estudió la actitud infantil hacia los vegetales (positiva, negativa o neutra), y el agrado sensorial que manifestaba esta población antes de la exposición al Kamishibai y posterior a la misma. Se trabajó con 213 infantes preescolares entre los 4 y ...

A survey for potential biological control agents of Pereskia aculeata Miller (Cactaceae) in Brazil reveals two new species of Horismenus Walker (Hymenoptera: Eulophidae).

Science.gov (United States)

Pikart, Tiago G; Costa, Valmir A; Hansson, Christer; Cristo, Sandra C DE; Vitorino, Marcelo D

2017-05-30

This paper deals with the description of two new species of Horismenus Walker (Hymenoptera: Eulophidae) from Brazil, parasitoids of larvae of Adetus analis (Haldeman) (Coleoptera: Cerambycidae). Both species are similar to Horismenus steirastomae (Girault), a species that also parasitizes cerambycids. Adetus analis is a pest of Sechium edule (Jacq.) Swartz (Cucurbitaceae), a minor crop in Brazil, Argentina and U.S.A., but also feeds in stems of Pereskia aculeata Miller (Cactaceae), an ornamental plant that has become a problematic weed species in Africa, where it was introduced. The two new Horismenus species are described, diagnosed, and compared to H. steirastomae.

Applicability Of A Semi-Automated Clinical Chemistry Analyzer In Determining The Antioxidant Concentrations Of Selected Plants

Directory of Open Access Journals (Sweden)

Allan L. Hilario

2017-07-01

Full Text Available Plants are rich sources of antioxidants that are protective against diseases associated to oxidative stress. There is a need for high throughput screening method that should be useful in determining the antioxidant concentration in plants. Such screening method should significantly simplify and speed up most antioxidant assays. This paper aimed at comparing the applicability of a semi-automated clinical chemistry analyzer Pointe Scientific MI USA with the traditional standard curve method and using a Vis spectrophotometer in performing the DPPH assay for antioxidant screening. Samples of crude aqueous leaf extract of kulitis Amaranthus viridis Linn and chayote Sechium edule Linn were screened for the Total Antioxidant Concentration TAC using the two methods. Results presented in mean SD amp956gdl were compared using unpaired Students t-test P0.05. All runs were done in triplicates. The mean TAC of A. viridis was 646.0 45.5 amp956gdl using the clinical chemistry analyzer and 581.9 19.4 amp956gdl using the standard curve-spectrophotometer. On the other hand the mean TAC of S. edule was 660.2 35.9 amp956gdl using the semi-automated clinical chemistry analyzer and 672.3 20.9 amp956gdl using the spectrophotometer. No significant differences were observed between the readings of the two methods for A. viridis P0.05 and S. edible P0.05. This implies that the clinical chemistry analyzer can be an alternative method in conducting the DPPH assay to determine the TAC in plants. This study presented the applicability of a semi-automated clinical chemistry analyzer in performing the DPPH assay. Further validation can be conducted by performing other antioxidant assays using this equipment.

Assessment of a fruit extract ( Sechium edule ) on the labeling of ...

African Journals Online (AJOL)

The blood was centrifuged and plasma (P) and RBC were isolated, also precipitated with trichloroacetic acid (TCA, 5%) and soluble (S) and insoluble (I) fractions (F) of plasma and cells (C) were determined. The radioactivity (ATI%) was rated in RBC, IF-P and IF-C. The results have showed that extract was able to reduce ...

Koos ühisele edule! = Together towards success / Jüri Järviste

Index Scriptorium Estoniae

Järviste, Jüri

2004-01-01

Autori hinnangul vaid ettevõtjate endi aktiivne suhtumine ettevõtlust puudutavatesse küsimustesse ja probleemidesse tagab nende kiirema lahendamise. EVEA kui väike- ja keskmise suurusega ettevõtteid ühendav organisatsioon aitab ühenduse liikmetel olla teadlikum oma õigustest ja võimalustest

Isolation of Cryptococcus neoformans var. neoformans from bird droppings, fruits and vegetables in Mexico City.

Science.gov (United States)

López-Martínez, R; Castañón-Olivares, L R

1995-01-01

The presence of Cryptococcus neoformans in various natural sources, such as bird droppings, fruits and vegetables, was investigated. A total of 711 samples were analyzed; C. neoformans var. neoformans was isolated from seven out of 74 bird droppings (9.5%), with parrots as one of the most significant sources. Fruits were positive in 9.5% of the 169 samples studied, specially citrus fruits, particularly grapefruit, in which the highest frequency was found. From the 468 vegetable samples, only 20 were positive (4.2%). It is emphasized that five of the positive vegetables species are autochthonous to Mexico: avocado (Nectandra salicifolia), beet (Beta vulgaris var. quinopodiace), chayote (Sechium edule), stringbean (Cassia sp), and nopal (Opuntia ficus-indica).

