A First Generation Comparative Chromosome Map between Guinea Pig (Cavia porcellus) and Humans.

Science.gov (United States)

Romanenko, Svetlana A; Perelman, Polina L; Trifonov, Vladimir A; Serdyukova, Natalia A; Li, Tangliang; Fu, Beiyuan; O'Brien, Patricia C M; Ng, Bee L; Nie, Wenhui; Liehr, Thomas; Stanyon, Roscoe; Graphodatsky, Alexander S; Yang, Fengtang

2015-01-01

The domesticated guinea pig, Cavia porcellus (Hystricomorpha, Rodentia), is an important laboratory species and a model for a number of human diseases. Nevertheless, genomic tools for this species are lacking; even its karyotype is poorly characterized. The guinea pig belongs to Hystricomorpha, a widespread and important group of rodents; so far the chromosomes of guinea pigs have not been compared with that of other hystricomorph species or with any other mammals. We generated full sets of chromosome-specific painting probes for the guinea pig by flow sorting and microdissection, and for the first time, mapped the chromosomal homologies between guinea pig and human by reciprocal chromosome painting. Our data demonstrate that the guinea pig karyotype has undergone extensive rearrangements: 78 synteny-conserved human autosomal segments were delimited in the guinea pig genome. The high rate of genome evolution in the guinea pig may explain why the HSA7/16 and HSA16/19 associations presumed ancestral for eutherians and the three syntenic associations (HSA1/10, 3/19, and 9/11) considered ancestral for rodents were not found in C. porcellus. The comparative chromosome map presented here is a starting point for further development of physical and genetic maps of the guinea pig as well as an aid for genome assembly assignment to specific chromosomes. Furthermore, the comparative mapping will allow a transfer of gene map data from other species. The probes developed here provide a genomic toolkit, which will make the guinea pig a key species to unravel the evolutionary biology of the Hystricomorph rodents.

Teste intradérmico com proteínas recombinantes de Mycobacterium bovis como antígenos em Cavia porcellus

Directory of Open Access Journals (Sweden)

Elaine S.P. Melo

2014-10-01

Full Text Available O teste intradérmico para o diagnóstico da tuberculose bovina utiliza derivados proteicos purificados (PPD de Mycobacterium bovis que são capazes de induzir reações de hipersensibilidade em animais infectados. No entanto, apresenta baixa especificidade devido à ocorrência de reações cruzadas com outras micobactérias. Neste sentido, o objetivo desse trabalho foi produzir proteínas recombinantes (ESAT-6, PE13, PE5 e ESX-1 de Mycobacterium bovis e avaliá-las como antígenos em teste intradérmico utilizando Cavia porcellus como modelo, e verificar se as condições empregadas na purificação (nativa ou desnaturante interferem no desempenho antigênico dessas proteínas. As proteínas foram testadas em Cavia porcellus previamente sensibilizados com cepa M. bovis AN5 inativada, individualmente (160 µg ou combinadas na forma de um coquetel (40 µg cada. O coquetel de proteínas induziu reações de hipersensibilidade nos animais sensibilizados significativamente superiores (p=0,002 as observadas nos animais não sensibilizados, possibilitando diferenciação. No entanto, as proteínas isoladamente não foram capazes de promover essa diferenciação. As condições de solubilização e purificação influenciaram o desempenho antigênico da proteína ESAT-6, pois, quando produzida em condição desnaturante desencadeou reações inespecíficas nos animais não sensibilizados, enquanto que aquela produzida em condições nativas e aplicada em concentrações de 6, 12, 24 e 48µg induziu reações significativas apenas nos animais sensibilizados, confirmando o seu potencial como antígeno.

Ractopamina y nivel de proteína de la dieta, respuesta productiva y características de la carcasa de cuyes (Cavia porcellus)

OpenAIRE

García Leandro, Madeline Victoria

2017-01-01

Universidad Nacional Agraria La Molina. Escuela de Posgrado. Maestría en Nutrición El objetivo del presente trabajo fue determinar el efecto del Clorhidrato de Ractopamina (RAC) y el nivel de proteína de la dieta sobre la respuesta productiva y características de la carcasa de cuyes (Cavia porcellus). Se emplearon 96 cuyes machos de 49 días de edad que se distribuyeron en 24 pozas. Cada poza fue una unidad experimental con cuatro cuyes. Se les administró seis dietas con dos niveles de RAC ...

Effet de Panicum maximum sur la productivité des femelles primipares durant le cycle de reproduction chez le cobaye (Cavia porcellus L.

Directory of Open Access Journals (Sweden)

Danho, M.

2012-01-01

Full Text Available Effect of Panicum maximum on Productivity of Primiparous Females during Reproduction Cycle in Guinea Pigs (Cavia porcellus L.. In Ivory Coast, Guinea pigs reared for meat (Cavia porcellus L. are mainly fed with Panicum maximum. To assess the effect of the latter during pregnancy and lactation (RC of these animals, primiparous dams were fed ad libitum, Panicum maximum alone during the RC (MOD1 or associated with pellets for rabbits during lactation (MOD2, or associated with pellets for rabbits during the last part of the pregnancy period and the lactation (MOD3, or associated with pellets for rabbits during the entire RC (MOD4. The number of corpora lutea per female was 1.3 ± 0.5 and 2.0 ± 0.0 respectively for MOD1 and MOD4. No pre-embryonic mortality was recorded. The mean weight of the young guinea pigs of MOD1 (54.7 ± 10. g was only 55% of that of MOD4 (98.6 ± 13.6 g. At weaning, the average weight gain of young guinea pigs of MOD1 (40.5 ± 22.2 g represented a third of those obtained with other diets that did not significantly differ. At the end of RC, the weight gain of dams was 17 ± 13.3% for MOD1 compared to 50% for MOD2, MOD3 and MOD4. Feeding Panicum maximum alone induces chronic malnutrition which in turn is responsible of the low ovulation rate and reduced growth in guinea pig breeding.

Prevalence of fur mites (Chirodiscoides caviae) in pet guinea pigs (Cavia porcellus) in southern Italy.

Science.gov (United States)

d'Ovidio, Dario; Santoro, Domenico

2014-04-01

Chirodiscoides caviae is the most common fur mite affecting guinea pigs; infestation is generally asymptomatic. No studies have been published on the prevalence of such mites in guinea pigs in southern Italy. We sought to evaluate the prevalence and the clinical signs of C. caviae infestation in guinea pigs in southern Italy. Clinical records of guinea pigs evaluated from August 2012 to July 2013 were retrospectively searched. In this retrospective matched case-control study, records of guinea pigs with evidence of C. caviae infestation were selected. The prevalence of C. caviae infestation was evaluated and exposure variables were assessed among guinea pigs with and without infestation using stepwise conditional logistic regression. Guinea pigs seen during the same time period, but without a diagnosis of C. caviae, were included as control animals. The prevalence of C. caviae was 32% (42 of 131); 66.6% of affected guinea pigs (28 of 42) originated from pet shops, whereas 28% (14 of 42) were privately owned. Thirty-one guinea pigs (73.8%) were asymptomatic, whereas 11 (26.1%) showed clinical signs (pruritus, alopecia, erythema and scaling). The most frequently affected area was the lumbosacral region (38 of 42). Guinea pigs in pet shops were more likely to be affected by C. caviae than owned guinea pigs (odds ratio, 5.12; 95% confidence interval, 2.32-11.29; P guinea pigs in southern Italy. Chirodiscoides mites should be sought in guinea pigs, particularly in animals coming from pet shops. © 2014 ESVD and ACVD.

Congenital malformations caused by Stryphnodendron fissuratum (Leg. Mimosoideae) in guinea pigs (Cavia porcellus).

Science.gov (United States)

Macedo, Josenaldo S; Rocha, Brena P; Colodel, Edson M; Freitas, Sílvio H; Dória, Renata G S; Riet-Correa, Franklin; Evêncio-Neto, Joaquim; Mendonça, Fábio S

2015-11-01

The aim of this study was to evaluate the toxicity of Stryphnodendron fissuratum pods in guinea pigs (Cavia porcellus) and test the hypothesis that this plant has teratogenic effects. Thus, sixteen guinea pigs were randomly divided into four groups of four animals each. Groups 10, 20 and 40 consisted of guinea pigs that received commercial food that contained crushed pods of S. fissuratum at concentrations of 10, 20 and 40 g/kg, respectively, during the period of organogenesis. Control group consisted of guinea pigs under the same management conditions that did not receive crushed pods of S. fissuratum in their food. In all experimental groups, the main clinical signs of poisoning consisted of anorexia, prostration, absence of vocalizations, alopecia, diarrhea, and abortions within the adult guinea pigs. Those that did not abort gave birth to weak, malnourished pups, some of which had fetal malformations. The main teratogenic changes consisted of eventration, arthrogryposis, amelia of the forelimbs, anophthalmia, microphthalmia, anotia and agnathia. The reductions in the number of offspring and the malformations observed in the experimental groups suggest that S. fissuratum affects fetal development and is teratogenic. Copyright © 2015 Elsevier Ltd. All rights reserved.

Temperature Preference in IAF Hairless and Hartley Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Kleven, Gale A; Joshi, Prianca

2016-03-01

The Hairless strain of guinea pigs (Cavia porcellus) is the result of a spontaneous recessive mutation first identified at the Institute Armand Frappier (IAF) in 1978. Despite the longstanding availability of this strain, little is known about its thermoregulatory behavior. The aim of this study was to determine temperature preference in Hartley and Hairless guinea pigs by observing each strain in a ring-shaped apparatus containing a nonlinear temperature gradient. Temperatures were maintained by separately controlled heating mats lining the apparatus. Set point temperatures ranged from 24 to 38 °C. Guinea pigs (Hartley female, Hairless female, and Hairless male guinea pigs; n = 8 each group) were placed either singly or in pairs at 1 of the 8 randomized starting points within the apparatus. Subjects were observed for 30 min and coded for location within the temperature gradient by both frequency and duration. When placed singly in the apparatus, all 3 groups spent more time in the 30 °C zones. However, when placed as pairs with a cagemate, Hartley female guinea pigs spent more time in the cooler range of temperatures from 24 to 30 °C, whereas Hairless guinea pigs preferred a range of 30 to 38 °C. These results confirm a temperature preference of 30 ± 2 °C for both Hartley and Hairless guinea pigs when singly housed. However, data from the paired housing condition suggest that context plays an important role in thermoregulatory behavior.

Experimental infection in Cavia porcellus by infected Amblyomma ovale nymphs with Rickettsia sp. (Atlantic rainforest strain).

Science.gov (United States)

Brustolin, Joice Magali; da Silva Krawczak, Felipe; Alves, Marta Elena Machado; Weiller, Maria Amélia; de Souza, Camila Lopes; Rosa, Fábio Brum; Cadore, Gustavo Cauduro; Dos Anjos Lopes, Sônia Terezinha; Labruna, Marcelo Bahia; Vogel, Fernanda Silveira Flores; de Avila Botton, Sônia; Sangioni, Luís Antônio

2018-03-01

This study describes experimental infection of guinea pigs (Cavia porcellus) infested with naturally infected Amblyomma ovale nymphs with Rickettsia sp. (Atlantic rainforest strain), and the capacity of A. ovale nymphs to transmit this bacterium. Twenty-six guinea pigs were divided into the following groups: G1, 10 animals infested with uninfected A. ovale nymphs; G2, 10 animals infested with nymphs infected with Rickettsia sp. (Atlantic rainforest strain); and G3, 6 animals without tick infestation. Blood samples were taken 7, 14, 21, and 28 days post-infestation for serological and hematological tests. For histopathological analysis and rickettsial DNA detection, fragments of the spleen, lung, brain, and liver were harvested after euthanasia. The average feeding period for nymphs was 6.6 days for G1 and 6 days for G2. Hemolymph and PCR assays, performed to detect the causative agent in ticks, indicated that in G1, all ticks were negative, and in G2, all nymphs were positive by PCR and 80% (8/10) was positive by hemolymph tests. The only clinical change was skin scarring at the tick attachment site. Hematological parameters indicated leukopenia and total plasma protein (TPP) increased with decreased platelets in G1. In G2, leukocytosis, neutrophilia, monocytosis, an increase in platelets, and reduced TPP were observed. Only G2 guinea pigs were seroconverted (80%; 8/10). Histopathology tests indicated mild, diffuse hemosiderosis and mild, multifocal, follicular hyperplasia in the spleen. Molecular analysis did not detect Rickettsia sp. DNA in C. porcellus tissues. We demonstrated the capacity of A. ovale nymphs to transmit Rickettsia sp. (Atlantic rainforest strain) to guinea pigs.

Cryptosporidium homai n. sp. (Apicomplexa: Cryptosporidiiae) from the guinea pig (Cavia porcellus).

Science.gov (United States)

Zahedi, Alireza; Durmic, Zoey; Gofton, Alexander W; Kueh, Susan; Austen, Jill; Lawson, Malcolm; Callahan, Lauren; Jardine, John; Ryan, Una

2017-10-15

The morphological, biological, and molecular characterisation of a new Cryptosporidium species from the guinea pig (Cavia porcellus) are described, and the species name Cryptosporidium homai n. sp. is proposed. Histological analysis conducted on a post-mortem sample from a guinea pig euthanised due to respiratory distress, identified developmental stages of C. homai n. sp. (trophozoites and meronts) along the intestinal epithelium. Molecular analysis at 18S rRNA (18S), actin and hsp70 loci was then conducted on faeces from an additional 7 guinea pigs positive for C. homai n. sp. At the 18S, actin and hsp70 loci, C. homai n. sp. exhibited genetic distances ranging from 3.1% to 14.3%, 14.4% to 24.5%, and 6.6% to 20.9% from other Cryptosporidium spp., respectively. At the 18S locus, C. homai n. sp. shared 99.1% similarity with a previously described Cryptosporidium genotype in guinea pigs from Brazil and it is likely that they are the same species, however this cannot be confirmed as actin and hsp70 sequences from the Brazilian guinea pig genotype are not available. Phylogenetic analysis of concatenated 18S, actin and hsp70 sequences showed that C. homai n. sp. exhibited 9.1% to 17.3% genetic distance from all other Cryptosporidium spp. This clearly supports the validity of C. homai n. sp. as a separate species. Copyright © 2017 Elsevier B.V. All rights reserved.

Injury Thresholds for Topical Cream-Coated Skin of Hairless Guinea Pigs (Cavia Procellus) in Near Infrared Region

National Research Council Canada - National Science Library

Stolarski, David J; Zohner, Justin J; Imholte, Michelle L; Chavey, Lucas J; Pocock, Ginger M; Buchanan, Kelvin C; Jindra, Nichole M; Figueroa, Manuel A; Thomas, Robert J; Rockwell, Benjamin A

2006-01-01

.... Hairless guinea pigs (cavia porcellus) in vivo were used to evaluate how the minimum visible lesion threshold for single-pulse laser exposure is changed with a topical agent applied to the skin...

[Dermatophyte colonization on guinea pigs (Cavia porcellus) kept in pet stores. First report from Santiago, Chile].

Science.gov (United States)

Thomson, Pamela; Monsalves, Pamela; Maier, Liliana; Silva, Víctor

2015-01-01

Dermatophytes are pathogenic fungi that can be present in the flora of mammals, such as dogs, cats and rodents, which can be a source and transmission vehicle to other hosts, including humans. In Chile, there is a steady increase of acquiring guinea pigs (Cavia porcellus) as pets, with no local studies on their colonization by dermatophytes. To determine the presence of dermatophytes on clinically healthy guinea pigs, kept in pet stores in Santiago, Chile. A total of 52 clinically healthy animals were studied using the method by Mariat and Tapia (1966). The specimen culture and identification of the dermatophytes were performed using classical mycological procedures. Four guinea pigs (7.7%) out of 52 were colonized by dermatophytes, and were identified as Trichophyton mentagrophytes (3 cases) and Trichophyton verrucosum (one case). This study shows, for the first time in Chile, that guinea pigs can be colonized by dermatophytes, which should alert administrators of pet stores, veterinarians and physicians, to keep this in mind when purchasing or looking after this type of pet in a veterinary office. Copyright © 2013 Revista Iberoamericana de Micología. Published by Elsevier Espana. All rights reserved.

Female novelty and the courtship behavior of male guinea pigs (Cavia porcellus

Directory of Open Access Journals (Sweden)

Cohn D.W.H.

2004-01-01

Full Text Available In several rodent species, an increase or recovery of sexual behavior can be observed when sexually satiated males are placed in contact with a novel mate. In order to assess the influence of female novelty on the courtship behavior of guinea pigs (Cavia porcellus, four adult males were observed during four daily 15-min sessions while interacting with the same pregnant female (same-female sessions. A new female was presented during the fifth session (switched-female session. The duration of behavioral categories was obtained from videotape records using an observational software. From the first to the second session, all males decreased the time allocated to investigating (sniffing and licking, following, and mounting the female, and that response did not recover by the end of the same-female sessions. No similar decreasing tendencies were detected in the circling or rumba categories. A marked increase of investigating occurred in all males from the last same-female session (8.1, 11.9, 15.1 and 17.3 percent session time to the switched-female one (16.4, 18.4, 37.1 and 28.9 percent session time, respectively. Increases in following and circling were recorded in three of four males, and full-blown recovery of mounting in one male. No consistent changes in the females' responses to males (following or attacking were observed throughout testing. These results are consistent with the hypothesis that guinea pig males recognize individual females and that courtship responses may suffer a habituation/recovery process controlled by mate novelty.

Validation of a Behavioral Ethogram for Assessing Postoperative Pain in Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Dunbar, Misha L; David, Emily M; Aline, Marian R; Lofgren, Jennifer L

2016-01-01

Although guinea pigs (Cavia porcellus) have been used in research for more than a century and remain the most prevalent USDA-covered species, little has been elucidated regarding the recognition of clinical pain or analgesic efficacy in this species. We sought to assess pain in guinea pigs by using newer, clinically relevant methods that have been validated in other rodent species: the behavioral ethogram and cageside proxy indicator. In this study, 10 male guinea pigs underwent electronic von Frey testing of nociception, remote videorecording of behavior, and cageside assessment by using time-to-consumption (TTC) of a preferred treat test. These assessments were performed across 2 conditions (anesthesia only and castration surgery under anesthesia) at 3 time points (2, 8, and 24 h after the event). The anesthesia only condition served to control for the nonpainful but potentially distressing components of the surgical experience. Compared with those after anesthesia only conditions, subtle body movements were increased and nociceptive thresholds were decreased at 2 and 8 h after surgery. At 24 h, neither subtle body movement behaviors nor nociceptive thresholds differed between the 2 conditions. In contrast, TTC scores did not differ between the anesthesia only and surgery conditions at any time point, underscoring the challenge of identifying pain in this species through cageside evaluation. By comparing ethogram scores with measures of nociception, we validated select behaviors as pain-specific. Therefore, our novel ethogram allowed us to assess postoperative pain and may further serve as a platform for future analgesia efficacy studies in guinea pigs.

Hyperendemic Campylobacter jejuni in guinea pigs (Cavia porcellus) raised for food in a semi-rural community of Quito, Ecuador.

Science.gov (United States)

Graham, Jay P; Vasco, Karla; Trueba, Gabriel

2016-06-01

Domestic animals and animal products are the source of pathogenic Campylobacter jejuni and C. coli in industrialized countries, yet little is known about the transmission of these bacteria in developing countries. Guinea pigs (Cavia porcellus) are commonly raised for food in the Andean region of South America, however, limited research has characterized this rodent as a reservoir of zoonotic enteric pathogens. In this study, we examined the prevalence of Campylobacter spp. in 203 fecal samples from domestic animals of 59 households in a semi-rural parish of Quito, Ecuador. Of the twelve animal species studied, guinea pigs showed the highest prevalence of C. jejuni (n = 39/40; 97.5%). Multilocus sequence typing (MLST) was used to characterize the genetic relationship of C. jejuni from domestic animals and 21 sequence types (STs) were identified. The majority of STs from guinea pigs appeared to form new clonal complexes that were not related to STs of C. jejuni isolated from other animal species and shared only a few alleles with other C. jejuni previously characterized. The study identifies guinea pigs as a major reservoir of C. jejuni and suggests that some C. jejuni strains are adapted to this animal species. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

Rationalité économique et objectifs de gestion de la production de cobayes (Cavia porcellus L. en zones tropicales

Directory of Open Access Journals (Sweden)

Ndébi, G.

2015-01-01

Full Text Available Economic Rationality and Production Management Goals of Guinea Pigs (Cavia porcellus L. in Tropical Zones. The economic productivity of guinea pig in tropical environment was assessed from one hundred and ninety-seven pairs of measures related to reproductive female and weaning weights per litter reared in-door at the Research and Experimental Farm of the University of Dschang between February 2012 and March 2013. An econometric model of linear regression was developed to take into account the main factors affecting the relative weight productivity index at the weaning age of each gestating female. The main results reveal that the economic productivity of guinea pigs in tropical zone, already of a substantial level, could be even more improved by taking into account the main factors of variability. The analysis thus put into evidence that the relative importance of female reproductive weight; the litter size, and the total weight of the kids at weaning are factors having significant effects on the relative weight productivity index of the guinea pig. However, in linking the female weight to economic productivity, the study led to an irrational management of the reproductive herd and put in evidence that the decrease in productivity observed in guinea pig is mostly attributable to the fattening of the female.

Guinea pig (Cavia porcellus) drinking preferences: do nipple drinkers compensate for behaviourally deficient diets?

Science.gov (United States)

Balsiger, A; Clauss, M; Liesegang, A; Dobenecker, B; Hatt, J-M

2017-10-01

When offered diets with hay ad libitum, rabbits (Oryctolagus cuniculus) clearly prefer open dishes over nipple drinkers, but whether this preference also applies in guinea pigs (Cavia porcellus) is unsure. We tested the drinker preference of 10 guinea pigs when offered open dishes (OD) and nipple drinkers (ND) simultaneously and measured the amount of water consumed by each animal on four different diets (grass hay 100%, or as 10% of intake on diets of fresh parsley, seed mix or pelleted complete feed, respectively) on either of the drinking systems. All animals ingested the hay portion of the combined diets first. The amount of water consumed differed significantly between individual animals. Animals drank less water on parsley than on the other diets. Nine of 10 animals clearly preferred ND when having a choice, and eight of these drank more when on ND only. The difference between the drinking systems was not consistent across all diets: on hay, similar amounts of water were drunk when on OD or ND only. Differences in water intake were reflected in urine production. Because drinking from ND in guinea pigs involves jaw movements similar to those in chewing, the results could suggest that when motivation for oral processing behaviour is not satisfied by a diet, animals may respond in using ND beyond physiological water necessity. Whereas physiological water requirements are probably better investigated with other drinking systems due to a possible overestimation when using ND, offering ND to pet guinea pigs most likely offers a form of behavioural enrichment that at the same time may increase water intake and hence act as prophylaxis against urolithiasis. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.

Evaluating the clinical and physiological effects of long term ultraviolet B radiation on guinea pigs (Cavia porcellus).

Science.gov (United States)

Watson, Megan K; Stern, Adam W; Labelle, Amber L; Joslyn, Stephen; Fan, Timothy M; Leister, Katie; Kohles, Micah; Marshall, Kemba; Mitchell, Mark A

2014-01-01

Vitamin D is an important hormone in vertebrates. Most animals acquire this hormone through their diet, secondary to exposure to ultraviolet B (UVB) radiation, or a combination thereof. The objectives for this research were to evaluate the clinical and physiologic effects of artificial UVB light supplementation on guinea pigs (Cavia porcellus) and to evaluate the long-term safety of artificial UVB light supplementation over the course of six months. Twelve juvenile acromelanic Hartley guinea pigs were randomly assigned to one of two treatment groups: Group A was exposed to 12 hours of artificial UVB radiation daily and Group B received only ambient fluorescent light for 12 hours daily. Animals in both groups were offered the same diet and housed under the same conditions. Blood samples were collected every three weeks to measure blood chemistry values, parathyroid hormone, ionized calcium, and serum 25-hydroxyvitamin D3 (25-OHD3) levels. Serial ophthalmologic examinations, computed tomography scans, and dual energy x-ray absorptiometry scans were performed during the course of the study. At the end of the study the animals were euthanized and necropsied. Mean ± SD serum 25-OHD3 concentrations differed significantly in the guinea pigs (pguinea pigs to UVB radiation long term significantly increased their circulating serum 25-OHD3 levels, and that this increase was sustainable over time. Providing guinea pigs exposure to UVB may be an important husbandry consideration that is not currently recommended.

Mystacial Whisker Layout and Musculature in the Guinea Pig (Cavia porcellus): A Social, Diurnal Mammal.

Science.gov (United States)

Grant, Robyn A; Delaunay, Mariane G; Haidarliu, Sebastian

2017-03-01

All mammals (apart from apes and humans) have whiskers that make use of a similar muscle arrangement. Whisker specialists, such as rats and mice, tend to be nocturnal and arboreal, relying on their whisker sense of touch to guide exploration around tree canopies at night. As such, nocturnal arboreal rodents have many whiskers that are organised into a grid-like pattern, and moved using a complex array of muscles. Indeed, most arboreal, nocturnal mammals tend to have specialised whiskers that are longer and arranged in a dense, regular grid, compared with terrestrial, diurnal mammals. The guinea pig diverged early from murid rodents (around 75 million years ago), and are ground-dwelling, diurnal animals. It would be predicted that, as a terrestrial mammal, they may have less whiskers and a reduced muscle architecture compared to arboreal, nocturnal rodents. We examined the mystacial whisker layout, musculature and movement capacity of Guinea pig (Cavia porcellus) whiskers and found that they did indeed have a disorganized whisker layout, with a fortification around the eye area. In addition, there was a reduction in musculature, especially in the intrinsic muscles. Despite guinea pigs not cyclically moving their whiskers, the mystacial musculature was still very similar to that of murid rodents. We suggest that the conserved presence of whisker layout and musculature, even in visual mammals such as primates and guinea pigs, may indicate that whiskers still play an important role in these animals, including protecting the eyes and being involved in tactile social behaviors. Anat Rec, 300:527-536, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Ingestion et digestibilité in vivo du Panicum maximum associé à trois compléments: tourteau de Jatophra curcas, tourteau de coton Gossypium hirsutum et Euphorbia heterophylla chez le cobaye Cavia porcellus L

Directory of Open Access Journals (Sweden)

N'G.D.V. Kouakou

2010-01-01

Full Text Available The Intake and the in vivo Digestibility of Panicum maximum Associated with Three Supplements: Jatophra curcas Cake, Gossypium hirsutum Cake and Euphorbia heterophylla (Euph in Guinea Pigs (Cavia porcellus L.. The intake and the in vivo digestibility of Panicum maximum associated with three supplements: Jatropha curcas cake, Gossypium hirsutum cake and Euphorbia heterophylla (Euph in guinea pigs (Cavia porcellus L. pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported. In order used weed Euphorbia heterophylla in guinea pigs diet, comparative study of the intake and the in vivo digestibility of four treatments, Panicum maximum (Pan, Panicum maximum and Gossypium hirsutum cake (Pancoton, Panicum maximum and Euphorbia heterophylla (Paneuph and Panicum maximum and Jatropha curcas cake (Panjatro, in male guinea pigs were conducted in Yamoussoukro (Ivory Coast. The means of the intake (g DM/d were 64.8 ± 12.5; 74.3 ± 12.9; 73.7 ± 17.8 and 69.1 ± 12.3 respectively for Pan, Pancoton, Paneuph and Panjatro. Pancoton and Paneuph were significantly better ingested than Pan and Panjatro. Euphorbia heterophylla was significantly better ingested than the other two supplements (P< 0.05 and the mean daily weight gain with its association with Panicum maximum of 3.1 ± 0.6 g/d. The rate of substitution of Panicum maximum by Euphorbia heterophylla was nearly to one (1. The apparent digestibility coefficients (ADC for dry (68.0 ± 10.5% and organic matter (84.1 ± 5.2% of Paneuph were significantly higher (P< 0.05 than the ADC's for the other three treatments. Given the nutritional value of Euphorbia heterophylla in guinea pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported.

GRAMÍNEAS TROPICALES EN EL ENGORDE DE CUYES MEJORADOS SEXADOS (Cavia porcellus Linnaeus EN LA ZONA DE LA MANÁ

Directory of Open Access Journals (Sweden)

Adolfo Sánchez Laiño

2009-06-01

Full Text Available La investigación de gramíneas tropicales en el engorde de cuyes en la zona de La Maná. La misma que persiguió los siguientes objetivos: Incrementar los índices productivos en cuyes (Cavia porcellus Linnaeus peruanos mejorados bajo el efecto del consumo del pasto saboya (Panicum maximun Jack, hojas de maíz (Zea mays y caña de azúcar (Saccharum officinarum L en la zona de La Maná, y determinar la rentabilidad de los tratamientos. Se utilizaron 48 cuyes peruanos mejorados sexados de 35 días de edad con un peso promedio de 305 g. Se aplicó un arreglo factorial 2 (sexo x 3 (gramíneas con cuatro repeticiones, dentro de un (DBCA. Para las comparaciones entre medidas se utilizó la prueba de Tukey al 0.05% de probabilidad. Para obtener la rentabilidad de los tratamientos se utilizó la Relación Beneficio–Costo. Se evaluó el: consumo de gramíneas (g, consumo de alimento (g, ganancia de peso (g, conversión alimenticia, peso vivo (g y rendimiento a la canal (%. Los cuyes machos presentaron el mayor (P0.05 no se vio afectado por el efecto del consumo de gramíneas. La mayor rentabilidad la registraron los cuyes machos alimentados con hoja de maíz + balanceado (52.4%.

Use of recombinant human thyroid-stimulating hormone for evaluation of thyroid function in guinea pigs (Cavia porcellus).

Science.gov (United States)

Mayer, Jörg; Wagner, Robert; Mitchell, Mark A; Fecteau, Kellie

2013-02-01

To evaluate the effects of administration of recombinant human (rh) thyroid-stimulating hormone (TSH) for evaluation of thyroid function in euthyroid guinea pigs (Cavia porcellus). Prospective, experimental study. 10 healthy, sexually intact, pet guinea pigs (approx 1 year of age). Guinea pigs were given rhTSH (100 μg, IM); plasma thyroxine concentrations were determined prior to and 3 and 4 hours after rhTSH injection. The animals were housed in 2 groups on the basis of sex and fed different commercial maintenance diets according to their husbandry. There was no significant difference in thyroxine concentrations between males and females before or after rhTSH injection. There was also no difference between thyroxine concentrations at 3 versus 4 hours after rhTSH injection. There was a significant difference between thyroxine concentrations before (median, 9.05 nmol/L [0.70 μg/dL]; 10% to 90% range, 7.39 to 16.99 nmol/L [0.57 to 1.32 μg/dL]) and after (mean ± SD, 23.95 ± 4.2 nmol/L) rhTSH injection. Euthyroid guinea pigs had plasma thyroxine concentrations of at least 7.30 nmol/L (0.57 μg/dL) and an increase of at least 2.6 times prestimulation thyroxine concentrations at 3 or 4 hours after stimulation. The results suggested that rhTSH administered IM can be used for the TSH stimulation testing in guinea pigs. We suggest thyroxine concentration in a euthyroid guinea pig should at least double 3 to 4 hours after rhTSH injection.

Endoparasitos em cobaias (Cavia porcellus) (Mammalia, Rodentia, Caviidae) provenientes de biotérios de criação e experimentação do município do Rio de Janeiro, Brasil Endoparasites in guinea pigs (Cavia porcellus) (Mammalia, Rodentia, Caviidae) from breeding and experimentation animal housing of the municipality of Rio de Janeiro, Brazil

OpenAIRE

Luciana Casartelli Alves; Cleide Cristina Apolinário Borges; Sidnei da Silva; Sebastião Enes Reis Couto; Rodrigo Caldas Menezes

2007-01-01

Foi realizado um levantamento sobre a prevalência e intensidade de infecção de endoparasitos em cobaias convencionais de linhagem Short Hair provenientes de biotérios de criação (A) e experimentação (B) do município do Rio de Janeiro, Brasil, avaliando-se a eficácia das medidas de prevenção entre eles. Para a realização do estudo, utilizou-se exame direto de mucosa e do conteúdo intestinal, a técnica de tricromo de WHEATLEY e exames coproparasitológicos pelas técnicas de Ritchie e Kinyoun. Os...

Treatment and control of Trixacarus caviae infestation in a conventional guinea pig (Cavia porcellus) breeding colony

OpenAIRE

Nath, Anjan Jyoti

2015-01-01

A case of sarcoptic mange caused by Trixacarus caviae in a conventional guinea pig breeding colony is reported. The infestation was reported in a large colony of guinea pigs during the month of July, 2013 affecting 30 breeder guinea pigs. Severely infested animals were treated individually with subcutaneous injection of ivermectin 1 % w/v (Neomec®) at the rate of 400 µg/kg body weight 10 days apart. Three doses of ivermectin were sufficient to eliminate the parasite which tested negative afte...

Skin diseases in companion guinea pigs (Cavia porcellus): a retrospective study of 293 cases seen at the Veterinary Medical Teaching Hospital, University of California at Davis (1990-2015).

Science.gov (United States)

White, Stephen D; Guzman, David Sanchez-Migallon; Paul-Murphy, Joanne; Hawkins, Michelle G

2016-10-01

Guinea pigs (Cavia porcellus) are popular companion animals with reported skin diseases, but most reports are accessed from textbooks or review articles. To document skin diseases and their prevalence in companion guinea pigs in northern California, USA, and to investigate predilections for the most common conditions over a 25 year period. Two hundred and ninety three guinea pigs from the hospital population met inclusion criteria. A retrospective study was performed by searching computerized medical records seen at the Veterinary Medical Teaching Hospital (VMTH), School of Veterinary Medicine, University of California from 1 January 1990 to 31 July 2015 using key words relevant to dermatology. Of the 580 guinea pigs seen at the VMTH, 50% (293) had skin disease. Of the 293 cases, 154 (52%) presented for nondermatological reasons. Guinea pigs with skin disease were significantly older than those without skin disease (P = 0.0002); females with skin disease were more likely to have cystic ovaries (P = 0.0203), although these were not always associated with alopecia. Pododermatitis and infestation with Trixacarus caviae or lice were the most common skin diseases. Ivermectin or selamectin was used for ectoparasite treatment. Abscesses unassociated with pododermatitis were the most common nodules. Benign follicular tumours were the most common neoplasm. Despite the frequent mention of dermatophytosis in the veterinary literature, only two cases of Trichophyton mentagrophytes were diagnosed. Cutaneous conditions in companion guinea pigs in the USA are common. Clinicians should include a dermatological examination when examining these rodents regardless of the reason for presentation. © 2016 ESVD and ACVD.

Etude comparative de la digestibilité in vivo de l'herbe de guinée (Panicum maximum Jacq.) associée aux feuilles et tiges de patate douce (Ipomoea batatas (L.) Lam) (régime Panipo) ou à l'herbe de lait (Euphorbia heterophylla L.) (régime Paneuph) chez le lapin (Oryctolagus cuniculus L.) et le cobaye (Cavia porcellus L.)

OpenAIRE

Kouakou, NGDV.; Kouba, M.; Thys, E.

2016-01-01

Digestibility of Guinea grass (Panicum maximum Jacq.) associated with sweet potato leaves and stems (Ipomoea batatas (L.) Lam) (Panipo diet) or poison milk (Euphorbia heterophylla L.) (Paneuph diet) in Rabbits (Oryctolagus cuniculus L.) and in Guinea Pigs (Cavia porcellus L.). A comparative study of in vivo digestibility of Guinea grass (Panicum maximum Jacq.) associated with sweet potato leaves and stems (Ipomoea batatas (L.) Lam) (Panipo diet) or with poison milk (Euphorbia heterophylla L.)...

Evaluation of Pain Assessment Techniques and Analgesia Efficacy in a Female Guinea Pig (Cavia porcellus) Model of Surgical Pain

Science.gov (United States)

Oliver, Vanessa L; Athavale, Stephanie; Simon, Katherine E; Kendall, Lon V; Nemzek, Jean A; Lofgren, Jennifer L

2017-01-01

Guinea pigs (Cavia porcellus) are a frequently used species in research, often involving potentially painful procedures. Therefore, evidence-based recommendations regarding analgesia are critically needed to optimize their wellbeing. Our laboratory examined the efficacy of carprofen and extended-release (ER) buprenorphine, alone and as a multimodal combination, for relieving postsurgical pain in guinea pigs. Animals were assessed by using evoked (mechanical hypersensitivity), nonevoked (video ethogram, cageside ethogram, time-to-consumption test), and clinical (weight loss) measurements for 96 h during baseline, anesthesia–analgesia, and hysterectomy conditions. In addition, ER buprenorphine was evaluated pharmacologically. Guinea pigs treated with a single analgesic showed increased mechanical sensitivity for at least 96 h and indices of pain according to the video ethogram for as long as 8 h, compared with levels recorded during anesthesia–analgesia. In contrast, animals given both analgesics demonstrated increased mechanical sensitivity and behavioral evidence of pain for only 2 h after surgery compared with anesthesia–analgesia. The cageside ethogram and time-to-consumption tests failed to identify differences between conditions or treatment groups, highlighting the difficulty of identifying pain in guinea pigs without remote observation. Guinea pigs treated with multimodal analgesia or ER buprenorphine lost at least 10% of their baseline weights, whereas weight loss in carprofen animals was significantly lower (3%). Plasma levels for ER buprenorphine exceeded 0.9 ng/mL from 8 to 96 h after injection. Of the 3 analgesia regimens evaluated, multimodal analgesia provided the most effective pain control in guinea pigs. However the weight loss in the ER buprenorphine–treated animals may need to be considered during analgesia selection. PMID:28724492

Helminths of the guinea pig, Cavia porcellus (Linnaeus, in Brazil

Directory of Open Access Journals (Sweden)

Roberto Magalhães Pinto

2002-07-01

Full Text Available Worm burdens were evaluated and compared in two groups of the guinea pig, Cavia poreellus (Linnaeus, 1758: animals of the first group were conventionally maintained in an institutional animal house and those of the second group were openly kept in pet shops in Brazil. Animals from both sources were infected only with the nematode Paraspidodera uncinata (Rudolphi, 1819 Travassos, 1914 (10% of prevalence in guinea pigs from lhe institutional facility and 40% in those animals from the pet shop. Other helminth samples recovered from Brazilian guinea pigs during 52 years and that are deposited in the Helminthological Collection of the Oswaldo Cruz Institute (CHIOC were also analyzed. Paraspidodera uncinata and the cestode Monoecocestus parcitesticulatus Rêgo, 1960 were identified in these samples.

Anatomia do fígado de fetos de Guinea pig em final de gestação (Cavia porcellus [Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Mariangela Toledo Barbino

2011-08-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n3p97 Desenvolveu-se este trabalho com o objetivo de descrever a anatomia do fígado de fetos de Guinea pig (Cavia porcellus [Linnaeus, 1758] em final de gestação e obter caracterizações anatômicas que possam fundamentar e auxiliar na compreensão da fisiologia da circulação fetal. Coletou-se os fetos de 3 fêmeas em final de gestação, os quais foram dissecados e retirado o fígado. Estes foram analisados, descritos e fotodocumentados macroscopicamente, por microscopia de luz em coloração HE e por microscopia eletrônica de varredura. O fígado dos fetos apresenta coloração castanho avermelhada e sua divisão em lobos é nitidamente observada, assim como a presença da vesícula biliar.  O fígado divide-se em lobo lateral esquerdo, lobo medial esquerdo, lobo lateral direito, lobo medial direito, lobo quadrado e lobo caudado com processos papilar e caudado Através da microscopia de luz, observa-se o tecido intensamente vascularizado sendo que, a porção esquerda do fígado recebe o sangue oriundo da placenta pela veia umbilical, e a porção direita é irrigada pela veia porta. Através desses resultados pode-se concluir que os fetos de Guinea pig possuem estruturas semelhantes anatomicamente aos de outras espécies de mamíferos.

ANÁLISIS PROXIMAL, PERFIL DE ÁCIDOS GRASOS DE LAS VÍSCERAS DEL CUY (Cavia porcellus Y SU USO POTENCIAL EN ALIMENTACIÓN ANIMAL

Directory of Open Access Journals (Sweden)

A. S. Parra

2016-01-01

Full Text Available Con el fin de evaluar el valor nutritivo de materias primas no convencionales en la elaboración de concentrado animal, de bajo coste y que no compitan con la alimentación del hombre, en la presente investigación se analizó el contenido nutricional de las vísceras abdominales de cuy (Cavia porcellus y de su harina, usando análisis proximal y perfil de ácidos grasos mediante cromatografía de gases. Se compararon estos resultados con materias primas convencionales como la harina de pescado y con vísceras de diversos animales. Los resultados obtenidos indican que la harina de vísceras de cuy puede competir con harinas de diversas procedencias dadas sus cualidades nutricionales (58% proteína, 28% grasa, 4% cenizas; además, el alto contenido de grasa en las vísceras frescas (55% base seca está constituido principalmente ácidos grasos poliinsaturados tipo omega 3, 6 y 9, siendo relevante el contenido de ácido linolénico, ácidos grasos que en la dieta de los animales son escasos y de alto costo. Es posible concluir que los componentes nutricionales de las vísceras de cuy la convierten en una materia prima promisoria en alimentación animal, estimulando así el aprovechamiento de estos residuos.

Treatment and control of Trixacarus caviae infestation in a conventional guinea pig (Cavia porcellus) breeding colony.

Science.gov (United States)

Nath, Anjan Jyoti

2016-12-01

A case of sarcoptic mange caused by Trixacarus caviae in a conventional guinea pig breeding colony is reported. The infestation was reported in a large colony of guinea pigs during the month of July, 2013 affecting 30 breeder guinea pigs. Severely infested animals were treated individually with subcutaneous injection of ivermectin 1 % w/v (Neomec ® ) at the rate of 400 µg/kg body weight 10 days apart. Three doses of ivermectin were sufficient to eliminate the parasite which tested negative after 30 days of the first treatment. The entire colony was given preventive dose of ivermectin spray (2 mg/ml solution) following the same schedule. Strict hygienic measures were followed. New hair growth in the severely affected animals was evidenced on 30th day of treatment.

Consommation de quelques graminées tropicales par le cobaye [Cavia porcellus : performances et détermination des surfaces nécessaires à l'entretien d'un cheptel

Directory of Open Access Journals (Sweden)

Kouonmenioc, J.

2000-01-01

Full Text Available Consumption of some Tropical Grass Forages by Guinea-Pigs (Cavia porcellus ; Performances and Determination of Required Areas to Maintain a Flock. In order to develop the mini-livestock sector in the agricultural production systems, investigations have been carried out on five tropical grass forages in the Cameroon forest humid zone in order to show the impact of organic manure on the total biomass production for guinea-pigs feeding. Adequate forages area required to maintain a family size guinea-pigs flock was determined. These various forage species compared in terms of growth showed positive response to guinea pigs manure. Panicum maximum with a 8 weeks regrowth which yielded 5146.7 kg DM/ha (on increase of 1500.8 kg seemed to be the best forage in terms of production. Positive response of these grasses to organic manure from guinea-pigs farming may direct the farmer not to use the manure not only for food and cash cropping, but also to sustain forage production. For a 8 weeks cutting frequency the adequate forage area to maintain a family flock size of 20 animals ranges from 90.8 m2 x2 for Brachiaria ruziziensis to 152.9 m2 x 2 for Trypsacum laxum.

Intake, selection, digesta retention, digestion and gut fill of two coprophageous species, rabbits (Oryctolagus cuniculus) and guinea pigs (Cavia porcellus), on a hay-only diet.

Science.gov (United States)

Franz, R; Kreuzer, M; Hummel, J; Hatt, J-M; Clauss, M

2011-10-01

A colonic separation mechanism (CSM) is the prerequisite for the digestive strategy of coprophagy. Two different CSM are known in small herbivores, the 'wash-back' CSM of lagomorphs and the 'mucous-trap' CSM of rodents. Differences between these groups in their digestive pattern when fed exclusively hay were investigated in six rabbits (Oryctolagus cuniculus) and six guinea pigs (Cavia porcellus). Intake, digestibility (by total faecal collection), solute and particle mean retention times (MRT, using Co-EDTA and Cr-mordanted fibres) were measured. Rabbits selected less fibrous parts of the hay than guinea pigs, leaving orts with higher content of neutral detergent fibre [NDF; 721 ± 21 vs. 642 ± 31 g/kg dry matter (DM) in guinea pigs]. They also expressed a lower NDF digestibility (0.44 ± 0.10 vs. 0.55 ± 0.05 of total), a similar particle MRT (15 ± 3 vs. 18 ± 6 h), a longer solute MRT (51 ± 9 vs. 16 ± 4 h), and a lower calculated dry matter gut fill (19.6 ± 4.7 vs. 29.7 ± 4.1 g DM/kg body mass) than guinea pigs (p bacterial matter from the colonic digesta plug than the 'mucous-trap' CSM found in the guinea pigs. Related to metabolic body mass, rabbits therefore need a less capacious colon for their CSM where a more efficient bacteria wash-out is reflected in the lower fibre digestibility. A lighter digestive tract could contribute to a peculiarity of lagomorphs: their ability to run faster than other similar-sized mammals. © 2010 Blackwell Verlag GmbH.

Paraspidodera uncinata (Nematoda, Lauroiinae as parasite of Cavia magna and Cavia aperea (Rodentia, Caviidae in southern Brazil

Directory of Open Access Journals (Sweden)

Ana Gabriela da Silva Rocha

2015-05-01

Full Text Available Out of the 5 species of Guinea pig registered for Brazil, 4 (Cavia fulgida, C. porcellus, C. aperea, and C. magna have already been reported as hosts of Paraspidodera uncinata. The rodent species C. magna and C. aperea are small-sized mammals, with terrestrial habits, which occur from southern Brazil to eastern Uruguay. Guinea pig specimens donated for research were necropsied for the analysis of endoparasites, and the nematodes found were identified as P. uncinata. The microhabitats of this species were the small and large intestines in C. magna and the large intestine in C. aperea. The prevalence of P. uncinata in the hosts was 60% in C. magna (n = 5 and 14% in C. aperea (n = 7. The record of P. uncinata in different Guinea pig species allows inferring that the foraging mode is similar in the different locations where they occur in southern Brazil, because, perhaps, the infection of hosts has occurred through the ingestion of vegetables contaminated with P. uncinata eggs. This study contributes to knowledge on the helminth fauna of C. magna and C. aperea in southern Brazil.

EFEK ANTIPIRETIK KOMBINASI EKSTRAK DAUN COCOR BEBEK (Kalanchoe pinnata L. DAN EKSTRAK DAUN TEMBELEKAN(Lantana camara L. PERS.TERHADAP MARMUT (Cavia porcellus DENGAN DEMAM YANG DIINDUKSI PEPTON

Directory of Open Access Journals (Sweden)

Heni Purwitasari

2017-03-01

Full Text Available Cocor Bebek (Kalanchoe pinnata L. is a medicinal plant that has been used as traditional medicine for long period, used to fight fever, but it empirically leaves of  Tembelekan (Lantana camara L. are also generally primarily used to treat fever. Research on the effects of the combination of Cocor Bebek’s leaf extract (Kalanchoe pinnata L. and the leaf extract of tembelekan (Lantana camara L. Pers on male guinea pig (Cavia porcellus is induced peptone 5% at a dose of 150 mg / kg body weight. With the aim to determine the effect of the combination and determine the effects of the most effective as an antipyretic. Extracts prepared by maceration method using ethanol 95%. Marmots were divided into 4 groups. Each guinea pig was induced using peptone 5%. The first group was given Na CMC as a negative control group 2nd given a combination of one dose combinations (50 + 720. Group 3 was given a second dose combination (100 + 720. Group-4 were given a 3-dose combination (150 + 720. Temperature measurement is carried out for 2 hours with a 30 minute interval. Data were analyzed temperature measurements were statistically analyzed using ANOVA (Analisys Of Variance. The research result was addressing, that the combination of extracts can reduce fever. The combination is most effective as an antipyretic is cocor duck leaf extract 50 mg and 720 mg tembelekan leaf extract (50 + 720.

Glycosylation at the fetomaternal interface in hemomonochorial placentae from five widely separated species of mammal

DEFF Research Database (Denmark)

Jones, Carolyn J. P.; Carter, Anthony M.; Aplin, John D.