Use of medicinal plants by people with hypertension

Directory of Open Access Journals (Sweden)

Marília Gabrielle Santos Nunes

2015-12-01

Full Text Available Objective: to describe the use of medicinal plants in the treatment of high blood pressure for people with hypertension enrolled in the Family Health Program in a city in Pernambuco State. Methods: a descriptive study, whose data were obtained through semi-structured interview script applied to 172 patients. Results: the use of medicinal plants for hypertension control was reported by 39.5%, of which 57.4% used only one medicinal plant. Among the species cited, there was predominant use of chayote [Sechium edule (Jacq. Sw.-34.8%]. Conclusion: medicinal plants constitute an adjunctive therapy in the treatment of hypertension. However, there is need for monitoring of handling and listed species.

Burrowing behavior of a deposit feeding bivalve predicts change in intertidal ecosystem state

Directory of Open Access Journals (Sweden)

Tanya Joan Compton

2016-03-01

Full Text Available Behavior has a predictive power that is often underutilized as a tool for signaling ecological change. The burrowing behavior of the deposit feeding bivalve Macoma balthica reflects a typical food-safety trade-off. The choice to live close to the sediment surface comes at a risk of predation and is a decision made when predation danger, food intake rates or future fitness prospects are low. In parts of the Dutch Wadden Sea, Macoma populations declined by 90% in the late 1990s, in parallel with large-scale mechanical cockle-dredging activities. During this decline, the burrowing depth of Macoma became shallow and was correlated with the population decline in the following year, indicating that it forecasted population change. Recently, there has been a series of large recruitment events in Macoma. According to the food-safety trade-off, we expected that Macoma should now live deeper, and have a higher body condition in association with this change in depth of living. Indeed, we observed that Macoma now lives deeper and that living depth in a given year forecasted population growth to the next year, especially in individuals larger than 14 mm. As living depth and body condition were strongly correlated in individuals larger than 14 mm, larger Macoma could be living deeper to protect their reproductive assets. Our results confirmed that burrowing depth signals impending population change and, together with body condition, can provide an early warning signal of ecological change. We suggest that population recovery is being driven by improved intertidal habitat quality in the Dutch Wadden Sea, rather than by the proposed climate-change related effects. This shift in ecosystem state is suggested to include the recovery of diatom habitat in the top layer of the sediment after cockle-dredging ended.

Intra-specific variability in life-history traits of Anadara tuberculosa (Mollusca: Bivalvia) in the mangrove ecosystem of the Southern coast of Ecuador.

Science.gov (United States)

Flores, Luis; Licandeo, Roberto; Cubillos, Luis A; Mora, Elba

2014-06-01

Anadara tuberculosa is one of the most important bivalves along the Western Pacific coast because of its commercial value. Nevertheless, the variability in growth, long-life span, natural mortality and reproductive parameters of this mangrove cockle has not yet been described. The aim of this study was to analyze these life-history traits in three areas of the Southern coast of Ecuador. Empirical and length-based methods were used to estimate these biological parameters. Body size data were collected from the commercial fishery between 2004 and 2011 in landing ports near to the Archipelago of Jambeli [Puerto Bolivar (PB), Puerto Jeli (PJ) and Puerto Hualtaco (PH)]. The von Bertalanffy growth parameters for combined sex were estimated between 70.87 to 93.45mm for L(infinity) and 0.22 to 0.80/year for k. The growth indices (PHI') ranged from 3.17 to 3.85, while the overall growth performance (OGP) ranged from 5.03 to 5.82. The mean of long-life span (t(max)), size and age at maturity (L50% and t50%) were estimated in 7.71 +/- 2.53 years, 39.13 +/- 2.24mm and 1.46 +/- 0.56 years for PB; 9.51 +/- 2.85 years, 37.78 +/- 1.95mm and 1.37 +/- 0.41 years for PJ and 5.81 +/- 2.11 years, 39.73 +/- 3.31mm and 0.94 +/- 0.41 years for PH. Natural mortality (M) ranged from 0.46 to 1.28/year. We concluded that significant intra-specific variation was observed in a temporal scale in PHI' and OGP indices as well as L50% and M. Therefore, temporal changes in these life-history traits should be taken into account when assessing the status of the mangrove cockle fishery.

Determination of trace elements in cockle Anadara Granosa L. using INAA

International Nuclear Information System (INIS)

Ibrahim, Noorddin

1994-01-01

This study determines the trace metal content in Anadara Granosa L., a popular seafood amongst South-East-Asians. Using the technique of instrumental neutron activation analysis (INAA) identification has been made of the presence of 17 trace metals including elements which are classified as toxic (As, Br, Cs) and those which are rare-earths (Eu, Ce, Lu, Tb, Yb). (author)

Abnormalities in bivalve larvae from the Puck Bay (Gulf of Gdansk, southern Baltic Sea) as an indicator of environmental pollution.

Science.gov (United States)

Lasota, Rafal; Gierszewska, Katarzyna; Viard, Frédérique; Wolowicz, Maciej; Dobrzyn, Katarzyna; Comtet, Thierry

2018-01-01

This study described the occurrence of abnormalities in bivalve larvae from the Puck Bay. Analyses of plankton samples collected in 2012-2013 showed that larval Mytilus trossulus, Mya arenaria, and Cerastoderma glaucum exhibited abnormalities that could indicate adverse environmental impacts. The deformities were mainly in shells, but missing soft tissue fragments and protruding vela were also noted. In addition to larval studies, we analyzed benthic postlarvae of Mytilus trossulus. Interestingly, grooves and notches at different locations of the prodissoconch, dissoconch, and shell margin were observed. Some of these deformations were reminiscent of the indentations found on the shell edge of larvae. Comparing the proportion of abnormal postlarvae to larvae with shell abnormalities suggested that the survival of larvae with shell abnormalities was low. Overall, our results suggested that the ratio of abnormal bivalve larvae could be used as an indicator of the biological effects of hazardous substances in the pelagic environment. Copyright © 2017 Elsevier Ltd. All rights reserved.

The trophic position of the alien crab Rhithropanopeus harrisii (crustacea decapoda panopeidae) in the Taman Bay, Sea of Azov community

Science.gov (United States)

Zalota, A. K.; Kolyuchkina, G. A.; Tiunov, A. V.; Biriukova, S. V.; Spiridonov, V. A.

2017-03-01

This work concerns the trophic web positioning of the alien crab Rhithropanopeus harrisii and other common marine invertebrate species and fishes in the benthic ecosystem of the shallows of Taman Bay, Sea of Azov. The base of the trophic web in this system is composed of phytoplankton, macrophytes (algae and marine grasses), and reeds that use atmospheric carbon for photosynthesis. Analysis of the isotopic composition of nitrogen and carbon has shown that although marine grasses are dominating primary producers in the shallows of the bay, primary consumers (such as Cerastoderma glaucum, Porifera gen. sp., Gammarus aequicauda, Deshayesorchestia deshayesii and Idotea balthica) only partially use this organic source; instead, they use a combination of different sources of primary production. It has been shown that the food source of the alien crab is primarily of animal origin. In Taman Bay, R. harrisii is on the same trophic level as other carnivores/scavengers: benthic fishes Syngnathus nigrolineatus, Gobius spp. and native crab Pilumnus hirtellus and shrimp Palaemon adspersus.

Uso de plantas medicinais por pessoas com hipertensão

Directory of Open Access Journals (Sweden)

Marília Gabrielle Santos Nunes

2015-01-01

Full Text Available Objetivo: describir el uso de plantas medicinales en el tratamiento de la hipertensión arterial por personas con hipertensión inscritas en el Programa de Salud Familiar en una ciudad del interior de Pernambuco. Métodos: estudio descriptivo, cuyos datos se obtuvieron a través de guía de entrevistas semiestructuradas aplicada a 172 pacientes. Resultados: el uso de plantas medicinales para el control de la hipertensión fue informado por 39,5%, de los cuales 57,4% utiliza sólo una planta medicinal. Entre las especies citadas predominó el uso de chayote [Sechium edule (Jacq. Sw.-34.8%]. Conclusión: plantas medicinales constituyen terapia coadyuvante en el tratamiento de hipertensión, sin embargo requiere monitoreo del manejo y de las especies seleccionadas.

Effects of pollination timing and distance on seed production in a dioecious weed Silene latifolia

Science.gov (United States)

Anderson, Jay F.; Duddu, Hema S. N.; Shirtliffe, Steven J.; Benaragama, Dilshan; Syrovy, Lena D.; Stanley, Katherine A.; Haile, Teketel A.

2015-11-01

Silene latifolia Poir. (white cockle or white campion) is an important invasive weed in North American agriculture. It exhibits dioecy, therefore, both male and female plants are required in order for seed production to occur. However, dioecious species being invasive is not common because of their limitations in pollination and subsequent seed production. The objective of this study is to determine the effect of pollination timing and distance on seed production of Silene latifolia. A series of experiments including pollination exclusion, timing and pollination distance were conducted in 2009 and 2010 at or around Saskatoon, Saskatchewan. For pollination exclusion, exclosures were built around the natural female plants for exclosure, sham-exclosure, and male and female combined treatments. Pollination timing was studied by applying exclosure, non-exclosure, night-exclosure, and day-exclosure treatments to individual female plants. Female plants were transplanted along a linear interval at six different distances from the pollen source to study the effect of pollination distance. S. latifolia was exclusively insect-pollinated and pollination occurred both day and night; however, in one year, pollination occurred mainly at night. Female plants that were in the range of 0-4 m from a compatible pollen source experienced no limitation to pollination. However, when the distance was increased further up to 128 m, pollination levels and subsequent seed production were declined. Moreover, there were differences in seed production between years suggesting that pollination was affected by the environmental conditions during pollination and the crop that white cockle was grown in. These experiments indicate that seed production in S. latifolia is limited by insect-pollination. Although there was pollination limitation for seed production at greater distances from a pollen source, the high fecundity rate (3000-18000 seeds per plant) resulted in a large seed output. Thus, we