2007-01-01

sapiens) and guinea pig (Cavia porcellus)--in order to assess whether evolutionary convergence to the hemomonochorial state is accompanied by a similar convergence of glycan expression. Placentae from 2 E. telfairi, 3 C. crocuta, 1 D. novemcinctus, 4 womenand 1 C. porcellus were fixed and processed...

Characterization of fetal growth by repeated ultrasound measurements in the wild guinea pig (Cavia aperea).

Science.gov (United States)

Schumann, K; Guenther, A; Göritz, F; Jewgenow, K

2014-08-01

Fetal growth during pregnancy has previously been studied in the domesticated guinea pig (Cavia aperea f. porcellus) after dissecting pregnant females, but there are no studies describing the fetal growth in their wild progenitor, the wild guinea pig (C aperea). In this study, 50 pregnancies of wild guinea pig sows were investigated using modern ultrasound technique. The two most common fetal growth parameters (biparietal diameter [BPD] and crown-rump-length [CRL]) and uterine position were measured. Data revealed similar fetal growth patterns in the wild guinea pig and domesticated guinea pig in the investigated gestation period, although they differ in reproductive milestones such as gestation length (average duration of pregnancy 68 days), average birth weight, and litter mass. In this study, pregnancy lasted on average 60.2 days with a variance of less than a day (0.96 days). The measured fetal growth parameters are strongly correlated with each (R = 0.91; P guinea pig. Copyright © 2014 Elsevier Inc. All rights reserved.

COMPARACIÓN DE DOS TIPOS DE SACRIFICIO Y DIFERENTES TIEMPOS DE MADURACIÓN SOBRE VARIABLES FÍSICO-QUÍMICAS Y MICROBIOLÓGICAS DE LA CARNE DE CUY (Cavia porcellus

Directory of Open Access Journals (Sweden)

H. A. Jurado-Gámez

2016-01-01

Full Text Available El objetivo fue determinar el comportamiento de las variables fisicoquímicas y microbiológicasdurante la maduración de la carne de cuy (Cavia porcellus, utilizandodos métodos de insensibilización (desnucamiento y electronarcosis. La investigaciónse realizó en los laboratorios de la Universidad de Nariño y se utilizaron 24 animales:12 para cada método. Los animales ayunaron 12 h antes del sacrificio y las canalesse maduraron en refrigeración (2 a 4°C durante 24 h. Se determinaron las variablespH, acidez, temperatura, capacidad de retención de agua (CRA, conductibilidadeléctrica (CE y pérdida de agua en refrigeración cada 4 h. Se evaluaron los parámetrosmicrobiológicos coliformes totales y fecales a las 0, 16 y 24 h, además de Listeria sp. yla presencia de antibióticos (sulfamidas al inicio de la maduración. Para detectar diferenciaentre métodos de insensibilización para las variables fisicoquímicas se utilizó undiseño de medidas repetidas en el tiempo; para las demás variables se utilizó estadísticadescriptiva. Los resultados mostraron que el mejor tiempo de maduración fue a las 16horas, con un pH promedio de 5,42, acidez de 0,272 % y CRA de 12,73. Además, lasvariables microbiológicas estuvieron por debajo de la norma vigente garantizando lainocuidad de la carne evaluada. No se observó diferencia estadísticas entre métodos deinsensibilización y los resultados de antibióticos fueron negativos. Se concluye que eltiempo adecuado de maduración para la carne de cuy fue de 16 horas sin diferencias enel método de insensibilización.

Ética da pesquisa em modelos animais Research ethics in animal models

Directory of Open Access Journals (Sweden)

Ivan Dieb Miziara

2012-04-01

Full Text Available A utilização de animais em experimentos científicos é descrita desde o século V a.C. Avanços científicos na área da saúde são atribuídos a modelos animais. O status moral dos animais sempre foi debatido. OBJETIVOS: Este artigo visa à revisão histórica e resumo da legislação atual, para orientar pesquisadores ao utilizar modelos animais na pesquisa em otorrinolaringologia. MATERIAL E MÉTODOS: Pesquisa na base de dados Medline. RESULTADOS: no Brasil, por muitos anos não havia regulamentação para o uso de animais em experimentação. Eram seguidas normas de organizações nacionais e internacionais. Recentemente, foi sancionada a lei nº 11.794/08, que estabelece procedimentos para o uso científico de animais. Na otorrinolaringologia, os estudos com laringe utilizaram coelho, porco, cachorro, cobaias (Cavia porcellus e camundongo; estudos para face coelho, rato e cachorro; rinoplastia com coelho; e orelha interna com ratos e cobaias (albinas. CONCLUSÕES: Os pesquisadores envolvidos em trabalhos científicos com animais devem conhecer os princípios da lei nº 11.794/08 e pesquisar quais animais são apropriados para cada subárea estudada seus modelos com maior aplicabilidade. Os otorrinolaringologistas, especialmente aqueles que se dedicam à pesquisa, necessitam estar sempre atentos para o respeito às regras éticas de utilização de animais em seus estudos.The use of animals in scientific experiments has beendescribed since the fifth century BC. A number of scientific advances in health are attributed to animal models. The issue of the moral status of animals has always been debated. OBJECTIVES: This article aims to review and to present a historical summary of the current laws, to guide researchers who wish to use animal models in otolaryngology research. MATERIAL AND METHODS: Research on the medline database. RESULTS: For many years there were no laws ruling the use of animals in scientific experimentation in Brazil

Lactobacillus caviae sp. nov., an obligately heterofermentative bacterium isolated from the oral cavity of a guinea pig (Cavia aperea f. porcellus).

Science.gov (United States)

Killer, Jiri; Pechar, Radko; Švec, Pavel; Salmonová, Hana; Švejstil, Roman; Geigerová, Martina; Rada, Vojtěch; Vlková, Eva; Mekadim, Chahrazed

2017-08-01

A Gram-stain-positive, facultatively anaerobic, and catalase- and oxidase-negative bacterial strain designated MOZM2T, having 98.4 % 16S rRNA gene sequence identity with Lactobacillus reuteri DSM 20016T, was isolated from a swab of the oral cavity of a home-bred guinea pig. Comparative analyses based on the hsp60, pheS and tuf genes confirmed L. reuteri as its closest relative species, with calculated sequence similarities of 92.8, 88.8 and 96.9 %, respectively. DNA-DNA hybridisation revealed a 42 % degree of genetic similarity between the novel strain and L. reuteri DSM 20016T. Strain MOZM2T degrades carbohydrates via the 6-phosphogluconate/phosphoketolase pathway, evidenced by its production of gas from glucose and the end products of hexose catabolism. Comparative analysis of the cellular fatty acid profiles determined significant differences between MOZM2T and L. reuteri DSM 20016T in their proportions of C8 : 0, C14 : 1, C17 : 0, C18 : 2ω6t and C20 : 0 fatty acids. Results of genotypic analyses also demonstrated differences between these two strains. They also differed in DNA G+C content, and some biochemical and physiological characteristics. We therefore believe that the examined bacterial isolate should be considered as a new taxon within the group of obligately heterofermentative lactobacilli. The species name Lactobacillus caviae sp. nov. is proposed, of which the type strain is MOZM2T (=CCM 8609T=DSM 100239T=LMG 28780T).

Wild genius - domestic fool? Spatial learning abilities of wild and domestic guinea pigs

OpenAIRE

Sachser Norbert; Pickel Thorsten; Lewejohann Lars; Kaiser Sylvia

2010-01-01

Abstract Background Domestic animals and their wild relatives differ in a wide variety of aspects. The process of domestication of the domestic guinea pig (Cavia aperea f. porcellus), starting at least 4500 years ago, led to changes in the anatomy, physiology, and behaviour compared with their wild relative, the wild cavy, Cavia aperea. Although domestic guinea pigs are widely used as a laboratory animal, learning and memory capabilities are often disregarded as being very scarce. Even less i...

Spot-on Treatments of Diflubenzuron and Permethrin to Control a Guinea Pig Louse, Gliricola Porcelli (Phthiraptera: Gyropidae)

Science.gov (United States)

Guinea pigs (Cavia porcellus (L.)) (Rodentia: Caviidae) are pets and laboratory animals. They can be infested by a chewing louse, Gliricola porcelli (Schrank) (Phthiraptera: Gyropidae), which is fairly common in some animal rearing facilities, pet stores, and on wild guinea pigs. Infestation with G....

Journal of the Cameroon Academy of Sciences - Vol 4, No 1 (2004)

African Journals Online (AJOL)

DOWNLOAD FULL TEXT Open Access DOWNLOAD FULL TEXT Subscription or Fee ... Influence of birth weight and litter size on the preweaning growth performance and survival of guinea pigs (Cavia porcellus L.) EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

Etude comparative de la digestibilité in vivo de l'herbe de guinée (Panicum maximum Jacq. associée aux feuilles et tiges de patate douce (Ipomoea batatas (L. Lam (régime Panipo ou à l'herbe de lait (Euphorbia heterophylla L. (régime Paneuph chez le lapin (Oryctolagus cuniculus L. et le cobaye (Cavia porcellus L.

Directory of Open Access Journals (Sweden)

Kouakou, NGDV.

2016-01-01

Full Text Available Digestibility of Guinea grass (Panicum maximum Jacq. associated with sweet potato leaves and stems (Ipomoea batatas (L. Lam (Panipo diet or poison milk (Euphorbia heterophylla L. (Paneuph diet in Rabbits (Oryctolagus cuniculus L. and in Guinea Pigs (Cavia porcellus L.. A comparative study of in vivo digestibility of Guinea grass (Panicum maximum Jacq. associated with sweet potato leaves and stems (Ipomoea batatas (L. Lam (Panipo diet or with poison milk (Euphorbia heterophylla L. (Paneuph diet was conducted involving 16 rabbits and 16 weaned guinea pigs fed ad libitum. Paneuph was significantly better ingested (P0.05 for guinea pigs. Poison milk was better ingested than the leaves and stems of sweet potato (P0.05. The ADC of DM, OM and MAT of Paneuph exceeded 80% and were higher than those of Panipo in rabbits and guinea pigs (P<0.05. Based on the results obtained, the effects of the distribution of the Guinea grass associated with the poison milk during rabbits growing have to be further studied before recommending this new diet to farmers in areas where poison milk and Guinea grass are present and rabbit breeding enough developed.

Production systems, diversity and richness of cavy culture in ...

African Journals Online (AJOL)

In order to assess existing cavy (Cavia porcellus) production systems of Cameroon western highlands and rain forest agro-ecological zones, a household ... for a well designed and comprehensive national breeding program for cavies, and increased capacity building of farmers to address mortality rates and health issues.

Comparative proteomic analysis of lung tissue from guinea pigs with Leptospiral Pulmonary Haemorrhage Syndrome (LPHS) reveals a decrease in abundance of host proteins involved in cytoskeletal and cellular organization

Science.gov (United States)

The recent completion of the complete genome sequence of the guinea pig (Cavia porcellus) provides innovative opportunities to apply proteomic technologies to an important animal model of disease. In this study, a 2-D guinea pig proteome lung map was used to investigate the pathogenic mechanisms of ...

Aeromonas caviae strain induces Th1 cytokine response in mouse intestinal tract

Energy Technology Data Exchange (ETDEWEB)

Hayes, S L; Lye, D J; McKinstry, Craig A.; Vesper, Sephen J.

2010-01-01

Aeromonas caviae has been associated with human gastrointestinal disease. Strains of this species typically lack virulence factors (VFs) such as enterotoxins and hemolysins that are produced by other human pathogens of the Aeromonas genus. Microarray profiling of murine small intestinal extracts, 24 hours after oral infection with an A. caviae strain, provides evidence of a Th1 type immune response. A large number of gamma-interferon (γ-IFN) induced genes are up-regulated as well as several tumor necrosis factor-alpha (TNF-α) transcripts. A. caviae has always been considered as opportunistic pathogen because it lacks obvious virulence factors. This current effort suggests that an A. caviae strain can colonize the murine intestinal tract and cause what has been described by others as a dysregulatory cytokine response. This response could explain why a number of diarrheal waterborne disease cases have been attributed to A. caviae even though it lacks obvious enteropathogenic properties.

Streptococcus caviae sp. nov., isolated from guinea pig faecal samples.

Science.gov (United States)

Palakawong Na Ayudthaya, Susakul; Hilderink, Loes J; Oost, John van der; Vos, Willem M de; Plugge, Caroline M

2017-05-01

A novel cellobiose-degrading and lactate-producing bacterium, strain Cavy grass 6T, was isolated from faecal samples of guinea pigs (Cavia porcellus). Cells of the strain were ovalshaped, non-motile, non-spore-forming, Gram-stain-positive and facultatively anaerobic. The strain gr at 25-40 °C (optimum 37 °C) and pH 4.5-9.5 (optimum 8.0). Phylogenetic analysis based on 16S rRNA gene sequences showed that strain Cavy grass 6T belongs to the genus Streptococcus with its closest relative being Streptococcus devriesei CCUG 47155T with only 96.5 % similarity. Comparing strain Cavy grass 6T and Streptococcus devriesei CCUG 47155T, average nucleotide identity and level of digital DNA-DNA hybridization dDDH were only 86.9 and 33.3 %, respectively. Housekeeping genes groEL and gyrA were different between strain Cavy grass 6T and other streptococci. The G+C content of strain Cavy grass 6T was 42.6±0.3 mol%. The major (>10 %) cellular fatty acids of strain Cavy grass 6T were C16:0, C20 : 1ω9c and summed feature 8 (C18 : 1ω7c and/or C18 : 1ω6c). Strain Cavy grass 6T ferment a range of plant mono- and disaccharides as well as polymeric carbohydrates, including cellobiose, dulcitol, d-glucose, maltose, raffinose, sucrose, l-sorbose, trehalose, inulin and dried grass extract, to lactate, formate, acetate and ethanol. Based on phylogenetic and physiological characteristics, Cavy grass 6T can be distinguished from other members of the genus Streptococcus. Therefore, a novel species of the genus Streptococcus, family Streptococcaceae, order Lactobacillales is proposed, Streptococcuscaviae sp. nov. (type strain Cavy grass 6T=TISTR 2371T=DSM 102819T).

948-IJBCS-Article-Joachim D Gbenou

African Journals Online (AJOL)

DR GATSING

Sterculia setigera, Aframomum melegueta et Citrus aurantifolia sont des plantes couramment utilisées en médecine et pharmacopée traditionnelles africaines pour traiter plusieurs affections dont la toux et l'asthme. L'objectif du présent travail est d'évaluer, sur Cavia porcellus (Cochon d'Inde), les propriétés ...

Aeromonas caviae septicemia in immunocompetent gastrointestinal carriers

Directory of Open Access Journals (Sweden)

M. Dwivedi

Full Text Available Aeromonas caviae strains have been isolated from blood and stool cultures of three immunocompetent patients, residents of Northern India, who presented with community acquired septicemia without any recent history of diarrhea. Cell culture infectivity test performed on Hep-2 cells have shown substantial degree of invasiveness in the isolated strains. This case unleashes a possibility of asymptomatic gastrointestinal carriage of such strains of A. caviae in a very large population of India, as several areas of India have very high rates of Aeromonas induced acute diarrhea/gastroenteritis (up to 13%. It needs to be appraised further in India as well as other countries having high rates of Aeromonas induced acute diarrhea/gastroenteritis.

CAViaR-based forecast for oil price risk

International Nuclear Information System (INIS)

Huang, Dashan; Yu, Baimin; Fabozzi, Frank J.; Fukushima, Masao

2009-01-01

As a benchmark for measuring market risk, value-at-risk (VaR) reduces the risk associated with any kind of asset to just a number (amount in terms of a currency), which can be well understood by regulators, board members, and other interested parties. This paper employs a new VaR approach due to Engle and Manganelli [Engle, R.F., Manganelli, S., 2004. CAViaR: Conditional Autoregressive Value at Risk by Regression Quantiles. Journal of Business and Economic Statistics 22, 367-381] to forecasting oil price risk. In doing so, we provide two original contributions by introducing a new exponentially weighted moving average CAViaR model and developing a mixed data regression model for multi-period VaR prediction. (author)

Caractérisation biomoléculaire et structure de la population des ...

African Journals Online (AJOL)

En vue de caractériser la diversité génétique des populations de cobayes domestiques (Cavia porcellus) dans la région agro-écologique du Cameroun, un panel de16 marqueurs microsatellites ont été utilisés. L'ADN génomique provenait de 110 prélèvements sanguins obtenus chez des animaux non apparentés des ...

Conhecimento da anatomia da orelha de cobaias e ratos e sua aplicação na pesquisa otológica básica Understanding the anatomy of ears from guinea pigs and rats and its use in basic otologic research

Directory of Open Access Journals (Sweden)

Agnes Afrodite Sumarelli Albuquerque

2009-02-01

Full Text Available O uso de mostras animais é importante na pesquisa otológica e o conhecimento da anatomia de sua orelha permite sua utilização adequada. OBJETIVO: Estudar a anatomia da orelha da cobaia e do rato por microscopia óptica de luz (MOL e microscopia eletrônica de varredura (MEV e suas vantagens anatômicas na pesquisa otológica básica. MATERIAL E MÉTODO: Os ossos temporais, as bulas timpânicas e cócleas de três cobaias e ratos albinos foram fotografados e analisados ao MOL e MEV. RESULTADOS: O rato não é tão simples de manipular como a cobaia, e freqüentemente apresenta otite média. O rato apresenta uma junção frágil da bula timpânica, duas e meia espiras na cóclea e a membrana timpânica não veda todo o conduto auditivo externo. A cobaia possui uma bula inteiriça, martelo e bigorna fundidos e três e meia espiras na cóclea. Pela MEV a cobaia e o rato possuem Membrana Tectória, Membrana de Raissner e o Órgão de Corti. As Células de Hensen estão presentes somente na cobaia. CONCLUSÃO: A cobaia foi considerada de fácil manipulação para a microdissecção, pelo tamanho e rigidez do osso temporal, e para experimentos cirúrgicos envolvendo o estribo, janela oval e a membrana timpânica. Pela MEV nota-se semelhança entre cobaia e rato, podendo ambos serem utilizados em estudos da orelha interna.The use of animal samples is important in otologic research and understanding the anatomy of their ears help make proper use of them in research projects. AIM: to study guinea pig's and rat's ears under light microscopy(LM and scanning electron microscopy(SEM and understand their anatomical advantages in basic otologic research. MATERIALS AND METHODS: The temporal bones, tympanic bullas and cochleas from three albino guinea pigs and rats were photographed and analyzed under LM and SEM. RESULTS: Rats aren't as simple to handle as guinea pigs, and often present with otitis media. Rats have a fragile junction of the tympanic bulla

Comparison of Human and Guinea Pig Acetylcholinesterase Sequences and Rates of Oxime-Assisted Reactivation

Science.gov (United States)

2010-01-01

of appropriate animal model systems. For OP poisoning, the guinea pig (Cavia porcellus) is a commonly used animal model because guinea pigs more...endogenous bioscavenger in vivo. Although guinea pigs historically have been used to test OP poisoning therapies, it has been found recently that guinea pig AChE...transcribed mRNA encoding guinea pig AChE, amplified the resulting cDNA, and sequenced this product. The nucleotide and deduced amino acid sequences of

Chlamydia caviae infection alters abundance but not composition of the guinea pig vaginal microbiota.

Science.gov (United States)

Neuendorf, Elizabeth; Gajer, Pawel; Bowlin, Anne K; Marques, Patricia X; Ma, Bing; Yang, Hongqiu; Fu, Li; Humphrys, Michael S; Forney, Larry J; Myers, Garry S A; Bavoil, Patrik M; Rank, Roger G; Ravel, Jacques

2015-06-01

In humans, the vaginal microbiota is thought to be the first line of defense again pathogens including Chlamydia trachomatis. The guinea pig has been extensively used as a model to study chlamydial infection because it shares anatomical and physiological similarities with humans, such as a squamous vaginal epithelium as well as some of the long-term outcomes caused by chlamydial infection. In this study, we aimed to evaluate the guinea pig-C. caviae model of genital infection as a surrogate for studying the role of the vaginal microbiota in the early steps of C. trachomatis infection in humans. We used culture-independent molecular methods to characterize the relative and absolute abundance of bacterial phylotypes in the guinea pig vaginal microbiota in animals non-infected, mock-infected or infected by C. caviae. We showed that the guinea pig and human vaginal microbiotas are of different bacterial composition and abundance. Chlamydia caviae infection had a profound effect on the absolute abundance of bacterial phylotypes but not on the composition of the guinea pig vaginal microbiota. Our findings compromise the validity of the guinea pig-C. caviae model to study the role of the vaginal microbiota during the early steps of sexually transmitted infection. © FEMS 2015.

Plasmid-cured Chlamydia caviae activates TLR2-dependent signaling and retains virulence in the guinea pig model of genital tract infection.

Science.gov (United States)

Frazer, Lauren C; Darville, Toni; Chandra-Kuntal, Kumar; Andrews, Charles W; Zurenski, Matthew; Mintus, Margaret; AbdelRahman, Yasser M; Belland, Robert J; Ingalls, Robin R; O'Connell, Catherine M

2012-01-01

Loss of the conserved "cryptic" plasmid from C. trachomatis and C. muridarum is pleiotropic, resulting in reduced innate inflammatory activation via TLR2, glycogen accumulation and infectivity. The more genetically distant C. caviae GPIC is a natural pathogen of guinea pigs and induces upper genital tract pathology when inoculated intravaginally, modeling human disease. To examine the contribution of pCpGP1 to C. caviae pathogenesis, a cured derivative of GPIC, strain CC13, was derived and evaluated in vitro and in vivo. Transcriptional profiling of CC13 revealed only partial conservation of previously identified plasmid-responsive chromosomal loci (PRCL) in C. caviae. However, 2-deoxyglucose (2DG) treatment of GPIC and CC13 resulted in reduced transcription of all identified PRCL, including glgA, indicating the presence of a plasmid-independent glucose response in this species. In contrast to plasmid-cured C. muridarum and C. trachomatis, plasmid-cured C. caviae strain CC13 signaled via TLR2 in vitro and elicited cytokine production in vivo similar to wild-type C. caviae. Furthermore, inflammatory pathology induced by infection of guinea pigs with CC13 was similar to that induced by GPIC, although we observed more rapid resolution of CC13 infection in estrogen-treated guinea pigs. These data indicate that either the plasmid is not involved in expression or regulation of virulence in C. caviae or that redundant effectors prevent these phenotypic changes from being observed in C. caviae plasmid-cured strains.

Plasmid-cured Chlamydia caviae activates TLR2-dependent signaling and retains virulence in the guinea pig model of genital tract infection.

Directory of Open Access Journals (Sweden)

Lauren C Frazer

Full Text Available Loss of the conserved "cryptic" plasmid from C. trachomatis and C. muridarum is pleiotropic, resulting in reduced innate inflammatory activation via TLR2, glycogen accumulation and infectivity. The more genetically distant C. caviae GPIC is a natural pathogen of guinea pigs and induces upper genital tract pathology when inoculated intravaginally, modeling human disease. To examine the contribution of pCpGP1 to C. caviae pathogenesis, a cured derivative of GPIC, strain CC13, was derived and evaluated in vitro and in vivo. Transcriptional profiling of CC13 revealed only partial conservation of previously identified plasmid-responsive chromosomal loci (PRCL in C. caviae. However, 2-deoxyglucose (2DG treatment of GPIC and CC13 resulted in reduced transcription of all identified PRCL, including glgA, indicating the presence of a plasmid-independent glucose response in this species. In contrast to plasmid-cured C. muridarum and C. trachomatis, plasmid-cured C. caviae strain CC13 signaled via TLR2 in vitro and elicited cytokine production in vivo similar to wild-type C. caviae. Furthermore, inflammatory pathology induced by infection of guinea pigs with CC13 was similar to that induced by GPIC, although we observed more rapid resolution of CC13 infection in estrogen-treated guinea pigs. These data indicate that either the plasmid is not involved in expression or regulation of virulence in C. caviae or that redundant effectors prevent these phenotypic changes from being observed in C. caviae plasmid-cured strains.

The effect of infectious dose on humoral and cellular immune responses in Chlamydophila caviae primary ocular infection.

Directory of Open Access Journals (Sweden)

Ana Filipovic

Full Text Available Following infection, the balance between protective immunity and immunopathology often depends on the initial infectious load. Several studies have investigated the effect of infectious dose; however, the mechanism by which infectious dose affects disease outcomes and the development of a protective immune response is not known. The aim of this study was to investigate how the infectious dose modulates the local and systemic humoral and the cellular immune responses during primary ocular chlamydial infection in the guinea pig animal model. Guinea pigs were infected by ocular instillation of a Chlamydophila caviae-containing eye solution in the conjunctival sac in three different doses: 1×102, 1×104, and 1×106 inclusion forming units (IFUs. Ocular pathology, chlamydial clearance, local and systemic C. caviae-specific humoral and cellular immune responses were assessed. All inocula of C. caviae significantly enhanced the local production of C. caviae-specific IgA in tears, but only guinea pigs infected with the higher doses showed significant changes in C. caviae-specific IgA levels in vaginal washes and serum. On complete resolution of infection, the low dose of C. caviae did not alter the ratio of CD4+ and CD8+ cells within guinea pigs' submandibular lymph node (SMLN lymphocytes while the higher doses increased the percentages of CD4+ and CD8+ cells within the SMLN lymphocytes. A significant negative correlation between pathology intensity and the percentage of CD4+ and CD8+ cells within SMLN lymphocyte pool at selected time points post-infection was recorded for both 1×104, and 1×106 IFU infected guinea pigs. The relevance of the observed dose-dependent differences on the immune response should be further investigated in repeated ocular chlamydial infections.

Repellent Effect and Insecticidal Activities of Bridelia ferruginea, Blighia sapida, and Khaya senegalensis Leaves Powders and Extracts against Dinoderus porcellus in Infested Dried Yam Chips

Directory of Open Access Journals (Sweden)

Laura Yêyinou Loko

2017-01-01

Full Text Available Dinoderus porcellus is considered as the most important pest of stored yam chips and compounds extracted from plants can be used for its control. The present study aimed to test the insecticidal and repellent activities of powders and extracts of leaves of Bridelia ferruginea, Blighia sapida, and Khaya senegalensis against D. porcellus. The efficacy of plant powders was compared with the synthetic pesticide Antouka (Permethrin 3 g/kg + pirimiphos 16 g/kg. The results of the experiment revealed that all plant powders were effective as repellents. Antouka was more effective as insecticidal than the plant powders and minimal weight loss was observed with B. sapida at 2%. Among treatments, propanol extract of K. senegalensis at 5% was found to elicit the highest repellent effect on D. porcellus. The LC50 results revealed that the acetone extract of K. senegalensis is the most toxic (0.29 μL/insect to the pest, while the propanol extract of B. ferruginea at 5% exhibited strong fumigant toxicity against D. porcellus, with 88.89% of pest mortality at 160 μL/L air. The findings from the current work proved that plant powders and extracts of the three plants are sources of botanical insecticides which may be used in the integrated management of D. porcellus.

Survey of endoparasites in pet guinea pigs in Italy.

Science.gov (United States)

d'Ovidio, Dario; Noviello, Emilio; Ianniello, Davide; Cringoli, Giuseppe; Rinaldi, Laura

2015-03-01

Little information is available on the occurrence of endoparasites in pet guinea pigs (Cavia porcellus). The purpose of this study was to evaluate the prevalence of intestinal parasites in cavies kept as pets in southern Italy. Fresh fecal samples were randomly collected from 60 guinea pigs housed in pet shops or privately owned. All fecal samples were processed using the FLOTAC pellet technique to identify and count helminthic eggs/larvae and protozoan cysts/oocysts. In addition, the specimens were analyzed also by the Remel Xpect® Giardia/Cryptosporidium immunoassay. Intestinal parasites were detected in 19 out of 60 guinea pigs (31.7 %). Paraspidodera uncinata eggs were found in 13.3 % (8/60) of the rodents examined, Nippostrongylus-like eggs in 10 % (6/60), and finally Eimeria caviae oocysts were found in 10 % (6/60) of the animals. In one case, both E. caviae oocysts and P. uncinata eggs were found. None of the samples was positive for Cryptosporidium or Giardia. To the authors' knowledge, this is the first survey of endoparasites in pet guinea pigs in Italy.

Persistência do efeito otoprotetor: qual a duração da otoproteção à amicacina? Persistence of the otoprotective effect: how long does otoprotection against amikacin lasts?

Directory of Open Access Journals (Sweden)

Andreia Ardevino de Oliveira

2012-12-01

Full Text Available Há comprovação de que o fenômeno de resistência ocorre quando a dose não lesiva da amicacina protege as células ciliadas contra a ototoxicidade da própria amicacina. OBJETIVO: O objetivo deste trabalho é verificar se o fenômeno de resistência é temporalmente persistente. MÉTODO: Estudo experimental com 14 cobaias albinas (Cavia porcellus divididas em três grupos. Avaliação da função auditiva por emissões otoacústicas por produto de distorção (EOAPD: na pré-exposição à amicacina, no 15º dia de aplicação da dose não lesiva, no final da aplicação da dose lesiva e antes da decapitação. RESULTADOS: O Grupo A (controle apresentou função auditiva e padrão histológico normais. No Grupo B (amicacina 20mg/kg/dia intramuscular por 30 dias e dose lesiva (400 mg/kg/dia por 12 dias e no Grupo C (mesmo esquema do grupo B, porém mantidos por 60 dias e sacrificados, as OEA-PD confirmaram função auditiva normal no período pré-exposição e manutenção do padrão após dose não lesiva, porém, houve perda importante da função auditiva após término do período de aplicação da dose lesiva. CONCLUSÃO: Não houve manutenção do fenômeno da autodefesa estendida por um período de 30 a 60 dias após a aplicação de doses lesivas de amicacina.There is evidence that a "resistance phenomenon" occurs when a none-damaging dose of amikacin protects the hair cells from ototoxicity. Our goal is to prove that this resistance is persistent. METHOD: Experimental study - 14 albino guinea pigs (Cavia porcellus divided into three groups. The auditory function was assessed by distortion product otoacoustic emissions (DPOAE: before exposure to amikacin, on the 15th day after the non-damaging dose was injected, at the end of the damage dose injection and prior to decapitation. RESULTS: Group A (control presented normal hearing and histological pattern. Group B (amikacin 20mg/kg/day (IM for 30 days and affecting dose (400 mg / kg

Functional Response of the Predators Alloeocranum biannulipes (Hemiptera: Reduviidae) and Teretrius nigrescens (Coleoptera: Histeridae) Feeding on Dinoderus porcellus (Coleoptera: Bostrichidae) Infesting Yam Chips.

Science.gov (United States)

Loko, Y L; Djagoun, A D; Dannon, E A; Datinon, B; Dansi, A; Thomas-Odjo, A A; Tamo, M

2017-02-01

The functional response and some predation parameters of the predators Alloeocranum biannulipes Montrouzier & Signoret (Hemiptera: Reduviidea) and Teretrius nigrescens Lewis (Coleoptera: Histeridae) were evaluated at five different densities of larvae and pupae of Dinoderus porcellus Lesne (Coleoptera: Bostrichidae) with the aim to understand their roles in the biological control of this major pest of stored yam chips. Experiments were performed in petri dishes at 25 ± 1 °C, 60 ± 10% RH, and a photoperiod of 12:12 (L:D) h in a controlled temperature room. Both predators showed Type II of functional response with respect to larvae, determined by a logistic regression model. However, T. nigrescens significantly killed more larvae of D. porcellus compared with A. biannulipes. This behavior, however, changed to a linear functional response (Type I), when pupae of D. porcellus were offered to both predators, possibly because of their immobility. In addition, there was no significant difference between T. nigrescens and A. biannulipes in terms of the killed pupae. Parameters of the Holling disc equation for both predators were estimated. Estimated handling time on larvae of D. porcellus for T. nigrescens and A. biannulipes was 0.254 and 0.677 h and the rate of searching efficiency was 0.289 and 0.348 h-1, respectively. Results indicated that T. nigrescens was a more suitable candidate for augmentative release for D. porcellus control than A. biannulipes. However, semifield studies are required to draw firm conclusions. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Unilateral flank ovariohysterectomy in guinea pigs (Cavia porcellus).

Science.gov (United States)

Rozanska, D; Rozanski, P; Orzelski, M; Chlebicka, N; Putowska, K

2016-11-01

To describe a simple, minimally invasive method of ovariohysterectomy via a unilateral flank approach in guinea pigs, for use in routine desexing of healthy female guinea pigs or treatment of ovarian cysts. The subjects of this retrospective study were 41 client-owned guinea pigs submitted for routine desexing or treatment of ovarian cysts. They included 16 healthy female guinea pigs aged 8-12 months (Group 1), and 15 females aged from 9 months to 3 years (Group 2), and 10 females aged from 3 to 7 years (Group 3) with different-sized ovarian cysts. Prior to surgery, the animals received clinical examination, blood testing (complete blood count and serum biochemistry profile) and examination of the abdomen using ultrasonography, to assess the condition of the reproductive tract and ensure the guinea pigs were fit for surgery. Ovariohysterectomy was performed via a unilateral flank incision made close to the erector spinae muscle starting approximately 1 cm caudal to the last rib. Both ovaries, uterine horns, and the uterine cervix were localised, ligated, and dissected through this unilateral retroperitoneal incision. Ovariohysterectomy was successfully completed via a single flank incision in 38/41 (93%) guinea pigs. Three guinea pigs with ovarian cysts from Group 3, which were >6 years old died during surgery due to circulatory and respiratory failure under anaesthesia. In the remaining 38 cases, surgery proceeded without complications. A further two guinea pigs from Group 3 were reluctant to move or eat for the first 3 days after surgery but recovered after provision of supportive care. All 38 animals fully recovered and wound healing was normal. This is the first report of ovariohysterectomy via a unilateral flank incision in guinea pigs. This approach is a simple, minimally invasive and safe alternative to the midline or bilateral flank approaches currently used for surgery of the reproductive tract in guinea pigs.

Immunoglobulin Genomics in the Guinea Pig (Cavia porcellus)

Science.gov (United States)

Guo, Yongchen; Bao, Yonghua; Meng, Qingwen; Hu, Xiaoxiang; Meng, Qingyong; Ren, Liming; Li, Ning; Zhao, Yaofeng

2012-01-01

In science, the guinea pig is known as one of the gold standards for modeling human disease. It is especially important as a molecular and cellular biology model for studying the human immune system, as its immunological genes are more similar to human genes than are those of mice. The utility of the guinea pig as a model organism can be further enhanced by further characterization of the genes encoding components of the immune system. Here, we report the genomic organization of the guinea pig immunoglobulin (Ig) heavy and light chain genes. The guinea pig IgH locus is located in genomic scaffolds 54 and 75, and spans approximately 6,480 kb. 507 VH segments (94 potentially functional genes and 413 pseudogenes), 41 DH segments, six JH segments, four constant region genes (μ, γ, ε, and α), and one reverse δ remnant fragment were identified within the two scaffolds. Many VH pseudogenes were found within the guinea pig, and likely constituted a potential donor pool for gene conversion during evolution. The Igκ locus mapped to a 4,029 kb region of scaffold 37 and 24 is composed of 349 Vκ (111 potentially functional genes and 238 pseudogenes), three Jκ and one Cκ genes. The Igλ locus spans 1,642 kb in scaffold 4 and consists of 142 Vλ (58 potentially functional genes and 84 pseudogenes) and 11 Jλ -Cλ clusters. Phylogenetic analysis suggested the guinea pig’s large germline VH gene segments appear to form limited gene families. Therefore, this species may generate antibody diversity via a gene conversion-like mechanism associated with its pseudogene reserves. PMID:22761756

Aeromonas caviae strain induces Th1 cytokine response in mouse intestinal tract

Science.gov (United States)

Aeromonas caviae has been associated with human gastrointestinal disease. Strains of this species typically lack virulence factors (VFs) such as enterotoxins and hemolysins that are produced by other human pathogens of the Aeromonas genus,. Microarray profiling of...

IDENTIFIKASI NEMATODA PARASIT PADA SALURAN PENCERNAAN MARMUT (Cavia cobaya SEBAGAI SUMBER BELAJAR BIOLOGI PADA MATERI INVERTEBRATA

Directory of Open Access Journals (Sweden)

Septia Nurhasanah

2014-05-01

Full Text Available The research was conducted in the Laboratory of Science Education, University of Muhammadiyah Metro. The research is a descriptive analysis, morphological observations were made by identifying the nematode parasite found that Trichostrongylus sp, Strongyloides sp, Trichuris sp, Trichuris sp. The results showed the prevalence and intensity values is the large number of guinea pigs to parasites divided by the number of guinea pigs that are 100% inspected. While the intensity is seen from the total number of nematode parasites that infect in the number of guinea pigs infected with a parasite that is 2,3. The population in this study was 10 cows pigs (Cavia cobaya . This study took a part in the digestion of marmots (Cavia cobaya the intestines and stomach , then cut and taken part in the large intestine and be Indian ink or coloring 2-3 drops to be easily identified microscopically . Put the preparations into a petri dish , and given alcohol as much as 96 % with 2-3 drops . Taking part in the examination of the large intestine to taste then used the nematode worm structure with Indian ink dye to be observed , and placed in the glass object . Observed with a microscope. Document if the parasites are found by using the camera Erlina 2008. Identification of the observations made have found 3 types of parasites that attack the guinea pig (Cavia cobaya is Strongyloides sp on samples 1,2,3,4,5,6 , dan10 . Then parasite Trichuris sp species found in samples 8 and 9. Trichostrongylus sp parasite species found in sample 7 . Parasitic nematodes found were 3 types of Trichostrongylus sp, Strongyloides sp, Trichuris sp. Number of samples that have been observed as many as 10 cows pigs (Cavia cobaya , with the overall result is as much as 23 tails parasites.               Kata kunci: nematode parasit, marmut (Cavia cobaya, sumber belajar biologi.

Isolation of Aeromonas caviae from yoghurt (“nono”) sold in Jos ...

African Journals Online (AJOL)

A total of 30 nono samples were collected from Farin Gada, Bauchi Road and Gangare markets in Jos and analysed for the presence of Aeromonas species. 3 (10%) of the 30 nono samples were positive for Aeromonas species; which was found to be Aeromonas caviae. All the isolates were obtained from non-heat treated ...

Performances de production des cobayes ( Cavia porcellus L.) en ...

African Journals Online (AJOL)

Au Cameroun, l'élevage des cobayes se pratique encore dans les cuisines et à même le sol et leur alimentation est essentiellement à base des déchets de cuisine. Le souci d'intensifier la production nécessite la détermination des besoins réels du cobaye afin d'asseoir de façon rationnelle sa table de rationnement.

Observaciones sobre la Bartonelosis en el Cuy: Cavia Porcellus

Directory of Open Access Journals (Sweden)

N. Van Der Walle

1943-03-01

Full Text Available 1. La Haemobartonella tyzzeri ha sido observada microscópicamente en 3 cuyes machos de 10 cuyes esplenectomizados procedentes de la zona verrucógena del Rímac.,, (5 machos, 5 hembras, mientras que 3 machos y 1 hembra de Lima resultaron negativos. 2. Una vez se ha cultivado la H. tyzzeri en el medio semi-sólido de NOGUCHI a 28ºC. 3. Sangre de un cuy naturalmente infectado fué inyectado intraperitonealmente a un cuy esplenectomizado de Lima; a las 2 semanas las bartonellas eran visibles en la sangre. De esta manera fueron inoculados 6 cuyes en pasajes sucesivos, siempre con resultados positivos. El porcentaje de glóbulos infectados (± 0.05 % en el cuy original, subió durante estos pasajes, hasta un máximo de 6.25%. El período de incubación bajó en los dos últimos pasajes hasta 1 semana. Tres de los 6 animales mostraron una ligera anemia (con 3.48, 3.74, y 3,19 millones de hematíes por mm.3, respectivamente y otro (el del segundo pasaje una anemia fuerte (1.25 millón, con macrocitos, normoblastos y un alto porcentaje de reticulocitos. Está comprobado pues, que la virulencia de la H. tyzzeri puede ser aumentada. 4. Se ha estudiado el cuadro hemático con los resultados siguientes. El diámetro medio del glóbulo parasitado resulta por lo. general un poco más pequeño que el del no infectado, diferencia que por lo menos en un caso no se podría atribuir al azar. En tres cuyes se observó un aumento de los hematíes, precediendo al descenso de éstos. En algunos de los cuyes parasitados se notó una disminución del número de los leucocitos, seguido por una leucocitosis, la cual era unas veces acompañada, de un aumento del porcentaje de los granulocitos neutrófilos. Eosinofílía durante o después de la infección fué observada en tres cuyes, monocitosis en dos. Algunas veces se pudo poner de manifiesto una hipersegmentación del núcleo de los granulocitos. 5. Se realizó un estudio anátomo-patológico del hígado de algunos cuyes parasitados y del bazo de un cuy naturalmente infectado; también dé un pedazo del bazo, dejado con una esplenectomía incompleta en otro cuy experimentalmente infectado.

Glicolipoproteína de Leptospira interrogans sorogrupo icterohaemorrhagiae: distribuição em fígado e rim de cobaias experimentalmente infectadas

Directory of Open Access Journals (Sweden)

R.T. Macêdo Santos

1989-08-01

Full Text Available Acredita-se que as lesões teciduais na leptospirose possam decorrer da ação direta das leptospiras, de toxinas sintetizadas ou liberadas durante sua lise. O presente estudo visou a extração quimica da glicolipoproteína (GLP da leptospira, a produção de anti-soro anti-GLP e a avaliação de sua distribuição em cortes de fígado e rim de cobaias inoculadas e sacrificadas em estudo seqüencial diário até o 6°dia de infecção, correspondente ao pico da doença. Procurou-se também correlacionar a expressão tecidual da GLP com o grau de lesões locais, em busca de novos subsídios para a compreensão da patogenia da leptospirose. A QLP foi detectada em fígado e rim de 2 dentre 6 cobaias no 5°dia e em todas as 6 no 6° dia de infecção, sob a forma de grânulos no citoplasma de macrófagos, livres no interstício ou acolados à membrana de células endoteliais e parenquimatosas, especialmente nas regiões mais lesadas. A cronologia do aparecimento da GLP e sua distribuição sugerem tratar-se de produto dc lise de leptospiras fagocitadas por macrófagos e que esta substância, conquanto não comprovada como iniciadora das lesões, associa-se a seu agravamento nas etapas mais avançadas da leptospirose.

Efeito do ácido trans-retinóico na inibição de colesteatoma em cobaias Effect of trans-retinoic acid in the inhibition of cholesteatoma in guinea pigs

Directory of Open Access Journals (Sweden)

Marcos Luiz Antunes

2008-02-01

Full Text Available O colesteatoma de orelha média atingia mais de 5 milhões de pessoas até a década de 80. Vários modelos animais já foram utilizados para alternativas de tratamento do colesteatoma sem sucesso. OBJETIVO: Estudar os efeitos do ácido trans-retinóico, uso tópico na orelha externa em cobaias, na inibição da formação do colesteatoma de orelha média induzido pelo propilenoglicol. Estudo experimental prospectivo. MATERIAL E MÉTODOS: 25 cobaias foram submetidas à aplicação de propilenoglicol a 100% na bula timpânica bilateralmente e uma solução de ácido trans-retinóico foi aplicada topicamente (total de 5 aplicações na orelha externa, região justa-timpânica, na orelha direita, enquanto na orelha esquerda aplicou-se solução fisiológica (orelha controle. As cobaias foram sacrificadas após 6 semanas do procedimento inicial e os ossos temporais foram separados, fixados e descalcificados, para análise macroscópica e histológica. RESULTADOS: Os achados macroscópicos evidenciaram a presença e suspeita de colesteatoma em 25% das orelhas direitas e 85% das orelhas esquerdas (P=0,0003*. Os achados histológicos dos 40 ossos temporais evidenciaram a presença de colesteatoma em 30% das orelhas direitas e 75% das orelhas esquerdas (P=0,0104*. CONCLUSÃO: O uso tópico do ácido trans-retinóico é efetivo na inibição da formação de colesteatoma induzido pelo propilenoglicol em cobaias.Middle ear cholesteatoma affected more than 5 million people until the 80`s. Many animal models were used, unsuccessfully, to study an alternative therapy to cholesteatoma. AIM: observe the effect of the trans-retinoic acid in the inhibition of middle ear cholesteatomas induced by propylene glycol. STUDY DESIGN: Clinical and Experimental. METHODS: 25 guinea pigs were submitted to the application of a 100% propylene glycol solution in their bulla bilaterally and a solution of trans-retinoic acid was applied locally in the external right ear, while

Een bijdrage tot de kennis van de experimentele tuberculeuze super-infectie bij de cavia

NARCIS (Netherlands)

Goslinga, Jan

1960-01-01

Er werd een beschrijving gegeven van een in 1954 in het sanatorium "de KLOKKENBERG" te Breda verricht onderzoek, waarbij 37 caviae achtereenvolgens enkele malen met virulente, tegen bepaalde stoffen selectief resistent gekweekte tuberkelbacteriën, afgeleid van &n bepaalde, bij een van de patienten

Impacts de la déficience maternelle modérée en fer sur le développement des fonctions auditives et le métabolisme des acides gras et eicosanoïdes de la progéniture

OpenAIRE

Jougleux, Jean-Luc

2015-01-01

Tableau d'honneur de la Faculté des études supérieures et postdorales, 2014-2015 Cette étude a pour objectif de déterminer les impacts de la l’anémie ferriprive (AF) modérée durant la gestation et la lactation, sur les fonctions neurophysiologiques des voies auditives, ainsi que sur les fonctions métaboliques de la progéniture du cochon d’Inde (Cavia porcellus). Elle s’articule selon 2 volets d’études distincts (protocoles 1 et 2), basés tant sur la composition en fer des diètes, que sur l...

Micro-endoscopic ear anatomy of guinea pig applied to experimental surgery.

Science.gov (United States)

Barros, Bruno Borges de Carvalho; Andrade, José Santos Cruz de; Garcia, Leandro Borborema; Pifaia, Gustavo Ribeiro; Cruz, Oswaldo Laércio Mendonça; Onishi, Ektor Tsuneo; Penido, Norma de Oliveira

2014-01-01

To describe topographic and endoscopic anatomy of guinea pig ear for development of surgical approaches in experimental studies. Experimental study. Eight adult guinea pigs (Cavia porcellus) were used in this study. Four animals were described through endoscopic view and four animals were used to describe topographic anatomy. The main structures of middle ear were well identified through endoscopy view: oval and round window, ossicles and vascular structures. Temporal bone position, landmarks and its relations to skull are perceived with topographic description. Topographic anatomic description allowed exposition of temporal bone relations for external surgical approaches. Alternatively, grooves and middle ear structures were identified and may be used to transcanal accesses.

Expression of Aeromonas caviae ST pyruvate dehydrogenase complex components mediate tellurite resistance in Escherichia coli

International Nuclear Information System (INIS)

Castro, Miguel E.; Molina, Roberto C.; Diaz, Waldo A.; Pradenas, Gonzalo A.; Vasquez, Claudio C.

2009-01-01

Potassium tellurite (K 2 TeO 3 ) is harmful to most organisms and specific mechanisms explaining its toxicity are not well known to date. We previously reported that the lpdA gene product of the tellurite-resistant environmental isolate Aeromonas caviae ST is involved in the reduction of tellurite to elemental tellurium. In this work, we show that expression of A. caviae ST aceE, aceF, and lpdA genes, encoding pyruvate dehydrogenase, dihydrolipoamide transacetylase, and dihydrolipoamide dehydrogenase, respectively, results in tellurite resistance and decreased levels of tellurite-induced superoxide in Escherichia coli. In addition to oxidative damage resulting from tellurite exposure, a metabolic disorder would be simultaneously established in which the pyruvate dehydrogenase complex would represent an intracellular tellurite target. These results allow us to widen our vision regarding the molecular mechanisms involved in bacterial tellurite resistance by correlating tellurite toxicity and key enzymes of aerobic metabolism.