The effects of Anadara granosa shell-Stichopus hermanni on bFGF expressions and blood vessel counts in the bone defect healing process of Wistar rats

Directory of Open Access Journals (Sweden)

Rima Parwati Sari

2017-12-01

Full Text Available Background: Bone damage can be caused by various factors with treatment usually involving graft materials being applied to the defective area. Moreover, in the bone defect healing process, blood vessels are also considered to be an important energy source for cell proliferation. One of the angiogenic factors playing an important role in blood vessel formation is basic fibroblast growth factor (bFGF. Furthermore, synthesized hydroxyapatite derived from Anadara granosa (AG shells constitutes one of the potential materials for use in bone graft. The gold sea cucumber genus Stichopus hermanni (SH possesses the ability to stimulate endothelial progenitor cells inducing bFGF. Purpose: This study aims to investigate the effects of AG shells and SH on bFGF expressions and blood vessel counts within the bone healing process. Methods: Twenty four male Wistar rats were divided into three groups, namely: a control group (C, a treatment group was administered with blood cockle shell (AG, and a treatment group with blood cockle shell and golden sea cucumber (AG+SH. Defects were made on their femurs measuring half the diameter of a circular, no. 018. bur These rats were subsequently sacrificed on day 7 after surgery. The expressions of bFGF were measured by means of IHC technique, while the number of blood vessels was quantified using HE technique. The resulting data was subjected to statistical analysis using an Anova test followed by an LSD test (p < 0.05. Results: The one-way Anova test results combined with those of an LSD test showed there to be significant differences in bFGF expressions and blood vessel counts between the control group (K and the treatment group (AG as well as between the treatment group (AG and the treatment group (AG+SH. Conclusions: A combination of Anadara granosa shell and Stichopus hermanni can increase the expression of bFGF and the number of blood vessels on day 7 during the bone healing process in Wistar rats.

Diuretic plants in the paintings of Pompeii.

Science.gov (United States)

Melillo, L

1994-01-01

The plants that appear in the paintings and mosaics of Pompeii are chiefly edible and medicinal, though flowers with purely esthetic appeal are also shown. An important example is one of the floor mosaics from the House of the Faun, in which it is possible to identify lemon, cherry, strawberry, pomegranate, grape and olive, leaves of grape, fig, apple and olive, and flowers of corn cockle. The diuretic properties of some of these plants are mentioned in the Naturalis Historia of Pliny the Elder. A silver cup from the House of Menandro, one of the most refined examples of plant decoration in antiquity, shows olive branches and fruits. The presence of plants in such artefacts confirms that people of classical times were conscious that plants were important producers of food, oils, fibers, woods and medicines.

Mythologizing Food: Marion Halligan’s non-fiction

Directory of Open Access Journals (Sweden)

Ulla Rahbek

2011-03-01

Full Text Available This paper discusses Marion Halligan’s non-fiction, particularly her writing on food: Those Women who go to Hotels, Eat my Words, Cockles of the Heart, Out of the Picture, and The Taste of Memory. The focus is on how Halligan deconstructs and reconstruct a mythology of food, in a Barthesian sense, revealing the contradictions at the heart of food mythology. The texts lay bare Halligan’s own personal and at times idiosyncratic mythology of food, where food is much more that just that. Venturing into areas of autobiography, memory, travel, place and gardens, this paper discusses how Halligan’s mythologizing of food doubles up, especially in her most recent food writing, as a rethinking and celebration of suburbia, which is figured as a site where nature and culture meet, and where paradise can be regained.

Gracilaria vermiculophylla (Ohmi) Papenfuss, 1967 (Rhodophyta, Gracilariaceae) in northern Europe, with emphasis on Danish conditions, and what to expect in the future

DEFF Research Database (Denmark)

Thomsen, Mads S.; Stæhr, Peter Anton; Nyberg, Cecilia D.

2007-01-01

Gracilaria vermiculophylla, a red macroalga from the West Pacific, was discovered in western Germany (the Wadden Sea) in 2002 and has since also been observed in Sweden (from about 70 km south to about 80 km north of Göteborg), Denmark (Wadden Sea, Horsens Fjord, Limfjorden, Vejle Fjord, Holckenh......Gracilaria vermiculophylla, a red macroalga from the West Pacific, was discovered in western Germany (the Wadden Sea) in 2002 and has since also been observed in Sweden (from about 70 km south to about 80 km north of Göteborg), Denmark (Wadden Sea, Horsens Fjord, Limfjorden, Vejle Fjord......-bottom estuaries and bays, typically in association with ubiquitous native invertebrates (lugworms, tube-building worms, mussels, cockles, snails). The invertebrates provide substratum for holdfast attachment and thalli incorporation, most likely increasing the stability of local G. vermiculophylla populations. We...

Artificial radioactivity in the environmental samples as IAEA reference materials

International Nuclear Information System (INIS)

Salagean, M.; Pantelica, A.

1998-01-01

Radioactivity levels of 110m Ag, 241 Am, 60 Co, 134 Cs, 137 Cs, 106 Ru, 125 Sb in some biological and environmental materials have been determined by gamma-ray spectrometry in the frame of 15 intercomparison runs organized by IAEA during 1986-1995. The investigated materials were polluted by various nuclear activities, as follows: 1. Nuclear experiments: IAEA-367, sediment collected in 1982 at the Enewetak Atoll (Marshall Islands in the Pacific Ocean). This atoll was used by the USA during 1948-1958 to test nuclear devices; IAEA-368, sediment collected in June 1989 from the Pacific Ocean at the Mururoa Atoll. Since 1966 this atoll has been used by France to test different nuclear devices. 2. Nuclear installations: IAEA-134, cockle flesh of Cardium edule collected in March 1991 from the Irish Sea (Morecambe Bay), England, about 45 km S-E of Sellafield radioactive discharge; IAEA-135, sediment collected in July 1991 in Lune Estuary-England. This area is influenced by the radioactive discharges of the nuclear installations of Sellafield; IAEA-326, soil collected in 1990 in the region of Kursk Atomic Power Plant (Russia). 3. Nuclear accidents (Chernobyl): IAEA-306, sediment collected in the Baltic Sea during October-November 1986; IAEA-307, seaplant Posidonia oceanica, collected in October 1986 in Mediterranean Sea along the shore, in the vicinity of the Principality of Monaco; IAEA-308, mixed seaweeds collected in October 1986 in Mediterranean Sea along the shore, in the vicinity of the Principality of Monaco; IAEA-156, clover collected during the summer harvest 1986 in Austria; IAEA-321, milk powder collected in autumn 1987 from a processing plant in Europe; IAEA-352, tuna fish flesh collected in April 1988 in the Western Mediterranean Sea; IAEA-373, grass collected from Kiev region during the summer harvest 1990; IAEA-375, soil collected in July 1990 from Brjansk region, Russia; IAEA-300, sediment collected in July 1992 in Bothnian Sea (Baltic Sea). 4

Polysaccharide composition of raw and cooked chayote (Sechium edule Sw.) fruits and tuberous roots.

Science.gov (United States)

Shiga, Tânia M; Peroni-Okita, Fernanda Helena Gonçalves; Carpita, Nicholas C; Lajolo, Franco Maria; Cordenunsi, Beatriz Rosana

2015-10-05

Chayote is a multipurpose table vegetable widely consumed in Latin America countries. Chayote fruits, leaves and tuberous roots contain complex carbohydrates as dietary fiber and starch, vitamins and minerals. The complex polysaccharides (cell walls and starch) were analyzed in the black and green varieties of chayote fruits as well as in green chayote tuberous root before and after a controlled cooking process to assess changes in their composition and structure. The monosaccharide composition and linkage analysis indicated pectins homogalacturonans and rhamnogalacturonan I backbones constitute about 15-20% of the wall mass, but are heavily substituted with, up to 60% neutral arabinans, galactans, arabinogalactans. The remainder is composed of xyloglucan, glucomannans and galactoglucomannans. Chayote cell-wall polysaccharides are highly stable under normal cooking conditions, as confirmed by the optical microscopy of wall structure. We found also that tuberous roots constitute a valuable additional source of quality starch and fiber. Published by Elsevier Ltd.

Optimization of PMAxx pretreatment to distinguish between human norovirus with intact and altered capsids in shellfish and sewage samples.