Análise clínica e morfológica da conjuntivite alérgica induzida por ovalbumina e tratada com chalcona em cobaias

Directory of Open Access Journals (Sweden)

Albuquerque Rosemary Jorge de Mendonça

2004-01-01

Full Text Available OBJETIVO: Verificar, do ponto de vista clínico e morfológico, o efeito da chalcona na conjuntivite alérgica induzida por ovalbumina em cobaias. MÉTODOS: Utilizaram-se 54 cobaias, albinos, machos pesando aproximadamente 400 g. Os animais foram sensibilizados por injeção intraperitoneal de ovalbumina suspensa em solução adjuvante completa de Freund. Posteriormente, a conjuntivite alérgica foi induzida por instilação de ovalbumina no saco conjuntival do olho direito. Os animais foram distribuídos em 3 grupos, conforme o tratamento proposto: chalcona, corticóide e salina. A avaliação clínica foi realizada com 5, 10 e 40 min, 7 e 24 h da indução e diariamente até o dia 7 da indução. A avaliação morfológica consistiu em avaliar edema, necrose, vascularização e exocitose nos dias 1, 3 e 7 da indução. RESULTADOS: Em todos os grupos a resposta inflamatória foi mais intensa 24 h após a indução. No grupo chalcona evidenciou-se menos sinais inflamatórios que no grupo salina. O grupo corticóide apresentou menos sinais inflamatórios quando comparados aos grupos chalcona e controle. À análise morfológica evidenciou-se que os grupos chalcona e corticóide apresentaram efeitos terapêuticos semelhantes. CONCLUSÃO: A chalcona teve efeito terapêutico na conjuntivite alérgica induzida por ovalbumina.

Estudo sorológico de infecções experimentais por Trypanosoma evansi, em cobaias

Directory of Open Access Journals (Sweden)

Teresa Cristina Goulart de Oliveira

1989-04-01

Full Text Available Comparamos os métodos de Imunofluorescência Indireta (IFI, Imunodifusão Radial Dupla e Aglutinação, para a pesquisa de anticorpos em soros, na tripanossomíase experimental por Trypanosoma evansi, em cobaias. Foram obtidas 20 amostras de soro correspondentes às 4 primeiras semanas de infecção. A IFI foi positiva em apenas 6 animais, com títulos variando de 1:4 a 1:16. Os títulos mais altos foram observados na 3ª semana pós-infecção. Anticorpos aglutinantes foram observados a partir da 1ª semana pós-infecção e, após a 2ª semana, todos os animais apresentaram reação de aglutinação positiva, com títulos variando de 1:8.000 a 1:250.000. O tratamento dos soros com 2-Mercapto-etanol inibiu a reação de aglutinação, sugerindo ser IgM a principal classe dos anticorpos presentes no soro dos animais infectados. Não se constatou a presença de anticorpos precipitantes durante todo o curso da infecção.

La domestication animale en Amérique du Sud: le point des connaissances

Directory of Open Access Journals (Sweden)

1990-01-01

Full Text Available Quatre espèces animales, d’importance économique inégale, ont été domestiquées dans les régions andines à l’époque préhistorique: le canard musqué Cairina moschata avant 3000 BP (?, le cobaye Cavia porcellus vers 2500 BP (?, l’alpaca Lama pacos vers 6000 BP et le lama Lama glama entre 5500 et 4000 BP, d’après les données archéologiques et les analyses archéozoologiques les plus récentes. A propos de chacune d’elles sont présentés synthétiquement les gisements-clés et les fouilles effectuées, les méthodes d’analyse archéozoologique mises en oeuvre, les résultats obtenus (modalités et chronologie des processus de domestication. En conclusion sont examinées, à propos des camélidés, les causes possibles de leur domestication et quelques-unes de ses conséquences socio-économiques les plus importantes. La domesticación animal en América del Sur. Balance de los conocimientos. Cuatro especies animales, de importancia económica desigual, han sido domesticadas en las regiones andinas durante la época prehistórica: el pato joque Cairana moschata antes de 3000 BP (?, el cuy Cavia porcellus hacia 2500 BP (?, la alpaca Lama pacos hacia 6000 BP y la llama Lama glama entre 5500 y 4000 BP, según los datos arqueológicos y los análisis arqueozoológicos más recientes. A propósito de cada especie, presentamos sintéticamente los yacimientos claves y las excavaciones efectuadas, los métodos de análisis arqueozoológico utilizados y los resultados obtenidos (modalidades y cronología de los procesos de domesticación. En conclusión y a proposito de los camélidos, se examina las causas posibles de su domesticación y algunas de sus consecuencias socioeconómicas más importantes. The animal domestication in South America. The state of knowledge. Four animal species, of unequal economic importance, have been domesticated in the Andean region during prehistoric times. Muscovy duck Cairina moschata before 3000 BP

Aeromonas caviae alters the cytosolic and mitochondrial creatine kinase activities in experimentally infected silver catfish: Impairment on renal bioenergetics.

Science.gov (United States)

Baldissera, Matheus D; Souza, Carine F; Júnior, Guerino B; Verdi, Camila Marina; Moreira, Karen L S; da Rocha, Maria Izabel U M; da Veiga, Marcelo L; Santos, Roberto C V; Vizzotto, Bruno S; Baldisserotto, Bernardo

2017-09-01

Cytosolic and mitochondrial creatine kinases (CK), through the creatine kinase-phosphocreatine (CK/PCr) system, provide a temporal and spatial energy buffer to maintain cellular energy homeostasis. However, the effects of bacterial infections on the kidney remain poorly understood and are limited only to histopathological analyses. Thus, the aim of this study was to investigate the involvement of cytosolic and mitochondrial CK activities in renal energetic homeostasis in silver catfish experimentally infected with Aeromonas caviae. Cytosolic CK activity decreased in infected animals, while mitochondrial CK activity increased compared to uninfected animals. Moreover, the activity of the sodium-potassium pump (Na + , K + -ATPase) decreased in infected animals compared to uninfected animals. Based on this evidence, it can be concluded that the inhibition of cytosolic CK activity by A. caviae causes an impairment on renal energy homeostasis through the depletion of adenosine triphosphate (ATP) levels. This contributes to the inhibition of Na + , K + -ATPase activity, although the mitochondrial CK activity acted in an attempt to restore the cytosolic ATP levels through a feedback mechanism. In summary, A. caviae infection causes a severe energetic imbalance in infected silver catfish, which may contribute to disease pathogenesis. Copyright © 2017 Elsevier Ltd. All rights reserved.

Blood profiles in unanesthetized and anesthetized guinea pigs (Cavia porcellus).

Science.gov (United States)

Williams, Wendy R; Johnston, Matthew S; Higgins, Sarah; Izzo, Angelo A; Kendall, Lon V

2016-01-01

The guinea pig is a common animal model that is used in biomedical research to study a variety of systems, including hormonal and immunological responses, pulmonary physiology, corticosteroid response and others. However, because guinea pigs are evolutionarily a prey species, they do not readily show behavioral signs of disease, which can make it difficult to detect illness in a laboratory setting. Minimally invasive blood tests, such as complete blood counts and plasma biochemistry assays, are useful in both human and veterinary medicine as an initial diagnostic technique to rule in or rule out systemic illness. In guinea pigs, phlebotomy for such tests often requires that the animals be anesthetized first. The authors evaluated hematological and plasma biochemical effects of two anesthetic agents that are commonly used with guinea pigs in a research setting: isoflurane and a combination of ketamine and xylazine. Hematological and plasma biochemical parameters were significantly different when guinea pigs were under either anesthetic, compared to when they were unanesthetized. Plasma proteins, liver enzymes, white blood cells and red blood cells appeared to be significantly altered by both anesthetics, and hematological and plasma biochemical differences were greater when guinea pigs were anesthetized with the combination of ketamine and xylazine than when they were anesthetized with isoflurane. Overall these results indicate that both anesthetics can significantly influence hematological and plasma biochemical parameters in guinea pigs.

Variation phénotypique des traits quantitatifs de Cavia porcellus ...

African Journals Online (AJOL)

SARAH

% de la population ..... l'effet de l'interaction entre le génotype et l'environnement sur les performances des cobayes pour la .... souche locale doivent être généralement en bonne santé, plus vigoureux et d'âge et de poids ...

Review of gastric torsion in eight guinea pigs (Cavia porcellus).

Science.gov (United States)

Nógrádi, Anna Linda; Cope, Iain; Balogh, Márton; Gál, János

2017-12-01

The authors present eight cases of gastric dilatation and volvulus (GDV) in guinea pigs from the Department and Clinic of Exotic Animal and Wildlife Medicine, University of Veterinary Medicine, Budapest, Hungary between 2012 and 2016. Seven animals were operated on and two survived. Gastric torsion has been noted in many mammalian species. Gastric volvulus has a high morbidity and high mortality rate with a guarded to poor prognosis in all of these species. How GDV develops is still not widely understood. Postmortem examinations, in both our cases and previously reported cases, have failed to reveal the exact causes of the gastric torsions. The aetiology of gastric torsion in guinea pigs is probably multifactorial. Feeding fewer meals per day, eating rapidly, decreased food particle size, exercise, stress after a meal, competition, age, and an aggressive or fearful temperament, are all likely and potential risk factors for GDV development in a similar fashion to dogs. Sex, breeding, dental diseases, anatomical abnormalities, pain and pregnancy may also be contributing factors.

Family Outbreaks of Nontyphoidal Salmonellosis following a Meal of Guinea Pigs.

Science.gov (United States)

Fournier, John B; Knox, Kimberly; Harris, Maureen; Newstein, Michael

2015-01-01

Salmonella outbreaks have been linked to a wide variety of foods, including recent nationwide outbreaks. Guinea pig (Cavia porcellus), also known as cuy or cobayo, has long been a popular delicacy and ceremonial food in the Andean region in South America. This case report describes three family outbreaks of nontyphoidal salmonellosis, each occurring after a meal of guinea pigs. We believe this case report is the first to describe a probable association between the consumption of guinea pig meat and human salmonellosis. Physicians should be aware of the association of Salmonella and the consumption of guinea pigs, given the increasing immigration of people from the Andean region of South America and the increasing travel to this region.

Characterisation of potential virulence markers in Aeromonas caviae isolated from polluted and unpolluted aquatic environments in Morocco

DEFF Research Database (Denmark)

Imziln, Boujama; Krovacek, Karel; Baloda, Suraj B.

1998-01-01

A total of 100 Aeromonas caviae strains isolated from river waters (38 isolates), raw sewage (30 isolates) and effluents of stabilisation ponds (i.e. treated sewage; 32 isolates) in Marrakech, Morocco, were tested for the presence of putative virulence factors to delineate differences, if any...

Pan-genome analysis of Aeromonas hydrophila, Aeromonas veronii and Aeromonas caviae indicates phylogenomic diversity and greater pathogenic potential for Aeromonas hydrophila.

Science.gov (United States)

Ghatak, Sandeep; Blom, Jochen; Das, Samir; Sanjukta, Rajkumari; Puro, Kekungu; Mawlong, Michael; Shakuntala, Ingudam; Sen, Arnab; Goesmann, Alexander; Kumar, Ashok; Ngachan, S V

2016-07-01

Aeromonas species are important pathogens of fishes and aquatic animals capable of infecting humans and other animals via food. Due to the paucity of pan-genomic studies on aeromonads, the present study was undertaken to analyse the pan-genome of three clinically important Aeromonas species (A. hydrophila, A. veronii, A. caviae). Results of pan-genome analysis revealed an open pan-genome for all three species with pan-genome sizes of 9181, 7214 and 6884 genes for A. hydrophila, A. veronii and A. caviae, respectively. Core-genome: pan-genome ratio (RCP) indicated greater genomic diversity for A. hydrophila and interestingly RCP emerged as an effective indicator to gauge genomic diversity which could possibly be extended to other organisms too. Phylogenomic network analysis highlighted the influence of homologous recombination and lateral gene transfer in the evolution of Aeromonas spp. Prediction of virulence factors indicated no significant difference among the three species though analysis of pathogenic potential and acquired antimicrobial resistance genes revealed greater hazards from A. hydrophila. In conclusion, the present study highlighted the usefulness of whole genome analyses to infer evolutionary cues for Aeromonas species which indicated considerable phylogenomic diversity for A. hydrophila and hitherto unknown genomic evidence for pathogenic potential of A. hydrophila compared to A. veronii and A. caviae.

Extratos metanólico e acetato de etila de Solanum megalonyx Sendtn. (Solanaceae apresentam atividade espasmolítica em íleo isolado de cobaia: um estudo comparativo

Directory of Open Access Journals (Sweden)

Rita de Cássia M. Oliveira

Full Text Available Solanum megalonyx Sendtn. (Solanaceae é conhecida popularmente por "jurubeba" no Nordeste do Brasil e se apresenta na forma de arbusto. Várias espécies de Solanum apresentam efeito espasmolítico em órgãos isolados. Assim, objetivou-se investigar e comparar o efeito dos extratos metanólico (SM-MeOH e acetato de etila (SM-AcOEt, obtidos das partes aéreas de S. megalonyx, em íleo isolado de cobaia. SM-MeOH e SM-AcOEt antagonizaram (n = 5 as contrações fásicas induzidas por 1 mM de acetilcolina (logCI50 = 3,2 ± 0,1 e 1,8 ± 0,6 mg/mL, respectivamente ou de histamina (logCI50 = 2,8 ± 0,5 e 1,7 ± 0,3 mg/mL, respectivamente. SM-MeOH e SM-AcOEt também relaxaram (n = 5 o íleo pré-contraído por 40 mM de KCl (logCE50 = 1,9 ± 0,09 e 1,9 ± 0,1 mg/mL, respectivamente, por 1 mM de histamina (logCE50 = 1,9 ± 0,07 e 1,7 ± 0,08 mg/mL, respectivamente ou de acetilcolina (logCE50 = 1,9 ± 0,02 e 1,7 ± 0,09 mg/mL, respectivamente de maneira dependente de concentração e equipotente. Demonstra-se pela primeira vez que S. megalonyx apresenta efeito espasmolítico não seletivo em íleo isolado de cobaia, sugerindo que os extratos podem estar agindo em um passo comum da via de sinalização dos agentes contráteis testados.

Efeito da casca da berinjela (Solanum melongena) sobre as concentrações plasmáticas de triglicerídeos, colesterol total e frações lipídicas, em cobaias (Cavia porcellus) hiperlipidêmicos ( The effect of the eggplant core on blood lipid concentrations in hypercholesterolemic guinea pigs (Cavia porcellus) )

NARCIS (Netherlands)

Cherem, A.D.R.; Tramonte, V.L.C.G.; Fett, R.; Dokkum, W. van

2007-01-01

We investigated the effect of the eggplant core on the plasma concentrations of triglycerides, total- LDL- and HDL-cholesterol, in male guinea pigs, randomly assigned into five groups: 1 (N) - normolipidic diet AIN-93G, 2 (NB) - normolipidic diet, supplemented with eggplant core, halfway of the

Family Outbreaks of Nontyphoidal Salmonellosis following a Meal of Guinea Pigs

Directory of Open Access Journals (Sweden)

John B. Fournier

2015-01-01

Full Text Available Salmonella outbreaks have been linked to a wide variety of foods, including recent nationwide outbreaks. Guinea pig (Cavia porcellus, also known as cuy or cobayo, has long been a popular delicacy and ceremonial food in the Andean region in South America. This case report describes three family outbreaks of nontyphoidal salmonellosis, each occurring after a meal of guinea pigs. We believe this case report is the first to describe a probable association between the consumption of guinea pig meat and human salmonellosis. Physicians should be aware of the association of Salmonella and the consumption of guinea pigs, given the increasing immigration of people from the Andean region of South America and the increasing travel to this region.

Microscopic aspects of lymphoid organs in the guinea pig (Cavia porcellus

Directory of Open Access Journals (Sweden)

Fernanda Menezes de Oliveira e Silva

2013-10-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2013v26n4p233 Microscopy of lymphoid organs was studied in the guinea pig at different developmental stages – fetus, pup, and adult. Liver is a lobed organ, coated with a mesothelium, and it consists of sinusoids and cell plates in its parenchyma, named hepatocytes. Thymus is covered by a thin capsule of connective tissue which is protruded as septa into the entire organ. The parenchyma of each lobule is not clearly separated into a cortex and medulla. Hassall’s corpuscles are abundant. Lymph nodes are arranged into cortex and medulla. The cortex has germinal centers or lymphoid nodules, surrounded by diffuse lymphoid tissue. Spleen is divided into red and white pulp. Trabeculae of connective tissue are protruded into the spleen from the capsule; however, they are sparsely found around the red and white pulps. Germinal centers were found in the white pulp, where small and large lymphocytes and lymphoblasts can be found. Since the guinea pig is regarded as an important model for morphological studies due to its closeness to human beings, this article raises relevant information on the structural components of the lymphoid system in these animals, providing a new source of data to other knowledge fields.

Microscopic aspects of lymphoid organs in the guinea pig (Cavia porcellus

Directory of Open Access Journals (Sweden)

Fernanda Menezes de Oliveira e Silva

2013-11-01

Full Text Available Microscopy of lymphoid organs was studied in the guinea pig at different developmental stages – fetus, pup, and adult. Liver is a lobed organ, coated with a mesothelium, and it consists of sinusoids and cell plates in its parenchyma, named hepatocytes. Thymus is covered by a thin capsule of connective tissue which is protruded as septa into the entire organ. The parenchyma of each lobule is not clearly separated into a cortex and medulla. Hassall’s corpuscles are abundant. Lymph nodes are arranged into cortex and medulla. The cortex has germinal centers or lymphoid nodules, surrounded by diffuse lymphoid tissue. Spleen is divided into red and white pulp. Trabeculae of connective tissue are protruded into the spleen from the capsule; however, they are sparsely found around the red and white pulps. Germinal centers were found in the white pulp, where small and large lymphocytes and lymphoblasts can be found. Since the guinea pig is regarded as an important model for morphological studies due to its closeness to human beings, this article raises relevant information on the structural components of the lymphoid system in these animals, providing a new source of data to other knowledge fields.

Typologie des élevages de cobayes (Cavia porcellus) au Bénin ...

African Journals Online (AJOL)

A cet effet, une enquête conduite suivant la méthode en boule de neige a ... du Sud et du Nord. Quatre types d'élevage ont été identifiés avec des ... les performances de ce petit herbivore ..... l'organisation de la commercialisation des produits ...

Aeromonas caviae inhibits hepatic enzymes of the phosphotransfer network in experimentally infected silver catfish: Impairment on bioenergetics.

Science.gov (United States)

Baldissera, M D; Souza, C F; Verdi, C M; Dos Santos, K L M; Da Veiga, M L; da Rocha, M I U M; Santos, R C V; Vizzotto, B S; Baldisserotto, B

2018-03-01

Several studies have been demonstrated that phosphotransfer network, through the adenylate kinase (AK) and pyruvate kinase (PK) activities, allows for new perspectives leading to understanding of disease conditions associated with disturbances in energy metabolism, metabolic monitoring and signalling. In this sense, the aim of this study was to evaluate whether experimental infection by Aeromonas caviae alters hepatic AK and PK activities of silver catfish Rhamdia quelen. Hepatic AK and PK activities decreased in infected animals compared to uninfected animals, as well as the hepatic adenosine triphosphate (ATP) levels. Also, a severe hepatic damage was observed in the infected animals due to the presence of dilation and congestion of vessels, degeneration of hepatocytes and loss of liver parenchyma architecture and sinusoidal structure. Therefore, we have demonstrated, for the first time, that experimental infection by A. caviae inhibits key enzymes linked to the communication between sites of ATP generation and ATP utilization. Moreover, the absence of a reciprocal compensatory mechanism between these enzymes contributes directly to hepatic damage and for a severe energetic imbalance, which may contribute to disease pathophysiology. © 2017 John Wiley & Sons Ltd.

Trixacarus caviae Fain, Howell & Hyatt 1972 (Acari: Sarcoptidae) as a cause of mange in guinea-pigs and papular urticaria in man

NARCIS (Netherlands)

Dorrestein, G.M.; Bronswijk, J.E.M.H. van

1979-01-01

The clinical symptoms of infestation with Trixacarus caviae in guinea-pigs are described. In general large areas of thickened, denuded skin, with a heavy secondary bacterial infection, and sometimes neurological signs, are observed in mangy cases. Antiparasitic therapy was successful with one or

Twenty-four-Hour Measurement of Intraocular Pressure in Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Ansari-Mood, Maneli; Mehdi-Rajaei, Seyed; Sadjadi, Reza; Selk-Ghaffari, Masoud; Williams, David L

2016-01-01

The objective of this study was to measure intraocular pressure (IOP) in intact, healthy guinea pigs (15 male, 15 female) every 2 h for a 24-h period. First, IOP was measured by using rebound tonometry (RBT). After a 1-min rest period, 0.5% proparacaine ophthalmic solution, a topical anesthetic, was applied to both eyes; 4 min after anesthetic instillation, IOP was measured by using applanation tonometry (APT). The IOP was lower during the light period (0700 to 1900) than during the dark phase (2000 to 0600). The lowest IOP by both RBT and APT (3.68 and 13.37 mm Hg, respectively) occurred at 0700, whereas maximal IOP occurred at 2300 for RBT (8.12 mm Hg) but at 2100 for APT (20.62 mm Hg). No significant differences in IOP between the left and right eyes or between RBT and APT were noted. In addition, daily variations in the IOP of guinea pigs seem to be independent of sex and body weight. The results of this study may be beneficial in the diagnosis and observation of glaucoma in guinea pigs.

Effects of Changing to Individually Ventilated Caging on Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Giral, Marta; Armengol, Clara; Sánchez-Gómez, Sonia; Gavaldà, Amadeu

2015-05-01

The goal of this study was to evaluate the effect of changing to IVC housing on guinea pigs by recording several physiologic parameters in guinea pigs housed sequentially in open-top cages (OTC) and IVC. To register heart rate and locomotor activity, 10 male Dunkin-Hartley guinea pigs implanted with telemetric transmitters were moved from OTC to new, freshly prepared OTC or IVC and subsequently monitored by telemetry during the 4 d after the first cage change. Body weight and food consumption were measured twice during the study. Comparison of data from OTC- and IVC-housed guinea pigs showed no relevant differences in heart rate (mean ± 1 SD; 213 ± 10 bpm and 207 ± 9 bpm, respectively) at any time point. In contrast, locomotor activity varied: whereas activity during the first 4 h after the change of cage type was greater in IVC-housed animals, that during the following 24 h was greater in OTC but was similar between groups thereafter. Animals housed in OTC consumed more food than did those in IVC and, under both conditions, consumption was statistically related to body weight changes. Together, these results show that a change to IVC housing induced only transient increases in locomotor activity in guinea pigs without a marked increase in heart rate but with a decrease in food consumption. Because decreased food consumption was the only stress-associated sign during the 4-d observation, longer studies are needed to ascertain the importance of this finding.

Effects of testicular irradiation with 60Co in guinea pigs CAVIA PORCELLUS

International Nuclear Information System (INIS)

Santos, O.R. dos.

1980-01-01

Improvements were made in restaint systems and in the technique of electroejaculation in guinea pigs, emphasizing safety, effectiveness and repetition. Arrangements for simultaneous testicular irradiation with 60 Co in 5 animals and a phantom to test dose levels in the target region and scattering were also made. Effects of single and fractionated exposures on sperm were studied. A collimated point-shaped 60 Co-machine calibrated to 7 R/min was used as radiation source. Groups of five 12 month aged male guinea pigs were exposed to either single testicular irradiation of 50, 100, 200 and 400 R or fractionated weekly testicular irradiation of 2, 5, 10 and 20 R, during 10 weeks. A last group was exposed to 4 fractionated testicular irradiations of 20 R at time intervals of 21 days and a group of 8 animals was used as control. Semen samples evaluations were made during 5 weeks before irradiation and in the subsequent 11 weeks. Abnormalities in sperm morphology were studied by William's method and phase contrast microscopy. Mean percentages of semen normal espermatzoons and spermatic abnormalities are shown in figures and photomicrographs. Marked differences on concentration, sperm motility and sperm abnormalities were found, but not on volume, in favour of 100 and 200 R single doses levels, as compared to fractionated 10 and 20 R. (Author) [pt

Teste de eficiência de vacinas antiaftosa. II. Relação entre o Índice C em cobaias e o Índice Proteção Camundongos

Directory of Open Access Journals (Sweden)

Ernani Ibirá Gonçalves

1994-03-01

Full Text Available O exame da eficiência de seis vacinas antiaftosa, realizado com os testes “Indice Proteção Camundongos” e "Índice C” utilizando 15 ou mais cobaias por diluição de vírus na titulação, demonstrou a presença de boa correlação e alta significância entre os resultados das duas provas. O valor do índice Proteção Camundongos foi aproximadamente o dobro do valor do índice C. Assim, o índice Proteção Camundongos pode ser recomendado como teste de eficiência de vacinas antiaftosa. principalmente quando se necessita um grande número de provas, devido a seu baixo custo e facilidade de execução, por usar exclusivamente camundongos.

Isolation and identification of Aeromonas caviae strain KS-1 as TBTC- and lead-resistant estuarine bacteria.

Science.gov (United States)

Shamim, Kashif; Naik, Milind Mohan; Pandey, Anju; Dubey, Santosh Kumar

2013-06-01

Tributyltin chloride (TBTC)- and lead-resistant estuarine bacterium from Mandovi estuary, Goa, India was isolated and identified as Aeromonas caviae strain KS-1 based on biochemical characteristics and FAME analysis. It tolerates TBTC and lead up to 1.0 and 1.4 mM, respectively, in the minimal salt medium (MSM) supplemented with 0.4 % glucose. Scanning electron microscopy clearly revealed a unique morphological pattern in the form of long inter-connected chains of bacterial cells on exposure to 1 mM TBTC, whereas cells remained unaltered in presence of 1.4 mM Pb(NO₃)₂ but significant biosorption of lead (8 %) on the cell surface of this isolate was clearly revealed by scanning electron microscopy coupled with energy dispersive X-ray spectroscopy. SDS-PAGE analysis of whole-cell proteins of this lead-resistant isolate interestingly demonstrated three lead-induced proteins with molecular mass of 15.7, 16.9 and 32.4 kDa, respectively, when bacterial cells were grown under the stress of 1.4 mM Pb (NO₃)₂. This clearly demonstrated their possible involvement exclusively in lead resistance. A. caviae strain KS-1 also showed tolerance to several other heavy metals, viz. zinc, cadmium, copper and mercury. Therefore, we can employ this TBTC and lead-resistant bacterial isolate for lead bioremediation and also for biomonitoring TBTC from lead and TBTC contaminated environment.

Techniques of DNA-studies on prehispanic ectoparasites (Pulex sp., Pulicidae, Siphonaptera from animal mummies of the Chiribaya Culture, Southern Peru

Directory of Open Access Journals (Sweden)

K Dittmar

2003-01-01

Full Text Available During a paleoparasitological survey of several animal mummies (Cavia aperea f. porcellus and Canis familiaris from Chiribaya Baja, an archaeological site in Southern Peru, an unexpected find was made. In the well preserved fur, large numbers of mummified fleas (Pulex simulans/irritansthat parasitized the animals during life were encountered. Due to the relative recent event of the host mummification and the outstanding preservation of the fleas, an attempt for the retrieval of DNA was made. A DNA extraction and sequencing protocol for archaeological ectoparasitic remains has been established, taking additional studies for tissue and protein preservation into account. Tissue preservation was assessed with transmission electron microscopy and the protein preservation was tested through the racemisation ratios of aspartic acid. Regions of the 28S rDNA gene were successfully amplified and sequenced. Further research perspectives are outlined.

Of Domestic and Wild Guinea Pigs: Studies in Sociophysiology, Domestication, and Social Evolution

Science.gov (United States)

Sachser, Norbert

Among mammals a majority of each individual's daily expectations, motivations, and behaviors are directed to encounters with conspecifics. Therefore the knowledge of the genesis, control, and consequences of social interactions is crucial for understanding their social life. We present here our research on the sociophysiology, domestication, and social evolution of wild (Cavia aperea and Galea musteloides) and domestic (Cavia aperea f. porcellus) guinea pigs, which summarizes general rules for many group-living mammals. It is shown that social interactions have consequences not only for the individuals' reproductive success but also for their degrees of stress and welfare. The way in which individuals interact is controlled not only by the present environment but also by the previous social experiences which they have gathered during their behavioral development. Furthermore, the study of ontogeny does not begin at birth, because prenatal social factors acting on pregnant females can also affect the way in which the offspring will interact when adult. In addition, to understand the genesis of interactions between domesticated animals implies knowledge of the behavioral and physiological changes which occurred during the process of domestication. Finally, understanding the social interactions among individuals of the wild ancestor of the domesticated form requires knowledge of how their behavior patterns were brought about by natural selection during the process of social evolution.

Spirulina chitosan gel induction on healing process of Cavia cobaya post extraction socket

Directory of Open Access Journals (Sweden)

Rostiny Rostiny

2014-03-01

Full Text Available Background: Prominent residual ridge is necessary to gain retention and stabilility for succesful prosthodontic treatment such as removable, fixed or implant. Spirulina is a natural substance that can help tissue healing and chitosan also a natural substance that reported to have the ability to help bone remodelling. The combination gel of spirulina and chitosan could be considered as an alternative material to maintain residual ridge height after tooth extraction. Purpose: The aim of study was to examine the effect of combination gel of Spirulina and chitosan on healing process of Cavia cobaya post tooth extraction socket by counting the amount of osteoclast, osteoblast and colagen as an indicator. Methods: Twenty eight cavia cobaya were divided into 4 groups. Insisive mandible extraction was done and the sockets were filled with 3% CMCNa for control groups, 3% spirulina chitosan 200 mg for group 1, 6% spirulina chitosan 200 mg for group 2, 12% spirulina chitosan 200 mg for group 3. After 30 days, histopathology examination was done by using microscope to count the amount of osteoclast, osteoblast and collagen. Results: Data was analyzed by using Anova and Tukey HSD. For osteoclast, there was no significant different between every groups, while for osteoblast and collagen there was significant different between groups. The results showed that induction of combination gel spirulina chitosan was able to accumulate collagen fiber and resulting faster wound healing. Conclusion: Combination 12% gel spirulina chitosan 200 mg could be used as an alternative material for better bone remodeling after tooth extraction.Latar belakang: Residual ridge yang prominen sangat dibutuhkan untuk mendapatkan retensi dan stabilitas untuk menunjang keberhasilan perawatan di bidang prostodonsia seperti pada kasus removable, fixed atau implant. Tindakan pencabutan gigi dapat merusak jaringan periodontal, sementum dan tulang alveolar yang mengakibatkan resorbsi ridge

Use of a Far-Infrared Active Warming Device in Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Zarndt, Bethany S; Buchta, Jessica N; Garver, Lindsey S; Davidson, Silas A; Rowton, Edgar D; Despain, Kenneth E

2015-11-01

Small mammals have difficulty maintaining body temperature under anesthesia. This hypothermia is a potential detriment not only to the health and comfort of the animal but also to the integrity of any treatment given or data gathered during the anesthetic period. Using an external warming device to assist with temperature regulation can mitigate these effects. In this study, we investigated the ability of an advanced warming device that uses far-infrared (FIR) heating and responds to real-time core temperature monitoring to maintain a normothermic core temperature in guinea pigs. Body temperatures were measured during 30 min of ketamine-xylazine general anesthesia with and without application of the heating device. The loss of core body heat from anesthetized guinea pigs under typical (unwarmed) conditions was significant, and this loss was almost completely mitigated by application of the FIR heating pad. The significant difference between the temperatures of the actively warmed guinea pigs as compared with the control group began as early as 14 min after anesthetic administration, leading to a 2.6 °C difference at 30 min. Loss of core body temperature was not correlated with animals' body weight; however, weight influences the efficiency of FIR warming slightly. These study results show that the FIR heating device accurately controls core body temperature in guinea pigs, therefore potentially alleviating the effects of body heat loss on animal physiology.

Efecto antimicrobiano de Psidium guajava L. contra Salmonella typhymurium en Cavia porcellus L.

OpenAIRE

Pineda Castillo, Carlos Alberto

2013-01-01

La explotación de cobayos es una actividad económica muy difundida en la zona andina del Perú, la cual tiene que sortear una serie de dificultades, siendo la mas importante de todas la salmonelosis. En consecuencia, para remediar dicho problema, sin incrementar los costes de producción, se opto por emplear la medicina alternativa con recursos propios de la zona. Es así, que se probó la actividad antimicrobiana del extracto etanólico de hojas de guayaba (Psidium guajava L.) contra Salmonella e...

Ocular disease in the guinea pig (Cavia porcellus): a survey of 1000 animals.

Science.gov (United States)

Williams, David; Sullivan, Ann

2010-09-01

Anecdotal evidence has suggested that guinea pigs have a high prevalence of ocular lesions. Here we undertook a survey of 1000 guinea pigs from populations of animals kept as laboratory animals, breeding show cavies, animals kept as pets and those from rescue and rehoming centers. Each animal was examined to assess for ocular abnormalities. A full ophthalmic examination was performed on each animal with direct and indirect ophthalmoscopy and with slit lamp biomicroscopy. Measurement of tear production using the Schirmer tear test 1 and intraocular pressure using the Tonopen applanation tonometer after topical anesthesia was undertaken in selected animals. Forty-five percent of animals examined had some ocular abnormality. The majority were lens lesions including 17% with cataract and 21% with subclinical lens abnormalities such as nuclear sclerosis. Other abnormalities included conjunctivitis in 4.7% and keratitis in 3.6%. Lipid deposition in conjunctiva was observed in 2.3% of guinea pigs and ciliary body heterotopic bone formation in 0.8% of animals. This study shows a high proportion of eyes with some degree of abnormality in animals otherwise considered healthy. Information on diseases of the guinea pig eye is important given the use of the species as a laboratory rodent and also the number kept as pets and show animals.

Comparative study of 2 surgical techniques for castration of guinea pigs (Cavia porcellus).

Science.gov (United States)

Guilmette, Josée; Langlois, Isabelle; Hélie, Pierre; El Warrak, Alexander de Oliveira

2015-10-01

The objective of this study was to compare 2 surgical approaches (scrotal or abdominal) for castration of guinea pigs and to investigate post-operative infection rates with either technique. Forty-eight guinea pigs were castrated by scrotal or abdominal technique after being randomly assigned to 1 of 2 groups (n = 24). Individuals were either castrated by an experienced exotic animal surgeon (n = 12) or by an experienced small animal surgeon (n = 12). Surgical wounds were evaluated daily before euthanasia for histological evaluation 2 wks after surgery. Post-operative infection rate was significantly higher in the scrotal group than in the abdominal group, with a higher rate for the experienced small animal surgeon. Castration of guinea pigs with the abdominal technique is significantly faster and has a significantly lower post-operative infection rate than the scrotal technique.

A new karyotype for the genus Cavia from a southern island of Brazil (Rodentia - Caviidae

Directory of Open Access Journals (Sweden)

A. Gava

1998-03-01

Full Text Available Intraspecific karyotype variation in mammal species is very common and often caused by centromeric fusion of acrocentric chromosomes. We describe here a new karyotype 2n = 62 (FN = 112 for the genus Cavia from the Moleques do Sul Islands, of the southern coast of Brazil. We analyzed two male and four female karyotypes that had twenty-four biarmed pairs and six pairs of acrocentric chromosomes. The sexual pair consisted of a metacentric X-chromosome and a large acrocentric Y. C-bands were found in the centromeric and pericentromeric regions of almost all chromosomes, except for some small biarmed and acrocentric ones. Nucleolus organizer regions appeared in two biarmed chromosomes, and G-banding patterns were also seen.RESUMO A variação cariotípica nas espécies de mamíferos é bastante comum e geralmente causada pela fusão de cromossomos acrocêntricos. Foi descrito neste trabalho um novo cariótipo, com 2n = 62 e FN = 112, para o gênero Cavia proveniente das ilhas Moleques do Sul, da costa sul do Brasil. Foram analisados os cariótipos de dois machos e quatro fêmeas que possuiam 24 pares de cromossomos com dois braços e seis pares de acrocêntricos. O par sexual era constituído por um cromossomo X metacêntrico grande e um Y acrocêntrico. As bandas C estavam localizadas nas regiões centroméricas e pericentroméricas da maioria dos cromossomos, com exceção de alguns acrocêntricos e os cromossomos de dois braços menores. As regiões organizadoras de nucléolo ocorreram em dois cromossomos com dois braços e o padrão de bandamento G foi também apresentado.

Lactobacillus caviae sp nov., an obligately heterofermentative bacterium isolated from the oral cavity of a guinea pig (Cavia aperea f. porcellus)

Czech Academy of Sciences Publication Activity Database

Killer, Jiří; Pechar, R.; Švec, P.; Salmonová, H.; Švejstil, R.; Geigerová, M.; Rada, V.; Vlková, E.; Mekadim, Ch.

2017-01-01

Roč. 67, č. 7 (2017), s. 2903-2909 ISSN 1466-5026 R&D Projects: GA ČR GA13-08803S; GA MZe QJ1510338 Institutional support: RVO:67985904 Keywords : Lactobacillus sp. nov. * oral cavity * guinea pig Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.134, year: 2016

Bone morphology of the hind limbs in two caviomorph rodents.

Science.gov (United States)

de Araújo, F A P; Sesoko, N F; Rahal, S C; Teixeira, C R; Müller, T R; Machado, M R F

2013-04-01

In order to evaluate the hind limbs of caviomorph rodents a descriptive analysis of the Cuniculus paca (Linnaeus, 1766) and Hydrochoerus hydrochaeris (Linnaeus, 1766) was performed using anatomical specimens, radiography, computed tomography (CT) and full-coloured prototype models to generate bone anatomy data. The appendicular skeleton of the two largest rodents of Neotropical America was compared with the previously reported anatomical features of Rattus norvegicus (Berkenhout, 1769) and domestic Cavia porcellus (Linnaeus, 1758). The structures were analyzed macroscopically and particular findings of each species reported. Features including the presence of articular fibular projection and lunulae were observed in the stifle joint of all rodents. Imaging aided in anatomical description and, specifically in the identification of bone structures in Cuniculus paca and Hydrochoerus hydrochaeris. The imaging findings were correlated with the anatomical structures observed. The data may be used in future studies comparing these animals to other rodents and mammalian species. © 2012 Blackwell Verlag GmbH.

Distribución y Hospederos de pulgas (Siphonaptera en la Provincia de Ayabaca, Piura - 1999

Directory of Open Access Journals (Sweden)

Edwar J Pozo

2005-10-01

Full Text Available Estudio descriptivo transversal realizado en la provincia de Ayabaca (zona endémica de peste bubónica, departamento de Piura, Perú; con el objetivo de ampliar los conocimientos sobre las especies de pulgas presentes. Fueron colectados 10 152 especimenes de pulgas en 46 localidades pertenecientes a seis distritos de la provincia de Ayabaca (Suyo, Sapillica, Montero, Paimas, Lagunas y Ayabaca, entre los meses de enero a julio de 1999. El muestreo se realizó seleccionando para cada vivienda un mínimo de cinco ropas de cama y cinco cuyes (Cavia porcellus además de la totalidad de los roedores capturados en las viviendas y en el área silvestre. Ocho especies de pulgas fueron identificadas (Pulex irritans, Tiamastus cavicola, Polygenis litargus, Xenopsylla cheopis, Ctenocephalides felis, Craneopsylla minerva, Leptopsylla segnis y Cediopsylla spillmanni de éstas, P. irritans se reportó en todos los distritos muestreados, seguida de X. cheopis y P. litargus, encontradas en cinco de los seis distritos.

Guinea pig for meat production: A systematic review of factors affecting the production, carcass and meat quality.

Science.gov (United States)

Sánchez-Macías, Davinia; Barba-Maggi, Lida; Morales-delaNuez, Antonio; Palmay-Paredes, Julio

2018-09-01

In developing countries, interest in guinea pig farming is growing exponentially because it provides a regular source of high quality animal protein for domestic consumption. Guinea pigs (Cavia porcellus) are prolific animals, grow and are capable of reproduction on a flexible diet, and are adaptable to a wide range of climates. This article mainly reviews findings on guinea pig meat production, including factors affecting raising guinea pigs, carcass and meat quality. We also present some studies that describe biological and pathologic effects on carcass component composition. During the last decades no standard procedure has been established for guinea pig carcass evaluation, which makes very difficult any comparison of results with other studies around the world. Herein we highlight a variety of factors that significantly affect carcass and meat quality. Some of these factors are production systems, environmental and genetic factors, management systems, the diet and health status, age, sex and reproductive management. Copyright © 2018 Elsevier Ltd. All rights reserved.

Hemoglobin affinity in Andean rodents

Directory of Open Access Journals (Sweden)

HRVOJ OSTOJIC

2002-01-01

Full Text Available Blood hemoglobin oxygen affinity (P50 was measured in three Andean species and in the laboratory rat (control, all raised near sea level. Chinchilla lanigera (Molina, 1792 has an altitudinal habitat range from low Andean slopes up to 3000 m., while Chinchilla brevicaudata (Waterhouse, 1848 has an altitudinal range from 3000 to 5000 m. The laboratory type guinea pig, wild type guinea pig (Cavia porcellus, (Waterhouse, 1748, and laboratory rat (Rattus norvegicus were also raised at sea level. The Andean species had high hemoglobin oxygen affinities (low P50 compared with the rat. Chinchilla brevicaudata had a higher affinity than Chinchilla lanigera. The wild type guinea pig had a higher affinity than the laboratory type. As has been shown in other species, this is another example of an inverse correlation between the altitude level and the P50 values. This is the first hemoglobin oxygen affinity study in Chinchilla brevicaudata.

Prokaryotic expression and in vitro functional analysis of IL-1β and MCP-1 from guinea pig.

Science.gov (United States)

Dirisala, Vijaya R; Jeevan, Amminikutty; Ly, Lan H; McMurray, David N

2013-06-01

The Guinea pig (Cavia porcellus) is an excellent animal model for studying human tuberculosis (TB) and also for a number of other infectious and non-infectious diseases. One of the major roadblocks in effective utilization of this animal model is the lack of readily available immunological reagents. In order to address this issue, guinea pig interleukin 1 beta (IL-1β) and monocyte chemoattractant protein-1 (MCP-1) were efficiently cloned and expressed in a prokaryotic expression vector, and the expressed proteins in soluble form from both the genes were confirmed by N-terminal sequencing. The biological activity of recombinant guinea pig IL-1β was demonstrated by its ability to drive proliferation in thymocytes, and the recombinant guinea pig MCP-1 exhibited chemotactic activity for guinea pig resident peritoneal macrophages. These biologically active recombinant guinea pig proteins will facilitate an in-depth understanding of the role they play in the immune responses of the guinea pig to TB and other diseases.

Location of bladder and urethral sphincter motoneurons in the male guinea pig (Cavia porcellus)

NARCIS (Netherlands)

Kuipers, R; Izhar, Z; Gerrits, PO; Miner, W; Holstege, G; Gerrits, Peter O.

2004-01-01

Although the guinea pig is used widely in experimental medical research, including in studies on micturition control, the spinal origin of preganglionic parasympathetic bladder and somatic external urethral sphincter motoneurons is not known. In the male, guinea pig using wheat germ

Studies on vertical transmission of Trichinella spiralis in experimentally infected guinea pigs (Cavia porcellus).

Science.gov (United States)

Riva, Eliana; Fiel, Cesar; Bernat, Gisele; Muchiut, Sebastián; Steffan, Pedro

2017-08-01

An experimental study to enhance knowledge on the capability of Trichenella spiralis to pass from guinea pigs to progeny at different periods of pregnancy or lactation was performed. For this purpose, 18 female adult guinea pigs were inoculated with 100 or 1000 T. spiralis muscle larvae (ML) during early, late gestation and during lactation period. The presence of T. spiralis (ML) in mothers and newborns was studied through enzymatic digestion from muscle samples. ML were observed in 9 of 42 newborn guinea pigs and levels of infection were significantly higher when infections of mothers were done during late gestation (p = 0.0046) with the high infective dose (p = 0.0043). T. spiralis ML were not recovered from any of the newborns from mothers infected in the lactation period. Ten out of 18 infected mothers presented larvae 1 in their mammary glands. Muscle samples from the tongue and the masseter showed the highest larval burdens. These observations confirm previous reports on that ML of T. spiralis are capable to pass through placental tissues to reach and encyst in striated muscle groups of newborn guinea pigs. This study may also reinforce the importance of preventive programs to control trichinellosis in those endemic areas where pregnant women would have high risk of infection.

Hallazgo de Panstrongylus rufotuberculatus (Champion, 1899 (Hemiptera, Reduviidae, Triatominae en ambiente domiciliario en la Región Piura, Perú Intra-domiciliary capture of Panstrongylus rufotuberculatus (Champion, 1899 (Hemiptera, Reduviidae, Triatominae in Piura, Peru

Directory of Open Access Journals (Sweden)

Edgard Marín

2007-09-01

Full Text Available Panstrongylus rufotuberculatus presenta una amplia distribución en América Central y del Sur con un comportamiento de especie silvestre. En el Perú ha sido registrado en Tumbes, Piura y Cuzco, siendo descrito en casas de localidades de este último departamento. En el presente trabajo se documenta evidencia de domiciliación de P. rufotuberculatus en la localidad de Chirinos-La Pareja, Distrito de Suyo, Provincia de Ayabaca, Región Piura, Perú (4º46'S, 79º93'W. Se capturaron 28 especímenes: 3 ninfas II, 4 ninfas III, 2 ninfas IV, 8 ninfas V, 3 machos y 8 hembras, lo que evidencia la existencia de una colonia intradomiciliar en "cuyeros" (criaderos de Cavia porcellus camas y paredes del dormitorio de la vivienda. Exámenes parasitológicos de heces evacuadas espontáneamente fueron negativos a infección natural por Trypanosoma cruzi. A pesar de que se ha reportado la presencia de P. rufotuberculatus en localidades de Tumbes y Piura, es la primera vez que se documenta su tendencia sinantrópica en la Región. La importancia de esta especie y posteriores investigaciones permitirán evaluar su etología y potencial vectorial de trypanosomiasis americana. Se recomienda una cuidadosa actividad de vigilancia entomo-epidemiológica para esta especie y las otras que coexisten simpátricamente, actualmente en esta región del norte de Perú.Panstrongylus rufotuberculatus is widely distributed in Central and South America. In Peru, it has been found in Tumbes, Piura, and Cuzco. The authors report the presence of P. rufotuberculatus in Chirinos-La Pareja, Suyo district, Ayabaca Province, Piura Region, Peru. Twenty-eight specimens were collected in two of 15 dwellings: three 2nd instar, four 3rd instar, two 4th instar, and eight 5th instar nymphs, three male and eight female, in an intra-domiciliary colony of guinea pigs (Cavia porcellus, raised indoors as a source of diet protein and beds and bedroom walls. None of the fecal samples were naturally

Production, characterization, and immobilization of partially purified surfactant-detergent and alkali-thermostable protease from newly isolated Aeromonas caviae.

Science.gov (United States)

Datta, Sumitra; Menon, Gopalakrishnan; Varughese, Bincy

2017-04-21

Proteolytic Aeromonas caviae P-1-1 growing at wide-ranging pH (7.0-11.0) and moderate salinity (0-5% NaCl) was isolated from cattle shed of Thanjavur, India. It produced lipase, gelatinase, and polyhydroxybutyrate. Different culture conditions, incubation time, carbon and nitrogen sources, vitamins, amino acids, surfactants, and metal ions for optimal growth and protease production of P-1-1 were examined. Maximum protease (0.128 U/mL) production was achieved with 1% fructose, 1% yeast extract, 0.1% ammonium sulfate, 3% NaCl, 0.1% CaCl 2  · 2H 2 O, 1% glycine, 0.1% vitamin E, and 0.1% Tween-40 at pH 8.0 after 42 hr of incubation at 37°C. It was active over broad range of pH (7.0-12.0), temperature (15-100°C), and salinity (0-9% NaCl) with optima at pH 10.0, 55°C, and 3% NaCl. It retained 65 and 48% activities at pH 12.0 and 100°C, respectively. Partially purified protease was highly stable (100%) within pH range 7.0-12.0 and salinities of 0-5% NaCl for 48 hr. Cu 2+ , Mn 2+ , Co 2+ , and Ca 2+ did not inhibit its activity. Its stability at extreme pHs, temperatures, and in the presence of surfactants and commercial detergents suggests its possible application in laundry detergents. Partially purified protease was immobilized and reused. This is the first report of alkali-thermotolerant, surfactant-detergent-stable partially purified extracellular protease from A. caviae.

Aspectos histopatológicos e micológicos da infecção experimental de cobaias com Microsporum canis

Directory of Open Access Journals (Sweden)

Josemara Neves Cavalcanti

2002-01-01

Full Text Available Com frequência o dermatófito Microsporum canis está envolvido na etiologia da dermatofitose, podendo ser transmitido para o homem por cães e gatos. Neste estudo foi procedida inoculação experimental de M. canis em cobaias resultando em lesões em 100 % dos animais e o curso clínico consistiu de período de incubação, fase inflamatória e fase de resolução das lesões. O exame histopatológico de biópsias cutâneas revelou presença de infiltrado neutrofílico e edema; acantose, hiperqueratose e espongiose. Estas lesões tornaram-se menos acentuadas no 30.0 dia pós-inoculação. Esporos e hifas de M. canis foram detectadas em cortes histológicos corados com PAS (Ácido Periódico de Schiff. A combinação dos corantes fluorescentes diacetato de fluoresceína (DF e brometo de etídio (BE, possibilitou uma adequada visualização das células fúngicas viáveis e não viáveis com evidenciação de seus caracteres morfológicos. Este modelo experimental representa um valioso instrumento para o estudo da patogênese da infecção por dermatófitos, para a avaliação da eficácia de drogas antifúngicas, podendo também ser utilizado em estudos sobre a imunologia das dermatofitoses e na determinação da morfogênese de dermatófitos.

Biosilicate® Ototoxicity and Vestibulotoxicity evaluation in guinea-pigs Avaliação da ototoxicidade e vestibulotoxicidade do biosilicato® em orelhas de cobaias

Directory of Open Access Journals (Sweden)

Eduardo Tanaka Massuda

2009-10-01

tecido ósseo ou a tecido mole em algumas horas, devido à formação de hidroxicarbonatoapatita em sua superfície de contato quando em contato com fluidos corpóreos. OBJETIVO: O objetivo deste trabalho é avaliar a ototoxicidade e vestibulotoxicidade do Biosilicato em cobaias, para posterior utilização em humanos. MATERIAL E MÉTODO: Trata-se de um estudo clínico e experimental, onde foram realizadas emissões otoacústicas antes e após a colocação de Biosilicato na orelha média de cobaias e realizada microscopia eletrônica de varredura da cóclea, sáculo, utrículo e máculas dos canais semicirculares após 30 e 90 dias para avaliar a oto e vestibulotoxicidade. RESULTADOS: Não houve sinais de oto ou vestibulotoxicidade em nenhum dos grupos relacionados ao Biosilicato. CONCLUSÃO: O Biosilicato é um material seguro para ser usado em ossiculoplastias.

The effect of combined Moringa oleifera and demineralized freeze-dried bovine bone xenograft on the amount of osteoblast and osteoclast in the healing of tooth extraction socket of Cavia cobaya

Directory of Open Access Journals (Sweden)

Rostiny Rostiny

2016-12-01

Full Text Available Background: Alveolar bone has an important role in providing support to teeth and dentures. Loss of support caused by alveolar resorption will cause functional and aesthetic problems. Preservation socket using bone graft is one way to maintain the dimensions of the alveolar bone. Moringa oleifera leaf can increase the activity of bone graft in the formation of new bone. Purpose: This study was aimed to evaluate the effect of combined Moringa oleivera leaf extract and demineralized freeze-dried bovine bone xenograft (DFDBBX towards the formation of osteoblasts and osteoclasts in the tooth extraction sockets of cavia cobaya. Method: This study used 28 cavia cobayas divided into four groups. The combination of Moringa oleifera leaf extract and DFDBBX was inducted into the sockets of lower incisor tooth with certain dose in each group, ointment 1 containing PEG (a mixture of PEG 400 and PEG 4000 for control group, ointment 2 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active subtance consentration of 0.5% for group 1, ointment 3 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active substance concentration of 1% for group 2, and Ointment 4 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active substance consentration of 2% for group 3. paraffin block preparations were made for histopathology examination using hematoxylin eosin staining. Result: The results showed that there were significant differences of the number of osteoblasts and osteoclasts in each treatment group (p <0.05. Conclusion: It can be concluded that the combination of Moringa oleifera leaf extract and DFDBBX at 2% cocentration can increase the number of osteoblasts and decrease osteoclasts in the healing of tooth extraction sockets of cavia cobaya.

Providing Homes For The Homeless - The Viable Alternative

Directory of Open Access Journals (Sweden)

Herbstein, D.

1994-01-01

Full Text Available Guinea pig Cavia porcellus farming for meat production remains a marginalised activity in Cameroon in spite of the advantages this specie offers. With the view to promote its production, a national countrywide survey was carried out in order to evaluate the production systems and constraints. Traditional guinea pig farming appears to be a secondary household activity undertaken by small farmers basically women. The extensive production system which reveals no management practices, integrates very well in the agricultural systems (small livestock, food crops and natural forages production of the western highlands and southern forest zones of Cameroon. Guinea pig productivity remains low due to many constraints such as predation, uncontrolled breeding, inbreeding, poor feeding, negative selection and lack of veterinary care. Nevertheless, guinea pig farming plays an important role in the well being of low income village dwellers as food security, cash savings and socio-cultural values within the populations of South Cameroon. The promotion of its production requires an awareness of animal scientists, development authorities, as well as on station research if improved raising conditions.

COMPARISON OF HEMATOXYLIN AND EOSIN STAINING WITH AND WITHOUT PRE TREATMENT WITH MARCHI’S SOLUTION ON NERVE SAMPLES FOR NERVE DEGENERATION AND REGENERATION STUDIES

Directory of Open Access Journals (Sweden)

Malik Abu Rafee

2017-12-01

Full Text Available The study was conducted on four healthy guinea pigs (Cavia porcellus of either sex in which the nerve was identified and subjected to crush injury with the tip (3mm of a curved hemostatic forceps. 30 days after the injury nerve samples were collected and subjected to Hematoxylin and Eosin staining with or without pretreatment with Marchi’s solution. The routine Hematoxylin and Eosin (H&E stained all neural elements in various intensities of pink and in purple and the degenerative changes were seen as vacuoles ranging from vacuolated foci- containing eosinophilic material and associated with a distorted cell nucleus to larger, multilocular, linear array of compartmentalized digestion chambers supposed to contain myelin debris .The myelin on the other hand appeared as empty zones in H&E staining. Combining Marchi’s and H & E procedures revealed the presence black aggregates/ deposits in the vacuoles and digestion chambers. This method confirmed the presence of degenerated myelin inside the vacuoles and digestion chambers and thus may allow better analysis of nerve damage and regeneration.

Genetic diversity and population structure of the Guinea pig (Cavia porcellus, Rodentia, Caviidae) in Colombia.

Science.gov (United States)

Burgos-Paz, William; Cerón-Muñoz, Mario; Solarte-Portilla, Carlos

2011-10-01

The aim was to establish the genetic diversity and population structure of three guinea pig lines, from seven production zones located in Nariño, southwest Colombia. A total of 384 individuals were genotyped with six microsatellite markers. The measurement of intrapopulation diversity revealed allelic richness ranging from 3.0 to 6.56, and observed heterozygosity (Ho) from 0.33 to 0.60, with a deficit in heterozygous individuals. Although statistically significant (p guinea-pig lines and populations, coincided with the historical and geographical distribution of the populations. Likewise, high genetic identity between improved and native lines was established. An analysis of group probabilistic assignment revealed that each line should not be considered as a genetically homogeneous group. The findings corroborate the absorption of native genetic material into the improved line introduced into Colombia from Peru. It is necessary to establish conservation programs for native-line individuals in Nariño, and control genealogical and production records in order to reduce the inbreeding values in the populations.

Genetic diversity and population structure of the Guinea pig (Cavia porcellus, Rodentia, caviidae in Colombia

Directory of Open Access Journals (Sweden)

William Burgos-Paz

2011-01-01

Full Text Available The aim was to establish the genetic diversity and population structure of three guinea pig lines, from seven production zones located in Nariño, southwest Colombia. A total of 384 individuals were genotyped with six microsatellite markers. The measurement of intrapopulation diversity revealed allelic richness ranging from 3.0 to 6.56, and observed heterozygosity (Ho from 0.33 to 0.60, with a deficit in heterozygous individuals. Although statistically significant (p < 0.05, genetic differentiation between population pairs was found to be low. Genetic distance, as well as clustering of guinea-pig lines and populations, coincided with the historical and geographical distribution of the populations. Likewise, high genetic identity between improved and native lines was established. An analysis of group probabilistic assignment revealed that each line should not be considered as a genetically homogeneous group. The findings corroborate the absorption of native genetic material into the improved line introduced into Colombia from Peru. It is necessary to establish conservation programs for native-line individuals in Nariño, and control genealogical and production records in order to reduce the inbreeding values in the populations.

Combination of Aloe vera and xenograft induction on decreasing of NF-kb of tooth extraction socket preservation in Cavia cobaya

Directory of Open Access Journals (Sweden)

Utari Kresnoadi

2014-03-01

Full Text Available Background: Tooth extraction can naturally cause inflammation triggering osteoclast proliferation and alveolar bone resorption. Preservation of the tooth extraction sockets is needed for patients in order to reduce alveolar bone resorption risks. Aloe vera is known to have anthraquinones components, namely Aloin, Aloe emedin, and barbaloin, considered as anti-inflammation. Therefore, to overcome the inflammation, the role of NF-kb is very significant to decrease nuclear factor kappa b (NF-kb. As a result, inflammation risks will be decreased. Purpose: The study was aimed to determine the induction effect of combination of Aloe vera and XCB into tooth extraction sockets to reduce inflammation by reducing NF-kb expression, osteoclasts and osteoblasts. Methods: Forty-eight Cavia cobaya were divided into eight groups, each group consisted of six animals. The mandibular incisors of those Cavia cobaya were extracted and induced with either PEG, XCB, Aloe vera, or the combination of Aloe vera + XCB. Those animals were sacrificed on day 7 and day 30 after the extraction. Then immunohistochemical and histopathology examinations were conducted to observe NF-kb expression, osteoblasts and osteoclasts. Results: It was known that in group induced with the combination of Aloe vera and xenograft concelous bovine, the growth of osteoblasts was high, while NF-kb expression and osteoclasts reduced. Conclusion: It can be concluded that the induction of the combination of Aloe vera and XCB into the tooth extraction sockets can reduce NF-kb expression and osteoclast, as a result, alveolar bone resorption risks decrease, and osteoblast increase.Latar belakang: Trauma mekanis akibat pencabutan gigi asli menyebabkan keradangan. Keradangan memicu proliferasi osteoklas sehingga menyebabkan resorpsi tulang alveolararis. Pada pembuatan gigi tiruan, resorpsi tulang alveolar yang terjadi, sangat tidak diinginkan, sebab resorpsi tulang alveolar mengurangi keberhasilan

Hypervitaminosis D and Metastatic Calcification in a Colony of Inbred Strain 13 Guinea Pigs, Cavia porcellus.

Science.gov (United States)

Holcombe, H; Parry, N M; Rick, M; Brown, D E; Albers, T M; Refsal, K R; Morris, J; Kelly, R; Marko, S T

2015-07-01

A commercial diet fed to a colony of inbred strain 13 guinea pigs for approximately 6 weeks was subsequently recalled for excessive levels of vitamin D. Twenty-one of 62 animals exhibited clinical signs, including anorexia, lethargy, and poor body condition. Nine affected and 4 clinically normal animals were euthanized for further evaluation, including serum chemistry, urinalysis, and gross and/or histopathology. Macroscopic findings included white discoloration in multiple organs in 8 animals, and microscopic evaluation confirmed multiorgan mineralization in tissues from 7 animals. Serum 25-hydroxyvitamin D levels were elevated in 10 animals. Serum inorganic phosphorus and alkaline phosphatase levels were increased in all exposed animals; however, total calcium and ionized calcium levels were not significantly higher in exposed animals than in control strain 13 guinea pigs from a different institution. The data support a diagnosis of hypervitaminosis D with metastatic calcification. Following the diet recall, the remaining guinea pigs increased their food intake and regained body condition. Diagnostic testing of 8 animals euthanized approximately 3 months after returning to a normal diet demonstrated that serum parathyroid hormone remained significantly lower, and ionized calcium and ionized magnesium were significantly higher, in recovered animals compared to controls and exposed animals. These results indicate that diagnostic tests other than serum calcium are necessary for a diagnosis of hypervitaminosis D in guinea pigs. © The Author(s) 2014.

Pharmacokinetics and Adverse Effects of 3 Sustained-release Buprenorphine Dosages in Healthy Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Zanetti, Andrea S; Putta, Sumanth K; Casebolt, Donald B; Louie, Stan G

2017-11-01

In guinea pigs, studies addressing the efficacy, safety, and pharmacokinetic profiles of different sustained-release buprenorphine (SRB) formulations are still in their infancy. Here we assessed the pharmacokinetic profiles of 3 SRB dosages (SR-LAB, ZooPharm; SRBLow, 0.15 mg/kg; SRBMedium, 0.3 mg/kg; and SRBHigh, 0.6 mg/kg) for 72 h after a single subcutaneous administration to 8 (4 male and 4 female) healthy guinea pigs. Body weight, fecal output, and cortisol levels were also monitored and the results compared with those of the sham group. Within the first h after administration, the maximal plasma concentration (Cmax) of the drug was 64.3 ± 9.2 ng/mL (males) and 71.3 ± 3.7 ng/mL (females) in the SRBHigh group; 11.5 ± 3.2 ng/mL (males) and 6.9 ± 0.9 ng/mL (females) in the SRBMedium group; and 2.3 ± 0.8 ng/mL (males) and 2.0 ± 0.5 ng/mL (females) in the SRBLow group. After 72 h, therapeutic levels of the drug (>1 ng/mL) were observed only in guinea pigs treated with SRBHigh (both sexes) and males treated with SRBMediu cm. Fecal output (quantity and distribution) and body weight were significantly lower in the SRB groups as compared with the sham group, and with the SRBHigh group showing larger reductions. Baseline levels of serum cortisol in healthy females (1440 ± 106 ng/mL) were significantly greater than in males (550 ± 66 ng/mL). But, independent of the sex, SRB administration significantly reduced those levels. In conclusion, the data indicate that all 3 SRB dosages can be safely used in guinea pigs. However, therapeutic levels of the drug were observed for at least 48 h only guinea pigs treated with SRBHigh and SRBMedium. Further investigation is needed to determine if these dosages can alleviate pain in guinea pigs.

Enriched open field facilitates exercise and social interaction in 2 strains of guinea pigs (Cavia porcellus).

Science.gov (United States)

Brewer, Jacob S; Bellinger, Seanceray A; Joshi, Prianca; Kleven, Gale A

2014-07-01

Current housing guidelines for laboratory rodents include recommendations for enrichment. Working with guinea pigs, we have developed an open-field enrichment paradigm that provides several aspects of this species' natural environment. These naturalistic aspects include access to increased space for exploration, access to western timothy (Phleum pratense L.) hay, and grouping as a herd to facilitate social interaction. To determine the immediate effect on behavior from access to the enriched environment, female guinea pigs from 2 strains, IAF Hairless and NIH Hartley, were observed in both standard home cages and an open-field enriched environment. Subjects were housed with cagemates in pairs for the home-cage observation and were grouped as a herd when in the open-field arena. Behaviors were videorecorded for 1 h and then scored. Salivary cortisol levels were measured both prior to and immediately after behavioral observations. Analyses revealed higher levels of activity and social interaction in the open-field arena compared with the home cage, with no significant change in salivary cortisol levels. These results suggest that exposure to the open-field environment provide increased opportunities for exercise and social enrichment. Although additional studies are needed to determine long-term effects on experimental outcomes, the open-field configuration holds promise as a laboratory enrichment paradigm for guinea pigs.

Genetic diversity and structure of domestic cavy (Cavia porcellus populations from smallholder farms in southern Cameroon

Directory of Open Access Journals (Sweden)

Basengere Ayagirwe

2017-09-01

Full Text Available Although domestic cavies are widely used in sub-Saharan Africa as a source of meat and income, there are only a few studies of their population structure and genetic relatedness. This seminal study was designed with the main objective to assess the genetic diversity and determine the population structure of cavy populations from Cameroon to guide the development of a cavy improvement program. Sixteen microsatellite markers were used to genotype 109 individuals from five cavy populations (Wouri, Moungo and Nkongsamba in the Littoral region, and Mémé and Fako in the Southwest region of Cameroon. Twelve markers worked in the five populations with a total of 17 alleles identified, with a range of 2.9 to 4.0 alleles per locus. Observed heterozygosity (from 0.022 to 0.277 among populations was lower than expected heterozygosity (from 0.42 to 0.54. Inbreeding rates between individuals of the populations and between individuals in each population were 59.3% and 57.2%, respectively, against a moderate differentiation rate of 4.9%. All the tested loci deviated from Hardy-Weinberg equilibrium, except for locus 3. Genetic distances between populations were small (from 0.008 to 0.277, with a high rate of variability among individuals within each population (54.4%. Three distinct genetic groups were structured. This study has shown that microsatellites are useful for the genetic characterization of cavy populations in Cameroon and that the populations investigated have sufficient genetic diversity that can be used to be deployed as a basis for weight, prolificacy and disease resistance improvement. The genetic of diversity in Southern Cameroon is wide and constitute an opportunity for cavy breeding program.

Is a wild mammal kept and reared in captivity still a wild animal?

Science.gov (United States)

Künzl, Christine; Kaiser, Sylvia; Meier, Edda; Sachser, Norbert

2003-01-01

This study compared domestic guinea pigs (Cavia aperea f. porcellus; DGP) and two different populations of the wild cavy (Cavia aperea), its ancestor, to examine whether rearing of wild mammals in captivity affects their behavior and physiological stress responses. One population of wild cavies consisted of wild-trapped animals and their first laboratory-reared offspring (WGP-1). The animals of the other population were reared in captivity for about 30 generations (WGP-30). The spontaneous behavior of each of six groups of WGP-1 and WGP-30 and nine groups of DGP, each consisting of one adult male and two adult females, was analyzed quantitatively. Blood samples of the males were taken to determine cortisol, epinephrine, and norepinephrine concentrations. In addition, the exploratory behavior of 60-day-old male WGP-1, WGP-30, and DGP was investigated in an exploration apparatus. The domesticated animals displayed significantly less aggression, but significantly more sociopositive and male courtship behavior than their wild ancestors. In addition, DGP were much less attentive to their physical environment. Surprisingly, no behavioral difference was found between WGP-1 and WGP-30. Basal cortisol concentrations did not differ between wild and domestic guinea pigs. Catecholamine concentrations, however, as well as the challenge values of cortisol, were distinctly reduced in the DGP. WGP-1 and WGP-30 did not differ with respect to their endocrine stress responses. In the exploration apparatus both forms of wild cavies were much more explorative than the domestic animals. These data suggest that the long-term breeding and rearing of wild guinea pigs in captivity do not result in significant changes in behavior and hormonal stress responses. It appears to take much longer periods of time and artificial selection by humans to bring about characters of domestication in wild animals.

Le mini-élevage, son développement villageoiset l'action de BEDIM

Directory of Open Access Journals (Sweden)

Jacques Hardouin

1997-01-01

Full Text Available Minilivestock, village development and the role of BEDIM.Minilivestock encompasses all animals of small site, and little-known in terras of production but usable as food, feed or revenues if not eaten. Sustainable breeding becomes possible, and should progressively replace uncontrolled gathering in the wild. Amongst vertebrates, an important meat supply is based on edible rodents like Thryonomys, Cricetomys, Xerus, Atherurus, Tenrec; Hydrochoerus, Dasyprocta, Myocastor, Capromys, Dolichotis, Agouti, etc. The saine applies to the guinea-pig Cavia porcellus and to frogs. Invertebrates farming is also practised through breeding of maggots, termites, butterflies (pupae and adults for consumption or sale; giant snails are also highly appreciated in many African countries. Minilivestock development is usually a back-yard activity, hence its interest as it relies on local species, substrates and raw materials for infrastructure. The demand for minilivestock product is high but there is still reluctance often from the official authorities, unfortunately. However minilivestock is not an utopia, and a country like Papua-New-Guinea, which bas officially adopted minilivestock production as a tool to help to develop remote villages, is an excellent example of success

Investigation Into the Humaneness of Slaughter Methods for Guinea Pigs (Cavia porcelus) in the Andean Region.

Science.gov (United States)

Limon, Georgina; Gonzales-Gustavson, Eloy A; Gibson, Troy J

2016-01-01

Guinea pigs (Cavia porcelus) are an important source of nonhuman animal protein in the Andean region of South America. Specific guidelines regarding the welfare of guinea pigs before and during slaughter have yet to be developed. This study critically assessed the humaneness of 4 different stunning/slaughter methods for guinea pigs: cervical neck dislocation (n = 60), electrical head-only stunning (n = 83), carbon dioxide (CO2) stunning (n = 21), and penetrating captive bolt (n = 10). Following cervical neck dislocation, 97% of guinea pigs had at least 1 behavioral or cranial/spinal response. Six percent of guinea pigs were classified as mis-stunned after electrical stunning, and 1% were classified as mis-stunned after captive bolt. Increased respiratory effort was observed during CO2 stunning. Apart from this finding, there were no other obvious behavioral responses that could be associated with suffering. Of the methods assessed, captive bolt was deemed the most humane, effective, and practical method of stunning guinea pigs. Cervical neck dislocation should not be recommended as a slaughter method for guinea pigs.

Anatomie a histologie zubů morčete domácího (Cavia aperea f. porcellus)

Czech Academy of Sciences Publication Activity Database

Mináriková, A.; Buchtová, Marcela; Jekl, V.

2017-01-01

Roč. 14, č. 4 (2017), s. 175-179 ISSN 1214-6080 R&D Projects: GA ČR(CZ) GA17-14886S Institutional support: RVO:67985904 Keywords : guinea pigs * dentition Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science

An Investigation into the Relationship between Owner Knowledge, Diet, and Dental Disease in Guinea Pigs (Cavia porcellus

Directory of Open Access Journals (Sweden)

Rosemary Norman

2016-11-01

Full Text Available Recent studies have highlighted a high prevalence of dental disease in domestic guinea pigs, yet the aetiology of this multi-factorial disease is still unclear. Factors that have been associated with dental disease include feeding a diet that is high in energy but low in fibre, feeding an insufficiently abrasive diet, a lack of dietary calcium, and genetics. As many of these factors relate to the husbandry requirements of guinea pigs, owner awareness of dietary requirements is of the utmost importance. An online questionnaire was created based on previous research into the husbandry and feeding of rabbits. Guinea pig owners were asked to answer questions on the clinical history of their animals and their diet and management. In total, 150 surveys were completed for 344 guinea pigs, where owners of multiple animals could complete the survey for individuals. According to the owners, 6.7% of guinea pigs had been clinically diagnosed with dental disease, but 16.6% had signs consistent with dental disease. The specific clinical signs of having difficulty eating (Exp(B = 33.927, Nagelkerke R 2 = 0.301, p < 0.05 and producing fewer or smaller faecal droppings (Exp(B = 13.733, Nagelkerke R 2 = 0.149, p < 0.05 were predictive for the presence of dental disease. Having access to an outside environment, including the use of runs on both concrete and grass, was significantly related to not displaying clinical signs of dental disease (Exp(B = 1.894, Nagelkerke R 2 = 0.021, p < 0.05. There was no significant relationship between owner knowledge, guinea pig diet, and dental disease in the study population. This study highlights the importance of access to the outdoors for the health and welfare of guinea pigs in addition to the need for owners to be alert to key clinical signs. A relationship between diet and dental disease was not identified in this study; however, the underlying aetiological causes of this condition require further investigation.

Effect of chest wall radiotherapy in different manners using tissue equivalent bolus on skin and lung of cavia cobayas

International Nuclear Information System (INIS)

Huang Wei; Qu Yaqin; Song Xiangfu; Liu Shixin; Jia Xiaojing; Guo He; Yang Lei

2009-01-01

Objective: To probe the influence of electron beam radiotherapy in different manners using different tissue equivalent boluses on skin and lung. Methods: Adult female cavia cobayas were randomly divided into four groups as control group, half-time with bolus group, half-time with bolus group and without bolus group. Acute-irradiation animal models were established using electron beam in different manners with or without 0.5 cm tissue equivalent bolus. Pathological changes in lung, hair vesicle and fibroblast cell count were analyzed 40 clays after irradiation. Results: The radiation dermatitis in the group with bolus was slighter than that of the group without bolus, but the radiation pneumonia was reverse. With bolus, the radiation dermatitis of haft-time group was slighter than that of full-time group. The injury repair of half-time group was more active than full-time group. Conclusions: The treatment of haft-time bolus could protect lung without serious skin complications. (authors)

Study on postpartum estrus of guinea pigs (Cavia cobaya using Anredera cordifolia leaf extract

Directory of Open Access Journals (Sweden)

D. Wijayanti

2017-04-01

Full Text Available Aim: The purpose of this study was to determine the postpartum estrus cycle of guinea pigs (Cavia cobaya using Anredera cordifolia leaf extract. Materials and Methods: Materials used were 8 males and 8 females of C. cobaya with body weight ranged 400-450 g. Mating ratio applied was 1:1. Treatments given were 0, 10, 50 and 90 mg of A. cordifolia leaf extract/head, designated as T0, T1, T2 and T3, respectively. Two females were subjected for each treatment. A. cordifolia leaf extract was administered orally from 10 days prepartum to 10 days postpartum. Observation of mating behavior, vulva morphology, and vaginal smear preparation was done in the afternoon for 10 days subsequence postpartum. Data were analyzed by univariate method and descriptively. Results: The results showed that the addition of A. cordifolia leaf extract 50 mg orally could accelerate the time of postpartum estrus based on the average frequency of mating behavior consisting of behavioral approach, allow the buck to sniffing her, mating positions, standing heat, lordosis position, and copulation. During estrus, vulva morphology was red color, had much mucus and no thin membrane covering vagina. There were a lot of superficial cells on vagina. Conclusion: The best treatment to accelerate occurring postpartum estrus was the addition of A. cordifolia leaf extract as many as 50 mg/head weight (T2 orally.

Acute and latent infection by bovine herpesvirus type 2 in a guinea pig model.

Science.gov (United States)

Torres, Fabrício Dias; Cargnelutti, Juliana Felipetto; Masuda, Eduardo Kenji; Weiblen, Rudi; Flores, Eduardo Furtado

2010-02-01

Bovine herpetic mammillits is a self-limiting cutaneous disease of the udder and teats of cows associated with bovine herpesvirus 2 (BoHV-2) whose pathogenesis is poorly understood. This article describes the use of guinea pigs (Cavia porcellus) to study the pathogenesis of BoHV-2 infection. Twelve weanling female guinea pigs inoculated subcutaneously with BoHV-2 in the genitalia and teats developed local hyperemia, edema, vesicles, ulcers and scabs. Infectious virus was recovered between days 3 and 7 post-infection (pi) from the genital area (9/12) and teats (1/12); and all inoculated animals seroconverted (virus-neutralizing titers of 16-128). Histological examination of lesions revealed lymphoplasmacytic perivascular infiltrates and intranuclear inclusion bodies in keratinocytes. PCR examination of tissues collected at day 35 pi detected latent viral DNA predominantly in lumbosacral spinal segments. In another experiment, eight females inoculated with BoHV-2 in the genitalia and treated with dexamethasone (Dx) at day 35 pi developed mild to moderate local signs, yet no virus could be recovered from lesions. PCR examination of spinal segments from these animals confirmed the presence of latent viral DNA. These results demonstrate that guinea pigs are susceptible to BoHV-2 infection and therefore may be used to study selected aspects of BoHV-2 biology.

Risk Prioritization Tool to Identify the Public Health Risks of Wildlife Trade: The Case of Rodents from Latin America.

Science.gov (United States)

Bueno, I; Smith, K M; Sampedro, F; Machalaba, C C; Karesh, W B; Travis, D A

2016-06-01

Wildlife trade (both formal and informal) is a potential driver of disease introduction and emergence. Legislative proposals aim to prevent these risks by banning wildlife imports, and creating 'white lists' of species that are cleared for importation. These approaches pose economic harm to the pet industry, and place substantial burden on importers and/or federal agencies to provide proof of low risk for importation of individual species. As a feasibility study, a risk prioritization tool was developed to rank the pathogens found in rodent species imported from Latin America into the United States with the highest risk of zoonotic consequence in the United States. Four formally traded species and 16 zoonotic pathogens were identified. Risk scores were based on the likelihood of pathogen release and human exposure, and the severity of the disease (consequences). Based on the methodology applied, three pathogens (Mycobacterium microti, Giardia spp. and Francisella tularensis) in one species (Cavia porcellus) were ranked as highest concern. The goal of this study was to present a methodological approach by which preliminary management resources can be allocated to the identified high-concern pathogen-species combinations when warranted. This tool can be expanded to other taxa and geographic locations to inform policy surrounding the wildlife trade. © 2015 Blackwell Verlag GmbH.

The influence of Aloe vera and xenograft XCB toward of bone morpho protein 2 BMP2 expression and amount of osteoblast of alveolar bone induced into tooth extraction sockets Cavia cobaya

Directory of Open Access Journals (Sweden)

Utari Kresnoadi

2014-12-01

Full Text Available Tooth extraction can cause inflammation leading to alveolar ridge resorption. In addition, prominent ridge has crucial role for making denture su-ccessfully. Thus, socket preservation is needed to prevent greater alveolar ridge resorption. An innovative material, a combination of Aloe vera and xe-nograft (XCB, is then considered as a biogenic stimulator that can reduce inflammation, as a result, the growth of alveolar bone is expected to be impro-ved. This research is aimed to prove whether the mixture of Aloe vera and xenograft can stimulate BMP2 and increase osteoblasts. Forty-eight Cavia co-baya animals were divided into eight groups each of which consisted of six animals. The mandibular incisors of those Cavia cobaya animals were then extracted and filled with PEG as Group Control, XCB as Group XCB, Aloe vera as Group Aloe vera, and a combination of Aloe vera +XCB as Group Aloe vera +XCB. Next, the first four groups were sacrificed seven days after extraction, and the second four groups were sacrificed 30 days after extrac-tion. And then, immunohistochemical and histopathology examinations were conducted to examine BMP2 expression and osteoblasts. Based on the re-sult known that the mixture of Aloe vera and xenograft can increase BMP2 expression and amount of osteoblasts. It can be concluded that the mixture of Aloe vera and xenograft can increase BMP2 expression and amount of osteoblast cel . It can be used as an alternative material to increase the growth of alveolar bone after extraction.

Isolation and identification of Caviibacter abscessus from cervical abscesses in a series of pet guinea pigs (Cavia porcellus).

Science.gov (United States)

Bemis, David A; Johnson, Brian H; Bryant, Mary Jean; Jones, Rebekah D; McCleery, Brynn V; Greenacre, Cheryl B; Perreten, Vincent; Kania, Stephen A

2016-11-01

An organism reported in the early literature to be a rare cause of cervical lymphadenitis in guinea pigs, Streptobacillus moniliformis, has been reclassified as Caviibacter abscessus We describe a series of sequential cases of abscesses in guinea pigs that were presented to our clinic from which the only agent isolated was a unique, serum-requiring bacterium. Discrete colonies were not detected in 6.5% CO 2 or anaerobically on routine primary isolation media containing up to 5% whole sheep blood, with and without cysteine, vitamin K, and hemin supplementation after 7 days of incubation at 37°C. Based on subsequently determined growth requirements, the organisms were best described as serum-requiring, aerotolerant anaerobes. Colonies were detectable within 24 h at 37°C in an anaerobic atmosphere on a mycoplasma agar-based medium containing 10% pig serum and reached 3 mm in diameter within 3-5 days. Microscopic appearance consisted of small gram-negative rods and coccobacilli with occasional filaments. However, in direct smears from clinical specimens and from weak or dysgonic growth on plates incubated under suboptimal growth conditions (e.g., in 6.5% CO 2 ), irregular rods with occasional small bulbous forms or numerous long wavy filaments were observed. All of the isolates generated unique spectral profiles similar to that of C. abscessus when examined by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry. Phylogenetic analysis of partial 16S rRNA gene sequences showed that the isolates were identical to each other and shared 99.9% sequence identity with C. abscessus. © 2016 The Author(s).

Molecular cloning, sequence identification and expression profile of domestic guinea pig (Cavia porcellus UGT1A1 gene

Directory of Open Access Journals (Sweden)

Yang Deming

2016-01-01

Full Text Available Domestic guinea pig is a model animal for human disease research. Uridine diphosphate glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1 is an important human disease-related gene. In this study, the complete coding sequence of domestic guinea pig gene UGT1A1 was amplified by reverse transcription-polymerase chain reaction. The open reading frame of the domestic guinea pig UGT1A1 gene is 1602 bp in length and was found to encode a protein of 533 amino acids. Sequence analysis revealed that the UGT1A1 protein of domestic guinea pig shared high homology with the UGT1A1 proteins of degu (84%, damara mole-rat (84%, human (80%, northern white-cheeked gibbon (80%, Colobus angolensis palliatus (80% and golden snub-nosed monkey (79%. This gene contains five exons and four introns, as revealed by the computer-assisted analysis. The results also showed that the domestic guinea pig UGT1A1 gene had a close genetic relationship with the UGT1A1 gene of degu. The prediction of transmembrane helices showed that domestic guinea pig UGT1A1 might be a transmembrane protein. Expression profile analysis indicated that the domestic guinea pig UGT1A1 gene was differentially expressed in detected domestic guinea pig tissues. Our experiment laid a primary foundation for using the domestic guinea pig as a model animal to study the UGT1A1-related human diseases.

Evaluation of pathogenic potential of Rickettsia amblyommii in guinea pigs (Cavia porcellus) and protective immunity against Rickettsia rickettsii

International Nuclear Information System (INIS)

Rivas Mejias, Juan Jose

2014-01-01

The pathogenic potential of R. amblyommii 9-CC-3-1 is evaluated in guinea pigs, through measurements of temperature, weight and behavioral observations; also, the detection of bacteria in different organs. The protective immunity that this bacterium can offer in guinea pigs is evaluated, against a subsequent infection with pathogenic strain of R. rickettsii NRH-2010. The production of specific IgG antibodies, mild disease and the presence of the bacterium to testicular level in guinea pigs is evidenced, before experimental infection, with isolation of R. amblyommii 9-CC-3-1, indicating mild or localized infection and production of response immune against R. amblyommii. Immuno protection offered by the strain R. rickettsii NRH-2010 is evidenced to a subsequent infection of a pathogenic strain of R. rickettsii NRH-2010. The decrease of symptoms and severity of the disease has been evident; but, without prevent infection caused by R. rickettsii in guinea pigs. The tropism of R. amblyommii 9-CC-3-1 has been, possibly, a causative agent of infection and clinical pictures by spotted fevers [es

Research on contraception: opinion of researchers, subjects and advocates of women rights

OpenAIRE

Hardy, Ellen; Bento, Silvana Ferreira; Osis, Maria José Duarte; Hebling, Eliana Maria

2004-01-01

OBJETIVO: Conhecer a opinião de pesquisadores, de mulheres - sujeitos de pesquisa, e de defensoras dos direitos das mulheres sobre o significado de "pesquisa" e "cobaia". MÉTODOS: Pesquisadores (11), mulheres (18) e defensoras (10) foram entrevistados. O estudo foi qualitativo e a análise dos dados foi temática. RESULTADOS: Os participantes tiveram dificuldade em explicar o que é pesquisa; alguns não conseguiram. Para pesquisadores e maioria das mulheres, sujeitos de pesquisa não são cobaias,...

Efeito da oxigenação hiperbárica em lesão ototóxica produzida pela amicacina em cobaias The effects of hyperbaric oxygen therapy upon ototoxic injuries produced by amikacin in guinea pigs

Directory of Open Access Journals (Sweden)

Luciana de Albuquerque Salviano Amora

2013-06-01

Full Text Available A oxigenação hiperbárica têm favorecido a prevenção e o tratamento de afecções auditivas como a ototoxicidade. OBJETIVO: Estudar os efeitos da oxigenação hiperbárica em lesão ototóxica promovida pela amicacina. Forma de estudo: Experimental. MÉTODO: Avaliados aspectos funcionais de 12 cobaias albinas por meio das emissões otoacústicas produtos de distorção e do potencial evocado auditivo de tronco encefálico, antes e após o uso de amicacina (600 mg/kg/dia e das sessões com oxigenação hiperbárica (2 ATA, 60 minutos. Aspectos morfológicos foram avaliados por meio de microscopia eletrônica de varredura. Grupos de estudo com três animais: grupo 1 - solução salina + oxigenação hiperbárica; grupo 2 - amicacina 8 dias; grupo 3 - amicacina + 7 dias de repouso e grupo 4 - amicacina + oxigenação hiperbárica. RESULTADOS: Grupo 1 apresentou preservação da funcionalidade e da morfologia durante todo experimento. Grupo 2 demonstrou, ao final do experimento, lesões estatisticamente significantes das células ciliadas com alterações funcionais. Grupos 3 e 4 apresentaram alterações estatisticamente significantes dos aspectos funcionais e morfológicos após o uso da amicacina, mantendo estas alterações após os procedimentos propostos. CONCLUSÃO: A oxigenação hiperbárica não promoveu alterações na morfologia das células ciliadas da cóclea e aos limiares eletrofisiológicos das cobaias submetidas à amicacina.Hyperbaric oxygen therapy (HBOT has enhanced the prevention and treatment of auditory ailments such as ototoxicity. OBJECTIVE: To study the effects of HBOT upon ototoxic injuries produced by amikacin. METHOD: This experimental study included 12 albino guinea pigs, whose auditory function was assessed through distortion product otoacoustic emissions (DPOAEs and brainstem auditory evoked potentials (BAEPs before and after the administration of amikacin (600 mg/kg/day and HBOT sessions (2 ATA, 60 minutes

Pesquisa em contracepção: opinião de pesquisadores, sujeitos e defensoras dos direitos das mulheres Research on contraception: opinion of researchers, subjects and advocates of women rights

Directory of Open Access Journals (Sweden)

Ellen Hardy

2004-12-01

Full Text Available OBJETIVO: Conhecer a opinião de pesquisadores, de mulheres - sujeitos de pesquisa, e de defensoras dos direitos das mulheres sobre o significado de "pesquisa" e "cobaia". MÉTODOS: Pesquisadores (11, mulheres (18 e defensoras (10 foram entrevistados. O estudo foi qualitativo e a análise dos dados foi temática. RESULTADOS: Os participantes tiveram dificuldade em explicar o que é pesquisa; alguns não conseguiram. Para pesquisadores e maioria das mulheres, sujeitos de pesquisa não são cobaias, porque têm liberdade de escolha. Para a maioria das defensoras, sujeitos são cobaias, ainda que consintam em participar de um estudo. CONCLUSÕES: Foi surpreendente a dificuldade dos pesquisadores em explicar o que é pesquisa. As diferentes opiniões sobre o termo "cobaia" refletem a controvérsia sobre seu significado em pesquisa. Seguramente o termo "cobaia" não se aplica à maior parte dos estudos realizados hoje no Brasil, mas os diferentes significados identificados servem para alertar os pesquisadores a prestar atenção aos aspectos éticos de seus estudos.OBJECTIVE: To survey the opinion of researchers, women - subjects of research- and of advocates of women's rights about the meaning of "research" and "guinea pigs". Methods: Researchers (11, women (18 and advocates (10 were interviewed. The study was qualitative and a thematic analysis was carried out. RESULTS: Participants experienced difficulty to explain what research meant and some were unable to do so. For the researchers and most of the women, subjects are not guinea pigs, because they have freedom of choice. Most of the advocates, however, said that subjects are guinea pigs, even when they consent to participate in a study. CONCLUSIONS: The difficulty experienced by researchers when explaining the meaning of research was surprising. The different opinions about "guinea pig" reflect the controversy about its meaning in research. Certainly the expression "guinea pig" does not apply to

Genetic structure and inter-generic relationship of closed colony of laboratory rodents based on RAPD markers.

Science.gov (United States)

Kumar, Mahadeo; Kumar, Sharad

2014-11-01

Molecular genetic analysis was performed using random amplified polymorphic DNA (RAPD) on three commonly used laboratory bred rodent genera viz. mouse (Mus musculus), rat (Rattus norvegicus) and guinea pig (Cavia porcellus) as sampled from the breeding colony maintained at the Animal Facility, CSIR-Indian Institute of Toxicology Research, Lucknow. In this study, 60 samples, 20 from each genus, were analyzed for evaluation of genetic structure of rodent stocks based on polymorphic bands using RAPD markers. Thirty five random primers were assessed for RAPD analysis. Out of 35, only 20 primers generated a total of 56.88% polymorphic bands among mice, rats and guinea pigs. The results revealed significantly variant and distinct fingerprint patterns specific to each of the genus. Within-genera analysis, the highest (89.0%) amount of genetic homogeneity was observed in mice samples and the least (79.3%) were observed in guinea pig samples. The amount of genetic homogeneity was observed very high within all genera. The average genetic diversity index observed was low (0.045) for mice and high (0.094) for guinea pigs. The inter-generic distances were maximum (0.8775) between mice and guinea pigs; and the minimum (0.5143) between rats and mice. The study proved that the RAPD markers are useful as genetic markers for assessment of genetic structure as well as inter-generic variability assessments.

EVALUATION in vitro OF THE ACTION OF Lactobacillus plantarum WITH PROBIOTIC CHARACTERISTICS ON Yersinia pseudotuberculosis

Directory of Open Access Journals (Sweden)

Henry Jurado-Gámez

2014-12-01

Full Text Available With the objective to check the potential probiotic of Lactobacillus plantarum on one of themost frequent diseases in guinea pig (Cavia porcellus caused by Yersinia pseudotuberculosis, tests were conducted of inhibition and comparisonin front of antibiotics, showing favorable results, the inhibitt othe pathogenic bacterium. It valued by HPLC the possible peptides produced by L. plantarum, characterizing an presence of two peptides. Tests were performed for the selection of lactic bacteria which showed the following profile: catalase-negative, not producer of gas, resistant to bile salts (0, 5%, 1%, 2% and 3%, pH (2,5, 3,5 and 7,6 and temperature of 38 at 45°C. Also determined the characteristics of the kinetics of fermentation, using two mediums, where it is evaluated CFU/ mL, pH, consumption of total sugars (mg/L and production of lactic acid (%; Lactobacillus plantarum reached the exponential phase of growth in the mediums MRS and Pro, at the 12 and 14:24 hours, with values of 7,0x1011 UFC/mL and 5,0x1013 UFC/mL, respectively. A design of blocks was applied at random with two treatments and eleven blocks, the result allowed to determine that it doesn’t exist significant statistical differences (P>0,05 between the proposed means, but if between the hours of evaluation (P <0,05.

Wild Rodents as Experimental Intermediate Hosts of Lagochilascaris minor Leiper, 1909

Directory of Open Access Journals (Sweden)

Julieta Machado Paçô

1999-07-01

Full Text Available A total of 25 specimens of Cavia porcellus (guinea pig, 5 Dasyprocta agouti (agouti, and 22 Calomys callosus (vesper mice were inoculated with infective eggs of Lagochilascaris minor. The inoculum was prepared with embryonated eggs and orally administered to each individual animal through an esophagus probe. In parallel, 100 specimens of Felis catus domesticus were individually fed with 55-70 nodules containing 3rd-stage larvae encysted in tissues of infected rodents. Animals were examined and necropsied at different time intervals. The migration and encystment of L3 larva was observed in viscera, skeletal muscle, adipose and subcutaneous tissues from all rodents. Adult worms localized at abscesses in the cervical region, rhino, and oropharynx were recovered from domestic cats inoculated with infected rodent tissues. Through this study we can conclude that: (1 wild rodents act as intermediate hosts, characterizing this ascarid heteroxenic cycle; (2 in natural conditions rodents could possibly act as either intermediate hosts or paratenic hosts of Lagochilascaris minor; (3 despite the occurrence of an auto-infecting cycle, in prime-infection of felines (definite hosts the cycle is only completed when intermediate hosts are provided; and (4 in the wild, rodents could serve as a source of infection for humans as they are frequently used as food in regions with the highest incidence of human lagochilascariasis.

Development of a novel, guinea pig-specific IFN-γ ELISPOT assay and characterization of guinea pig cytomegalovirus GP83-specific cellular immune responses following immunization with a modified vaccinia virus Ankara (MVA)-vectored GP83 vaccine.

Science.gov (United States)

Gillis, Peter A; Hernandez-Alvarado, Nelmary; Gnanandarajah, Josephine S; Wussow, Felix; Diamond, Don J; Schleiss, Mark R

2014-06-30

The guinea pig (Cavia porcellus) provides a useful animal model for studying the pathogenesis of many infectious diseases, and for preclinical evaluation of vaccines. However, guinea pig models are limited by the lack of immunological reagents required for characterization and quantification of antigen-specific T cell responses. To address this deficiency, an enzyme-linked immunospot (ELISPOT) assay for guinea pig interferon (IFN)-γ was developed to measure antigen/epitope-specific T cell responses to guinea pig cytomegalovirus (GPCMV) vaccines. Using splenocytes harvested from animals vaccinated with a modified vaccinia virus Ankara (MVA) vector encoding the GPCMV GP83 (homolog of human CMV pp65 [gpUL83]) protein, we were able to enumerate and map antigen-specific responses, both in vaccinated as well as GPCMV-infected animals, using a panel of GP83-specific peptides. Several potential immunodominant GP83-specific peptides were identified, including one epitope, LGIVHFFDN, that was noted in all guinea pigs that had a detectable CD8+ response to GP83. Development of a guinea pig IFN-γ ELISPOT should be useful in characterization of additional T cell-specific responses to GPCMV, as well as other pathogens. This information in turn can help focus future experimental evaluation of immunization strategies, both for GPCMV as well as for other vaccine-preventable illnesses studied in the guinea pig model. Copyright © 2014 Elsevier Ltd. All rights reserved.

Sex-specific impact of prenatal stress on growth and reproductive parameters of guinea pigs.

Science.gov (United States)

Schöpper, Hanna; Klaus, Teresa; Palme, Rupert; Ruf, Thomas; Huber, Susanne

2012-12-01

Body condition and reproductive maturation are parameters of reproductive success that are influenced by sexual hormones rising in the circulation during the time of puberty. Various endocrine systems can be programmed by conditions experienced during early life. Stress for instance is supposed to be capable of influencing fetal development, leading to adjustments of offspring's later physiology. We examined whether prenatal stress (induced by exposure to strobe light) during early- to mid-gestation was capable of affecting later reproductive parameters in guinea pigs (Cavia aperea f. porcellus). Therefore, we measured the levels of testosterone and progesterone from the age of day 12-124 in prenatally stressed (PS, n = 20) and unaffected control animals (n = 24). Furthermore, we determined the timing of puberty and growth. Body weight development revealed significantly faster growth in PS females compared to control animals. The onset of first estrus was slightly earlier in PS females, however not significantly so. Cycle lengths and levels of progesterone differed between groups over the course of time with higher progesterone levels and more constant cycles among PS females compared to control females who displayed marked differences between first and subsequent cycles. Levels of testosterone did not differ between groups. We conclude that prenatal stress accelerates growth and maturity in females, but not in males.

Pharmacokinetics and Paw Withdrawal Pressure in Female Guinea Pigs (Cavia porcellus) Treated with Sustained-Release Buprenorphine and Buprenorphine Hydrochloride.