Science.gov (United States)

Randazzo, Walter; Khezri, Mohammad; Ollivier, Joanna; Le Guyader, Françoise S; Rodríguez-Díaz, Jesús; Aznar, Rosa; Sánchez, Gloria

2018-02-02

Shellfish contamination by human noroviruses (HuNoVs) is a serious health and economic problem. Recently an ISO procedure based on RT-qPCR for the quantitative detection of HuNoVs in shellfish has been issued, but these procedures cannot discriminate between inactivated and potentially infectious viruses. The aim of the present study was to optimize a pretreatment using PMAxx to better discriminate between intact and heat-treated HuNoVs in shellfish and sewage. To this end, the optimal conditions (30min incubation with 100μM of PMAxx and 0.5% of Triton, and double photoactivation) were applied to mussels, oysters and cockles artificially inoculated with thermally-inactivated (99°C for 5min) HuNoV GI and GII. This pretreatment reduced the signal of thermally-inactivated HuNoV GI in cockles and HuNoV GII in mussels by >3 log. Additionally, this pretreatment reduced the signal of thermally-inactivated HuNoV GI and GII between 1 and 1.5 log in oysters. Thermal inactivation of HuNoV GI and GII in PBS, sewage and bioaccumulated oysters was also evaluated by the PMAxx-Triton pretreatment. Results showed significant differences between reductions observed in the control and PMAxx-treated samples in PBS following treatment at 72 and 95°C for 15min. In sewage, the RT-qPCR signal of HuNoV GI was completely removed by the PMAxx pretreatment after heating at 72 and 95°C, while the RT-qPCR signal for HuNoV GII was completely eliminated only at 95°C. Finally, the PMAxx-Triton pretreatment was applied to naturally contaminated sewage and oysters, resulting in most of the HuNoV genomes quantified in sewage and oyster samples (12 out of 17) corresponding to undamaged capsids. Although this procedure may still overestimate infectivity, the PMAxx-Triton pretreatment represents a step forward to better interpret the quantification of intact HuNoVs in complex matrices, such as sewage and shellfish, and it could certainly be included in the procedures based on RT-qPCR. Copyright �

Combined toxicity of mercury and plastic wastes to crustacean and gastropod inhabiting the waters in Kuwait.

Science.gov (United States)

Bu-Olayan, A H; Thomas, B V

2015-11-01

The present study determined total mercury (T-Hg) in crustacean Portunus pelagicus (blue crab) and mollusc Tapes sulcarius (Furrowed Venus: Cockle) following suspected rise in beach plastic wastes and their effect on marine organisms. Live samples were collected from beaches representing six Kuwait Governorate areas and exposed to toxicity (96hr) and bio accumulation tests for 180 d with inclusion of plastic wastes and environmental conditions simulated in laboratory. Results revealed high T-Hg concentrations in T sulcarius (1.44ng l(-1)) compared to P. pelagicus (1.03ng l(-1)) during winter than summer, with bio accumulation factor (BAF) > 1 labelled these species as hyper-accumulators. Significantly, combination of T-Hg concentrations from plastic wastes and in seawater validated the possibilities of detrimental effects of other marine lives besides deteriorating the aesthetic values of scenic beaches and likelihood of invasive species in such coastal areas.

Pattern of relative growth in cockle Anadara antiquata in Ihamahu coastal waters, Central Maluku

Science.gov (United States)

Siahainenia, L.; Tuhumury, S. F.; Uneputty, P. A.; Tuhumury, N. C.

2018-03-01

Anadara antiquata is economically important species for fisheries and belong to phylum mollusc which also found in Maluku. However, the density of population begins to decrease recently due to high exploitation by people. The objective of the present study was to analyze relative growth pattern of A. antiquata including size distribution and growth pattern based on shell dimensions. The study was conducted from December 2016 to February 2017 in Ihamahu coastal waters. Data were collected by using purposive random sampling. All the individuals of A. antiquata found were measured the length, width and height by using a vernier caliper to the nearest 0.01mm. Data were analyzed by using SPSS 20 and Microsoft Excel software. The results indicated that the A. antiquata mostly found in seagrass bed with a muddy substrate. The size distribution of shell dimensions was different during sampling. Overall, the length ranged from 15.87 mm to 57.5 mm, the width from 15.50 mm to 48.60 mm and the height was from 9.36 mm to 35.9 mm. The population of A. antiquata consisted of juvenile and mature size. The mature size (> 30 mm) was more dominant in the population. The A. antiquata showed allometric relative growth pattern based on shell dimensions.

EFEKTIFITAS PEMBERIAN JUS LABU SIAM (Sechium edule TERHADAP PROFIL LIPID TIKUS (Rattus novergicus MODEL HIPERLIPIDEMIA

Directory of Open Access Journals (Sweden)