Science.gov (United States)

Smith, Brian J; Wegenast, Daniel J; Hansen, Ryan J; Hess, Ann M; Kendall, Lon V

2016-11-01

Providing appropriate analgesia is essential in minimizing pain and maintaining optimal animal care and welfare in laboratory animals. Guinea pigs are common animal models in biomedical research, often requiring analgesic support. Here we evaluated the pharmacokinetics and efficacy of a sustained-release formulation of buprenorphine (Bup-SR) in this species. Guinea pigs (n = 7 each group) received either Bup-HCl (0.05 mg/kg BID for 3 d) or Bup-SR (0.3 mg/kg once). Plasma collection and measurement of paw-withdrawal pressure (PWP) was conducted at 0, 1, 3, 6, 12, 26, 48, and 72 h after treatment. Plasma levels of Bup-HCl peaked at 2331 pg/mL at 1 h after administration and declined to 165 pg/mL by 12 h. Plasma concentrations of Bup-SR peaked at 1344 pg/mL at 26 h after administration and declined to 429 pg/mL by 48 h. The PWP of the Bup-HCltreated guinea pigs peaked at 674 g at 1 h and declined to 402 g at 6 h, whereas that of Bup-SRtreated guinea pigs at 1 h was 361 g, 555 g at 6 h (significantly higher than that after Bup-HCl), and peaked at 680 g at 12 h. The PWP of both treatments was similar from 24 to 72 h and ranged from 348 to 450 g. The plasma concentration and PWP showed good correlation. These results suggest that Bup-SR provides consistent analgesia equivalent to that of Bup-HCl for a prolonged period of time and that Bup-SR is an alternative method of analgesia in guinea pigs.

Wild genius - domestic fool? Spatial learning abilities of wild and domestic guinea pigs

Directory of Open Access Journals (Sweden)

Sachser Norbert

2010-03-01

Full Text Available Abstract Background Domestic animals and their wild relatives differ in a wide variety of aspects. The process of domestication of the domestic guinea pig (Cavia aperea f. porcellus, starting at least 4500 years ago, led to changes in the anatomy, physiology, and behaviour compared with their wild relative, the wild cavy, Cavia aperea. Although domestic guinea pigs are widely used as a laboratory animal, learning and memory capabilities are often disregarded as being very scarce. Even less is known about learning and memory of wild cavies. In this regard, one striking domestic trait is a reduction in relative brain size, which in the domesticated form of the guinea pig amounts to 13%. However, the common belief, that such a reduction of brain size in the course of domestication of different species is accomplished by less learning capabilities is not at all very well established in the literature. Indeed, domestic animals might also even outperform their wild conspecifics taking advantage of their adaptation to a man-made environment. In our study we compared the spatial learning abilities of wild and domestic guinea pigs. We expected that the two forms are different regarding their learning performance possibly related to the process of domestication. Therefore wild cavies as well as domestic guinea pigs of both sexes, aged 35 to 45 days, were tested in the Morris water maze to investigate their ability of spatial learning. Results Both, wild cavies and domestic guinea pigs were able to learn the task, proving the water maze to be a suitable test also for wild cavies. Regarding the speed of learning, male as well as female domestic guinea pigs outperformed their wild conspecifics significantly. Interestingly, only domestic guinea pigs showed a significant spatial association of the platform position, while other effective search strategies were used by wild cavies. Conclusion The results demonstrate that domestic guinea pigs do not at all

Wild genius - domestic fool? Spatial learning abilities of wild and domestic guinea pigs.

Science.gov (United States)

Lewejohann, Lars; Pickel, Thorsten; Sachser, Norbert; Kaiser, Sylvia

2010-03-25

Domestic animals and their wild relatives differ in a wide variety of aspects. The process of domestication of the domestic guinea pig (Cavia aperea f. porcellus), starting at least 4500 years ago, led to changes in the anatomy, physiology, and behaviour compared with their wild relative, the wild cavy, Cavia aperea. Although domestic guinea pigs are widely used as a laboratory animal, learning and memory capabilities are often disregarded as being very scarce. Even less is known about learning and memory of wild cavies. In this regard, one striking domestic trait is a reduction in relative brain size, which in the domesticated form of the guinea pig amounts to 13%. However, the common belief, that such a reduction of brain size in the course of domestication of different species is accomplished by less learning capabilities is not at all very well established in the literature. Indeed, domestic animals might also even outperform their wild conspecifics taking advantage of their adaptation to a man-made environment.In our study we compared the spatial learning abilities of wild and domestic guinea pigs. We expected that the two forms are different regarding their learning performance possibly related to the process of domestication. Therefore wild cavies as well as domestic guinea pigs of both sexes, aged 35 to 45 days, were tested in the Morris water maze to investigate their ability of spatial learning. Both, wild cavies and domestic guinea pigs were able to learn the task, proving the water maze to be a suitable test also for wild cavies. Regarding the speed of learning, male as well as female domestic guinea pigs outperformed their wild conspecifics significantly. Interestingly, only domestic guinea pigs showed a significant spatial association of the platform position, while other effective search strategies were used by wild cavies. The results demonstrate that domestic guinea pigs do not at all perform worse than their wild relatives in tests of spatial

Isolation and characterisation of a dinucleotide microsatellite set for a parentage and biodiversity study in domestic guinea pig (Cavia porcellus

Directory of Open Access Journals (Sweden)

Diana Aviles

2015-10-01

Full Text Available The domestic guinea pig is a valuable genetic resource because it is part of local folklore and food tradition in many South American countries. The economic importance of the guinea pig is due to its high feed efficiency and the quality of animal protein produced. For these reasons, our study is aimed to design a complete dinucleotide microsatellite marker set following international recommendation to assess the genetic diversity and genealogy management of guinea pigs. We selected a total of 20 microsatellites, looking for laboratory efficiency and good statistical parameters. The set was tested in 100 unrelated individuals of guinea pigs from Ecuador, Peru, Colombia, Bolivia and Spain. Our results show a high degree of polymorphisms with a total of 216 alleles and a mean number of 10.80±3.49 for markers with a combined exclusion probability of 0.99.

Accuracy of real-time shear wave elastography in the assessment of normal liver tissue in the guinea pig (cavia porcellus).

Science.gov (United States)

Glińska-Suchocka, K; Kubiak, K; Spużak, J; Jankowski, M; Borusewicz, P

2017-03-28

Shear wave elastography is a novel technique enabling real-time measurement of the elasticity of liver tissue. The color map is superimposed on the classic ultrasound image of the assessed tissue, which enables a precise evaluation of the stiffness of the liver tissue. The aim of the study was to assess the stiffness of normal liver tissue in the guinea pig using shear wave elastography. The study was carried out on 36 guinea pigs using the SuperSonic Imagine Aixplorer scanner, and a 1 to 6 MH convex SC6-1 transducer. An ultrasound guided Try-Cut liver core needle biopsy was carried out in all the studied animals and the collected samples were examined to exclude pathological lesions. The mean liver tissue stiffness ranged from 0.89 to 5.40 kPa. We found that shear wave elastography is an easy, non-invasive technique that can be used to assess the stiffness of liver tissue. The obtained results can be used in future studies to assess the types and changes of liver tissue in the course of various types of liver disease.

Spatial hearing ability of the pigmented Guinea pig (Cavia porcellus): Minimum audible angle and spatial release from masking in azimuth.

Science.gov (United States)

Greene, Nathaniel T; Anbuhl, Kelsey L; Ferber, Alexander T; DeGuzman, Marisa; Allen, Paul D; Tollin, Daniel J

2018-08-01

Despite the common use of guinea pigs in investigations of the neural mechanisms of binaural and spatial hearing, their behavioral capabilities in spatial hearing tasks have surprisingly not been thoroughly investigated. To begin to fill this void, we tested the spatial hearing of adult male guinea pigs in several experiments using a paradigm based on the prepulse inhibition (PPI) of the acoustic startle response. In the first experiment, we presented continuous broadband noise from one speaker location and switched to a second speaker location (the "prepulse") along the azimuth prior to presenting a brief, ∼110 dB SPL startle-eliciting stimulus. We found that the startle response amplitude was systematically reduced for larger changes in speaker swap angle (i.e., greater PPI), indicating that using the speaker "swap" paradigm is sufficient to assess stimulus detection of spatially separated sounds. In a second set of experiments, we swapped low- and high-pass noise across the midline to estimate their ability to utilize interaural time- and level-difference cues, respectively. The results reveal that guinea pigs can utilize both binaural cues to discriminate azimuthal sound sources. A third set of experiments examined spatial release from masking using a continuous broadband noise masker and a broadband chirp signal, both presented concurrently at various speaker locations. In general, animals displayed an increase in startle amplitude (i.e., lower PPI) when the masker was presented at speaker locations near that of the chirp signal, and reduced startle amplitudes (increased PPI) indicating lower detection thresholds when the noise was presented from more distant speaker locations. In summary, these results indicate that guinea pigs can: 1) discriminate changes in source location within a hemifield as well as across the midline, 2) discriminate sources of low- and high-pass sounds, demonstrating that they can effectively utilize both low-frequency interaural time and high-frequency level difference sound localization cues, and 3) utilize spatial release from masking to discriminate sound sources. This report confirms the guinea pig as a suitable spatial hearing model and reinforces prior estimates of guinea pig hearing ability from acoustical and physiological measurements. Copyright © 2018 Elsevier B.V. All rights reserved.

Leucocyte profile and offspring production of guinea pig (Cavia cobaya given Anredera cordifolia leaf extract

Directory of Open Access Journals (Sweden)

D. Wijayanti

2018-03-01

Full Text Available The objective of this study was to determine leucocyte and offspring production of guinea pig (Cavia cobaya giving Anredera cordifolia leaf extract. Materials used were female 16 heads of guinea pig with body weight of 425g. The treatments were an extract of A. cordifolia leaf at doses of 0, 10, 50 and 90 mg/head, designated as T0, T1, T2 and T3, respectively. A. cordifolia leaf extract was administered orally from 10 days prepartum to 10 days postpartum. Blood was taken at 10 days prepartum and 10 days postpartum. Total birth of the offspring was observed. Data were analyzed by analysis of variance and if there was effect of treatment, then continued with Duncan multiple range test and Chi-Square test for fetal production between the given A. cordifolia leaf extract and control. The result showed that there was no significant difference for 10 days prepartum after addition of A cordifolia leaf extract treatment. The postpartum treated showed a total 50 mg/head level increaed for monocytes than that of level 0, 10 and 90 mg/head. Ten days postpartum treatment showed the total increase for leucocyte and monocytes total were 50 and 90 mg/head, respectively compared to 10 mg/head level. Total lymphocyte of 90 mg/head increased compared to level 10 and 50 mg/head. The highest total neutrophil as found at level of 50 mg/head which increased compared to the level of 0 and 10 mg/head. ProvisioningA. cordifolialeaf extract at doses level of 50 and 90 mg/head could increase litter size (P<0.05; χ2=9.267 and decreased offspring mortality (P<0.05; χ2=6.4. In conclusion, by giving 50 mg/head A. cordifolia leaf extract could increase leucocyte profile and offspring production of guinea pig.

PROECHIMYS SEMISPINOSUS (RATÓN DE ESPINAS: UNA ESPECIE DE FAUNA SILVESTRE CON POTENCIAL PROMISORIO PARA COMUNIDADES NEGRAS DEL DEPARTAMENTO DEL CHOCÓ, PACÍFICO COLOMBIANO

Directory of Open Access Journals (Sweden)

Asprilla-Perea Jeferson

2012-12-01

Full Text Available Se valoró el potencial de Proechimys semispinosus (ratón de espinas como especiepromisoria para el departamento del Chocó, según su uso tradicional en comunidadesnegras y a través de ensayos de laboratorio como aporte nutricional de su carne. Laalimentación es el principal uso que los pobladores de estas comunidades le dana la especie, y la trampa de cajón es la técnica de cacería que más se utiliza parasu captura. El sabor de la carne de este roedor goza de buena aceptación por partede sus consumidores, y no se han asociado enfermedades humanas a la ingesta dela misma. A nivel socioeconomico, aunque es una importante fuente de proteinapara las comunidades, su carne no se comercializa con frecuencia. Los ensayosde laboratorio mostraron que su carne posee características bromatológicas (20%proteínas, 78% humedad, 0.40% grasas, 0.97% Cenizas y 3.34 Kcal/100 g similaresa carnes domésticas de origen porcino, vacuno y aviar, así como también a otrassilvestres como la guagua (Cuniculus paca y el cuy (Cavia porcellus. Por lotanto, P. semispinosus es una especie de fauna silvestre con potencial promisoriopara comunidades negras en el departamento del Chocó, ya que es ampliamenteutilizado como alimento en localidades rurales de la región (que es la mayor partedel territorio y su carne cuenta con un importante valor nutricional

Evaluation of femur of orchiectomized Guinea pigs by bone densitometry using dual-energy X-ray absorptiometry (DXA) and mechanical testing

International Nuclear Information System (INIS)

Estanislau, Cristiane de Abreu; Rahal, Sheila Canavese; Araujo, Fabio Andre Pinheiro de; Sergio Swain Muller; Louzada, Mario Jefferson Quirino; Estanislau, Caroline de Abreu

2010-01-01

The aim of this study was to evaluate the effects of castration on bones in the male guinea pigs and to observe whether mechanical testing correlates with dual-energy X-ray absorptiometry (DXA). Twelve male guinea pigs (Cavia porcellus), aged 21-27 days, and with average initial weight of 279 grams were used. The animals were equally allocated to two groups: GI - orchiectomized animals and GII - intact control animals. They underwent euthanasia at seven months following surgery. DXA measurement was performed at the mid third of the right femoral diaphysis in the cortical region and at the left femoral neck in order to verify its correlation with results of mechanical testing. Three-point bending test of right femur and axial compression test of left femur were performed. Bone mineral density of GI was significantly lower only at femoral neck. No differences were observed in the maximum load values between GI and GII for both bending and axial compression tests. The bending test revealed lower bone stiffness in GI compared to GII, but in the axial compression test no differences between groups were observed. Only left femur showed positive correlation coefficient between maximum load and bone mineral density according to Pearson's correlation coefficient. The results suggest that hormonal deprivation in guinea pigs induces reduction of bone mineral density, especially in the femoral neck area and reduction of bone stiffness in the mid-femoral diaphysis. (author)

Evaluation of femur of orchiectomized Guinea pigs by bone densitometry using dual-energy X-ray absorptiometry (DXA) and mechanical testing

Energy Technology Data Exchange (ETDEWEB)

Estanislau, Cristiane de Abreu; Rahal, Sheila Canavese; Araujo, Fabio Andre Pinheiro de, E-mail: crisestanislau@hotmail.co, E-mail: sheilacr@fmvz.unesp.b, E-mail: fabioandre@fmvz.unesp.b [Universidade Estadual Paulista (UNESP), Botucatu, SP (Brazil). Faculdade de Medicina, Veterinaria e Zootecnia. Dept. de Cirurgia e Anestesiologia Veterinaria; Sergio Swain Muller, E-mail: diretoria@fmb.unesp.b [Universidade Estadual Paulista (UNESP), Botucatu, SP (Brazil). Faculdade de Medicina, Veterinaria e Zootecnia. Dept. de Cirurgia e Ortopedia; Louzada, Mario Jefferson Quirino, E-mail: louzada@fmva.unesp.b [Universidade Estadual Paulista (UNESP), Aracatuba, SP (Brazil). Faculdade de Medicina Veterinaria; Estanislau, Caroline de Abreu, E-mail: caestanis@hotmail.co

2010-03-15

The aim of this study was to evaluate the effects of castration on bones in the male guinea pigs and to observe whether mechanical testing correlates with dual-energy X-ray absorptiometry (DXA). Twelve male guinea pigs (Cavia porcellus), aged 21-27 days, and with average initial weight of 279 grams were used. The animals were equally allocated to two groups: GI - orchiectomized animals and GII - intact control animals. They underwent euthanasia at seven months following surgery. DXA measurement was performed at the mid third of the right femoral diaphysis in the cortical region and at the left femoral neck in order to verify its correlation with results of mechanical testing. Three-point bending test of right femur and axial compression test of left femur were performed. Bone mineral density of GI was significantly lower only at femoral neck. No differences were observed in the maximum load values between GI and GII for both bending and axial compression tests. The bending test revealed lower bone stiffness in GI compared to GII, but in the axial compression test no differences between groups were observed. Only left femur showed positive correlation coefficient between maximum load and bone mineral density according to Pearson's correlation coefficient. The results suggest that hormonal deprivation in guinea pigs induces reduction of bone mineral density, especially in the femoral neck area and reduction of bone stiffness in the mid-femoral diaphysis. (author)

Efek Pemberian Ekstrak Lidah Buaya (Aloe Barbadensis Miller pada Soket Gigi terhadap Kepadatan Serabut Kolagen Pasca Ekstraksi Gigi Marmut (Cavia Porcellus

Directory of Open Access Journals (Sweden)

Fatma Yuza

2014-12-01

sockets density of collagen were observed using light microscope 400x magnification. Analyzing data is done by Kruskal-Wallis test followed by Post Hoc test using the Mann-Whitney test for comparing collagen density between groups. Statistically results between groups showed that the extract of 90% Aloe barbadensis Miller affected the formation of collagen fibers when compared to the control group (p <0.05 on day 7 after tooth extraction of guinea pig. The conclusion of this study was 90% Aloe barbadensis Miller extract increased the density of collagen fibers from the tooth socket seven days after tooth extraction of guinea pig.

Potenciais miogênicos evocados vestibulares: metodologias de registro em homens e cobaias Vestibular evoked myogenic potential: recording methods in humans and guinea pigs

Directory of Open Access Journals (Sweden)

Aline Cabral de Oliveira

2008-10-01

Full Text Available O potencial miogênico evocado vestibular (VEMP é um teste clínico que avalia a função vestibular através de um reflexo vestíbulo-cervical inibitório captado nos músculos do corpo em resposta à estimulação acústica de alta intensidade. OBJETIVO: Verificar e analisar os diversos métodos de registro dos potenciais miogênicos evocados vestibulares no homem e em cobaias. MATERIAL E MÉTODO: Realizou-se busca eletrônica nas bases de dados MEDLINE, LILACS, SCIELO e COCHRANE. RESULTADOS: Foram verificadas divergências quanto às formas de registro dos potenciais miogênicos evocados vestibulares, relacionadas com os seguintes fatores: posição do paciente no momento do registro, tipo de estímulo sonoro utilizado (clicks ou tone bursts, parâmetros para a promediação dos estímulos (intensidade, freqüência, tempo de apresentação, filtros, ganho de amplificação das respostas e janelas para captação dos estímulos, tipo de fone utilizado e forma de apresentação dos estímulos (monoaural ou binaural, ipsi ou contralateral. CONCLUSÃO: Não existe consenso na literatura quanto ao melhor método de registro dos potenciais evocados miogênicos vestibulares, havendo necessidade de pesquisas mais específicas para comparação entre estes registros e a definição de um modelo padrão para a utilização na prática clínica.The vestibular evoked myogenic potential (VEMP is a clinical test that assess the vestibular function by means of an inhibitory vestibulo-neck reflex, recorded in body muscles in response to high intensity acoustic stimuli. AIM: To check and analyze the different methods used to record VEMPs in humans and in guinea pigs. MATERIALS AND METHODS: We researched the following databases: MEDLINE, LILACS, SCIELO and COCHRANE. RESULTS: we noticed discrepancies in relation to the ways used to record the vestibular evoked myogenic potentials in relation to the following factors: patient position at the time of recording

Influência de bloqueadores H2 no processo de cicatrização gástrica

Directory of Open Access Journals (Sweden)

Sandra Pedroso de Moraes

Full Text Available Com o objetivo de avaliar a influência de bloqueadores H2 no processo de cicatrização de lesões gástricas suturadas foram estudadas vinte cobaias machos. Após anestesia geral, laparotomia, gastrotomia de 0,5cm de extensão na parede anterior do corpo gástrico e gastrorrafia, os animais foram separados em dois grupos (GI e GII com dez cobaias cada. As do GI receberam injeções de 0,1ml de água destilada e as do GIl 0,75mg de ranitidina, por via intramuscular, de 12/12 horas, iniciadas imediatamente após a operação e mantidas até as datas de sacrifício, realizado em número igual de cobaias, no segundo e no décimo dias de pós-operatório (PO. As peças operatórias ressecadas foram avaliadas detalhadamente. À macroscopia observou-se deiscência de sutura gástrica em um animal do GI no décimo dia de PO. A face mucosa de todas as peças apresentava enantema na linha de sutura no segundo dia de PO, porém, no décimo dia de PO o aspecto era normal, com pequena cicatriz branca no local. À microscopia, no segundo dia de PO, observou-se processo inflamatório agudo grave em ambos os grupos. No décimo dia de PO evidenciou-se inflamação moderada no GI e leve no Gil. À morfometria não houve diferença significante entre os grupos, em relação ao número de células inflamatórias, mas a densidade volumétrica de fibroblastos e de fibras colágenas foi significativamente maior no GII no décimo dia de PO. Concluiu-se que o tratamento de cobaias com bloqueadores H2 não provocou retardo da cicatrização de feridas gástricas suturadas.

Transplantation and survival of mouse inner ear progenitor/stem cells in the organ of Corti after cochleostomy of hearing-impaired guinea pigs: preliminary results

Directory of Open Access Journals (Sweden)

L.C.M. Barboza Jr.

2016-01-01

Full Text Available In mammals, damage to sensory receptor cells (hair cells of the inner ear results in permanent sensorineural hearing loss. Here, we investigated whether postnatal mouse inner ear progenitor/stem cells (mIESCs are viable after transplantation into the basal turns of neomycin-injured guinea pig cochleas. We also examined the effects of mIESC transplantation on auditory functions. Eight adult female Cavia porcellus guinea pigs (250-350g were deafened by intratympanic neomycin delivery. After 7 days, the animals were randomly divided in two groups. The study group (n=4 received transplantation of LacZ-positive mIESCs in culture medium into the scala tympani. The control group (n=4 received culture medium only. At 2 weeks after transplantation, functional analyses were performed by auditory brainstem response measurement, and the animals were sacrificed. The presence of mIESCs was evaluated by immunohistochemistry of sections of the cochlea from the study group. Non-parametric tests were used for statistical analysis of the data. Intratympanic neomycin delivery damaged hair cells and increased auditory thresholds prior to cell transplantation. There were no significant differences between auditory brainstem thresholds before and after transplantation in individual guinea pigs. Some mIESCs were observed in all scalae of the basal turns of the injured cochleas, and a proportion of these cells expressed the hair cell marker myosin VIIa. Some transplanted mIESCs engrafted in the cochlear basilar membrane. Our study demonstrates that transplanted cells survived and engrafted in the organ of Corti after cochleostomy.

Temporal Progression of Lesions in Guinea Pigs Infected With Lassa Virus.

Science.gov (United States)

Bell, T M; Shaia, C I; Bearss, J J; Mattix, M E; Koistinen, K A; Honnold, S P; Zeng, X; Blancett, C D; Donnelly, G C; Shamblin, J D; Wilkinson, E R; Cashman, K A

2017-05-01

Lassa virus (LASV) infection causes an acute, multisystemic viral hemorrhagic fever that annually infects an estimated 100 000 to 300 000 persons in West Africa. This pathogenesis study evaluated the temporal progression of disease in guinea pigs following aerosol and subcutaneous inoculation of the Josiah strain of LASV as well as the usefulness of Strain 13 guinea pigs as an animal model for Lassa fever. After experimental infection, guinea pigs ( Cavia porcellus; n = 67) were serially sampled to evaluate the temporal progression of infection, gross and histologic lesions, and serum chemistry and hematologic changes. Guinea pigs developed viremia on day 5 to 6 postexposure (PE), with clinical signs appearing by day 7 to 8 PE. Complete blood counts revealed lymphopenia and thrombocytopenia. Gross pathologic findings included skin lesions and congested lungs. Histologic lesions consisted of cortical lymphoid depletion by day 6 to 7 PE with lymphohistiocytic interstitial pneumonia at 7 to 8 days PE. Scattered hepatocellular degeneration and cell death were also noted in the liver and, to a lesser extent, in other tissues including the haired skin, lung, heart, adrenal gland, lymph nodes, thymus, and spleen. The first cell types to demonstrate staining for viral antigen were fibroblastic reticular cells and macrophages/dendritic cells in the lymph nodes on day 5 to 6 PE. This study demonstrates similarities between Lassa viral disease in human infections and experimental guinea pig infection. These shared pathologic characteristics support the utility of guinea pigs as an additional animal model for vaccine and therapeutic development under the Food and Drug Administration's Animal Rule.

Guinea pig ID-like families of SINEs.

Science.gov (United States)

Kass, David H; Schaetz, Brian A; Beitler, Lindsey; Bonney, Kevin M; Jamison, Nicole; Wiesner, Cathy

2009-05-01

Previous studies have indicated a paucity of SINEs within the genomes of the guinea pig and nutria, representatives of the Hystricognathi suborder of rodents. More recent work has shown that the guinea pig genome contains a large number of B1 elements, expanding to various levels among different rodents. In this work we utilized A-B PCR and screened GenBank with sequences from isolated clones to identify potentially uncharacterized SINEs within the guinea pig genome, and identified numerous sequences with a high degree of similarity (>92%) specific to the guinea pig. The presence of A-tails and flanking direct repeats associated with these sequences supported the identification of a full-length SINE, with a consensus sequence notably distinct from other rodent SINEs. Although most similar to the ID SINE, it clearly was not derived from the known ID master gene (BC1), hence we refer to this element as guinea pig ID-like (GPIDL). Using the consensus to screen the guinea pig genomic database (Assembly CavPor2) with Ensembl BlastView, we estimated at least 100,000 copies, which contrasts markedly to just over 100 copies of ID elements. Additionally we provided evidence of recent integrations of GPIDL as two of seven analyzed conserved GPIDL-containing loci demonstrated presence/absence variants in Cavia porcellus and C. aperea. Using intra-IDL PCR and sequence analyses we also provide evidence that GPIDL is derived from a hystricognath-specific SINE family. These results demonstrate that this SINE family continues to contribute to the dynamics of genomes of hystricognath rodents.

Blood-feeding Behaviors of Anopheles stephensi But Not Phlebotomus papatasi are Influenced by Actively Warming Guinea Pigs (Cavia porcellus) Under General Anesthesia

Science.gov (United States)

2015-01-01

differential biting behaviors on warmed or unwarmed guinea pig hosts. (A) Warmed (dashed line with square time points) and control (solid line with circle time ...Fig. 2. Sand flies do not display differential biting behaviors on warmed or unwarmed guinea pig hosts. (A) Warmed (dashed line with square time ...books/NBK54050/ Peterson D, Brown A. 1951. Studies of the responses of the female Aedes mosquito. Part III. The response of Aedes aegypti (L.) to a warm

Pathogenic potential of a Costa Rican strain of 'Candidatus Rickettsia amblyommii' in guinea pigs (Cavia porcellus) and protective immunity against Rickettsia rickettsii.

Science.gov (United States)

Rivas, Juan J; Moreira-Soto, Andrés; Alvarado, Gilberth; Taylor, Lizeth; Calderón-Arguedas, Olger; Hun, Laya; Corrales-Aguilar, Eugenia; Morales, Juan Alberto; Troyo, Adriana

2015-09-01

'Candidatus Rickettsia amblyommii' is a spotted fever group rickettsia that is not considered pathogenic, although there is serologic evidence of possible infection in animals and humans. The aim of this study was to evaluate the pathogenic potential of a Costa Rican strain of 'Candidatus R. amblyommii' in guinea pigs and determine its capacity to generate protective immunity against a subsequent infection with a local strain of Rickettsia rickettsii isolated from a human case. Six guinea pigs were inoculated with 'Candidatus R. amblyommii' strain 9-CC-3-1 and two controls with cell culture medium. Health status was evaluated, and necropsies were executed at days 2, 4, and 13. Blood and tissues were processed by PCR to detect the gltA gene, and end titers of anti-'Candidatus R. amblyommii' IgG were determined by indirect immunofluorescence. To evaluate protective immunity, another 5 guinea pigs were infected with 'Candidatus R. amblyommii' (IGPs). After 4 weeks, these 5 IGPs and 3 controls (CGPs) were inoculated with pathogenic R. rickettsii. Clinical signs and titers of anti-Rickettsia IgG were determined. IgG titers reached 1:512 at day 13 post-infection with 'Candidatus R. amblyommii'. On day 2 after inoculation, two guinea pigs had enlarged testicles and 'Candidatus R. amblyommii' DNA was detected in testicles. Histopathology confirmed piogranulomatous orchitis with perivascular inflammatory infiltrate in the epididymis. In the protective immunity assay, anti-Rickettsia IgG end titers after R. rickettsii infection were lower in IGPs than in CGPs. IGPs exhibited only transient fever, while CGP showed signs of severe disease and mortality. R. rickettsii was detected in testicles and blood of CGPs. Results show that the strain 9-CC-3-1 of 'Candidatus R. amblyommii' was able to generate pathology and an antibody response in guinea pigs. Moreover, its capacity to generate protective immunity against R. rickettsii may modulate the epidemiology and severity of Rocky Mountain spotted fever in areas where both species circulate. Copyright © 2015 Elsevier GmbH. All rights reserved.

Proteção do recém-nascido contra o tétano pela imunização ativa da gestante com antitoxina tetânica: estudo original de 1953 Protection of newborn infants against tetanus by active immunization of the pregnant women with tetanus antitoxin: the 1953 original study

Directory of Open Access Journals (Sweden)

Augusto Gomes Mattos

2008-12-01

Full Text Available OBJETIVO: Determinar, em cobaias prenhes e em gestantes, a produção de antitoxina tetânica induzida pela aplicação da anatoxina tetânica e estudar a sua passagem para o recém-nascido. MÉTODOS: Na primeira fase, em estudo experimental, cobaias prenhes foram vacinadas com duas doses de toxóide tetânico em um intervalo de 15 dias, seguida da dosagem de anticorpos na cobaia imunizada, na prole ao nascer e 15 dias após o nascimento. Outro grupo de animais previamente vacinado recebeu uma dose de reforço 30 dias antes do parto, medindo-se o nível de anticorpos na cobaia e na prole. Na segunda fase, em ensaio clínico, as gestantes humanas foram vacinadas com três injeções de anatoxina tetânica, com um intervalo de 30 dias, em qualquer período da gravidez, medindo-se, a seguir, a antitoxina tetânica. Nos recém-nascidos, os anticorpos foram medidos ao nascer e aos 15 dias de vida. RESULTADOS: O título de antitoxina no sangue da prole de cobaias vacinadas com anatoxina tetânica foi elevado ao nascimento e aos 15 dias de vida. A dose de reforço provocou elevação do título basal. Nas gestantes, a aplicação de três doses de toxóide antitetânico conferiu imunidade a 95% dos recém-nascidos estudados. Os recém-nascidos de mães vacinadas apresentaram títulos elevados de antitoxina que persistiram por mais de 15 dias de vida. CONCLUSÕES: A vacinação durante a gestação foi acompanhada de títulos protetores de antitoxina contra o tétano tanto nos filhotes de cobaias quanto nos recém-nascidos humanos.OBJECTIVE: To measure, in pregnant guinea pigs and women, the production of tetanus antitoxin, induced by vaccination with tetanus toxin, and to study the transmission of these antibodies to the offspring. METHODS: In an experimental design, pregnant guinea pigs were vaccinated with two doses of tetanus toxoid with a 15-day interval followed by determination of antibodies in the immunized guinea pig, in the offspring at birth

Bowman-Birk Protease Inhibitor from Vigna unguiculata Seeds Enhances the Action of Bradykinin-Related Peptides

Directory of Open Access Journals (Sweden)

Alice da Cunha M. Álvares

2014-10-01

Full Text Available The hydrolysis of bradykinin (Bk by different classes of proteases in plasma and tissues leads to a decrease in its half-life. Here, Bk actions on smooth muscle and in vivo cardiovascular assays in association with a protease inhibitor, Black eyed-pea trypsin and chymotrypsin inhibitor (BTCI and also under the effect of trypsin and chymotrypsin were evaluated. Two synthetic Bk-related peptides, Bk1 and Bk2, were used to investigate the importance of additional C-terminal amino acid residues on serine protease activity. BTCI forms complexes with Bk and analogues at pH 5.0, 7.4 and 9.0, presenting binding constants ranging from 103 to 104 M−1. Formation of BTCI-Bk complexes is probably driven by hydrophobic forces, coupled with slight conformational changes in BTCI. In vitro assays using guinea pig (Cavia porcellus ileum showed that Bk retains the ability to induce smooth muscle contraction in the presence of BTCI. Moreover, no alteration in the inhibitory activity of BTCI in complex with Bk and analogous was observed. When the BTCI and BTCI-Bk complexes were tested in vivo, a decrease of vascular resistance and consequent hypotension and potentiating renal and aortic vasodilatation induced by Bk and Bk2 infusions was observed. These results indicate that BTCI-Bk complexes may be a reliable strategy to act as a carrier and protective approach for Bk-related peptides against plasma serine proteases cleavage, leading to an increase in their half-life. These findings also indicate that BTCI could remain stable in some tissues to inhibit chymotrypsin or trypsin-like enzymes that cleave and inactivate bradykinin in situ.

The Guinea Pig as a Model for Sporadic Alzheimer’s Disease (AD): The Impact of Cholesterol Intake on Expression of AD-Related Genes

Science.gov (United States)

Ong, Daniel; Wijaya, Linda; Laws, Simon M.; Taddei, Kevin; Newman, Morgan; Lardelli, Michael; Martins, Ralph N.; Verdile, Giuseppe

2013-01-01

We investigated the guinea pig, Cavia porcellus, as a model for Alzheimer’s disease (AD), both in terms of the conservation of genes involved in AD and the regulatory responses of these to a known AD risk factor - high cholesterol intake. Unlike rats and mice, guinea pigs possess an Aβ peptide sequence identical to human Aβ. Consistent with the commonality between cardiovascular and AD risk factors in humans, we saw that a high cholesterol diet leads to up-regulation of BACE1 (β-secretase) transcription and down-regulation of ADAM10 (α-secretase) transcription which should increase release of Aβ from APP. Significantly, guinea pigs possess isoforms of AD-related genes found in humans but not present in mice or rats. For example, we discovered that the truncated PS2V isoform of human PSEN2, that is found at raised levels in AD brains and that increases γ-secretase activity and Aβ synthesis, is not uniquely human or aberrant as previously believed. We show that PS2V formation is up-regulated by hypoxia and a high-cholesterol diet while, consistent with observations in humans, Aβ concentrations are raised in some brain regions but not others. Also like humans, but unlike mice, the guinea pig gene encoding tau, MAPT, encodes isoforms with both three and four microtubule binding domains, and cholesterol alters the ratio of these isoforms. We conclude that AD-related genes are highly conserved and more similar to human than the rat or mouse. Guinea pigs represent a superior rodent model for analysis of the impact of dietary factors such as cholesterol on the regulation of AD-related genes. PMID:23805206

High-purity flow sorting of early meiocytes based on DNA analysis of guinea pig spermatogenic cells.

Science.gov (United States)

Rodríguez-Casuriaga, Rosana; Geisinger, Adriana; Santiñaque, Federico F; López-Carro, Beatriz; Folle, Gustavo A

2011-08-01

Mammalian spermatogenesis is still nowadays poorly understood at the molecular level. Testis cellular heterogeneity is a major drawback for spermatogenic gene expression studies, especially when research is focused on stages that are usually very short and poorly represented at the cellular level such as initial meiotic prophase I (i.e., leptotene [L] and zygotene [Z]). Presumably, genes whose products are involved in critical meiotic events such as alignment, pairing and recombination of homologous chromosomes are expressed during the short stages of early meiotic prophase. Aiming to characterize mammalian early meiotic gene expression, we have found the guinea pig (Cavia porcellus) as an especially attractive model. A detailed analysis of its first spermatogenic wave by flow cytometry (FCM) and optical microscopy showed that guinea pig testes exhibit a higher representation of early meiotic stages compared to other studied rodents, partly because of their longer span, and also as a result of the increased number of cells entering meiosis. Moreover, we have found that adult guinea pig testes exhibit a peculiar 4C DNA content profile, with a bimodal peak for L/Z and P spermatocytes that is absent in other rodents. Besides, we show that this unusual 4C peak allows the separation by FCM of highly pure L/Z spermatocyte populations aside from pachytene ones, even from adult individuals. To our knowledge, this is the first report on an accurate and suitable method for highly pure early meiotic prophase cell isolation from adult mammals, and thus sets an interesting approach for gene expression studies aiming at a deeper understanding of the molecular groundwork underlying male gamete production. Copyright © 2011 International Society for Advancement of Cytometry.

Similarity of satellite DNA properties in the order Rodentia

Energy Technology Data Exchange (ETDEWEB)

Mazrimas, J A; Hatch, F T

1977-09-01

We have characterized satellite DNAs from 9 species of kangaroo rat (Dipodomys) and have shown that the HS-..cap alpha.. and HS-..beta.. satellites, where present, are nearly identical in all species as to melting transition midpoint (Tm), and density in neutral CsCl, alkaline CsCl, and Cs/sub 2/SO/sub 4/-Ag/sup +/ gradients. However, the MS satellites exist in two internally similar classes. The satellite DNAs from three other rodents were characterized (densities listed are in neutral CsCl). The pocket gopher, Thomomys bottae, contains Th-..cap alpha.. (1.713 g/ml) and Th-..beta.. (1.703 g/ml). The guinea pig (Cavia porcellus) contains Ca-..cap alpha.., Ca-..beta.., and Ca-..gamma.. at densities of 1.706 g/ml, 1.704 g/ml, and 1.704 g/ml, respectively. The antelope ground squirrel (Ammospermophilus harrisi) contains Am-..cap alpha.., 1.708 g/ml, Am-..beta.., 1.717 g/ml, and Am-..gamma.., 1.707 g/ml. The physical and chemical properties of the alpha-satellites from the above four rodents representing four different families in two suborders of Rodentia were compared. They show nearly identical Tm, nucleoside composition of single strands, and single strand densities in alkaline CsCl. Similar comparisons on the second or third satellite DNAs from these rodents also indicate a close relationship to each other. Thus the high degree of similarity of satellite sequences found in such a diverse group of rodents suggests a cellular function that is subject to natural selection, and implies that these sequences have been conserved over a considerable span of evolutionary time since the divergence of these rodents about 50 million years ago.

Similarity of satellite DNA properties in the order Rodentia

Energy Technology Data Exchange (ETDEWEB)

Mazrimas, J A; Hatch, F T

1977-09-01

Satellite DNAs from 9 species of kangaroo rat (Dipodomys) have been characterized and have shown that the HS-..cap alpha.. and HS-..beta.. satellites, where present, are nearly identical in all species as to melting transition midpoint (Tm), and density in neutral CsCl, alkaline CsCl, and Cs/sub 2/SO/sub 4/-Ag/sup +/ gradients. However, the MS satellites exist in two internally similar classes. The satellite DNAs from three other rodents were characterized (densities listed are in neutral CsCl). The pocket gopher, Thomomys bottae, contains Th-..cap alpha.. (1.713 g/ml) and Th..beta.. (1.703 g/ml). The guinea pig (Cavia porcellus) contains Ca-..cap alpha.., Ca-..beta.. and Ca-..gamma.. at densities of 1.706 g/ml, 1.704 g/ml and 1.704 g/ml, respectively. The antelope ground squirrel (Ammospermophilus harrisi) contains Am-..cap alpha.., 1.708 g/ml, Am-..beta.., 1.717 g/ml, and Am-..gamma.., 1.707 g/ml. The physical and chemical properties of the alpha-satellites from the above four rodents representing four different families in two suborders of Rodentia were compared. They show nearly identical Tm, nucleoside composition of single strands, and single strand densities in alkaline CsCl. Similar comparisons on the second or third satellite DNAs from these rodents also indicate a close relationship to each other. Thus the high degree of similarity of satellite sequences found in such a diverse group of rodents suggests a cellular function that is subject to natural selection, and implies that these sequences have been conserved over a considerable span of evolutionary time since the divergence of these rodents about 50 million years ago.

Effects of heat stress on some reproductive parameters of male cavie (Cavia porcellus) and mitigation strategies using guava (Psidium guajava) leaves essential oil.

Science.gov (United States)

Ngoula, Ferdinand; Guemdjo Tekam, Maryvonne; Kenfack, Augustave; Tadondjou Tchingo, Cyrille D'Alex; Nouboudem, Sandrine; Ngoumtsop, Herman; Tsafack, Borice; Teguia, Alexis; Kamtchouing, Pierre; Galeotti, Marco; Tchoumboue, Joseph

2017-02-01

Climate changes, particularly the increase of temperature are among the main causes behind the decline of fertility in humans as well as animals. In this study, the effects of heat stress on some reproductive parameters of male cavies and mitigation strategies using guava leaves essential oil (GLEO) were studied. For this purpose, 40 male cavies aged 2.5-3 months and weighing between 348 and 446g were divided into 4 groups of 10 animals each and subjected to the following temperatures: Ambient temperature (20-25°C) for the control group, 35°C for group 1, 45°C for group 2 and 45°C+100µl GLEO/kg body weight, administered by gavage to animals for group 3. Exposure time of heat was 7h per day for 60 days. Results reveal that the relative weights of testes, epididymis, vas deferens and seminal vesicles were hardly affected by the temperature levels considered (P>0.05). The mass and individual sperm motility was significantly lower (Pleaves essential oil. Copyright © 2017 Elsevier Ltd. All rights reserved.

Preferência por hospedeiro e estratificação de Culicidae (Diptera em área de remanescente florestal do Parque Regional do Iguaçu, Curitiba, Paraná, Brasil Host preference and Culicidae stratification in area of degradated inside forest of Regional do Iguaçu Park, Curitiba, Paraná, Brazil

Directory of Open Access Journals (Sweden)

Ana Cristina Tissot

2004-12-01

Full Text Available A investigação das populações de Culicidae em áreas de remanescentes florestais inseridas em área urbana, podem fornecer subsídios para compreensão dos processos de utilização de habitats apresentando diferentes graus de interferência antrópica. Foram investigadas espécies potencialmente zoofílicas durante o período vespertino no interior de remanescente florestal, no espaço urbano de Curitiba, Paraná. Durante o período de setembro de 2000 a junho de 2001, foram realizadas cinco coletas por estação, com auxílio de armadilhas CDC-M instaladas em dois estratos verticais, a 1,5 m do solo e na copa das árvores (6 m. Como iscas foram utilizados mamíferos Cavia porcellus (Linnaeus, 1758 (Rodentia, Cavidae e aves Nothura maculosa (Temminck, 1815 (Tinamiformes, Tinamidae em cada um dos estratos, com revezamento das iscas animais. As armadilhas foram operadas no intervalo horário das 16:00 às 20:00 h, sendo retiradas amostras a cada intervalo de 30 minutos. Em 60 horas de operação das armadilhas CDC-M, foram capturados 1.407 exemplares de Culicidae, sendo 1.143 espécies identificadas, distribuídas em nove gêneros e 13 espécies. As espécies mais freqüentes foram Mansonia(Mansonia fonsecai (Pinto, 1932 e Mansonia (Mansonia pessoai (Barreto e Coutinho, 1944, destaca-se também a ocorrência de: Ochlerotatus (Ochlerotatus scapularis (Rondani, 1848; Psorophora (Janthinosoma ferox (Humboldt, 1819 e Aedes (Stegomyia albopictus (Skuse, 1894. Na área foram detectadas a presença de espécies com graus variados de importância epidemiológica e com tendência a explorar ambientes exófilos, florestais e peridomiciliares.Parks and plazas (green areas or vegetation islands within urban areas can provide conditions for the development of populations of mosquitoes, many species of which are very adaptable to a variety of environments. The species of mosquitoes in the family Culicidae with animal hosts, in a vegetation island within an

INVESTIGACIÓN DE MERCADO SOBRE EL GRADO DE ACEPTACIÓN DE LA CARNE DE CUY (CAVIA PORCELLUS EN PRESENTACIONES DE AHUMADO, CROQUETAS Y APANADO EN LA CIUDAD DE PASTO MARKET RESEARCH ON THE DEGREE OF ACCEPTANCE OF MEAT FROM CUY (CAVIA PORCELLUS PRESENTATIONS SMOKED, AND BROSTER CROQUETTES IN THE CITY OF PASTO

Directory of Open Access Journals (Sweden)

FRANCISCO E ARGOTE

2009-06-01

Full Text Available Los cambios de hábitos en el consumo de alimentos, insinúan productos de fácil preparación y oportuna adquisición en supermercados, motivo por el cual se hizo necesario indagar a los consumidores de la ciudad de Pasto, su interés y disponibilidad por adquirir Cuy, en presentaciones diferentes a la tradicional. Los objetivos desarrollados fueron valoración de la demanda potencial, realización de test de mercado, determinación de la participación de la carne de Cuy con sustitutos y diseño de estrategias de mercadeo. El modelo de investigación empleado fue el cuantitativo y obedeció a muestreo probabilístico aleatorio con estratificación proporcional. La recolección de la información se realizó mediante encuesta. La población objeto de estudio de la ciudad de Pasto correspondió a 27.428 hogares distribuidos en los estratos, tres, cuatro, cinco y seis. La muestra calculada fue de 383 observaciones, con un nivel de confianza del 95% y un margen de error del 5%. Las estrategias se formularon con base en la mezcla de mercadeo (precio, producto, plaza, promoción y publicidad. Como resultados y conclusiones se logró determinar que el consumo de la carne de Cuy es ocasional con cantidades entre una y cuatro canales. El Cuy en el momento no se vende en famas ni en supermercados, los precios se analizaron en asaderos comerciales (700 gramos de Cuy asado $24.000 y plazas de mercados (Kilo de Cuy vivo alrededor de $12.000. El porcentaje de participación de la carne de Cuy fue de 3,3% del consumo total de carnes. El estimativo de la demanda potencial para las nuevas presentaciones fue de: 92.158 unidades/año para el Cuy ahumado, 69.119 unidades/año para el apanado, y croquetas con 65.827 unidades/año, con pesos de 750 g y 500 g. Los encuestados prefirieron la carne de Cuy ahumada.The changes of habits in the consumption of foods, insinuate products of easy preparation and opportune acquisition in supermarkets, reason for which became necessary to investigate consumers of the city of Pasto, their interest and readiness to acquire cuy, in presentations different to the traditional one. The developed objectives were valuation of the potential demand, realization of market test, determination of the participation of the cuy meat with substitutes and design of marketing strategies. The used investigation pattern was the quantitative one and it obeyed probabilistic aleatory sampling with proportional stratification. The gathering of information was carried out by means of survey. The population object of study the city of Pasto corresponded to 27.428 homes distributed in the strata, three, four, five and six. The calculated sample was of 383 observations, with a level of trust of 95% and a margin of error of 5%. The strategies were formulated with base in the marketing mixture (price, product, square, promotion and publicity. As results and conclusions it was possible to determine that the consumption of the cuy meat is occasional with quantities between one and four channels. The cuy in the moment is not sold in fame neither in supermarkets, the prices were analyzed in commercial (700 grams of roasted cuy $24.000 assayers and squares of markets (Kilo of alive cuy around $ 12.000. The percentage of participation of the cuy meat was of 3,3% of the total consumption of meats. The estimative of the potential demand for the new presentations was of: 92.158 units/year for the smoky cuy, 69.119 units/year for the one broster, and croquettes with 65.827 units/year, with pesos of 750 g and 500 g. Those interviewed preferred the smoky cuy meat.

Alloscardovia venturai sp nov., a fructose 6-phosphate phosphoketolase-positive species isolated from the oral cavity of a guinea-pig (Cavia aperea f. porcellus)

Czech Academy of Sciences Publication Activity Database

Sechovcová, Hana; Killer, Jiří; Pechar, R.; Geigerová, M.; Švejstil, R.; Salmonová, H.; Mekadim, Ch.; Rada, V.; Vlková, E.; Kofroňová, O.; Benada, Oldřich

2017-01-01

Roč. 67, č. 7 (2017), s. 2842-2847 ISSN 1466-5026 R&D Projects: GA ČR GA13-08803S; GA MŠk(CZ) LO1509 Institutional support: RVO:67985904 ; RVO:61388971 Keywords : Alloscardovia * guinea pig * Bifidobacteriaceae Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.134, year: 2016

Straminipilous organisms growing on herbivorous pirapitinga (Piaractus brachypomus and carnivorous piranha (Pygocentrus nattereri from Poland Organismos stramenophila em crescimento na herbívora pirapitinga (Piaractus brachypomus e na carnívora piranha (Pygocentrus nattereri da Polônia

Directory of Open Access Journals (Sweden)

B. Czeczuga

2010-05-01

Full Text Available We investigated the growth of straminipilous organisms on the skin, muscles and liver of herbivorous pirapitinga (Piaractus brachypomus and carnivorous piranha (Pygocentrus nattereri in water of three different eutrophication levels. Sixteen straminipilous organism species were found growing on the investigated body parts of both species of fish used as baits. The higher number of species was found on the baits of carnivorous species (15 when compared with the ones from the herbivorous pirapitinga (10 species. The highest number of straminipilous organisms species developed on the skin of both species of fish. The highest number of species of straminipilous organisms was observed growing in the water of the BiaBa river (middle eutrophication, while the lowest number occurred in the baits of vessels with water from the Dojlidy pond (low eutrophication.Investigamos o crescimento de organismos stramenophila sobre a pele, músculos e fígado da herbívora pirapitinga (Piaractus brachypomus e da carnívora piranha (Pygocentrus nattereri em águas de três diferentes níveis de eutrofização. Dezesseis espécies de organismos stramenophila foram encontradas crescendo sobre as partes do corpo investigadas de ambas as espécies de peixes utilizadas como cobaias. O maior número de espécies foi encontrado em cobaias de espécies carnívoras (15, quando comparado com o da herbívora pirapitinga (10 espécies. A maioria das espécies de organismos stramenophila desenvolveu-se sobre a pele de ambas as espécies de peixes. O maior número de espécies de organismos stramenophila foi observado em crescimento nas águas do rio BiaBa (eutrofização do meio, enquanto o número mais baixo ocorreu em cobaias de vasos com água do lago de Dojlidy (eutrofização baixa.

Effects of phenol, glycerin and acetic acid on the liver of guinea pigs Efeitos da soluçao de fenol, glicerina e ácido acético em figado de cobaias

Directory of Open Access Journals (Sweden)

Rogério Saad-Hossne

2007-12-01

Full Text Available PURPOSE: To investigate the histolytic action of a solution composed of phenol, glycerin and acetic acid for irresectable hepatic metastasis. METHODS: Thirty-two (n=32 guinea pigs were randomly distributed into two groups of 16 animals. The animals in group 1 (experimental and group 2 (control were redistributed in two subgroups of eight animals each, according to the day of sacrifice (24 hours and four weeks after injection. All the animals were submitted to median laparotomy, which was followed by the injection of solution E and saline into the livers of subjects in both the experimental and control groups, respectively. The animals were evaluated for biochemical and anatomopathological (liver alterations after 24 hours and four weeks of the experiment. RESULTS: It was observed that solution E produced necrosis limited to the injected area and that hepatic tissue recovery occurred after four weeks with the formation of a small necrosis area. No biochemical parameters were altered either in the experimental or in the control group. CONCLUSION: In view of the obtained results, the possibility of using the proposed solution can be considered in cases of irresectable metastasis.OBJETIVO: Investigar a ação histolítica da solução composta de fenol, glicerina e ácido acético para os casos de metástases hepáticas não ressecáveis. MÉTODOS: Foram utilizadas 32 cobaias, distribuídas, por sorteio, em quatro grupos: experimental (24 horas e quatro semanas e controle (24 horas e quatro semanas; todos os animais foram submetidos a laparotomia mediana e realizada a injeção da solução E (grupo experimental ou solução fisiológica (grupo controle. Foram estudadas as alterações bioquímicas e anatomopatológicas (fígado com 24 horas e quatro semanas de evolução. RESULTADOS: Verificou-se que a solução E produz necrose delimitada à área infiltrada apos 24 horas e que ao final de quatro semanas ocorreu regeneração do tecido hep

Communication calls produced by electrical stimulation of four structures in the guinea pig brain

Science.gov (United States)

Green, David B.; Shackleton, Trevor M.; Grimsley, Jasmine M. S.; Zobay, Oliver; Palmer, Alan R.

2018-01-01

One of the main central processes affecting the cortical representation of conspecific vocalizations is the collateral output from the extended motor system for call generation. Before starting to study this interaction we sought to compare the characteristics of calls produced by stimulating four different parts of the brain in guinea pigs (Cavia porcellus). By using anaesthetised animals we were able to reposition electrodes without distressing the animals. Trains of 100 electrical pulses were used to stimulate the midbrain periaqueductal grey (PAG), hypothalamus, amygdala, and anterior cingulate cortex (ACC). Each structure produced a similar range of calls, but in significantly different proportions. Two of the spontaneous calls (chirrup and purr) were never produced by electrical stimulation and although we identified versions of chutter, durr and tooth chatter, they differed significantly from our natural call templates. However, we were routinely able to elicit seven other identifiable calls. All seven calls were produced both during the 1.6 s period of stimulation and subsequently in a period which could last for more than a minute. A single stimulation site could produce four or five different calls, but the amygdala was much less likely to produce a scream, whistle or rising whistle than any of the other structures. These three high-frequency calls were more likely to be produced by females than males. There were also differences in the timing of the call production with the amygdala primarily producing calls during the electrical stimulation and the hypothalamus mainly producing calls after the electrical stimulation. For all four structures a significantly higher stimulation current was required in males than females. We conclude that all four structures can be stimulated to produce fictive vocalizations that should be useful in studying the relationship between the vocal motor system and cortical sensory representation. PMID:29584746

Repeated anaesthesia with isoflurane and medetomidine-midazolam-fentanyl in guinea pigs and its influence on physiological parameters.

Directory of Open Access Journals (Sweden)

Sabrina Schmitz

Full Text Available Repeated anaesthesia may be required in experimental protocols and in daily veterinary practice, but anaesthesia is known to alter physiological parameters in GPs (Cavia porcellus, GPs. This study investigated the effects of repeated anaesthesia with either medetomidine-midazolam-fentanyl (MMF or isoflurane (Iso on physiological parameters in the GP. Twelve GPs were repeatedly administered with MMF or Iso in two anaesthesia sets. One set consisted of six 40-min anaesthesias, performed over 3 weeks (2 per week; the anaesthetic used first was randomized. Prior to Iso anaesthesia, atropine was injected. MMF anaesthesia was antagonized with AFN (atipamezole-flumazenil-naloxone. Abdominally implanted radio-telemetry devices recorded the mean arterial blood pressure (MAP, heart rate (HR and core body temperature continuously. Additionally, respiratory rate, blood glucose and body weight were assessed. An operable state could be achieved and maintained for 40 min in all GPs. During the surgical tolerance with MMF, the GPs showed a large MAP range between the individuals. In the MMF wake- up phase, the time was shortened until the righting reflex (RR returned and that occurred at lower MAP and HR values. Repeated Iso anaesthesia led to an increasing HR during induction (anaesthesias 2-6, non-surgical tolerance (anaesthesias 3-6 and surgical tolerance (anaesthesias 4, 6. Both anaesthetics may be used repeatedly, as repeating the anaesthesias resulted in only slightly different physiological parameters, compared to those seen with single anaesthesias. The regular atropine premedication induced HR increases and repeated MMF anaesthesia resulted in a metabolism increase which led to the faster return of RR. Nevertheless, Iso's anaesthesia effects of strong respiratory depression and severe hypotension remained. Based on this increased anaesthesia risk with Iso, MMF anaesthesia is preferable for repeated use in GPs.

Communication calls produced by electrical stimulation of four structures in the guinea pig brain.

Directory of Open Access Journals (Sweden)

David B Green

Full Text Available One of the main central processes affecting the cortical representation of conspecific vocalizations is the collateral output from the extended motor system for call generation. Before starting to study this interaction we sought to compare the characteristics of calls produced by stimulating four different parts of the brain in guinea pigs (Cavia porcellus. By using anaesthetised animals we were able to reposition electrodes without distressing the animals. Trains of 100 electrical pulses were used to stimulate the midbrain periaqueductal grey (PAG, hypothalamus, amygdala, and anterior cingulate cortex (ACC. Each structure produced a similar range of calls, but in significantly different proportions. Two of the spontaneous calls (chirrup and purr were never produced by electrical stimulation and although we identified versions of chutter, durr and tooth chatter, they differed significantly from our natural call templates. However, we were routinely able to elicit seven other identifiable calls. All seven calls were produced both during the 1.6 s period of stimulation and subsequently in a period which could last for more than a minute. A single stimulation site could produce four or five different calls, but the amygdala was much less likely to produce a scream, whistle or rising whistle than any of the other structures. These three high-frequency calls were more likely to be produced by females than males. There were also differences in the timing of the call production with the amygdala primarily producing calls during the electrical stimulation and the hypothalamus mainly producing calls after the electrical stimulation. For all four structures a significantly higher stimulation current was required in males than females. We conclude that all four structures can be stimulated to produce fictive vocalizations that should be useful in studying the relationship between the vocal motor system and cortical sensory representation.

Communication calls produced by electrical stimulation of four structures in the guinea pig brain.

Science.gov (United States)

Green, David B; Shackleton, Trevor M; Grimsley, Jasmine M S; Zobay, Oliver; Palmer, Alan R; Wallace, Mark N

2018-01-01

One of the main central processes affecting the cortical representation of conspecific vocalizations is the collateral output from the extended motor system for call generation. Before starting to study this interaction we sought to compare the characteristics of calls produced by stimulating four different parts of the brain in guinea pigs (Cavia porcellus). By using anaesthetised animals we were able to reposition electrodes without distressing the animals. Trains of 100 electrical pulses were used to stimulate the midbrain periaqueductal grey (PAG), hypothalamus, amygdala, and anterior cingulate cortex (ACC). Each structure produced a similar range of calls, but in significantly different proportions. Two of the spontaneous calls (chirrup and purr) were never produced by electrical stimulation and although we identified versions of chutter, durr and tooth chatter, they differed significantly from our natural call templates. However, we were routinely able to elicit seven other identifiable calls. All seven calls were produced both during the 1.6 s period of stimulation and subsequently in a period which could last for more than a minute. A single stimulation site could produce four or five different calls, but the amygdala was much less likely to produce a scream, whistle or rising whistle than any of the other structures. These three high-frequency calls were more likely to be produced by females than males. There were also differences in the timing of the call production with the amygdala primarily producing calls during the electrical stimulation and the hypothalamus mainly producing calls after the electrical stimulation. For all four structures a significantly higher stimulation current was required in males than females. We conclude that all four structures can be stimulated to produce fictive vocalizations that should be useful in studying the relationship between the vocal motor system and cortical sensory representation.

EVALUACIÓN in vivo DE Lactobacillus plantarum CON CARACTERÍSTICAS PROBIOTICAS MEDIANTE QUÍMICA SANGUÍNEA, INMUNOHISTOQUÍMICA Y MICROSCOPIA ELECTRÓNICA EN Cavia porcellus

OpenAIRE

HENRY JURADO GÁMEZ; ADRIANA ELISABETH ORBES VILLACORTE; LAURA NATHALY MESÍAS PANTOJA

2017-01-01

Health problems mainly the lack of a specific pharmacology, affect the production parameters and the profitability of productions guinea pig in the department of Nariño. Which is why, new alternatives that promote cleaner production through the use of probiotic lactic acid bacteria (LAB) are raised. Therefore, the in vivo effect of L. plantarum administration in guinea pigs of alternative to antibiotics in two different diets was assessed. peptides by HPLC was determined in the supernatant, r...

EVALUACIÓN in vivo DE Lactobacillus plantarum CON CARACTERÍSTICAS PROBIOTICAS MEDIANTE QUÍMICA SANGUÍNEA, INMUNOHISTOQUÍMICA Y MICROSCOPIA ELECTRÓNICA EN Cavia porcellus

Directory of Open Access Journals (Sweden)

HENRY JURADO GÁMEZ

2017-12-01

Full Text Available Health problems mainly the lack of a specific pharmacology, affect the production parameters and the profitability of productions guinea pig in the department of Nariño. Which is why, new alternatives that promote cleaner production through the use of probiotic lactic acid bacteria (LAB are raised. Therefore, the in vivo effect of L. plantarum administration in guinea pigs of alternative to antibiotics in two different diets was assessed. peptides by HPLC was determined in the supernatant, resistance to basic pH, analysis of zootechnical parameters, laboratory tests (Table hematic, blood chemistry, partial urine and stool before and after administration to the further selected animals was analyzed effectiveness by colonization tests histopathology, histochemistry, immunohistochemistry and scanning electron microscopy. GPT and CA statistically significant differences between diets. Also different degrees of severity and type of injury in the intestinal tissues adherent bacteria was observed hairiness with Gram staining and scanning electron microscopy. The PAS was positive for all treatments and immunostaining was mild, moderate or severe depending on the intestinal segment.

The Application of the Fluoride Reactivation Process to the Detection of Sarin and Soman Nerve Agent Exposures in Biological Samples

National Research Council Canada - National Science Library

Adams, T. K; Capacio, B. R; Smith, J. R; Whalley, C. E; Korte, W. D

2004-01-01

The fluoride reactivation process was evaluated for measuring the level of sarin or soman nerve agents reactivated from substrates in plasma and tissue from in vivo exposed guinea pigs (Cava porcellus...

Quantity and quality of guinea pig (cavia porcellus) spermatozoa after administration of methanol extract of bitter melon (momordica charantia) seed and depot medroxy progesterone acetate (DMPA)

Science.gov (United States)

Ilyas, Syafruddin; Hutahaean, Salomo; Nursal

2018-03-01

The discovery of male contraceptive drugs continues to be pursued, due to the few participation of men associated with the lack of contraceptive options for men. The combination of bitter melon seed methanol extract and DMPA are the options that currently apply to men. Therefore, the use of guinea pigs as experimental animals conducted research using experimental methods with complete randomized design (CRD). There are 4 control groups and 4 treatment groups. The first group, control group of dimethyl sulphoxide (DMSO) for 0 week (K0), The second one, bitter melon seed extract of 50 mg/100g Body Weight/day for 0 week (P0), the third one, control group of dimethyl sulfoxide (DMSO) for 4 weeks (K1), the fourth one, bitter melon seed extract of 50 mg/100g BW/day for 4 weeks + Depot medroxy Progesterone Acetate (P1), the fifth one, control group of dimethyl sulfoxide (DMSO) for 8 weeks (K2), the sixth one, bitter melon seed extract of 50 mg/100g BW/day for 8 weeks + DMPA (P2), the seventh one, control group of dimethyl sulfoxide (DMSO) for 12 weeks (K3), the eighth one, bitter melon seed extract of 50 mg/100g BW/day for 12 weeks + DMPA (P3). Methanol extract of bitter melon seed to decrease the quantity and quality of guinea pig spermatozoa decreased significantly, i.e. viability and normal morphology of spermatozoa (p<0.05).

Download this PDF file

African Journals Online (AJOL)

Femi Olorunniji

2014-06-30

Jun 30, 2014 ... ... parameters in improved indigenous NIGERHYB pigs in Southwestern Nigeria .... NIGERHYB pigs as preferred alternative for swine production in South Western .... of Weiser-Maples guinea pigs (Cava porcellus). Laboratory ...

Potential of pomegranate fruit extract (Punica granatum Linn.) to increase vascular endothelial growth factor and platelet-derived growth factor expressions on the post-tooth extraction wound of Cavia cobaya.

Science.gov (United States)

Nirwana, Intan; Rachmadi, Priyawan; Rianti, Devi

2017-08-01

Pomegranates fruit extracts have several activities, among others, anti-inflammatory, antibacterial, and antioxidants that have the main content punicalagin and ellagic acid. Pomegranate has the ability of various therapies through different mechanisms. Vascular endothelial growth factor (VEGF) function was to form new blood vessels produced by various cells one of them was macrophages. Platelet-derived growth factor (PDGF) was a growth factor proven chemotactic, increased fibroblast proliferation and collagen matrix production. In addition, VEGF and PDGF synergize in their ability to vascularize tissues. The PDGF function was to stabilize and regulate maturation of new blood vessels. Activities of pomegranate fruit extract were observed by measuring the increased of VEGF and PDGF expression as a marker of wound healing process. To investigate the potential of pomegranate extracts on the tooth extraction wound to increase the expression of VEGF and PDGF on the 4 th day of wound healing process. This study used 12 Cavia cobaya , which were divided into two groups, namely, the provision of 3% sodium carboxymethyl cellulose and pomegranate extract. The 12 C. cobaya would be executed on the 4 th day, the lower jaw of experimental animals was taken, decalcified about 30 days. The expression of VEGF and PDGF was examined using immunohistochemical techniques. The differences of VEGF and PDGF expression were evaluated statistically using t-test. Statistically analysis showed that there were significant differences between control and treatment groups (p<0.05). Pomegranate fruit extract administration increased VEGF and PDGF expression on post-tooth extraction wound.

Ascorbic acid suppresses endotoxemia and NF-κB signaling cascade in alcoholic liver fibrosis in guinea pigs: A mechanistic approach

Energy Technology Data Exchange (ETDEWEB)

Abhilash, P.A.; Harikrishnan, R.; Indira, M., E-mail: indiramadambath@gmail.com

2014-01-15

Alcohol consumption increases the small intestinal bacterial overgrowth (SIBO) and intestinal permeability of endotoxin. The endotoxin mediated inflammatory signaling plays a major role in alcoholic liver fibrosis. We evaluated the effect of ascorbic acid (AA), silymarin and alcohol abstention on the alcohol induced endotoxemia and NF-κB activation cascade pathway in guinea pigs (Cavia porcellus). Guinea pigs were administered ethanol at a daily dose of 4 g/kg b.wt for 90 days. After 90 days, ethanol administration was stopped. The ethanol treated animals were divided into abstention, silymarin (250 mg/kg b.wt) and AA (250 mg/kg b.wt) supplemented groups and maintained for 30 days. The SIBO, intestinal permeability and endotoxin were significantly increased in the ethanol group. The mRNA expressions of intestinal proteins claudin, occludin and zona occludens-1 were significantly decreased in ethanol group. The mRNA levels of inflammatory receptors, activity of IKKβ and the protein expressions of phospho-IκBα, NF-κB, TNF-α, TGF-β{sub 1} and IL-6 were also altered in ethanol group. The expressions of fibrosis markers α-SMA, α{sub 1} (I) collagen and sirius red staining in the liver revealed the induction of fibrosis. But the supplementation of AA could induce greater reduction of ethanol induced SIBO, intestinal barrier defects, NF-κB activation and liver fibrosis than silymarin. The possible mechanism may be the inhibitory effect of AA on SIBO, intestinal barrier defect and IKKβ, which decreased the activation of NF-κB and synthesis of cytokines. This might have led to suppression of HSCs activation and liver fibrosis. - Highlights: • Alcohol increases intestinal bacterial overgrowth and permeability of endotoxin. • Endotoxin mediated inflammation plays a major role in alcoholic liver fibrosis. • Ascorbic acid reduces endotoxemia, NF-κB activation and proinflammatory cytokines. • AA's action is by inhibition of SIBO, IKKβ and alteration of

Quantitative and histological assessment of maternal-fetal transmission of Trypanosoma cruzi in guinea pigs: An experimental model of congenital Chagas disease.

Directory of Open Access Journals (Sweden)

Jatziri Torres-Vargas

2018-01-01

Full Text Available We evaluated the effect of Trypanosoma cruzi infection on fertility, gestation outcome, and maternal-fetal transmission in guinea pigs (Cavia porcellus.Animals were infected with T. cruzi H4 strain (TcI lineage before gestation (IBG or during gestation (IDG. Tissue and sera samples of dams and fetuses were obtained near parturition.All IBG and IDG dams were seropositive by two tests, and exhibited blood parasite load of 1.62±2.2 and 50.1±62 parasites/μl, respectively, by quantitative PCR. Histological evaluation showed muscle fiber degeneration and cellular necrosis in all infected dams. Parasite nests were not detected in infected dams by histology. However, qPCR analysis detected parasites-eq/g heart tissue of 153±104.7 and 169.3±129.4 in IBG and IDG dams, respectively. All fetuses of infected dams were positive for anti-parasite IgG antibodies and tissue parasites by qPCR, but presented a low level of tissue inflammatory infiltrate. Fetuses of IDG (vs. IBG dams exhibited higher degree of muscle fiber degeneration and cellular necrosis in the heart and skeletal tissues. The placental tissue exhibited no inflammatory lesions and amastigote nests, yet parasites-eq/g of 381.2±34.3 and 79.2±84.9 were detected in IDG and IBG placentas, respectively. Fetal development was compromised, and evidenced by a decline in weight, crow-rump length, and abdominal width in both groups.T. cruzi TcI has a high capacity of congenital transmission even when it was inoculated at a very low dose before or during gestation. Tissue lesions, parasite load, and fetal under development provide evidence for high virulence of the parasite during pregnancy. Despite finding of high parasite burden by qPCR, placentas were protected from cellular damage. Our studies offer an experimental model to study the efficacy of vaccines and drugs against congenital transmission of T. cruzi. These results also call for T. cruzi screening in pregnant women and adequate follow up of

[Communication and auditory behavior obtained by auditory evoked potentials in mammals, birds, amphibians, and reptiles].

Science.gov (United States)

Arch-Tirado, Emilio; Collado-Corona, Miguel Angel; Morales-Martínez, José de Jesús

2004-01-01

amphibians, Frog catesbiana (frog bull, 30 animals); reptiles, Sceloporus torcuatus (common small lizard, 22 animals); birds: Columba livia (common dove, 20 animals), and mammals, Cavia porcellus, (guinea pig, 20 animals). With regard to lodging, all animals were maintained at the Institute of Human Communication Disorders, were fed with special food for each species, and had water available ad libitum. Regarding procedure, for carrying out analysis of auditory evoked potentials of brain stem SPL amphibians, birds, and mammals were anesthetized with ketamine 20, 25, and 50 mg/kg, by injection. Reptiles were anesthetized by freezing (6 degrees C). Study subjects had needle electrodes placed in an imaginary line on the half sagittal line between both ears and eyes, behind right ear, and behind left ear. Stimulation was carried out inside a no noise site by means of a horn in free field. The sign was filtered at between 100 and 3,000 Hz and analyzed in a computer for provoked potentials (Racia APE 78). In data shown by amphibians, wave-evoked responses showed greater latency than those of the other species. In reptiles, latency was observed as reduced in comparison with amphibians. In the case of birds, lesser latency values were observed, while in the case of guinea pigs latencies were greater than those of doves but they were stimulated by 10 dB, which demonstrated best auditory threshold in the four studied species. Last, it was corroborated that as the auditory threshold of each species it descends conforms to it advances in the phylogenetic scale. Beginning with these registrations, we care able to say that response for evoked brain stem potential showed to be more complex and lesser values of absolute latency as we advance along the phylogenetic scale; thus, the opposing auditory threshold is better agreement with regard to the phylogenetic scale among studied species. These data indicated to us that seeking of auditory information is more complex in more

Polimorfismos en la longitud de fragmentos amplificados (AFLP´s) a partir de muestras de sangre almacenadas en tarjetas FTA® para la especie Cavia porcellus Lin. (Rodentia: Caviidae)

OpenAIRE

Burgos-Paz, William; Rosero-Galindo, Carol; Cárdenas-Henao, Heiber; Solarte-Portilla, Carlos

2007-01-01

Una manera eficaz de establecer el grado de variabilidad entre y dentro de poblaciones, es a través del análisis de polimorfismos de ADN con marcadores moleculares como los AFLP`s. En este artículo se presenta una metodología que combina la utilización de tarjetas de FTA® (Whatman Bioscience, Cambridge) para colección y conservación de muestras de sangre, con los procedimientos de extracción de ADN y obtención de marcadores AFLP´s, aspectos sobre los cuales no existen antecedentes para la esp...

Efecto del Manano Oligosacárido (MOS) a dosis de 1g/Kg en un alimento balanceado en el crecimiento y mortalidad en cobayos (Cavia porcellus) hembras

OpenAIRE

Siguencia Fernandez, Jessica Noemi

2017-01-01

This research evaluates the effect of mannan-oligosaccharide (MOS) on weight gain, feed conversion and mortality in female guinea pigs, three treatments were carried out: (a) Control, (b) MOS and (c) Growth Promoter Antibiotic for 10 consecutive weeks; no significant effects of the treatments on the variables evaluated were detected. Esta investigación evalúa el efecto del manano-oligosacárido (MOS) sobre el incremento de peso, conversión alimenticia y mortalidad en cobayos hembras, se rea...

Effect of mangosteen peel extract combined with demineralized freezed-dried bovine bone xenograft on osteoblast and osteoclast formation in post tooth extraction socket

Directory of Open Access Journals (Sweden)

Utari Kresnoadi

2016-12-01

Full Text Available Background: Tooth extraction, a common procedure in dentistry, can cause bone resorption during socket healing. Therefore, it is important to perform socket preservation procedure to maintain alveolar bone. Providing a combination of mangosteen peel extract with demineralized freezed-dried bovine bone xenograft (DFDBBX in tooth extraction socket was expected to accelerate alveol bone formation. Purpose: This study aims to determine the effect of mangosteen peel extract combined with DFDBBX introduced into the socket of post tooth extraction on the formation of osteoblasts and osteoclasts. Method: Twenty-eight (28 Cavia cobayas were divided into four groups. Extraction to the lower left incisor of Cavia cobaya was performed. The extraction socket was filled with 25 gram of PEG (group I as a control, active materials consisted of mangosteen peel extract and DFDBBX 0.5% (group II, active materials consisted of mangosteen peel extract and DFDBBX 1% (group III, and active materials consisted of mangosteen peel extract and DFDBBX 2% (group IV. After thirty days, those Cavia cobayas were sacrificed. By using HE on Histopatological examination, the number of osteoblasts and osteoclasts were measured by light microscope with 400 times of magnification. The statistical analysis was then performed using oneway Anova & TukeyHSD test. Result: The component active materials consisted of mangosteen peel extract and DFDBBX 2% had the most significant results related to the formation of osteoblasts and osteoclasts. Conclusion: Mangosteen peel extract combined with DFDBBX can increase osteoblasts and decrease osteoclasts in the socket of tooth extraction in Cavia cobaya. The combination of mangosteen peel extract and DFDBBX 2% is the most effective material in increasing osteoblast and decreasing osteoclast.

ORF Alignment: NC_003361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available on ... tolerance protein [Chlamydophila caviae GPIC] ... Length = 102 ... Query: 2 ... TPVIIFTQLPSQEEADCISH...ALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI 61 ... TPVIIFTQLPSQEEADCISH...ALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI Sbjct: 1 ... TPVIIFTQLPSQEEADCISHALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI 60 ...

ORF Alignment: NC_003361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Chlamydophila caviae GPIC] ... Length = 212 ... Query: 1 ... MNKKQRQKTLIAPSIMGGDLACIGAEAKKIEESGADLIHID...VMDGHFVPNLTFGPGVIAA 60 ... MNKKQRQKTLIAPSIMGGDLACIGAEAKKIEESGADLIHIDVMDGHF...VPNLTFGPGVIAA Sbjct: 1 ... MNKKQRQKTLIAPSIMGGDLACIGAEAKKIEESGADLIHIDVMDGHFVPNLTFGPGVIAA 60 ... Query: 121 FSPETSI

Evaluación de la inclusión del manano oligosacarido a dosis de 1.5 g/kg en el crecimiento y mortalidad en cobayos (Cavia porcellus) machos

OpenAIRE

Bermeo Sacta, Jessica Alexandra

2018-01-01

El trabajo experimental fue realizado en la Granja Experimental Paute en la provincia del Azuay, cantón Paute, en el cual se evaluó la inclusión del prebiótico manano oligosacárido (MOS) en el balanceado de los cobayos machos durante diez semanas, con el fin de evaluar los caracteres de crecimiento y mortalidad, como resultado no se obtuvo efectos significativos. The experimental work was carried out in the experimental farm in the province of Azuay Paute. In inclusion of the oligosacchari...

Aeromonas spp. isolated from oysters (Crassostrea rhizophorea from a natural oyster bed, Ceará, Brazil Aeromonas spp. isoladas de ostras (Crassostrea rhizophorea coletadas em um criadouro natural, Ceará, Brazil

Directory of Open Access Journals (Sweden)

Norma S. Evangelista-Barreto

2006-06-01

Full Text Available Between April and October 2002, thirty fortnightly collections of oysters (Crassostrea rhizophorea from a natural oyster bed at the Cocó River estuary in the Sabiaguaba region (Fortaleza, Ceará, Brazil were carried out, aiming to isolate Aeromonas spp. strains. Oyster samples were submitted to the direct plating (DP and the presence/absence (P/A methods. Aeromonas were identified in 15 (50% samples analyzed by the DP method and in 13 (43% analyzed by the P/A method. A. caviae, A. eucrenophila, A. media, A. sobria, A. trota, A. veronii bv. sobria, A. veronii bv. veronii and Aeromonas sp. were isolated. The predominant species was A. veronii (both biovars, which was identified in 13 (43% samples, followed by A. media in 11 (37% and A. caviae in seven (23%. From the 59 strains identified, 28 (48% presented resistance to at least one of the eight antibiotics tested.Foram realizadas 30 coletas quinzenais, entre abril e outubro de 2002, de ostras (Crassostrea rhizophorea de um criadouro natural, no estuário do rio Cocó (Fortaleza/Ceará/Brasil, objetivando-se isolar cepas de Aeromonas spp. As amostras de ostras foram submetidas aos métodos de plaqueamento direto (PD e presença/ausência (P/A. Foram identificadas Aeromonas em 15 (50% amostras analisadas pelo método PD e em 13 (43% pelo método P/A. Foram isoladas: A. caviae, A. eucrenophila, A. media, A. sobria, A. trota, A. veronii bv. sobria, A. veronii bv. veronii e Aeromonas sp. A espécie predominate foi A. veronii (ambos biovars, identificada em 13 (43% amostras, seguida de A. media em 11 (37% e A. caviae em 7 (23%. Das 59 cepas identificadas, 28 (48% apresentaram resistência a pelo menos um, dos oitos antibióticos testados.

Effects of Crude Oil Contaminated Water On Haematocrit and ...

African Journals Online (AJOL)

Twenty-four guinea pigs (Caria porcellus) obtained from the Animal House of College of Health Sciences, University of Port-Harcourt, Nigeria, were weighed individually and divided into six groups of four per group. They were allowed access to rat feed and tap water ad libitum for two weeks acclimatization. Different ...

INCLUSIÓN DE HARINAS DE FOLLAJES ARBÓREOS Y ARBUSTIVOS TROPICALES (Morus alba, Erythrina poeppigiana, Tithonia diversifolia EHibiscus rosa-sinensis EN LA ALIMENTACIÓN DE CUYES (Cavia porcellus Linnaeus

Directory of Open Access Journals (Sweden)

G. A. Meza

2014-01-01

Full Text Available La investigación se ejecutó en la Finca Experimental “La María” propiedad de la Univer-sidad Técnica Estatal de Quevedo (UTEQ localizada en el km 71/2de la vía Quevedo-Mocache; Provincia de Los Ríos cuya ubicación geográfica de 1º 6’ 23” de latitud sury 79º 29’ 12” de longitud oeste y a una altura de 73 m.s.n.m. El objetivo principal fueevaluar el comportamiento productivo de cuyes con la inclusión del 20% de harinasderivadas de follajes arbustivos y arbóreos tropicales. Se utilizaron 40 cuyes macho de 30días de edad. Se empleó un diseño completamente al azar con cinco tratamientos, cuatroréplicas y la unidad experimental estuvo conformado por dos cuyes. Para determinarlas diferencias entre medias de tratamientos se aplicó la prueba de Tukey (P≤0.05. Seevaluaron cinco dietas-tratamientos: (T0 dieta 100% balanceado, (T1 80% dieta y 20%harina deMorus alba, (T2 80% dieta y 20% harina deErythrina poeppigiana, (T3 80%dieta y 20% harina deTithonia diversifolia, (T4 80% dieta y 20% harina deHibiscusrosa-sinensis. Las variables bajo estudio fueron: consumo de alimento de balanceado enmateria seca (CABMS, g, ganancia de peso (GP, g, índice de conversión alimenticia(ICA y rendimiento en canal (RC, %. La rentabilidad de los tratamientos se determinóa través de la relación beneficio-costo (R b/c. Los mayores (P<0.01 CABMS, GP-ICAy RC-Rentabilidad, la registraron los tratamientos: T0 (48.34 g MS animal-1d-1, T1(8.80 g animal-1d-1y 5.04 y el T3 (77.67% y 26.20%, respectivamente.

A systems biology approach reveals a link between systemic cytokines and skeletal muscle energy metabolism in a rodent smoking model and human COPD.

Science.gov (United States)

Davidsen, Peter K; Herbert, John M; Antczak, Philipp; Clarke, Kim; Ferrer, Elisabet; Peinado, Victor I; Gonzalez, Constancio; Roca, Josep; Egginton, Stuart; Barberá, Joan A; Falciani, Francesco

2014-01-01

A relatively large percentage of patients with chronic obstructive pulmonary disease (COPD) develop systemic co-morbidities that affect prognosis, among which muscle wasting is particularly debilitating. Despite significant research effort, the pathophysiology of this important extrapulmonary manifestation is still unclear. A key question that remains unanswered is to what extent systemic inflammatory mediators might play a role in this pathology. Cigarette smoke (CS) is the main risk factor for developing COPD and therefore animal models chronically exposed to CS have been proposed for mechanistic studies and biomarker discovery. Although mice have been successfully used as a pre-clinical in vivo model to study the pulmonary effects of acute and chronic CS exposure, data suggest that they may be inadequate models for studying the effects of CS on peripheral muscle function. In contrast, recent findings indicate that the guinea pig model (Cavia porcellus) may better mimic muscle wasting. We have used a systems biology approach to compare the transcriptional profile of hindlimb skeletal muscles from a Guinea pig rodent model exposed to CS and/or chronic hypoxia to COPD patients with muscle wasting. We show that guinea pigs exposed to long-term CS accurately reflect most of the transcriptional changes observed in dysfunctional limb muscle of severe COPD patients when compared to matched controls. Using network inference, we could then show that the expression profile in whole lung of genes encoding for soluble inflammatory mediators is informative of the molecular state of skeletal muscles in the guinea pig smoking model. Finally, we show that CXCL10 and CXCL9, two of the candidate systemic cytokines identified using this pre-clinical model, are indeed detected at significantly higher levels in serum of COPD patients, and that their serum protein level is inversely correlated with the expression of aerobic energy metabolism genes in skeletal muscle. We conclude that

Biosorption of Cr (III) from aqueous solution by the leaf biomass of ...

African Journals Online (AJOL)

Michael Horsfall

long time contact causes skin allergy and cancer. (Yun et al., 2001). ... same active metal binding sites such as carboxylate or amino groups ..... (silverleaf night shade). Proceedings of ... caviae, cell surface adsorption: Physical. Chemistry and ...

Use of a Guinea pig-specific transcriptome array for evaluation of protective immunity against genital chlamydial infection following intranasal vaccination in Guinea pigs.

Science.gov (United States)

Wali, Shradha; Gupta, Rishein; Veselenak, Ronald L; Li, Yansong; Yu, Jieh-Juen; Murthy, Ashlesh K; Cap, Andrew P; Guentzel, M Neal; Chambers, James P; Zhong, Guangming; Rank, Roger G; Pyles, Richard B; Arulanandam, Bernard P

2014-01-01

Guinea pigs have been used as a second animal model to validate putative anti-chlamydial vaccine candidates tested in mice. However, the lack of guinea pig-specific reagents has limited the utility of this animal model in Chlamydia sp. vaccine studies. Using a novel guinea pig-specific transcriptome array, we determined correlates of protection in guinea pigs vaccinated with Chlamydia caviae (C. caviae) via the intranasal route, previously reported by us and others to provide robust antigen specific immunity against subsequent intravaginal challenge. C. caviae vaccinated guinea pigs resolved genital infection by day 3 post challenge. In contrast, mock vaccinated animals continued to shed viable Chlamydia up to day 18 post challenge. Importantly, at day 80 post challenge, vaccinated guinea pigs experienced significantly reduced genital pathology - a sequelae of genital chlamydial infections, in comparison to mock vaccinated guinea pigs. Sera from vaccinated guinea pigs displayed antigen specific IgG responses and increased IgG1 and IgG2 titers capable of neutralizing GPIC in vitro. Th1-cellular/inflammatory immune genes and Th2-humoral associated genes were also found to be elevated in vaccinated guinea pigs at day 3 post-challenge and correlated with early clearance of the bacterium. Overall, this study provides the first evidence of guinea pig-specific genes involved in anti-chlamydial vaccination and illustrates the enhancement of the utility of this animal model in chlamydial pathogenesis.

Use of a chiA probe for detection of chitinase genes in bacteria from the Chesapeake Bay

Digital Repository Service at National Institute of Oceanography (India)

Ramaiah, N.; Hill, R.T.; Chun, J.; Ravel, J.; Matte, M.H.; Straube, W.L.; Colwell, R.R.

PCR primers specific for the chiA gene were designed by alignment and selection of highly conserved regions of chiA sequences from Serratia marcescens, Alteromonas sp., Bacillus circulans and Aeromonas caviae. These primers were used to amplify a...

Micromamiferos andinos holocenicos del sitio arqueologico Inca Cueva 5, Ju Juy, Argentina: tafonomia, zoogeografia y reconstruccion paleoambiental

Directory of Open Access Journals (Sweden)

Ortiz, P. E.

2002-08-01

Full Text Available A micromammal archaeological sequence (2120 f 120 to 780 f 100 years BP from Inca Cueva 5 site (23" 05' S - 65" 27' W; 3700 m.a.s.l., Jujuy Province, Argentina was studied. The following mammalian taxa were recorded: Order Didelphimorphia, Family Didelphidae, Thylamys cf. T. pallidior; Order Rodentia, Family Muridae, Akodon cf. A. albiventer, Andinomys edax, Auliscomys sublimis, Calomys lepidus, Neotomys ebriosus, Phyllotis sp.; Family Caviidae, Cavia cf. C. tschudii, Galea musteloides; Family Abrocomidae, Abrocoma cinerea; Family Chinchillidae, Lagidium viscacia; Family Octodontidae, Octodontomys gliroides. The taphonomy indicates that the sequence is an owl pellet accumulation inside the cave. The general landscape corresponds to the oriental border of the Puna steppe, with scattered shrub and low brush vegetation. Near the site there are small tree groups of Polylepis australis as well as small streams covered with grass and ciperaceous vegetation known as «vegas». Al1 the recorded taxa at Inca Cueva 5 exist today in Puna and Prepuna environments from Jujuy and Salta Provinces and southem Bolivia, excepting Cavia cf. C. tschudii. The modem records of this species in northem Argentina and southern Bolivia come from localities with high montane bunchgrass prairies and forests of the humid Yungas phytogeographical region. The presence of this species in the sequence suggests wetter climatic conditions on this region when the archaeological site was originated. Later drier conditions, caused probably by anthropic influence in the last 500 years, produced the retraction of Cavia tschudii to the moist eastern side of the Andes and its disappeareance of the Puna areas.El sitio arqueológico Inca Cueva 5 se encuentra en la provincia de Jujuy, Argentina, en el borde oriental de la región de la Puna (23" 05' S - 65" 27' W; 3700 m s n m y está fechado entre 2120 f 120 y 780 f 100 años radiocarbónicos AP. El estudio de una pequeña muestra de

Aeromonas associated diarrhoeal disease in south Brazil: prevalence, virulence factors and antimicrobial resistance Aeromonas associadas a diarréias no sul do Brasil: prevalência, fatores de virulência, e resistência a antibiótico

Directory of Open Access Journals (Sweden)

Ivani M.F. Guerra

2007-12-01

Full Text Available Aeromonas were isolated from 27 (6.6% of 408 patients admitted with acute gastroenteritis in two hospitals at Rio Grande do Sul, Brazil. Isolates were classified as A. hydrophila (51.8%, A. caviae (40.8%, and A. veronii biotype sobria (7.4%. The highest prevalence of Aeromonas associated infections occurred in lactants and children. Virulence genes (aerA -aerolysin/hemolysin, ahpA -serine-protease, satA - glycerophospholipid-cholesterol acyltransferase, lipA -lipase, and ahyB -elastase and virulence factors (hemolytic, proteolitic, lipolitic activities, and biofilm formation were identified in most A. hydrophila and A. veronii biotype sobria isolates, with lower frequencies on A. caviae. All Aeromonas isolates were resistant to ampicillin, ticarcillin/clavulanic acid, cephalotin, and cephazolin, and most of them (>70% exhibited resistance to imipenem, carbenicillin, amoxillin/sulbactan, and piperacillin. Multiple-resistance, more than four antibiotics, was evidenced in 29.6% of the isolates. The most efficient antibiotics were the quinolones (ciprofloxacin and norfloxacin, and the aminoglycosides (amikacin and netilmicin.Aeromonas foram isoladas de 27 (6.6% dos 408 pacientes admitidos com gastroenterite aguda em dois hospitais do Rio Grande do Sul, Brasil. Os isolados foram classificados com A. hydrophila (51.8%, A. caviae (40.8%, e A. veronii biotype sobria (7.4%. A maior prevalência de Aeromonas ocorreu em lactantes e crianças. Genes (aerA -aerolisina/hemolisina, ahpA -serina-protease, satA - glicerofosfolipidio-colesterol aciltransferase, lipA -lipase, e ahyB -elastase e factores (atividade hemolítica, proteolítica, lipolítica, e formação de biofilme de virulência foram identificados na maioria dos isolados de A. hydrophila e A. veronii biotype sobria, com freqüências menores em A. caviae. Todos os isolados de Aeromonas apresentaram resistência a ampicilina, ticarcilina/ácido clavulânico, cefalotina e cefazolina, e a maior parte

Suckling behaviour in captive Dendrohyrax arboreus

African Journals Online (AJOL)

1980-11-06

Nov 6, 1980 ... the subject of several studies (Coe 1962; Rahm 1963; Sale. 1965a,b,c; 1966, .... possibly olfactory, stimulus which is not functional until some time after the ... Notes on the habits of the Mount Kenya hyrax (Pro- cavia johnstoni ...

Vulnérabilité des cossettes issues de quelques cultivars d'igname à ...

African Journals Online (AJOL)

Dinoderus porcellus Lesne a été récemment identifié comme un véritable ravageur des stocks de cossettes d'igname en Afrique de l'Ouest. En conséquence, plusieurs méthodes de lutte ont été testées ou envisagées contre ce ravageur et comprennent, entre autres, l'utilisation des cultivars d'ignames résistants à l'insecte.

AEROMONAS SPP BACTEREMIA OF RAINBOW TROUT FRY (ONCORHYNCHUS MYKISS: BIOCHEMICAL CHARACTERIZATION OF THE CAUSATIVE ORGANISM AND ANTIMICROBIAL SUSCEPTIBILITY

Directory of Open Access Journals (Sweden)

Damir Kapetanović

2004-09-01

Full Text Available Aeromonas hydrophila and other members of Aeromonas genus are ubiquitus in aquatic environment and make part of normal bacterial flora of rainbow trout. Aeromonas spp. infections are worldwide registered. Here we present our experience and knowledge on Aeromonas bacteremia, which causes mortality of rainbow trout fry. Rainbow trout fry, 7 month old, started to die in November 2003. Fish samples (17 samples of dead and moribund fish were delivered to the Laboratory for aquaculture. With Api 20 NE tests Aeromonas hydrophila / caviae type I was identified with an average probability of 99.9 % (one test against, as well as Aeromonas hydrophila / caviae type II with an average probability of 99.5 % (one test against from liver, spleen, kidney, intestines and damaged eye. All of isolated and identified samples were tested for antibiotic susceptibility by disc diffusion method. The test showed that specimens were most sensitive on flumequin, and relatively less sensitive on chloramphenicol and enrofloxacin. Therapy was successfully applied with Flubactin®.

Molecular cloning and expression of the IL-10 gene from guinea pigs.

Science.gov (United States)

Dirisala, Vijaya R; Jeevan, Amminikutty; Bix, Gregory; Yoshimura, Teizo; McMurray, David N

2012-04-25

The Guinea pig (Cavia porcellus) is one of the most relevant small animals for modeling human tuberculosis (TB) in terms of susceptibility to low dose aerosol infection, the organization of granulomas, extrapulmonary dissemination and vaccine-induced protection. It is also considered to be a gold standard for a number of other infectious and non-infectious diseases; however, this animal model has a major disadvantage due to the lack of readily available immunological reagents. In the present study, we successfully cloned a cDNA for the critical Th2 cytokine, interleukin-10 (IL-10), from inbred Strain 2 guinea pigs using the DNA sequence information provided by the genome project. The complete open reading frame (ORF) consists of 537 base pairs which encodes a protein of 179 amino acids. This cDNA sequence exhibited 87% homology with human IL-10. Surprisingly, it showed only 84% homology with the previously published IL-10 sequence from the C4-deficient (C4D) guinea pig, leading us to clone IL-10 cDNA from the Hartley strain of guinea pig. The IL-10 gene from the Hartley strain showed 100% homology with the IL-10 sequence of Strain 2 guinea pigs. In order to validate the only published IL-10 sequence existing in Genbank reported from C4D guinea pigs, genomic DNA was isolated from tissues of C4D guinea pigs. Amplification with various sets of primers showed that the IL-10 sequence reported from C4D guinea pigs contained numerous errors. Hence the IL-10 sequence that is being reported by us replaces the earlier sequence making our IL-10 sequence to be the first one accurate from guinea pig. Recombinant guinea pig IL-10 proteins were subsequently expressed in both prokaryotic and eukaryotic cells, purified and were confirmed by N-terminal sequencing. Polyclonal anti-IL-10 antibodies were generated in rabbits using the recombinant IL-10 protein expressed in this study. Taken together, our results indicate that the DNA sequence information provided by the genome project

Hot and cold: medicinal plant uses in Quechua speaking communities in the high Andes (Callejón de Huaylas, Ancash, Perú).

Science.gov (United States)

de la Cruz, Mercedes Gonzales; Malpartida, Severo Baldeón; Santiago, Hamilton Beltrán; Jullian, Valérie; Bourdy, Geneviève

2014-09-11

An ethnopharmacological survey has been set up in high altitude Quechua speaking communities dwelling in Callejón de Huaylas (Ancash department, Peru) and in medicinal plant markets in order to document the medicinal plants use of 178 species within the frame of a traditional Andean medicinal system. A sound ethnopharmacological survey was performed during the years 2011, 2012 and 2013 in different places along Callejón de Huaylas valley in the peruvian Andes, were Quechua speaking communities dwell. Two different methodologies were used: first, plant uses were recorded during walks with informants and in medicinal plant markets held on a regular bases in the area (Huaraz, Carhuaz, Yungay). Secondly, traditional healers (curanderas, curanderos) were interviewed about their practices and healing sessions were observed, in order to understand better the traditional medicinal system as a whole (disease aetiology, diagnosis, treatments, healers). Altogether, 178 medicinal species were collected. Most of the plants found on the market were also found in the wild and vice-versa. Medicinal plant trade is exclusively held by women, selling their merchandise to local people or to big retailer. Plants are classified according their hot or cold virtues, this in accordance with the local conception of the body physiology and disease aetiology, based on a hot-cold polarity. Main use notified for medicinal plants is "(bath) against cold", a prophylactic measure against diseases of cold nature. Other uses include culture bound illnesses i.e. susto, aire, nervios, or heart pain, commonly cited in South America. Regarding symptoms, rheumatic/arthritic pain, musculoskeletal traumas, cough, pulmonary and respiratory problems, gastritis and stomach ache, were the most frequently cited. Diagnosis and treatment are intrinsically linked together and mainly based upon divination techniques using egg and cuy (Cavia porcellus L., Caviidae). Medicinal plants use and traditional medicinal

Computed tomography analysis of guinea pig bone: architecture, bone thickness and dimensions throughout development.