Yanita Listianasari

2017-10-01

Full Text Available Hyperlipidemia is a lipid profile (TC, TG, HDL, LDL metabolism disorder becoming the leading cause of cardiovascular disease. Flavonoid, phenol, vitamin C contained in squash have strong cardioprotective effect but its optimal dose has not been known yet. The objective of this research was to analyze the effectiveness of squash juice administration with varying doses on the lipid profile of hyperlipidemia model-rat with High Fat Diet induced. This research was done in laboratory experimental research with pre and posttest control group design.The experimental animals were consisted of 36 rats and divided into negative control, positive control, treatment I (drug, treatment II, III, IV (squash juice dose 1 ml, 2 ml, 4 ml/ 100 g BW rat/day with treatment for 38 days. The rat’s blood was taken before and after treatment for lipid profile. TC, HDL, LDL levels were measured using spectrophotometer Microlab 300 with CHOD-PAP. TG level was measured using Microlab 300 with GPO-PAP. Considering the statistic analysis, squash juice at doses 1 ml, 2 ml and 4 ml / 100 g BW rat/day, could reduce significantly (p < 0.05 TC, TG, LDL levels of rats. HDL level of rat could increase significantly (p < 0.05 with squash juice at dose 1 ml/100 g BW rat/day. There was no significant difference between the three doses of squash juice, so that squash juice at dose 1 ml/100 g BW rat/day is the best dose to reduce the lipid profile of hyperlipidemia model-rat. Hiperlipidemia merupakan gangguan metabolisme profil lipid (kolesterol total, trigliserida, HDL, LDL yang menjadi penyebab utama timbulnya penyakit kardiovaskular. Flavonoid, fenol, vitamin C yang terkandung dalam buah labu siam mempunyai efek kardioprotektif yang kuat akan tetapi belum diketahui dosis optimal. Tujuan penelitian ini adalah untuk menganalisis efektifitas pemberian jus labu siam dengan variasi dosis terhadap profil lipid tikus model hiperlipidemia. Metode yang digunakan adalah eksperimental laboratorik dengan rancangan pre and posttest control group design. Sebanyak 36 tikus putih Strain Wistar jantan dibagi menjadi 6 kelompok dengan 6 ekor tiap kelompok, yaitu kontrol negatif, kontrol positif (diinduksi High Fat Diet, perlakuan 1 (diinduksi High Fat Diet dan obat, perlakuan 2, 3, 4 (diinduksi High Fat Diet dan jus labu siam dosis 1 ml, 2 ml, 4 ml/100 g BB tikus/hari dengan perlakuan selama 38 hari. Pengambilan darah tikus dilakukan sebelum dan sesudah perlakuan untuk analisis profil lipid. Kadar kolesterol total, HDL, LDL diukur menggunakan spektrofotometer Microlab 300 dengan metode CHOD-PAP. Kadar trigliserida diukur menggunakan spektrofotometer Microlab 300 dengan metode GPO-PAP. Data dianalisis menggunakan uji Paired T-Test dan menunjukkan jus labu siam ketiga dosis dapat menurunkan secara bermakna (p<0,05 kadar kolesterol total, trigliserida dan LDL tikus. Kadar HDL tikus dapat naik secara bermakna (p<0,05 dengan jus labu siam dosis 1 ml/100 g BB tikus/hari. Pemberian jus labu siam dosis 1 ml/100 g BB tikus/hari merupakan dosis yang paling efektif dalam menurunkan kadar kolesterol total, trigliserida dan LDL serta menaikkan kadar HDL.

Bicomplex holomorphic functions the algebra, geometry and analysis of bicomplex numbers

CERN Document Server

Luna-Elizarrarás, M Elena; Struppa, Daniele C; Vajiac, Adrian

2015-01-01

The purpose of this book is to develop the foundations of the theory of holomorphicity on the ring of bicomplex numbers. Accordingly, the main focus is on expressing the similarities with, and differences from, the classical theory of one complex variable. The result is an elementary yet comprehensive introduction to the algebra, geometry and analysis of bicomplex numbers. Around the middle of the nineteenth century, several mathematicians (the best known being Sir William Hamilton and Arthur Cayley) became interested in studying number systems that extended the field of complex numbers. Hamilton famously introduced the quaternions, a skew field in real-dimension four, while almost simultaneously James Cockle introduced a commutative four-dimensional real algebra, which was rediscovered in 1892 by Corrado Segre, who referred to his elements as bicomplex numbers. The advantages of commutativity were accompanied by the introduction of zero divisors, something that for a while dampened interest in this subject. ...

From oysters to cockles at Hjarnø: chronology and economy on a Mesolithic kitchenmidden site

DEFF Research Database (Denmark)

Philippsen, Bente; Larsen, Johan Sandvang; Skriver, Claus

At Hjarnø, an island in Horsens fjord (Denmark), a submerged Mesolithic settlement has been known since at least 1936. In 2010 and 2011, a refuse layer of the former settlement was excavated. Despite the threat of erosion, organic preservation was generally good. For example, fragments of paddles...

Potensi Ekstrak Tumbuhan Sebagai Pengawet Produk Pangan

Directory of Open Access Journals (Sweden)

I Nengah Kencana Putra

2015-04-01

Full Text Available Nowadays, the use of natural antimicrobials such as plants extracts to preserve food get much attention of the researchers. This is related to the increasing of public concern over synthetic chemical food preservatives. Various types of plants had been declared can produce extracts that effectively inhibited the growth of food-contaminating microbes, such as methanol and ethanol extracts of bark Saccoglottis gabonensis, effectively inhibited the growth of Leuconostoc mesenteroides and Lactobacillus plantarum; extracts of onion and red pepper inhibited Candida crucei and Candida utilis; ethanol and water extracts of Eugenia Jambos had antimicrobial properties against bacteria such as Staphylococcus aureus, Yersenia enterocolitica, Staphylococcus hominis, Staphylococcus cohnii, Staphylococcus warneri; Picung seed extract (Pagium edule inhibited the growth of Staphylococcus aureus; and ethanol extract of Salvia pratensis leaves inhibited Escherichia coli, Bacillus cereus and Saccharomyces cerevisiae. Extraction of antimicrobial compounds from plant material could be done by using different types of solvents. Among the various types of solvents, ethanol and methanol solvents are most commonly used.Keyword: antimicrobial, plant extract, food preservative

Assessing the impact of the Asian mussel Arcuatula senhousia in the recently invaded Oristano Lagoon-Gulf system (W Sardinia, Italy)

Science.gov (United States)

Como, S.; Floris, A.; Pais, A.; Rumolo, P.; Saba, S.; Sprovieri, M.; Magni, P.

2018-02-01

In the marine environment, the introduction and spread of non-indigenous mussels may cause major modifications to native assemblages and alter the trophic flow within the food web. We analysed the impacts of the recently sighted Asian date mussel Arcuatula (=Musculista) senhousia on sediment features, native macrozoobenthic assemblages and the δ13C and δ15N values of dominant macrozoobenthic taxa in the Oristano Lagoon-Gulf system (western Sardinia, Italy). Results showed that the amount of variation generated by the occurrence of Arcuatula senhousia was lower than the intrinsic spatial variability in sediment features, macrozoobenthic assemblages and the δ13C values of dominant deposit feeders (Hediste diversicolor, Cirriphormia tentaculata, Haminoea navicula and Cyclope neritea) of this system. In addition, δ13C and δ15N values of A. senhousia were found to be similar to those of co-occurring suspension feeders Cerastoderma glaucum, Ruditapes decussatus and Scrobicularia plana, indicating exploitation of common food resources. The overall lack of effects of A. senhousia may be dependent on the moderate densities encountered in our study area (environmental conditions of the lagoons especially in summer (e.g. anoxia) which erode mussel populations, likely prevent A. senhousia from entering its expansion phase and impacting local benthic communities.

Additions to the flora of Tenerife (Canary Islands, Spain

Directory of Open Access Journals (Sweden)

Verloove, F.

2011-12-01

Full Text Available Additions to the flora of Tenerife (Canary Islands, Spain.- Recent fieldwork in Tenerife, especially in September 2010, yielded several interesting new records of non-native vascular plants. Bothriochloa ischaemum var. songarica, “Asian” Cardamine flexuosa, Cestrum parqui, Digitaria violascens, Ficus lyrata, Ficus rubiginosa, Hoffmannseggia glauca, Hyparrhenia rufa subsp. altissima, Jacaranda mimosifolia, Merremia tuberosa, Passiflora morifolia, Phytolacca dioica, Schefflera actinophylla and Solanum abutiloides are reported for the first time from the Canary Islands, while Eragrostis barrelieri var. pygmaea, Ficus microcarpa, Ipomoea purpurea, Leucaena leucocephala subsp. glabrata, Sechium edule, Tradescantia zebrina and Turnera ulmifolia are new to the flora of the island of Tenerife. New records of Acacia cyclops, Atriplex suberecta, Heliotropium curassavicum, Paspalum dilatatum, P. notatum, Pluchea ovalis, Pulicaria paludosa, Sclerophylax spinescens and Solanum villosum subsp. miniatum confirm their recent expansion on the island of Tenerife. New records are provided for the recently described Sporobolus copei . Finally, Paspalum vaginatum (hitherto possibly confused with P. distichum and Potentilla indica are confirmed from the island of Tenerife.

Adiciones para la flora de Tenerife (Islas Canarias, España.- Algunos recientes trabajos de campo en Tenerife, especialmente en Septiembre de 2010, trajeron consigo varias nuevas e interesantes adiciones de plantas vasculares no autóctonas. Bothriochloa ischaemum var. songarica, Cardamine flexuosa “Asiática”, Cestrum parqui, Digitaria violascens, Ficus lyrata, Ficus rubiginosa, Hoffmannseggia glauca, Hyparrhenia rufa subsp. altissima, Jacaranda mimosifolia, Merremia tuberosa, Passiflora morifolia, Phytolacca dioica, Schefflera actinophylla y