Science.gov (United States)

Witkowska, Agata; Alibhai, Aziza; Hughes, Chloe; Price, Jennifer; Klisch, Karl; Sturrock, Craig J; Rutland, Catrin S

2014-01-01

The domestic guinea pig, Cavia aperea f. porcellus, belongs to the Caviidae family of rodents. It is an important species as a pet, a source of food and in medical research. Adult weight is achieved at 8-12 months and life expectancy is ∼5-6 years. Our aim was to map bone local thickness, structure and dimensions across developmental stages in the normal animal. Guinea pigs (n = 23) that had died of natural causes were collected and the bones manually extracted and cleaned. Institutional ethical permission was given under the UK Home Office guidelines and the Veterinary Surgeons Act. X-ray Micro Computed Tomography (microCT) was undertaken on the left and right scapula, humerus and femur from each animal to ascertain bone local thickness. Images were also used to undertake manual and automated bone measurements, volumes and surface areas, identify and describe nutrient, supratrochlear and supracondylar foramina. Statistical analysis between groups was carried out using ANOVA with post-hoc testing. Our data mapped a number of dimensions, and mean and maximum bone thickness of the scapula, humerus and femur in guinea pigs aged 0-1 month, 1-3 months, 3-6 months, 6 months-1 year and 1-4 years. Bone dimensions, growth rates and local bone thicknesses differed between ages and between the scapula, humerus and femur. The microCT and imaging software technology showed very distinct differences between the relative local bone thickness across the structure of the bones. Only one bone showed a singular nutrient foramen, every other bone had between 2 and 5, and every nutrient canal ran in an oblique direction. In contrast to other species, a supratrochlear foramen was observed in every humerus whereas the supracondylar foramen was always absent. Our data showed the bone local thickness, bone structure and measurements of guinea pig bones from birth to 4 years old. Importantly it showed that bone development continued after 1 year, the point at which most guinea pigs have

NDM 1 Gene Carrying Gram negative Bacteria Isolated from Rats ...

African Journals Online (AJOL)

In this study, we screened 56 Gram negative bacteria comprising: 3 isolates of Enterobacter ludwigii, 30 Pseudomonas aeruginosa, 22 Proteus mirabilis, and 1 Aeromonas caviae isolated from oral cavity and rectum of rats captured from commercial poultry houses in Ibadan, Oyo State, Nigeria that were resistant to at least ...

NIGERIAN VETERINARY JOURNAL

African Journals Online (AJOL)

ADEYEYE

In this study, we screened 56 Gram negative bacteria comprising: 3 isolates of Enterobacter ludwigii, 30 Pseudomonas aeruginosa, 22. Proteus mirabilis, and 1 Aeromonas caviae isolated from oral cavity and rectum of rats captured from commercial poultry houses in Ibadan, Oyo State, Nigeria that were resistant to at least ...

Integration of metabolism and digestion in the hyrax | Fairall | South ...

African Journals Online (AJOL)

Metabolic adaptations and digestive ability were integrated to explain the ecological efficiency of the hyrax (Procavia capensis). Metabolic rate was shown to decrease linearly with a drop in ambient temperature, but at a lower rate than an animal of equivalent size, the guinea-pig (Cavia porcel/us). This is achieved by ...

A prospective study on Aeromonas in outpatients with diarrhea in the central region of Rio Grande do Sul State

Directory of Open Access Journals (Sweden)

Karoline de Campos Prediger

2012-09-01

Full Text Available Aeromonas spp. were identified in five (2,7% of 182 diarrheal stool cultures, A. caviae was predominant, resistant mainly to ampicillin and cephalotin. This is the first study showing the presence of Aeromonas spp. in diarrheal stools of outpatients in the central region of Rio Grande do Sul State, Brazil.

Epidemiologia da doença de Chagas no Ceará VIII - estudo da infecção de animais por T. cruzi no município de Morada Nova

Directory of Open Access Journals (Sweden)

J. E. Alencar

1977-02-01

Full Text Available Foram examinados 1.368 mamíferos em ecótopos naturais ou artificiais: 443 cães com 2,5% positivos; 605 gatos com 0,7%, 65 roedores domésticos com 4,6%, 6 coelhos e 10 cobaias negativos. Dentre os animais silvestres, foram examinados 115 preás (Galea s. spixii com 2,3% positivos, 12 "cassacos" (Didelphis azarae dos quais 9 positivos; 5 quirópteros, 5 punáres (Cercomys c. laurentius e 3 pebas (Dasypus sexcinctus negativos. A amostra apresentada é suficiente para considerada a existência de ciclos doméstico e silvestre de T. cruzi na área estudada e considerada endêmica da Doença de Chagas.

Assessment of toxicity of a glyphosate-based formulation using bacterial systems in lake water.

Science.gov (United States)

Amorós, I; Alonso, J L; Romaguera, S; Carrasco, J M

2007-05-01

A new Aeromonas bioassay is described to assess the potential harmful effects of the glyphosate-based herbicide, Roundup, in the Albufera lake, a protected area near Valencia. Viability markers as membrane integrity, culturability and beta-galactosidase production of Aeromonas caviae were studied to determine the influence of the herbicide in the bacterial cells. Data from the multifactor analysis of variance test showed no significant differences (P>0.05) between A. caviae counts of viability markers at the studied concentrations (0, 50 and 100 mg l-1 of glyphosate). The effects of Roundup on microbial biota present in the lake were assessed by measuring the number of indigenous mesophilic Aeromonas in presence of different amounts of the herbicide at 0, 50 and 100 mg l-1 of glyphosate. In samples containing 50 and 100 mg l-1 of glyphosate a significant (PAlbufera lake water to Microtox luminescent bacterium (Vibrio fischeri) also was determined. The EC50 values obtained were 36.4 mg l-1 and 64.0 mgl-1 of glyphosate respectively. The acidity (pH 4.5) of the herbicide formulation was the responsible of the observed toxicity.

Molecular Cloning, Characterization and Predicted Structure of a Putative Copper-Zinc SOD from the Camel, Camelus dromedarius

Directory of Open Access Journals (Sweden)

Ajamaluddin Malik

2012-01-01

Full Text Available Superoxide dismutase (SOD is the first line of defense against oxidative stress induced by endogenous and/or exogenous factors and thus helps in maintaining the cellular integrity. Its activity is related to many diseases; so, it is of importance to study the structure and expression of SOD gene in an animal naturally exposed most of its life to the direct sunlight as a cause of oxidative stress. Arabian camel (one humped camel, Camelus dromedarius is adapted to the widely varying desert climatic conditions that extremely changes during daily life in the Arabian Gulf. Studying the cSOD1 in C. dromedarius could help understand the impact of exposure to direct sunlight and desert life on the health status of such mammal. The full coding region of a putative CuZnSOD gene of C. dromedarius (cSOD1 was amplified by reverse transcription PCR and cloned for the first time (gene bank accession number for nucleotides and amino acids are JF758876 and AEF32527, respectively. The cDNA sequencing revealed an open reading frame of 459 nucleotides encoding a protein of 153 amino acids which is equal to the coding region of SOD1 gene and protein from many organisms. The calculated molecular weight and isoelectric point of cSOD1 was 15.7 kDa and 6.2, respectively. The level of expression of cSOD1 in different camel tissues (liver, kidney, spleen, lung and testis was examined using Real Time-PCR. The highest level of cSOD1 transcript was found in the camel liver (represented as 100% followed by testis (45%, kidney (13%, lung (11% and spleen (10%, using 18S ribosomal subunit as endogenous control. The deduced amino acid sequence exhibited high similarity with Cebus apella (90%, Sus scrofa (88%, Cavia porcellus (88%, Mus musculus (88%, Macaca mulatta (87%, Pan troglodytes (87%, Homo sapiens (87%, Canis familiaris (86%, Bos taurus (86%, Pongo abelii (85% and Equus caballus (82%. Phylogenetic analysis revealed that cSOD1 is grouped together with S. scrofa. The

Molecular cloning, characterization and predicted structure of a putative copper-zinc SOD from the camel, Camelus dromedarius.

Science.gov (United States)

Ataya, Farid S; Fouad, Dalia; Al-Olayan, Ebtsam; Malik, Ajamaluddin

2012-01-01

Superoxide dismutase (SOD) is the first line of defense against oxidative stress induced by endogenous and/or exogenous factors and thus helps in maintaining the cellular integrity. Its activity is related to many diseases; so, it is of importance to study the structure and expression of SOD gene in an animal naturally exposed most of its life to the direct sunlight as a cause of oxidative stress. Arabian camel (one humped camel, Camelus dromedarius) is adapted to the widely varying desert climatic conditions that extremely changes during daily life in the Arabian Gulf. Studying the cSOD1 in C. dromedarius could help understand the impact of exposure to direct sunlight and desert life on the health status of such mammal. The full coding region of a putative CuZnSOD gene of C. dromedarius (cSOD1) was amplified by reverse transcription PCR and cloned for the first time (gene bank accession number for nucleotides and amino acids are JF758876 and AEF32527, respectively). The cDNA sequencing revealed an open reading frame of 459 nucleotides encoding a protein of 153 amino acids which is equal to the coding region of SOD1 gene and protein from many organisms. The calculated molecular weight and isoelectric point of cSOD1 was 15.7 kDa and 6.2, respectively. The level of expression of cSOD1 in different camel tissues (liver, kidney, spleen, lung and testis) was examined using Real Time-PCR. The highest level of cSOD1 transcript was found in the camel liver (represented as 100%) followed by testis (45%), kidney (13%), lung (11%) and spleen (10%), using 18S ribosomal subunit as endogenous control. The deduced amino acid sequence exhibited high similarity with Cebus apella (90%), Sus scrofa (88%), Cavia porcellus (88%), Mus musculus (88%), Macaca mulatta (87%), Pan troglodytes (87%), Homo sapiens (87%), Canis familiaris (86%), Bos taurus (86%), Pongo abelii (85%) and Equus caballus (82%). Phylogenetic analysis revealed that cSOD1 is grouped together with S. scrofa. The

Biochemical characteristics, serogroups, and virulence factors of aeromonas species isolated from cases of diarrhoea and domestic water samples in Chennai

Directory of Open Access Journals (Sweden)

Alavandi S

2003-01-01

Full Text Available PURPOSE: The objective of the present study was to delineate the differences between the clinical and environmental Aeromonas species with respect to their biochemical characteristics, serogrouping and virulence factors, in order to find a phenotypic marker of enteropathogenicity. METHODS: A total of 55 Aeromonas spp. inclusive of 19 isolates from cases of diarrhoea, and 36 from water samples comprising, 10 isolates of A. hydrophila, 21 isolates each of A. sobria, and A. caviae, two isolates of A. jandaei and one isolate of A. veronii were subjected to analysis of their biochemical characteristics, serogrouping, and virulence factors. RESULTS: Among the differences recorded in the biochemical characteristics in the three major species, the most striking characteristic was fermentation of lactose, which was observed in all the 11 A. caviae isolates recovered from water samples. None of the 10 clinical isolates of A. caviae tested fermented lactose. The clinical Aeromonas isolates belonged to seven typable serogroups, O:13, O:14, O:16, O:21, O:27, O:32 and O:35. The environmental isolates belonged to eight different serogroups, such as, O:3, O:11, O:14, O:16, O:18, O:28, O:64 and O:78 and were predominated by serotypes O:18 and O:64. Among the virulence factors tested, 89% of the environmental isolates produced b haemolysin, while only 62.3% of clinical isolates were able to do so. There was no significant difference between the clinical and environmental aeromonads with respect to their enterotoxigenicity in suckling mice in vivo, cytotoxicity in vitro in Vero cell monolayers, and ability to produce siderophores. CONCLUSION: Efforts to delineate the differences between the clinical and environmental Aeromonas spp. did not reveal significant difference between them. However, difference was observed with respect to their ability to produce b haemolysin, wherein, higher percentage of environmental isolates was haemolytic. The results also suggest

Tecnologia simplificada na enfermagem materno infantil

Directory of Open Access Journals (Sweden)

Selma Campestrini

1991-09-01

Full Text Available A autora apresenta três modelos de tecnologia simplificada da enfermagem materno infantil: o equipamento didático SEIO COBAIA para treinar exercícios e massagens da mama e mamilo; a peça indumentária SUPRETRAUMA - sutiã preventivo de traumatismo mamilar - usado por gestantes; e, a técnica para reverter mamilo umbilicado durante o puerperio imediato. Além de corroborar na promoção do aleitamento materno e na prevenção de desmame precoce, demonstra a possibilidade da enfermagem relacionar o saber teórico-científico com o saber tecnico-prático, na saúde da mulher e da criança, com tecnologia adequada às necessidades, à compreensão e ao bem estar da população.

TECNOLOGÍA Y SUBSISTENCIA EN EL SITIO ARQUEOLÓGICO CERRO TAPERA VÁZQUEZ (PARQUE NACIONAL PRE-DELTA, REPÚBLICA ARGENTINA

Directory of Open Access Journals (Sweden)

Mariano Bonomo

2014-10-01

Full Text Available In this paper the results of the studies carried out on ceramic and bone materials recorded at Cerro Tapera Vázquez site (Argentinean Northeast are presented. Taxonomic, anatomic and taphonomic studies of bone assemblages and technological-decorative analysis and refitting of pottery were undertaken. The site is located on a mound next to El Ceibo Creek, where 16 m2 were excavated in 2008. Abundant smooth, incised and modeled pottery (handles and zoomorphic appendages and numerous bones remains of Myocastor coypus (most frequent taxon, Blastocerus dichotomus, Ozotoceros bezoarticus, Cavia aperea, Leopardus geoffroyi, Lycalopex gymnocercus, Hydrochaeris hydrochaeris, birds and fish (Siluriformes and Characiformes were recorded. Except Cavia aperea rodent and Dusicyon gimnocercus fox, all taxa show evidence of anthropic modification (cut marks, fresh fractures and burning. Two radiocarbon dates were obtained: 650 and 520 yrs. BP. The results reached in this study lead to the conclusion that the pre-Hispanic populations that occupied Cerro Tapera Vázquez by the end of the Late Holocene were riverine canoe peoples, with complex ceramic technology and subsistence based on hunting of coypu, capybara and cervids, fishing and small-scale horticulture.

Micromamiferos andinos holocenicos del sitio arqueologico Inca Cueva 5, Ju Juy, Argentina: tafonomia, zoogeografia y reconstruccion paleoambiental

OpenAIRE

Ortiz, P. E.; Teta, P.

2002-01-01

A micromammal archaeological sequence (2120 f 120 to 780 f 100 years BP) from Inca Cueva 5 site (23" 05' S - 65" 27' W; 3700 m.a.s.l., Jujuy Province, Argentina) was studied. The following mammalian taxa were recorded: Order Didelphimorphia, Family Didelphidae, Thylamys cf. T. pallidior; Order Rodentia, Family Muridae, Akodon cf. A. albiventer, Andinomys edax, Auliscomys sublimis, Calomys lepidus, Neotomys ebriosus, Phyllotis sp.; Family Caviidae, Cavia cf. C. tschudii, Galea musteloides; Fam...

Feasibility of same-day identification of members of the family Vibrionaceae by the API 20E system.

OpenAIRE

Overman, T L; Overley, J K

1986-01-01

Sixty isolates, comprising nine species of the family Vibrionaceae, were tested with the API 20E 5-h same-day procedure (Analytab Products, Plainview, N.Y.). Included were 27 Aeromonas hydrophila isolates, 10 Aeromonas sobria isolates, 7 Aeromonas caviae isolates, 3 Plesiomonas shigelloides isolates, 3 Vibrio alginolyticus isolates, 3 Vibrio cholerae isolates, 1 Vibrio fluvialis isolate, 5 Vibrio parahaemolyticus isolates, and 1 Vibrio vulnificus isolate. The 5-h profile numbers were specific...

Effect of Robusta coffee beans ointment on full thickness wound healing

Directory of Open Access Journals (Sweden)

Yorinta Putri Kenisa

2012-03-01

Full Text Available Background: Traumatic lesions, whether chemical, physical, or thermal in nature, are among the most common lesion in the mouth. Wound healing is essential for the maintenance of normal structure, function, and survival of organisms. Experiments of Robusta coffee powder on rat-induced alloxan incision wound, clinically demonstrated similar healing rate with the povidone iodine 10%. No studies that look directly the effect of coffee extract in ointment form when viewed in terms of histopathology. Robusta coffee bean (Coffea canephora consists of chlorogenic acid (CGA and caffeic acid which are belived to act as antioxidant and take part in wound healing process. Purpose: The aim of this study was to identify the enhancement of healing process of full-thickness skin wound after Robusta coffee beans extract ointment application. Methods: Sample consisted of 20 Cavia cabaya treated with full-thickness with wounds and was given Robusta coffee beans extract ointment concentration range of 22.5%, 45%, and 90% except the control group which was given ointment base material. Animals were then harvested on the fourth day and made for histopathological preparations. Data were calculated and compared by one-way ANOVA test and LSD test. Results: The study showed that Robusta coffee bean extract ointment can increase the number of lymphocytes, plasma cells, macrophages, fibroblasts, and blood vessels by the presence of chlorogenic acid (CGA and Caffeic acid. Conclusion: In conclusion Robusta coffee bean extract ointment enhance the healing process of fullthickness skin wound of Cavia cabaya.Latar belakang: Lesi traumatik, baik akibat rangsang kimia, fisik, atau termal, merupakan lesi yang paling umum terjadi di dalam rongga mulut. Penyembuhan luka yang terjadi ini penting untuk pemeliharaan struktur normal, fungsi, dan kelangsungan hidup organisme. Percobaan pemberian bubuk kopi Robusta terhadap luka sayatan pada tikus yang diinduksi aloksan, secara klinis

Multilocus genetics to reconstruct aeromonad evolution

Directory of Open Access Journals (Sweden)

Roger Frédéric

2012-04-01

Full Text Available Abstract Background Aeromonas spp. are versatile bacteria that exhibit a wide variety of lifestyles. In an attempt to improve the understanding of human aeromonosis, we investigated whether clinical isolates displayed specific characteristics in terms of genetic diversity, population structure and mode of evolution among Aeromonas spp. A collection of 195 Aeromonas isolates from human, animal and environmental sources was therefore genotyped using multilocus sequence analysis (MLSA based on the dnaK, gltA, gyrB, radA, rpoB, tsf and zipA genes. Results The MLSA showed a high level of genetic diversity among the population, and multilocus-based phylogenetic analysis (MLPA revealed 3 major clades: the A. veronii, A. hydrophila and A. caviae clades, among the eleven clades detected. Lower genetic diversity was observed within the A. caviae clade as well as among clinical isolates compared to environmental isolates. Clonal complexes, each of which included a limited number of strains, mainly corresponded to host-associated subsclusters of strains, i.e., a fish-associated subset within A. salmonicida and 11 human-associated subsets, 9 of which included only disease-associated strains. The population structure was shown to be clonal, with modes of evolution that involved mutations in general and recombination events locally. Recombination was detected in 5 genes in the MLSA scheme and concerned approximately 50% of the STs. Therefore, these recombination events could explain the observed phylogenetic incongruities and low robustness. However, the MLPA globally confirmed the current systematics of the genus Aeromonas. Conclusions Evolution in the genus Aeromonas has resulted in exceptionally high genetic diversity. Emerging from this diversity, subsets of strains appeared to be host adapted and/or “disease specialized” while the A. caviae clade displayed an atypical tempo of evolution among aeromonads. Considering that A. salmonicida has been

CARACTERIZAÇÃO DE AEROMONAS SPP ISOLADAS DE AMOSTRAS DE OSTRAS E ÁGUA POR MÉTODO MICROBIOLÓGICO E MOLECULAR

Directory of Open Access Journals (Sweden)

Ana Carolina Miranda de Melo Silva

2014-09-01

Full Text Available This study aimed to isolate and identify Aeromonas bacteria from samples of oysters and water, by microbiological and molecular methods. Identification of Aeromonas was performed by the conventional method and by PCR and species characterization was performed by identification key Aerokey II and by RFLP-PCR of 16S rDNA. 59 (98.3% samples of oysters and 15 (75% samples of water contaminated by Aeromonas bacteria were identified. Of the 74 isolates of Aeromonas spp. obtained by microbiological analysis, 53 (71.62%, 38 (65.51% oyster samples and 15 (100% of water samples confirmed the characterization of the genus by molecular technique. As to biochemical species identification, 59.3% (n = 35 and 40.6% (n = 24 of isolates from Aeromonas sp. obtained from oyster samples were rated as A. hydrophila and A. caviae, respectively; and from isolates obtained from water samples, 60% (n = 9 were classified as A. hydrophila and 40% (n = 6 as A. caviae; however, only the A. hydrophila was confirmed by genetic sequencing. Regarding the classification by RFLP-PCR 16S rDNA, patterns of nonspecific bands were obtained, making it impossible to identify the species by this technique. The large number of oyester samples contaminated with Aeromonas spp. and identification of A. hydrophila, demonstrate that this mollusk might present a risk to consumer health, mainly because it is consumed raw and is to a potentially pathogenic micro-organism to humans.

Genospecies and virulence factors of Aeromonas species in different sources in a North African country

Directory of Open Access Journals (Sweden)

Khalifa Sifaw Ghenghesh

2014-09-01

Full Text Available Introduction: Aeromonads of medical importance have been reported from numerous clinical, food, and water sources, but identification of genospecies and virulence factors of Aeromonas species from countries in North Africa and the Middle East are few. Methods: In total 99 Aeromonas species isolates from different sources (diarrheal children [n=23], non-diarrheal children [n=16], untreated drinking water from wells [n=32], and chicken carcasses [n=28] in Tripoli, Libya, were included in the present investigation. Genus identification was confirmed by biochemical analysis, and genospecies were determined using a combination of 16S rDNA variable region and gyrB sequence analysis. Polymerase chain reaction (PCR was used to detect genes encoding toxins from 52 of the isolates. Results: We identified 44 isolates (44% as A. hydrophila (3 [3.0%] subspecies anaerogenes, 23 [23%] subspecies dhakensis, and 18 [18%] subspecies ranae; 27 isolates (27% as A. veronii; 23 isolates (23% as A. caviae; and 5 isolates (5.0% as other genospecies. The genes encoding aerolysin (aer, cytolytic enterotoxin (act, and A. hydrophila isolate SSU enterotoxin (ast were detected in 45 (87%, 4 (7.7%, and 9 (17% of the 52 isolates tested, respectively. The gene encoding an extracellular lipase (alt was not detected. Conclusion: The majority of aeromonads from Libya fall within three genospecies (i.e. A. hydrophila, A. veronii, and A. caviae, and genes coding for toxin production are common among them.

Chlamydial plasmids and bacteriophages.

Science.gov (United States)

Pawlikowska-Warych, Małgorzata; Śliwa-Dominiak, Joanna; Deptuła, Wiesław

2015-01-01

Chlamydia are absolute pathogens of humans and animals; despite being rather well recognised, they are still open for discovery. One such discovery is the occurrence of extrachromosomal carriers of genetic information. In prokaryotes, such carriers include plasmids and bacteriophages, which are present only among some Chlamydia species. Plasmids were found exclusively in Chlamydia (C.) trachomatis, C. psittaci, C. pneumoniae, C. suis, C. felis, C. muridarum and C. caviae. In prokaryotic organisms, plasmids usually code for genes that facilitate survival of the bacteria in the environment (although they are not essential). In chlamydia, their role has not been definitely recognised, apart from the fact that they participate in the synthesis of glycogen and encode proteins responsible for their virulence. Furthermore, in C. suis it was evidenced that the plasmid is integrated in a genomic island and contains the tetracycline-resistance gene. Bacteriophages specific for chlamydia (chlamydiaphages) were detected only in six species: C. psittaci, C. abortus, C. felis, C. caviae C. pecorum and C. pneumoniae. These chlamydiaphages cause inhibition of the developmental cycle, and delay transformation of reticulate bodies (RBs) into elementary bodies (EBs), thus reducing the possibility of infecting other cells in time. Plasmids and bacteriophages can be used in the diagnostics of chlamydioses; although especially in the case of plasmids, they are already used for detection of chlamydial infections. In addition, bacteriophages could be used as therapeutic agents to replace antibiotics, potentially addressing the problem of increasing antibiotic-resistance among chlamydia.

The role of active ingredients nanopowder Stichopus hermanii gel to bone resorption in tension area of orthodontic tooth movement

Directory of Open Access Journals (Sweden)

Noengki Prameswari

2017-12-01

Full Text Available Background: Orthodontic tooth movement is a continual and balanced process between bone deposition and bone resorption in pressure and tension sites. Stichopus hermanii is one of the best fishery commodities in Indonesia. It is natural and contains various active ingredients such as hyaluronic acid, chondroitin sulphate, cell growth factor, eicosa pentaenoic acid (EPA docosa hexaenoic acid (DHA and flavonoid that potentially play a role in orthodontic tooth movement. Purpose: The aim of this study was to investigate the active ingredients of nanopowder Stichopus hermanii promoting bone resorption in tension area orthodontic tooth movement. Methods: A quantitative test for active ingredients of stichopus hermanii was conducted. Thirty two male Cavia cobaya were divisibled became four groups. K (– groups as a negative control group (without treatment, K (+ groups as a positive control group which were provided with a separator rubber for orthodontic tooth movement, and P1, P2 groups, which were treated with 3% and 3.5% stichopus hermanii for orthodontic tooth movement. After treatment the cavia cobaya were sacrificed. TRAP-6 expression as a osteoclast marker was examined by means of an immunohistochemistry method. Results: A one-way Anova test confirmed that TRAP-6 expression was significantly increased with p = 0.00 (p≤0,05 in P2 compared to K (+. P2 to K (–, P2 to P1 and P1 to K (+ had no significant differences Conclusion: Nanopowder Stichopus hermanii 3.5% has an active ingredient that could increase osteoclast activity to resorb periodontal ligament and alveolar bone in tension areas of orthodontic tooth movement.

Miologia do membro pélvico da paca (Cuniculus paca Linnaeus, 1766

Directory of Open Access Journals (Sweden)

Leonardo M. Leal

2015-12-01

Full Text Available Resumo: Objetivam-se descrever os músculos do membro pélvico da paca (Cuniculus paca Linnaeus, 1766, mediante dissecção anatômica dessa região. Foram utilizadas dez Cuniculus paca adultas, machos e fêmeas, pesando entre cinco e 10 kg do plantel de pacas do setor de Animais Silvestres da FCAV, Unesp, Jaboticabal/SP. Os animais foram fixados em formaldeído 10% e conservados em solução salina a 30% para dissecação anatômica da musculatura da pelve, coxa e perna, identificando-se a origem e inserção de cada músculo. Os resultados foram fotodocumentados e discutidos com base na literatura sobre animais domésticos, ratos e cobaias. Salvo algumas variâncias na origem e inserção de cada músculo e na fusão dos ventres de alguns grupos musculares, de forma geral, a musculatura da paca assemelha-se a dos animais domésticos e a de outros roedores.

The ribonucleic acid content of some mammalian erythrocytes

Directory of Open Access Journals (Sweden)

Helion Povoa Jr.

1955-12-01

Full Text Available RNA was determined in red blood cells of man and other mammals. Our report is based on 41 determinations. Red blood cells of rat showed the highest values in comparison with the blood cells of guinea pig, rabbit, horse and sheep which showed the lowest values, and man with intermediate ones. The method used was a combination of Schimidt and Thanhauser and Schneider extractions with the final reactions of pentose with the orcinol reagent colorimetrically measured.O ácido ribonucleico foi dosado em hemátias de mamíferos, num total de 41 casos. Valores altos foram encontrados em hemátias de ratos em comparação com os de cobaia, coelho, cavalo e carneiro. Hemátias humanas apresentaram valores intermediários. Usou-se um método, combinando-se as extrações de Schmidt, Thanhauser e Schneider com a reação final da pentose com o orcinol, lendo-se a côr verde num fotocolorímetro, em 650 milimicra.

Cocleotoxicidade da gentamicina por doses habituais para neonatos - estudo funcional A functional study on gentamicin-related cochleotoxicity in its conventional dose in newborns

Directory of Open Access Journals (Sweden)

Carla Luiza Baggio

2010-02-01

Full Text Available A identificação precoce das alterações auditivas possibilita a intervenção ainda no "período crítico" e ideal de estimulação da linguagem e da audição. A ototoxicidade infantil é um tema bastante controverso. Têm sido relatadas percentagens variáveis de casos de ototoxicidade em crianças com vários antibióticos aminoglicosídeos. Os principais grupos pediátricos que recebem antibióticos aminoglicosídeos são recém-nascidos com infecções graves na UTI neonatal. OBJETIVOS: Verificar o aspecto funcional das células ciliadas externas da cóclea a esquemas terapêuticos utilizados para o tratamento de infecções no período neonatal. FORMA DE ESTUDO: Experimental. MATERIAL E MÉTODO: Foram estudadas 26 cobaias albinas, através das emissões otoacústicas por produto de distorção, prévia e posteriormente a aplicação de gentamicina. RESULTADOS: Em todas as avaliações, o estado funcional das células ciliadas externas, estudadas pelas emissões otoacústicas por produto de distorção, mostraram-se preservadas. CONCLUSÃO: Neste experimento não foram observadas alterações no funcionamento das células ciliadas externas de cobaias albinas sob tratamento com gentamicina nas doses de 4 mg/Kg/dia e 2,5 mg/Kg/dia a cada 12 horas, por 10 e 14 dias.The early identification of hearing impairment allows for an intervention still in the "critical" and ideal period of hearing and language stimulation. Pediatric ototoxicity is a very controversial topic. There have been variable percentages of ototoxicity cases in children with different aminoglycosides antibiotics. The main pediatric groups whom receive aminoglycosides are newborns with severe infections on the neonatal ICU. AIM: to check the functional aspect of the cochlear external hair cells and treatment regimens used to treat infections during the neonatal period. STUDY DESIGN: Experimental. Materials and Methods: we studied 26 albino guinea pigs, through distortion

Prevalência de Aeromonas ssp em fezes diarréicas de crianças menores de 5 anos de idade na cidade de Goiânia, Goiás, no biênio 1995 - 1996

Directory of Open Access Journals (Sweden)

Idalina Thiomi Inumaru Nojimoto

1997-10-01

Full Text Available Foram analisadas 163 amostras de fezes de crianças com idade abaixo de 5 anos no período de 1995 a 1996, sendo 91 de fezes diarréicas e 72 de fezes não diarréicas. O material foi coletado em meio para transporte e submetido ao processo de enriquecimento a 4oC por 7 dias. Para o isolamento primário foi utilizado ágar amido ampicilina e incubado a 35oC por 18 a 24 horas. Foram isoladas 20 (21,9% das seguintes espécies: Aeromonas A. caviae (7,7%, A. salmonicida salmonicida (6,6%, A. sobria (4,3%, A. hydrophila (2,2% e Salmonicida achromogenes (1,1%. Nenhuma Aeromonas spp foi isolada dos 72 pacientes-controles. A susceptibilidade das amostras de Aeromonas spp aos antimicrobianos foi maior com a ciprofloxacina, diminuindo gradativamente com cloranfenicol, gentamicina, ampicilina e eritromicina.From 1995 through 1996, 163 fecal specimens of children aged under 5 years were analysed, 91 being from diarrhea feces and 72 without diarrhea. The material was collected in transport medium and submitted to the enrichment procedure at 4oC for 7 days. For the primary isolation starch ampicillin agar was used and incubated at 35oC for 18 to 24 hours. Twenty (20.9% from the following specimens were isolated: Aeromonas A. caviae (7.7%, A. salmonicida salmonicida (6.6%, A. sobria (4.3%, A. hydrophila (2.2% e Salmonicida achromogenes (1.1%. No Aeromonas spp was isolated from the 72 control subjects. The Aeromonas spp susceptibility to antimicrobian was greater with ciprofloxacin, being this susceptibility gradually diminished with chloranphenicol, gentamicin, ampicillin and erythromycin.

Origem e distribuição das principais artérias do membro torácico de Cuniculus paca (Linnaeus, 1766

Directory of Open Access Journals (Sweden)

Leonardo M. Leal

Full Text Available RESUMO: Objetivou-se descrever as artérias do membro torácico da paca (Cuniculos paca Linanaeus, 1766, mediante a dissecação da região. Para tanto, foram utilizadas 10 pacas adultas, machos ou fêmeas, pesando entre cinco e 10 kg do plantel de pacas do setor de Animais Silvestres da FCAV, Unesp, Jaboticabal-SP. Nos animais, injetou-se látex pela artéria carótida comum esquerda para preencher e corar todo o sistema arterial, seguido pela fixação em formaldeído a 10% e conservação em solução salina a 30% para dissecação anatômica das principais artérias do arco aórtico, braço e antebraço, identificando-se a origem e distribuição destes vasos. Os resultados foram foto documentados e discutidos com base na literatura sobre os animais domésticos, e roedores selvagens. De forma geral, as artérias do membro torácico da paca, assemelham-se com as dos carnívoros domésticos, do rato e da cobaia.

Miologia do membro torácico da paca (Cuniculus paca

Directory of Open Access Journals (Sweden)

Leonardo M. Leal

2016-02-01

Full Text Available Resumo: Objetivou-se descrever os músculos do membro torácico da paca (Cuniculus paca Linnaeus, 1766, mediante dissecação anatômica dessa região. Foram utilizadas cinco Cuniculus paca adultas, machos e fêmeas, pesando entre cinco e 10kg do plantel de pacas do setor de Animais Silvestres da FCAV, Unesp, Jaboticabal/SP. Os animais foram fixados em formoldeído a 10% e conservados em solução salina a 30% para dissecação anatômica da musculatura do ombro, braço e antebraço, identificando-se a origem e inserção de cada músculo. Os resultados foram fotodocumentados e discutidos com base na literatura sobre animais domésticos, ratos e cobaias. Salvo algumas variâncias na origem e inserção de cada músculo e na fusão dos ventres de alguns grupos musculares, de forma geral, a musculatura do ombro, braço e antebraço da paca assemelha-se a dos animais domésticos e a de outros roedores.

Contribuição ao conhecimento do tifo exantemático neotrópico no Brasil

Directory of Open Access Journals (Sweden)

Octavio de Magalhães

1953-12-01

Full Text Available O extrato total placentário humano, o Apoidin (Park-Davis (hormônio sexual pré-hipofisoide, a Cortone (Merk, U.S.A. - acetato de Cortisona e o sangue placentário total humano citratado, quando injetados como terpêutica curativa, não tiveram influência alguma benéfica na evolução da doença experimetnal pela raça V. B. no cobaio. As cobaias fêmeas prenhes, quando inoculadas com a raça V.B. apresentam, não raro, uma evolução mórbida aparentemente mais benígna que as não fecundadas.Human palcentary total extract, Apoidin (Parke Davis - pre-hypophysoid sexual hormone, Cortone (Merck, U.S.A. - acetate of Cortisona and citrated total blood of the human placenta, when injected as therapeutic treatment, had no beneficient influence in the evolution of the experimental diseas in the V. B. strain in the guienea-pig. The pregnant female guienea-pigs, when inoculated with the V.B. strain often present a morbid evolution apparently more benignant than those not fecundated.

Chlorinated and ultraviolet radiation -treated reclaimed irrigation water is the source of Aeromonas found in vegetables used for human consumption

Energy Technology Data Exchange (ETDEWEB)

Latif-Eugenín, Fadua; Beaz-Hidalgo, Roxana; Silvera-Simón, Carolina [Unidad de Microbiología, Facultad de Medicina y Ciencias de la Salud, IISPV, Universidad Rovira i Virgili, Reus (Spain); Fernandez-Cassi, Xavi [Departamento de Microbiología, Facultad de Biología, Universidad de Barcelona, Barcelona (Spain); Figueras, María J., E-mail: mariajose.figueras@urv.cat [Unidad de Microbiología, Facultad de Medicina y Ciencias de la Salud, IISPV, Universidad Rovira i Virgili, Reus (Spain)

2017-04-15

Wastewater is increasingly being recognized as a key water resource, and reclaimed water (or treated wastewater) is used for irrigating vegetables destined for human consumption. The aim of the present study was to determine the diversity and prevalence of Aeromonas spp. both in reclaimed water used for irrigation and in the three types of vegetables irrigated with that water. Seven of the 11 (63.6%) samples of reclaimed water and all samples of vegetables were positive for the presence of Aeromonas. A total of 216 Aeromonas isolates were genotyped and corresponded to 132 different strains that after identification by sequencing the rpoD gene belonged to 10 different species. The prevalence of the species varied depending on the type of sample. In the secondary treated reclaimed water A. caviae and A. media dominated (91.4%) while A. salmonicida, A. media, A. allosaccharophila and A. popoffii represented 74.0% of the strains in the irrigation water. In vegetables, A. caviae (75.0%) was the most common species, among which a strain isolated from lettuce had the same genotype (ERIC pattern) as a strain recovered from the irrigation water. Furthermore, the same genotype of the species A. sanarellii was recovered from parsley and tomatoes demonstrating that irrigation water was the source of contamination and confirming the risk for public health. - Highlights: • Reclaimed water (= treated wastewater) is used for the irrigation of vegetables. • Aeromonas was found in reclaimed water and irrigated vegetables with this water. • The prevalence of Aeromonas spp. varied between irrigation water and vegetables. • Epidemiological relationships were found between irrigation water and vegetables. • The water was the source of contamination which means a risk for the public health.

Chlorinated and ultraviolet radiation -treated reclaimed irrigation water is the source of Aeromonas found in vegetables used for human consumption

International Nuclear Information System (INIS)

Latif-Eugenín, Fadua; Beaz-Hidalgo, Roxana; Silvera-Simón, Carolina; Fernandez-Cassi, Xavi; Figueras, María J.

2017-01-01

Wastewater is increasingly being recognized as a key water resource, and reclaimed water (or treated wastewater) is used for irrigating vegetables destined for human consumption. The aim of the present study was to determine the diversity and prevalence of Aeromonas spp. both in reclaimed water used for irrigation and in the three types of vegetables irrigated with that water. Seven of the 11 (63.6%) samples of reclaimed water and all samples of vegetables were positive for the presence of Aeromonas. A total of 216 Aeromonas isolates were genotyped and corresponded to 132 different strains that after identification by sequencing the rpoD gene belonged to 10 different species. The prevalence of the species varied depending on the type of sample. In the secondary treated reclaimed water A. caviae and A. media dominated (91.4%) while A. salmonicida, A. media, A. allosaccharophila and A. popoffii represented 74.0% of the strains in the irrigation water. In vegetables, A. caviae (75.0%) was the most common species, among which a strain isolated from lettuce had the same genotype (ERIC pattern) as a strain recovered from the irrigation water. Furthermore, the same genotype of the species A. sanarellii was recovered from parsley and tomatoes demonstrating that irrigation water was the source of contamination and confirming the risk for public health. - Highlights: • Reclaimed water (= treated wastewater) is used for the irrigation of vegetables. • Aeromonas was found in reclaimed water and irrigated vegetables with this water. • The prevalence of Aeromonas spp. varied between irrigation water and vegetables. • Epidemiological relationships were found between irrigation water and vegetables. • The water was the source of contamination which means a risk for the public health.

The influence of p H during growth of bacteria in toluene

International Nuclear Information System (INIS)

Nahar, N.; Quilty, B.; Alauddin, M.

2000-01-01

Five toluene tolerant species were isolated from the activated sludge of a wastewater treatment plant (Dublin). The isolate were investigated for influence of pH on the growth in toluene. Four of the bacteria have been identified as Pseudomonas putida and one as an Aeromonas caviae. When these bacteria were grown with toluene as the sole source of carbon and energy, the pH of the culture medium became acidic and dropped. 0.5 M sodium phosphate buffer was selected to investigate the optimum pH for growth in the presence of 500 mu l of toluene. In general, the growth was optimum between pH 5.8 and 7.4. (author)

Real-Time Detection and Identification of Chlamydophila Species in Veterinary Specimens by Using SYBR Green-Based PCR Assays

DEFF Research Database (Denmark)

Nordentoft, Steen; Kabell, Susanne; Pedersen, Karl

2011-01-01

of Chlamydiaceae and differentiate the most prevalent veterinary Chlamydophila species: Cp. psittaci, Cp. abortus, Cp. felis, and Cp. caviae. By adding bovine serum albumin to the master mixes, target DNA could be detected directly in crude lysates of enzymatically digested conjunctival or pharyngeal swabs...... or tissue specimens from heart, liver, and spleen without further purification. The assays were evaluated on veterinary specimens where all samples were screened using a family-specific PCR, and positive samples were further tested using species-specific PCRs. Cp. psittaci was detected in 47 birds, Cp...... with a highly sensitive family-specific PCR, we were able to screen for Chlamydiaceae in veterinary specimens and confirm the species in positive samples with additional PCR assays....

Implantação do mixoma infeccioso do coelho na câmara anterior do ôlho da cobaia

Directory of Open Access Journals (Sweden)

C. Magarinos Torres

1948-09-01

Full Text Available Mammalian cancer as well as the Rous chicken sarcoma has been successfully transplanted into the anterior chamber of the eyes of guinea pigs. It was of interest, therefore, to see if the infectious myxomatosis of rabbits, another representative of the infectious tumors, could be grown in the anterior chamber of the guinea pig eye, and, if growth occurred, to compare the tumor's behaviour with that of growths of the above mentioned etiology. Forty-three full-grown guinea pigs from mixed stocks were used throughout, and seventy-eight heterologous transplantation experiments were performed. The grafts measuring less than 2 mm. in diameter were cut from the subcutaneous tissue in skin lesions of rabbits with infectious myxomatosis recently killed. The transfer to the anterior chamber was performed after the usual technique. Some degree of partial survival was found in 23,8% of the grafts, in which typical myxoma cells could be demonstrated fifteen days after the transplantation. The transplant apparently does not increase in size, differing in that respect from that of the Rous chicken sarcoma, which increases in size by 2 or 3 diameters in 2 weeks (Shrigley, Greene & Duran-Reynals, 1945. The virus was still alive in 26% of the grafts 21 days after transplantation, and was able to induce a typical disease when injected to normal rabbits. No alteration in the properties of the virus after growth in the guinea pig was noticed, and this also is different from what happens with the Rous chicken sarcoma.

Los conflictos armados contemporáneos. Construcción de la paz y derechos humanos.

Directory of Open Access Journals (Sweden)

Jenny Estefany Valenzuela Rincón

2016-07-01

Full Text Available Esta reseña es del libro Los conflictos armados contemporáneos. Construcción de paz y de derechos humanos, cuyo editor es José Antonio Valles Cavia. En ella se hace una síntesis del libro, destacando algunas ideas principales y dando un aporte crítico a estas. También se estudia la importancia que tienen los trabajos de derechos humanos y se correlacionan con el momento histórico contemporáneo, en el cual dichos estudios son de gran envergadura debido a los conflictos armados que acontecen actualmente. Posteriormente se analizan las posturas de otros autores que tienen ideas semejantes a los postulados del libro y fortalecen la crítica hecha al mismo.

Molecular characterization and susceptibility to antimicrobial drugs of isolated bacterials from shrimps (“Litopenaeus vannamei” Caracterização molecular e susceptibilidade aos antimicrobianos de isolados bacterianos de camarões

Directory of Open Access Journals (Sweden)

Ricardo Castelo Branco Albinati

2010-06-01

Full Text Available The objective was to isolate bacteria from gut of shrimps from Litopenaeus vannamei, by biochemical characterization and molecular identification, inhibition activity in vitro of Bacillus cereus and sensitivity pattern determination. The bacterial species isolated were: Aeromonas caviae (n = 7, Alcaligenes denitrificans (n = 1, Bacillus cereus (n = 1 and Enterobacter spp. (n = 3. Bacillus cereus isolated in this study did not have inhibitory activity to other shrimps isolated bacteria evaluated. In the susceptibility to antimicrobial drug test, it were observed 68,7% to erythromycin, 50% to tetracycline, 81,2% to trimethoprim:sulfamethoxazole, neomycin and estreptomycin, 12,5% to lincomycin and ampicillin, 87,5% to enrofloxacin and nitrofurantoin, 93,7% to ceftriaxone, 100% to norfloxacin and nalidix acid. The characterization molecular is important on identifying the microrganisms studied. The nalidixic acid and norfloxacin are antimicrobial drugs with high sensitivity for bacteria isolated from shrimps.Objetivou-se isolar bactérias provenientes do trato intestinal de camarões da espécie Litopenaeus vannamei, por meio da caracterização bioquímica e molecular, atividade de inibição in vitro do Bacillus cereus e perfil de sensibilidade aos antimicrobianos. As espécies bacterianas identificadas foram Aeromonas caviae (n = 7, Alcaligenes denitrificans (n = 1, Bacillus cereus (n = 1 e Enterobacter spp. (n = 3. Bacillus cereus obtido neste estudo não apresentou atividade de inibição frente às demais bactérias isoladas de camarões. Quanto ao perfil de sensibilidade aos antimicrobianos, foram observados 68,7% de eritromicina, 50% de tetraciclina, 81,2% de sulfametoxazol/trimetoprina, neomicina e estreptomicina, 12,5% de lincomicina e ampicilina, 87,5% de enrofloxacina e nitrofurantoína, 93,7% de ceftriaxona, 100% de norfloxacina e ácido nalidíxico. A caracterização molecular é útil para identificação dos microrganismos estudados

Translation inhibition of the developmental cycle protein HctA by the small RNA IhtA is conserved across Chlamydia.

Directory of Open Access Journals (Sweden)

Jeremiah Tattersall

Full Text Available The developmental cycle of the obligate intracellular pathogen Chlamydia trachomatis serovar L2 is controlled in part by the small non-coding RNA (sRNA, IhtA. All Chlamydia alternate in a regulated fashion between the infectious elementary body (EB and the replicative reticulate body (RB which asynchronously re-differentiates back to the terminal EB form at the end of the cycle. The histone like protein HctA is central to RB:EB differentiation late in the cycle as it binds to and occludes the genome, thereby repressing transcription and translation. The sRNA IhtA is a critical component of this regulatory loop as it represses translation of hctA until late in infection at which point IhtA transcription decreases, allowing HctA expression to occur and RB to EB differentiation to proceed. It has been reported that IhtA is expressed during infection by the human pathogens C. trachomatis serovars L2, D and L2b and C. pneumoniae. We show in this work that IhtA is also expressed by the animal pathogens C. caviae and C. muridarum. Expression of HctA in E. coli is lethal and co-expression of IhtA relieves this phenotype. To determine if regulation of HctA by IhtA is a conserved mechanism across pathogenic chlamydial species, we cloned hctA and ihtA from C. trachomatis serovar D, C. muridarum, C. caviae and C. pneumoniae and assayed for rescue of growth repression in E. coli co-expression studies. In each case, co-expression of ihtA with the cognate hctA resulted in relief of growth repression. In addition, expression of each chlamydial species IhtA rescued the lethal phenotype of C. trachomatis serovar L2 HctA expression. As biolayer interferometry studies indicate that IhtA interacts directly with hctA message for all species tested, we predict that conserved sequences of IhtA are necessary for function and/or binding.

Translation inhibition of the developmental cycle protein HctA by the small RNA IhtA is conserved across Chlamydia.

Science.gov (United States)

Tattersall, Jeremiah; Rao, Geeta Vittal; Runac, Justin; Hackstadt, Ted; Grieshaber, Scott S; Grieshaber, Nicole A

2012-01-01

The developmental cycle of the obligate intracellular pathogen Chlamydia trachomatis serovar L2 is controlled in part by the small non-coding RNA (sRNA), IhtA. All Chlamydia alternate in a regulated fashion between the infectious elementary body (EB) and the replicative reticulate body (RB) which asynchronously re-differentiates back to the terminal EB form at the end of the cycle. The histone like protein HctA is central to RB:EB differentiation late in the cycle as it binds to and occludes the genome, thereby repressing transcription and translation. The sRNA IhtA is a critical component of this regulatory loop as it represses translation of hctA until late in infection at which point IhtA transcription decreases, allowing HctA expression to occur and RB to EB differentiation to proceed. It has been reported that IhtA is expressed during infection by the human pathogens C. trachomatis serovars L2, D and L2b and C. pneumoniae. We show in this work that IhtA is also expressed by the animal pathogens C. caviae and C. muridarum. Expression of HctA in E. coli is lethal and co-expression of IhtA relieves this phenotype. To determine if regulation of HctA by IhtA is a conserved mechanism across pathogenic chlamydial species, we cloned hctA and ihtA from C. trachomatis serovar D, C. muridarum, C. caviae and C. pneumoniae and assayed for rescue of growth repression in E. coli co-expression studies. In each case, co-expression of ihtA with the cognate hctA resulted in relief of growth repression. In addition, expression of each chlamydial species IhtA rescued the lethal phenotype of C. trachomatis serovar L2 HctA expression. As biolayer interferometry studies indicate that IhtA interacts directly with hctA message for all species tested, we predict that conserved sequences of IhtA are necessary for function and/or binding.

Mel e açúcar mascavo na cicatrização de feridas Honey and brown sugar in wounds healing

Directory of Open Access Journals (Sweden)

Ivan Felismino Charas dos Santos

2012-12-01

Full Text Available O estudo teve como objetivo comparar a eficácia do mel e do açúcar mascavo na cicatrização de feridas induzidas cirurgicamente na pele de cobaias, para avaliar o tempo de cicatrização, as variações macroscópicas e microscópicas do tecido cicatricial, a contração das feridas e o grau de contaminação. Quinze cobaias da raça Abissínia, machos inteiros, de seis meses de idade e pesando entre 500 a 850 gramas, foram divididas em três grupos com cinco animais cada, nos quais foram induzidas, cirurgicamente, três feridas em cada animal com dimensão de 1,5cm² e distância entre elas de 1,5cm, na região dorsal. A ferida F1 foi tratada diariamente com mel, a ferida F2 com solução salina 0,9% (controle e a ferida F3 com o açúcar mascavo. A eutanásia foi realizada no Grupo 1 ao sétimo dia após a cirurgia, no Grupo 2 ao décimo quarto dia e no Grupo 3 no vigésimo primeiro dia após a cirurgia, sendo as biópsias encaminhadas para avaliação histopatológica. Foram também realizados swabs das feridas em todos os grupos no terceiro e sétimo dias após a cirurgia e as amostras enviadas para a cultura e isolamento bacteriano. Concluiu-se que as feridas tratadas com o mel cicatrizaram mais rápido em relação às tratadas com o açúcar mascavo, demonstrando a maior propriedade cicatrizante do mel em relação ao açúcar mascavo.The study aimed to compare the effectiveness of honey and brown sugar in wounds healing induced in the skin of guinea pigs, to evaluate the healing time, microscopic and macroscopic healing variations, wound contraction and contamination degree. Fifteen guinea pigs, Abyssinia breed, males, six months of age and weighing between 500 to 850 grams, were divided in three groups with five animals each. Three wounds were promoted in each animal, surgical, with 1.5cm² and 1.5cm between them, in the dorsal region. The F1 was treated, daily, with honey, F2 with saline solution 0,9% (control and F3 with brown

Eficácia antitussígena de duas formulações fitoterápicas Antitussive efficacy of two phytotherapics formulations

Directory of Open Access Journals (Sweden)

F.B. Mello

2007-06-01

Full Text Available Avaliaram-se os efeitos antitussígenos-expectorantes de duas formulações fitoterápicas utilizando-se três modelos biológicos diferentes. Foram utilizados ratos Wistar no modelo da secreção das vias aéreas, cobaias no modelo de tosse induzido por ácido cítrico e codornas japonesas na determinação da velocidade de transporte mucociliar. Os animais foram distribuídos em grupos e tratados por via oral com as formulações, com doses equivalentes a 10 vezes a terapêutica recomendada, 9ml.kg-1. O grupo-controle negativo de cada espécie foi tratado com solução fisiológica, 10ml.kg-1. O grupo-controle positivo no modelo de tosse induzida pelo ácido cítrico foi tratado com morfina, 1mg.kg-1, por via subcutânea. No modelo em que foram utilizados ratos e codornas, o grupo-controle positivo recebeu erdosteína por via oral, 600mg.kg-1. Os resultados mostraram que as duas formulações fitoterápicas foram eficazes no reflexo da tosse em cobaias, causando 36,4% e 27,3%, respectivamente, de redução. Nos modelos de secreção das vias aéreas e determinação da velocidade de transporte mucociliar, ambas as formulações não apresentaram eficácia significativa.The antitussive-expectorant effects of two phytotherapic formulations available in the Brazilian market were evaluated using three different biological models. Each phytotherapic formulation, with different composition, had the same batch number and fabrication date. The trade names of the phytotherapics were: Gripalplus Solução® and Melagrião®. Wistar rats were used in the airway secretion model, guinea pigs in the citric acid-induced cough model and japanese quails in the mucociliary transport rate determination. The animals (one group/formulation were divided in the two phytotherapic groups and orally treated with the equivalent to ten told the therapeutic recommended dose, which was 9ml.kg-1. Animals of negative control group of each specie were orally treated with 10ml

Prevalence and resistance to antibiotics for Aeromonas species from retail fish in Malaysia.

Science.gov (United States)

Radu, Son; Ahmad, Noorlis; Ling, Foo Hooi; Reezal, Abdul

2003-03-25

A total of 87 market fish samples representing five types of fish were evaluated for the presence of Aeromonas spp. Of the samples examined, 69%, 55%, 11.5% and 2.3% harbored Aeromonas spp., A. veronii biovar sobria, A. hydrophila and A. caviae, respectively. The 60 isolated Aeromonas spp. strains were further examined for hemolytic activity, resistance to antimicrobial agents and presence of plasmids. Hemolytic activity varied widely among the isolated strains. Though all the isolates demonstrated resistance to three or more of the antibiotics tested, all were susceptible to ceptazidime. Thirty-four (56.7%) of the sixty isolates harbored plasmids, with sizes ranging from 2.3 to 15.7 kb. These results indicate that hemolytic, multiple antibiotic resistant and genetically diverse aeromonads are easily recovered from fish in this region.

Ação de venenos de serpentes brasileiras sôbre a alexina ou complemento

Directory of Open Access Journals (Sweden)

F. da Rocha Lagôa

1947-06-01

Full Text Available O autor estudou a ação inativante, sôbre o complemento de cobaia, alguns venenos de serpentes brasileiras pertencentes às famílias dos Elapideos e Crotalideos. Da primeira, foi utilizado veneno de Micrurus frontalis, da segunda, foram usados venenos de espécies pertencentes aos gêneros Crotalus (C. terrificus e Bothrops (B. atrox, B. neuwiedii, B. jararaca, B. ja-raracussú, B. cotiara e B. alternata. O venenos de M. frontalis e C. terri¬ficus se revelaram incapazes de inativar o complemento, ao passo que os diversos de Bothrops empregados se mostraram altamente inativantes, destruindo sempre o 4.° componente do complemento (C4, fração idêntica à afetada pela ação da amônea.The author shows in this paper the results of the inactivation of com¬plement or alexin by some Brazilian snakes venoms of the Elapideae and Cro¬talideae families. The venom of Micrurus frontalis (Elapideae family and of Crotalus terrificus (Crotalideae family did not destroy the complement; but the venoms of Bothrops generus (B. atrox, B. neuwiedii, B. jararaca, B. jararacussú, B. cotiara e B. alternata, (Crotalideae family are highly active in the inactivation complement, always destroing the fourth component, whichis exactly the same component that is detroyed by ammonia.

Effect of season on reproductive behaviors and fertilization success in cavies (Cavia aperea).

Science.gov (United States)

Hribal, Romy; Rübensam, Kathrin; Bernhardt, Sandra; Jewgenow, Katarina; Guenther, Anja

2018-04-05

Finding the optimal timing for breeding is crucial for small mammals to ensure survival and maximize lifetime reproductive success. Species living in temperate regions therefore often restrict breeding to seasons with favorable food and weather conditions. Although caviomorph rodents such as guinea pigs are described as non-seasonal breeders, a series of recent publications has shown seasonal adaptations in litter size, offspring birth mass and maternal investment. Here, we aim to test if seasonal patterns of litter size variation found in earlier studies, are mediated by seasonal differences in female estrus length, fertilization rate and mating behavior. The female estrus period was longer in fall compared to all other seasons (p < 0.001), frequently lasting 7-9 days while estrus in spring usually lasted less than 2 days. In fall, females mated later during estrus (p < 0.001), resulting in reduced fertilization rates (p < 0.001). Fertilization rate was well above 95% in summer while it dropped to less than 85% in fall and winter. While none of the male mating characteristics such as number and duration of copulations differed across seasons, the number of mating bouts was reduced in fall (p = 0.04). Finally, the developmental stages of flushed embryos were more diverse in spring and summer compared to fall and winter. These results suggest that seasonal differences in fertilization rate and quality of implanted embryos are mediated by female estrus length and timing and intensity of mating behavior. Together, these effects contribute to the observed differences in litter size across seasons. Copyright © 2018 Elsevier Inc. All rights reserved.

Reseña descriptiva de la explotación del cuy Cavia porceilus

Directory of Open Access Journals (Sweden)

Escobar L. Gustavo A.

1987-12-01

Full Text Available It was revised 241 scientific and empiric references about guinea pig based on which it was formulated a description about such an exploitation this summary is composed of thirteen chapters with the following contents: history, taxonomy, geographical distribution, anatomy, physiology, ethology, nutrition, genetic and improvement, production and handling, soundness, benefic construction and cost production and market.Con base en 241 bibliografías relacionadas con el conocimiento del cuy, se formuló una reseña descriptiva que consta de trece acápites en las siguientes áreas: historia, taxonomía, distribución geográfica, anatomía, fisiología, etología, nutrición, genética y mejoramiento, producción y manejo, sanidad, construcciones y costos de producción y mercadeo.

Avaliação da qualidade microbiológica de águas minerais consumidas na região metropolitana de Recife, Estado de Pernambuco = Evaluation of the microbiological quality of mineral water consumed in the metropolitan region of Recife, Pernambuco State

Directory of Open Access Journals (Sweden)

Marcelo Iran Souza Coelho

2010-01-01

Full Text Available Águas minerais comercializadas em garrafões de 20 L na região metropolitana de Recife, Estado de Pernambuco foram analisadas microbiologicamente, no período de junho de 2002 a maio de 2003. As dez marcas escolhidas de água mineral foram avaliadas no tocante às bactérias heterotróficas, coliformes, Escherichia coli, Pseudomonas spp., Pseudomonas aeruginosa e Aeromonas spp. Os dados foram analisados estatisticamente por meio de Modelos Lineares Generalizados (GLM. As águas minerais apresentaram contaminação por E. coli, P. aeruginosa, A. hydrophila e A. caviae. Concluiu-se que, de todas as dez marcas analisadas, pelo menos uma amostra de cada marca apresentou-se imprópria para o consumo, por não atender aos parâmetros estabelecidos pela legislação em vigor em, no mínimo, duas análises; o Número Mais Provável (NMP de Pseudomonas spp. e de P. aeruginosa foi influenciado pela sazonalidade e a contagem de bactérias heterotróficas; o Número Mais Provável (NMP de coliformes totais e termotolerantes e a pesquisa de Aeromonas spp. não sofreram influência significativa da sazonalidade.Mineral water sold in 20 L bottles in the metropolitan area of Recife, Pernambuco State were microbiologically analyzed between June 2002 and May 2003. The ten selected brands of mineral water were evaluated with regard to heterotrophic bacteria, coliforms, Escherichia coli, Pseudomonas spp., Pseudomonas aeruginosa and Aeromonas spp. Data were statistically analyzed using Generalized Linear Models (GLM. Mineral waters showed contamination by the following: E. coli, P. aeruginosa, A. hydrophila and A. caviae. It was concluded that of all ten tested brands, at least one sample of each brand was improper for consumption, for not meeting the parameters established by legislation in at least two tests; the Most Probable Number (MPN for Pseudomonas spp. and P. aeruginosa was influenced by seasonality and the count of heterotrophic bacteria; the Most

Bactérias do gênero Aeromonas em água de matadouro bovino Aeromonas bacteria in beef slaughtering water

Directory of Open Access Journals (Sweden)

O.D. Rossi Jr

2000-10-01

Full Text Available Verificou-se a ocorrência de bactérias do gênero Aeromonas em amostras de água (abastecimento/residuária obtidas em matadouro bovino. Analisaram-se a água utilizada nas dependências internas, a água dos currais, utilizada na dessedentação, pré-higienização e tranqüilização dos animais e a água residuária da lavagem das carcaças. Das 30 amostras representativas de cada tipo, bactérias do gênero Aeromonas foram isoladas em 10 (33,3% amostras da água dos currais e em 10 (33,3% amostras da água residuária da lavagem de carcaças. Nenhuma das amostras da água tratada de abastecimento das instalações revelou-se positiva no isolamento. As espécies isoladas foram Aeromonas hydrophila em duas (2,2% e Aeromonas caviae em 19 (21,1% amostras. Uma cepa considerada atípica foi isolada da água dos currais. Os resultados evidenciaram que a água dos currais pode ser uma importante fonte de contaminação, principalmente para a pele, e através dela as Aeromonas sp. podem chegar à sala de matança.The aim of this work was to verify the occurrence of Aeromonas bacteria in samples of water (supply and residual collected at beef slaughterhouse. Water used at the internal facilities, water from corrals, drinking water, water for pre-hygiene and tranquilization of the animals and residual water from carcasses’ wash, were analyzed. From those 30 samples of each type, Aeromonas bacteria were isolated in 10 (33.3% samples of corral water and in 10 (33.3% samples of residual water from carcasses’ wash. None of the facilities treated water supply samples showed positive in isolation. The isolated species were Aeromonas hydrophila in two (2.2% and Aeromonas caviae in 19 (21.1% of the samples. One non-typical strain was isolated from corral water. The results demonstrated that corral water may be an important contamination source, mainly to the hide and, through it, Aeromonas sp. can reach the slaughter room.

Species Distribution and Prevalence of Putative Virulence Factors in Mesophilic Aeromonas spp. Isolated from Fresh Retail Sushi

Directory of Open Access Journals (Sweden)

Sunniva Hoel

2017-05-01

Full Text Available Aeromonas spp. are ubiquitous bacteria that have received increasing attention as human pathogens because of their widespread occurrence in food, especially seafood and vegetables. The aim of this work was to assess the species identity and phylogenetic relationship of 118 Aeromonas strains isolated from fresh retail sushi from three producers, and to characterize the isolates with respect to genetic and phenotypic virulence factors. We also evaluate the potential hazard associated with their presence in ready-to-eat seafood not subjected to heat treatment. Mesophilic Aeromonas salmonicida was most prevalent (74%, followed by A. bestiarum (9%, A. dhakensis (5%, A. caviae (5%, A. media (4%, A. hydrophila (2%, and A. piscicola (1%. All isolates were considered potentially pathogenic due to the high prevalence of genes encoding hemolysin (hlyA (99%, aerolysin (aerA (98%, cytotoxic enterotoxin (act (86%, heat-labile cytotonic enterotoxin (alt (99%, and heat-stable cytotonic enterotoxin (ast (31%. The shiga-like toxins 1 and 2 (stx-1 and stx-2 were not detected. Moreover, there was heterogeneity in toxin gene distribution among the isolates, and the combination of act/alt/hlyA/aerA was most commonly detected (63%. β-hemolysis was species-dependent and observed in 91% of the isolates. All A. media and A. caviae strains were non-hemolytic. For isolates belonging to this group, lack of hemolysis was possibly related to the absence of the act gene. Swimming motility, linked to adhesion and host invasion, occurred in 65% of the isolates. Partial sequencing of the gyrB gene demonstrated its suitability as a genetic marker for Aeromonas species identification and for assessment of the phylogenetic relationship between the isolates. The gyrB sequence divergence within a given species ranged from 1.3 to 2.9%. A. bestiarum, A. salmonicida, and A. piscicola were the most closely related species; their sequences differed by 2.7–3.4%. The average gyrB sequence

Detection of all Chlamydophila and Chlamydia spp. of veterinary interest using species-specific real-time PCR assays.

Science.gov (United States)

Pantchev, Alexandra; Sting, Reinhard; Bauerfeind, Rolf; Tyczka, Judith; Sachse, Konrad

2010-12-01

The aim of the present study was to analyse the occurrence of chlamydiae in several mammalian host species. Clinical samples that previously tested positive in a Chlamydiaceae-specific real-time PCR were retested using six species-specific real-time PCR assays to identify the chlamydial species involved. Chlamydophila (Cp.) abortus was the agent most frequently found in cattle, sheep, horses, goats, and pigs. Detection in cattle of Cp. psittaci (11% of samples) and Chlamydia (C.) suis (9%), as well as Cp. psittaci in a goat sample was somewhat unexpected. DNA of two different chlamydiae was identified in 56 (12.7%) of 440 samples tested. Cp. felis was the predominant species found in cats, while in guinea pigs and rabbits only Cp. caviae was detected. Interestingly, the latter two pathogens were also identified in samples from dogs. The data show that mixed chlamydial infections are not rare and suggest an extended host range of individual species. Copyright © 2009 Elsevier Ltd. All rights reserved.

MICROBIAL POPULATION OF HOT SPRING WATERS IN ESKİŞEHİR/TURKEY

Directory of Open Access Journals (Sweden)

Nalan YILMAZ SARIÖZLÜ

2012-02-01

Full Text Available In order to investigate and find out the bacterial community of hot spring waters in Eskişehir, Turkey, 7 hot spring water samples were collected from 7 different hot springs. All samples were inoculated using four different media (nutrient agar, water yeast extract agar, trypticase soy agar, starch casein agar. After incubation at 50 ºC for 14 days, all bacterial colonies were counted and purified. Gram reaction, catalase and oxidase properties of all isolates were determined and investigated by BIOLOG, VITEK and automated ribotyping system (RiboPrinter. The resistance of these bacteriawas examined against ampiciline, gentamisine, trimethoprime-sulphamethoxazole and tetracycline. As a result, heat resistant pathogenic microorganisms in addition to human normal flora were determined in hot spring waters (43-50 ºC in investigated area. Ten different species belong to 6 genera were identified as Alysiella filiformis, Bordetella bronchiseptica, B. pertussis, Molexalla caprae, M. caviae, M. cuniculi, M. phenylpyruvica, Roseomonas fauriae, Delftia acidovorans and Pseudomonas taetrolens.

Aliesterase no sôro de alguns animais de laboratório Blood aliesterase in some laboratory animals

Directory of Open Access Journals (Sweden)

Maria Isabel Mello

1949-12-01

Full Text Available A esterase, aliesterase, foi determinada no sôro de 38 ratos de ambos os sexos, 6 hamsters, 34 cobaias e S coelhos, pela técnica de Huggins e Lapides. Os resultados obtidos para os machos e fêmeas foram tabelados em separado. As fêmeas apresentaram uma esterasemia maior que os machos, com uma média global de 11.6 U/ml ± 4.01 e um erro padrão de 0.83 enquanto que para os machos a média foi de 6.9 U ml ± 0.99 com um erro padrão de 0.26. A significância calculada pclo t foi de 4.4 Isto demonstra a interferência da aliesterase na produção ou no metabolismo dos estrogênios. Os valores médios encontrados para as cobaias foram 4.50 U/ ml ± 0.15, com um êrro padrão de 0.036 para as fêmeas e 4.28 U / ml ± 0.30 com um êrro padrão de 0.073 para os machos, sendo a significância (t de 2.6. Para os coelhos (machos a média foi de 4.41 U / ml ± 0.16, com um erro padrão de 0.058 enquanto para os hamsters os valores foram de 4.01 U/l ± 0.085, êrro padrão de 0.049 para os machos e 3.81 U/ml ± 0.227, êrro padrão de 0.133 para as fêmeas. Os animais castrados mostram uma diminuição progressiva da esterase no sôro, enquanto que nos castrados e tratados com estrogênios, êstes valores atingem o teôr normal. Os resultados obtidos nestes casos serão objeto de publicação ulterior.Esterase, "aliesterase" was determined, in blood sera from 38 rats, 6 hamsters, 34 guinea-pig and 8 rabbits by the Huggins & Lapides' method. Normal values for male and female animals were related separately. In female rat, blood aliesterase is higher within a mean value of 11.6 U/ml ± 4.01 and standard error of 0.83. Aliesterase sera values in male are lower than in female. The mean value being 6.9 U/ml ± 0.99, standard error, 0.26. The significance of means (t for female and male rats was 4.4. This fact reveals that aliesterase concentration in sera is related with estrogen production or metabolism. For guinea-pig the mean values were 4.50 U/ml ± 0

Stimulation of osteoblast activity by induction of Aloe vera and xenograft combination

Directory of Open Access Journals (Sweden)

Utari Kresnoadi

2011-12-01

Full Text Available Background: Tooth extraction is generally followed by alveolar ridge resorption that later can cause flat ridge. Aloe vera have biogenic stimulator and hormone activities for wound healing. Purpose: This study was aimed to know osteoblast activities in alveolar bone after induction of Aloe vera and XCB combination. Methods: Fifty four of Cavia cabaya were divided into three main groups. Group I was control group. Group II was filled with xenograft concelous bovine (XCB and group III was filled with the combination of Aloe vera gel and XCB. Then, each group was divided into three sub groups according to timing, they are 14, 30, and 60 days after tooth extraction and application. Histology and morphology examination were performed on the harvested specimens. Results: There were significant differences between the control group and the other groups filled with the combination of Aloe vera and XCB. Conclusion: In conclusion, the application of Aloe vera gel and xenograft combination decrease the number of osteoclast and increase the number of osteoblast in post tooth extraction alveolar bone structure indicating the new growth of alveolar bone.Latar belakang: Pencabutan gigi pada umumnya selalu diikuti resopsi tulang alveolar, sehingga bila terjadi dalam waktu yang lama ridge akan menjadi flat. Aloe vera adalah bahan stimulasi biogenik dan mempunyai aktivitas hormon untuk proses penyembuhan luka. Tujuan: Tujuan dari penelitian ini adalah untuk mengetahui aktivitas osteoblas pada tulang alveol dengan pemberian kombinasi Aloe vera gel dan xenograft concelous bovine (XCB. Metode: Lima puluh empat ekor Cavia cabaya, dibagi menjadi 3 kelompok besar, kelompok pertama adalah kelompok kontrol yaitu hanya dilakukan pencabutan saja tanpa perlakuan, kelompok ke-2 yaitu kelompok yang setelah dicabut diberi XCB saja dan kelompok ke-3 yaitu kelompok yang setelah pencabutan diberi kombinasi Aloe vera gel dengan XCB pada luka bekas pencabutan gigi. Kemudian masing

Histological and Immunohistochemical Characterization of a Case of Endometriosis in a Guinea Pig (Cavia tschudii

Directory of Open Access Journals (Sweden)

Alfonso Baldi

2017-01-01

Full Text Available Endometriosis is a chronic gynecological disease characterized by the ectopic proliferation of endometrial tissue outside of the uterine cavity. The pathogenesis of this disease is still obscure, and Sampson’s theory of retrograde menstruation is still the most widely accepted explanation. Endometriosis in animals has been so far described not only in baboons and a rhesus macaque but also in dogs and horses that are nonmenstruating animals. In this article, we report the histological and immunohistochemical characterization of the first case of ovarian cystic endometriosis and adenomyosis in a guinea pig. The case presented supports the hypothesis that endometriosis is a disease not at all related to the phenomenon of retrograde menstruation but is a consequence of some alterations in the morphogenesis of the female genital system and therefore it could be found in any mammal. We suggest considering endometriosis among the other pathological phenotypes in animals displaying ovarian and uterine alterations and having a history of difficulties in conceiving.

Possível interferência da antitoxina tetânica pré-existente, na vacinação antitetânica Possible interference of pre-existing tetanus antitoxin in antitetanus immunization

Directory of Open Access Journals (Sweden)

Rosalvo Guidolin

1981-04-01

Full Text Available Estudou-se qual a possível interferência no desenvolvimento da imunidade antitetânica ativa em cobaias e camundongos, filhos de fêmeas vacinadas contra o tétano em diferentes épocas durante o período da prenhês. Verificou-se que a vacinação das fêmeas, em gestação não interferiu, negativamente, no desenvolvimento da imunidade ativa dos animais filhos, quando submetidos à vacinação ao redor de 60 dias após o nascimento. A presença de baixos níveis de anticorpos circulantes, recebidos congenitamente, parece ter, em determinadas condições, estimulado a resposta imunitária quando, posteriormente, os animais filhos foram vacinados contra o tétano. Sugere-se que o complexo antígeno-anticorpo formado seja capaz de melhorar a resposta imunitária induzida pelo toxóide.Possibility of interference in the development of active antitetanic immunity was studied in the offspring of guinea pigs and mice whose mothers had received antitetanic vaccine during different periods of pregnancy. Vaccination of the females during pregnancy did not interfere negatively in the development of active immunity in their offspring when the latter were vaccinated about 60 days after birth. The presence of small amounts of circulating antibodies, congenitally received, seems, under certain conditions, to stimulate the immune response upon posterior vaccination against tetanus. This suggests that the acquired antigen-antibody complex heightens the immune response induced by the toxoid.

Ludwik Fleck: pesquisador e prisioneiro

Directory of Open Access Journals (Sweden)

Ethel Mizrahy

2012-03-01

Full Text Available Quando o objetivo único de médicos e autoridades é desenvolver a ciência sem levar em conta os seres humanos, todos os caminhos ficam abertos para qualquer deformação, todas as regressões e degradações da desumanização tornam-se possíveis. E foi essa a realidade que Ludwik Fleck, judeu, médico, pesquisador e prisioneiro, se deparou nos campos de Auschwitz (Polônia e Buchenwald (Alemanha. Ele foi detido sob pena de morte e assim obrigado a servir como “especialista” dos “cientistas” nazistas em pesquisas para o desenvolvimento e fabricação de vacina contra o tifo exantemático. No bloco 10 de Auschwitz, ele presenciou experimentos de esterilização em prisioneiras sob a chefia do Dr. Clauberg. Em Buchenwald, Fleck trabalhou no centro experimental de tifo exantemático, no bloco 46, na fabricação de vacinas. O meio científico já conhecia diversas vacinas eficientes, mas os experimentos com cobaias humanas foram levados adiante... Hoje, de um modo geral, admite-se que todas essas experiências feitas com prisioneiros não levaram a nenhuma descoberta. Essa vivência como prisioneiro/pesquisador de Fleck pode ser caracterizada pelo termo cunhado por Primo Levi, “zona cinzenta” e no presente artigo pretendo discutir a questão do privilégio nos campos de concentração e a “ciência” desenvolvida nesse ambiente de terror.

Molecular detection of Leishmania spp. in road-killed wild mammals in the Central Western area of the State of São Paulo, Brazil.

Science.gov (United States)

Richini-Pereira, Virginia Bodelão; Marson, Pamela Merlo; Hayasaka, Enio Yoshinori; Victoria, Cassiano; da Silva, Rodrigo Costa; Langoni, Hélio

2014-01-01

Road-killed wild animals have been classified as sentinels for detecting such zoonotic pathogens as Leishmania spp., offering new opportunities for epidemiological studies of this infection. This study aimed to evaluate the presence of Leishmania spp. and Leishmania chagasi DNA by PCR in tissue samples (lung, liver, spleen, kidney, heart, mesenteric lymph node and adrenal gland) from 70 road-killed wild animals. DNA was detected in tissues of one Cavia aperea (Brazilian guinea pig), five Cerdocyon thous (crab-eating fox), one Dasypus septemcinctus (seven-banded armadillo), two Didelphis albiventris (white-eared opossum), one Hydrochoerus hydrochoeris (capybara), two Myrmecophaga tridactyla (giant anteater), one Procyon cancrivorus (crab-eating raccoon), two Sphiggurus spinosus (porcupine) and one Tamandua tetradactyla (lesser anteater) from different locations in the Central Western part of São Paulo state. The Leishmania chagasi DNA were confirmed in mesenteric lymph node of one Cerdocyon thous. Results indicated common infection in wild animals. The approach employed herein proved useful for detecting the environmental occurrence of Leishmania spp. and L. chagasi, as well as determining natural wild reservoirs and contributing to understand the host-parasite interaction.

Antimicrobial property of lemongrass (Cymbopogon citratus) oil against pathogenic bacteria isolated from pet turtles.

Science.gov (United States)

De Silva, B C J; Jung, Won-Gi; Hossain, Sabrina; Wimalasena, S H M P; Pathirana, H N K S; Heo, Gang-Joon

2017-06-01

The usage of essential oils as antimicrobial agents is gaining attention. Besides, pet turtles were known to harbor a range of pathogenic bacteria while the turtle keeping is a growing trend worldwide.The current study examined the antimicrobial activity of lemon grass oil (LGO) against seven species of Gram negative bacteria namely; Aeromonas hydrophila , A. caviae , Citrobacter freundii , Salmonella enterica , Edwardsiella tarda , Pseudomonas aeruginosa , and Proteus mirabilis isolated from three popular species of pet turtles. Along with the results of disc diffusion, minimum inhibitory and minimum bactericidal concentration (MIC and MBC) tests, LGO was detected as effective against 6 species of bacteria excluding P. aeruginosa . MIC of LGO for the strains except P. aeruginosa ranged from 0.016 to 0.5% (V/V). The lowest MIC recorded in the E. tarda strain followed by A. hydrophilla , C. freundii , P. mirabilis , and S. enterica . Interestingly, all the bacterial species except E. tarda were showing high multiple antimicrobial resistance (MAR) index values ranging from 0.36 to 0.91 upon the 11 antibiotics tested although they were sensitive to LGO.

Meningoencephalitis in farmed monosex Nile tilapia (Oreochromis niloticus L. caused by Streptococcus agalactiae

Directory of Open Access Journals (Sweden)

Adikesavalu Harresh

2017-09-01

Full Text Available Aquaculture of tilapia is a new research venture in India. With intensification in farming practices, tilapia are increasingly susceptible to bacterial infections. This article describes the isolation and identification of pathogenic bacteria from cultured monosex Nile tilapia, Oreochromis niloticus (L., that experienced moderate to severe mortalities in West Bengal, India between September and August 2014 and histopathological alterations in various organs. Gram-positive diplococci, identified as Streptococcus agalactiae with Streptococcus identification kits and 16S rDNA sequencing analysis, were isolated from the brain, operculum, and kidney. Other bacteria from the kidney were identified as Aeromonas sobria, A. caviae, Klebsiella pneumoniae ssp. pneumoniae, Escherichia coli, and Enterobacter cloacae. Staphylococcus epidermis was isolated from opercular hemorrhages. Histological sections of the infected tilapia brain revealed meningoencephalitis and granulomatous lesions. Sections from other organs indicated congestion, hemorrhagic and hyperplastic cells, necrosis, vacuolation, hemosiderin deposition, hypertrophic nuclei, melanomacrophage aggregation, and ruptured veins. This report is the first description of S. agalactiae as a primary pathogen causing meningoencephalitis in cultured tilapia in India.

Emendation of the family Chlamydiaceae: proposal of a single genus, Chlamydia, to include all currently recognized species.

Science.gov (United States)

Sachse, Konrad; Bavoil, Patrik M; Kaltenboeck, Bernhard; Stephens, Richard S; Kuo, Cho-Chou; Rosselló-Móra, Ramon; Horn, Matthias

2015-03-01

The family Chlamydiaceae (order Chlamydiales, phylum Chlamydiae) comprises important, obligate intracellular bacterial pathogens of humans and animals. Subdivision of the family into the two genera Chlamydia and Chlamydophila has been discussed controversially during the past decade. Here, we have revisited the current classification in the light of recent genomic data and in the context of the unique biological properties of these microorganisms. We conclude that neither generally used 16S rRNA sequence identity cut-off values nor parameters based on genomic similarity consistently separate the two genera. Notably, no easily recognizable phenotype such as host preference or tissue tropism is available that would support a subdivision. In addition, the genus Chlamydophila is currently not well accepted and not used by a majority of research groups in the field. Therefore, we propose the classification of all 11 currently recognized Chlamydiaceae species in a single genus, the genus Chlamydia. Finally, we provide emended descriptions of the family Chlamydiaceae, the genus Chlamydia, as well as the species Chlamydia abortus, Chlamydia caviae and Chlamydia felis. Copyright © 2015 Elsevier GmbH. All rights reserved.

Use of saprophytic leptospira strains in the serodiagnosis of experimental leptospirosis in guinea-pigs (Cavia sp

Directory of Open Access Journals (Sweden)

Raul J. S. Girio

1988-04-01

Full Text Available The efficiency of four Leptospira biflexa strains (Buenos Aires, Patoc 1, Rufino and São Paulo as single antigen in the serodiagnosis in guinea-pigs experimentally infected with seven Leptospira interrogans serovars (canicola, grippotyphosa, hardjo, icterohaemorrhagiae, pomona, tarassovi and wolffi was evaluated by the microscopic agglutination test. The four saprophytic strains were not able to reveal antibody titres in sera of guinea-pigs experimentally infected with Leptospira interrogans. Serological cross-reactions were observed between strains Patoc 1 and São Paulo and between serovars wolffi and hardjo.

The increasing of fibroblast growth factor 2, osteocalcin, and osteoblast due to the induction of the combination of Aloe vera and 2% xenograft concelous bovine

Directory of Open Access Journals (Sweden)

Utari Kresnoadi

2012-12-01

Full Text Available Background: To make a successfull denture prominent ridge is needed, preservation on tooth extraction socket is needed in order to prevent alveol bone resorption caused by revocation trauma. An innovative modification of the material empirically suspected to be able reduce inflammation caused by the revocation trauma is a combination of Aloe vera and xenograft concelous bovine (XCB and Aloe vera is a biogenic stimulator and accelerating the growth of alveolar ridge bone after tooth extraction. Purpose: The research was aimed to determine of the increasing alveol bone formation by inducing the combination of Aloe vera and 2% xenograft concelous bovine. Methods: To address the problems, the combination of Aloe vera and xenograft concelous bovine was induced into the tooth extraction sockets of Cavia cabayas which devided on 8 groups. Groups control, filled with XCB, Aloe vera and Aloe vera and XCB combination, at 7 days and 30 days after extraction. Afterwards, immunohistochemical examination was conducted to examine the expressions of FGF-2 and osteocalcin, as the product of the growth of osteoblasts. Results: There were significantly increases expression of FGF-2 and osteocalcyn on group which filled with XCB, Aloe vera and combined Aloe vera and XCB. Conclusion: It may be concluded that the induction of the combination of Aloe vera and xenograft concelous bovine into the tooth sockets can enhance the growth expressions of FGF-2 and osteocalcin as the product of osteoblasts, thus, the growth of alveolar bone was increased.Latar belakang: Untuk keberhasilan pembuatan gigitiruan diperlukan ridge yang prominent, maka diperlukan suatu preservasi soket pencabutan gigi untuk mencegah terjadinya resopsi tulang alveolar akibat trauma pencabutan. Suatu inovasi modifikasi bahan yang diduga secara empiris dapat mengurangi keradangan karena trauma pencabutan adalah berupa kombinasi Aloe vera dan xenograft concelous bovine (XCB. Aloe vera yang merupakan

Susceptibilidade de animais de laboratório à intoxicação por Ateleia glazioviana (Leg. Papilionoideae

Directory of Open Access Journals (Sweden)

Leite Lenir G.

2002-01-01

Full Text Available Coelhos, cobaias, ratos e camundongos foram utilizados com a finalidade de reproduzir a forma cardíaca da intoxicação por Ateleia glazioviana. Quatro animais de cada espécie receberam por 4 meses a planta, secada à sombra, na concentração de 10% na ração, fornecida na forma de pelets. Os pelets foram preparados misturando 700 g de ração comercial, 200 g de amido de milho, 1000 ml de água destilada e 100 g de planta seca e, posteriormente, secados em estufa a 100ºC, durante 16 a 20 horas. Quatro animais de cada espécie serviram como testemunhas, recebendo a ração preparada da mesma forma, porém com a utilização de azevém (Lolium multiflorum em lugar de A. glazioviana. Era fornecida água à vontade e, para os coelhos e cobaias, também aveia (Avena sativa verde diariamente. Esses animais não apresentaram nenhuma alteração clínica, e foram pesados semanalmente nas últimas 5 semanas do período experimental, não apresentando diferença significativa no ganho de peso. À necropsia não foram observadas alterações macroscópicas e pelo exame histológico também não foram detectadas lesões significativas no coração e em outros órgãos. Para testar a atividade abortiva de A. glazioviana, ração contendo 10% de planta seca, preparada da mesma forma que no experimento anterior, foi administrada a 11 outros ratos, fêmeas, prenhes, nos dois últimos ter��os da gestação. Um grupo controle de 11 fêmeas recebeu a ração com azevém a 10%, durante o mesmo período. Esses animais tiveram filhotes normais e no prazo correto. Para determinar a possível perda de toxidez da planta durante a preparação dos pelets, A. glazioviana foi aquecida por 16 a 20 horas a 100ºC e, posteriormente, administrada a um ovino em 26 doses diárias de 2,65 g/kg de planta seca. Durante o período experimental, a ovelha apresentou batimentos cardíacos mais fortes, taquicardia e arritmia cardíacas, depois bradicardia e, no período final

Prevalence, species differentiation, haemolytic activity, and antibiotic susceptibility of aeromonads in untreated well water

Directory of Open Access Journals (Sweden)

Khalifa Sifaw Ghenghesh

2001-02-01

Full Text Available The use of untreated water for drinking and other activities have been associated with intestinal and extraintestinal infections in humans due to Aeromonas species. In the present study aeromonads were isolated from 48.7% of 1,000 water samples obtained from wells and other miscellaneous sources. Aeromonas species were detected in 45% of samples tested in spring, 34.5% in summer, 48% in autumn and 60% of samples tested in winter. Speciation of 382 strains resulted in 225 (59% being A. hydrophila, 103 (27% A. caviae, 42 (11% A. sobria and 11 (3% atypical aeromonads. Of 171 Aeromonas strains tested for their haemolytic activity, 53%, 49%, 40% and 37% were positive in this assay using human, horse, sheep and camel erythrocytes respectively. The results obtained indicate that potentially enteropathogenic Aeromonas species are commonly present in untreated drinking water obtained from wells in Libya (this may also apply to other neighbouring countries which may pose a health problem to users of such water supplies. In addition, ceftriaxone and ciprofloxacin are suitable drugs that can be used in the treatment of Aeromonas-associated infections, particularly in the immunocompromised, resulting from contact with untreated sources of water.

Potential enterotoxicity and antimicrobial resistance pattern of Aeromonas species isolated from pet turtles and their environment.

Science.gov (United States)

Wimalasena, S H M P; Shin, Gee-Wook; Hossain, Sabrina; Heo, Gang-Joon

2017-05-23

To investigate the potential enterotoxicity and antimicrobial resistance of aeromonads from pet turtles as a risk for human infection, one hundred and two Aeromonas spp. were isolated from the feces, skin and rearing environments of pet turtles and identified by biochemical and gyrB sequence analyses. Aeromonas enteropelogenes was the predominant species among the isolates (52.9%) followed by A. hydrophila (32.4%), A. dharkensis (5.9%), A. veronii (4.9%) and A. caviae (3.9%). Their potential enterotoxicities were evaluated by PCR assays for detecting genes encoding cytotoxic enterotoxin (act) and two cytotonic enterotoxins (alt and ast). 75.8% of A. hydrophila isolates exhibited the act + /alt + /ast + genotype, whereas 94.4% of A. enteropelogenes isolates were determined to be act - /alt - /ast - . In an antimicrobial susceptibility test, most isolates were susceptible to all tested antibiotics except amoxicillin, ampicillin, cephalothin, chloramphenicol and tetracycline. Non-susceptible isolates to penicillins (ampicillin and amoxicillin) and fluoroquinolones (ciprofloxacin and norfloxacin) were frequently observed among the A. enteropelogenes isolates. Few isolates were resistant to imipenem, amikacin, ceftriaxone and cefotaxime. Collectively, these results suggest that pet turtles may pose a public health risk of infection by enterotoxigenic and antimicrobial resistant Aeromonas strains.

Habitat associations of small mammals in southern Brazil and use of regurgitated pellets of birds of prey for inventorying a local fauna

Directory of Open Access Journals (Sweden)

DR. Scheibler

Full Text Available We inventoried terrestrial small mammals in an agricultural area in southern Brazil by using trapping and prey consumed by Barn Owls (Tyto alba and White-tailed Kites (Elanus leucurus. Small mammals were trapped in three habitat types: corn fields, uncultivated fields ("capoeiras", and native forest fragments. A total of 1,975 small mammal specimens were trapped, another 2,062 identified from the diet of Barn Owls, and 2,066 from the diet of White-tailed Kites. Both trapping and prey in the predators' diet yielded 18 small mammal species: three marsupials (Didelphis albiventris, Gracilinanus agilis, and Monodelphis dimidiata and 15 rodents (Akodon paranaensis, Bruceppatersonius iheringi, Calomys sp., Cavia aperea, Euryzygomatomys spinosus, Holochilus brasiliensis, Mus musculus, Necromys lasiurus, Nectomys squamipes, Oligoryzomys nigripes, Oryzomys angouya, Oxymycterus sp.1, Oxymycterus sp.2, Rattus norvegicus, and Rattus rattus (Linnaeus, 1758. The greatest richness was found in the uncultivated habitat. We concluded that the three methods studied for inventorying small mammals (prey in the diet of Barn Owls, White-tailed Kites, and trapping were complementary, since together, rather than separately, they produced a better picture of local richness.

Identification of chitinolytic bacteria isolated from shrimp pond sediment and characterization of their chitinase encoding gene

Science.gov (United States)

Triwijayani, A. U.; Puspita, I. D.; Murwantoko; Ustadi

2018-03-01

Chitinolytic bacteria are a group of bacteria owning enzymes that able to hydrolyze chitin. Previously, we isolated chitinolytic bacteria from shrimp pond sediment in Bantul, Yogyakarta, and obtained five isolates showing high chitinolytic index named as isolate PT1, PT2, PT5, PT6 and PB2. The aims of this study were to identify chitinolytic bacteria isolated from shrimp pond sediment and to characterize the chitinase encoding gene from each isolate. The molecular technique was performed by amplification of 16S rDNA, amplification of chitinase encoding gene and sequence analysis. Two chitinolytic bacteria of PT1 and PT2 were similar to Aeromonas bivalvium strain D15, PT5 to Pseudomonas stutzeri strain BD-2.2.1, PT6 to Serratia marcescens strain FZSF02 and PB2 to Streptomyces misionensis strain OsiRt-1. The comparison of chitinase encoding gene between three isolates with those in Gen Bank shows that PT1 had similar sequences with the chi1 gene in Aeromonas sp. 17m, PT2 with chi1 gene in A. caviae (CB101) and PT6 with chiB gene in S. Marcescens (BJL200).

Unusual microorganisms and antimicrobial resistances in a group of Syrian migrants: Sentinel surveillance data from an asylum seekers centre in Italy.

Science.gov (United States)

Angeletti, Silvia; Ceccarelli, Giancarlo; Vita, Serena; Dicuonzo, Giordano; Lopalco, Maurizio; Dedej, Etleva; Blasi, Aletheia; Antonelli, Francesca; Conti, Alessia; De Cesaris, Marina; Farchi, Francesca; Lo Presti, Alessandra; Ciccozzi, Massimo

2016-01-01

Three years of civil war in Syria have caused death and increase of communicable diseases. The suffering population has been forced to migrate creating a fertile condition for epidemic spread of infection within the refugee camps. Forty-eight Syrian migrants, upon their arrival in Italy, were accommodated at the asylum seekers centre of Castelnuovo di Porto. They received a physical examination and were subjected to microbiological surveillance by blood, rectal, pharyngeal and nasal swabs collection and delivering to the Clinical Pathology and Microbiology Laboratory of the University Campus Bio-Medico of Rome. All refugees resulted negative for HBV, HCV and HIV infections. In swabs a large number of unusual gram-negative bacteria species were isolated, such as Pseudomonas putida, Pseudomonas monteilii, Pseudomonas fulva, Pseudomonas moselii, Aeromonas veronii, Aeromonas caviae, Aeromonas hydrophila, Acinteobacter guilloviae, Acinteobacter lowffii; Acinetobacter johnsonii; Acinteobacter tjernbergae; Pantoea agglomerans; Pantoea calida. Among isolates, strains resistant to carbapenems, ESBL producers and methicillin resistant were found. The microbiological surveillance performed represents a useful action to understand refugees health status and to trace unusual microorganisms movement even carriers of antimicrobial resistance during migrants traveling. Copyright © 2016 Elsevier Ltd. All rights reserved.

Multinucleation during C. trachomatis infections is caused by the contribution of two effector pathways.

Directory of Open Access Journals (Sweden)

Heather M Brown

Full Text Available Chlamydia trachomatis is an obligate intracellular bacterial pathogen and the second leading cause of sexually transmitted infections in the US. Infections cause significant morbidity and can lead to serious reproductive sequelae, including an epidemiological link to increased rates of reproductive cancers. One of the overt changes that infected cells exhibit is the development of genomic instability leading to multinucleation. Here we demonstrate that the induction of multinucleation is not conserved equally across chlamydial species; C. trachomatis L2 caused high levels of multinucleation, C. muridarum intermediate levels, and C. caviae had very modest effects on multinucleation. Our data show that at least two effector pathways together cause genomic instability during infection leading to multinucleation. We find that the highly conserved chlamydial protease CPAF is a key effector for one of these pathways. CPAF secretion is required for the loss of centrosome duplication regulation as well as inducing early mitotic exit. The second effector pathway involves the induction of centrosome position errors. This function is not conserved in three chlamydial species tested. Together these two pathways contribute to the induction of high levels of genomic instability and multinucleation seen in C. trachomatis infections.

Histological and microbiological aspects of actinomycetoma cases in Venezuela

Directory of Open Access Journals (Sweden)

José Antonio Serrano

1988-08-01

Full Text Available A ten year (1976-1986 review study of cases of Actinomycetoma in Venezuela was made through personal interview and clinical examinations, analysis of medical records of patients with actinomycetoma, histological studies of biopsy samples, as well as microbiological studies of isolates strain, also through out personal interviews with researchers and dermatologists who were sources of information on mycetoma cases. A total of 47 cases were recorded. As etiologic agent Actinomadura madurae was found in 20 cases - (42.5%, Nocardia brasiliensis in 13 cases (27.6%, Nocardia spp 7 cases (14.8%, Streptomyces somaliensis in 4 cases (8.5%, N. asteroides in 2 cases (4.2% and N. otitidis caviarum, (N. caviae in 1 case (2.1%. Most of the reported cases involved individuals living and working in rural areas, mostly males who outnumber females 4:1. The patients were 18 to 80 years old. A. madurae was reported as the most frequent etiologic agent. Most of the clinical cases were seen when the disease was well established. Twenty four of the forty seven cases reported were observed in Lara State, which represents a 51.0% of all the cases studied.

In Azospirillum brasilense, mutations in flmA or flmB genes affect polar flagellum assembly, surface polysaccharides, and attachment to maize roots.

Science.gov (United States)

Rossi, Fernando Ariel; Medeot, Daniela Beatriz; Liaudat, Juan Pablo; Pistorio, Mariano; Jofré, Edgardo

2016-09-01

Azospirillum brasilense is a soil bacterium capable of promoting plant growth. Several surface components were previously reported to be involved in the attachment of A. brasilense to root plants. Among these components are the exopolysaccharide (EPS), lipopolysaccharide (LPS) and the polar flagellum. Flagellin from polar flagellum is glycosylated and it was suggested that genes involved in such a posttranslational modification are the same ones involved in the biosynthesis of sugars present in the O-antigen of the LPS. In this work, we report on the characterization of two homologs present in A. brasilense Cd, to the well characterized flagellin modification genes, flmA and flmB, from Aeromonas caviae. We show that mutations in either flmA or flmB genes of A. brasilense resulted in non-motile cells due to alterations in the polar flagellum assembly. Moreover, these mutations also affected the capability of A. brasilense cells to adsorb to maize roots and to produce LPS and EPS. By generating a mutant containing the polar flagellum affected in their rotation, we show the importance of the bacterial motility for the early colonization of maize roots. Copyright © 2016 Elsevier GmbH. All rights reserved.

Suprasegmental lexical stress cues in visual speech can guide spoken-word recognition.

Science.gov (United States)

Jesse, Alexandra; McQueen, James M

2014-01-01

Visual cues to the individual segments of speech and to sentence prosody guide speech recognition. The present study tested whether visual suprasegmental cues to the stress patterns of words can also constrain recognition. Dutch listeners use acoustic suprasegmental cues to lexical stress (changes in duration, amplitude, and pitch) in spoken-word recognition. We asked here whether they can also use visual suprasegmental cues. In two categorization experiments, Dutch participants saw a speaker say fragments of word pairs that were segmentally identical but differed in their stress realization (e.g., 'ca-vi from cavia "guinea pig" vs. 'ka-vi from kaviaar "caviar"). Participants were able to distinguish between these pairs from seeing a speaker alone. Only the presence of primary stress in the fragment, not its absence, was informative. Participants were able to distinguish visually primary from secondary stress on first syllables, but only when the fragment-bearing target word carried phrase-level emphasis. Furthermore, participants distinguished fragments with primary stress on their second syllable from those with secondary stress on their first syllable (e.g., pro-'jec from projector "projector" vs. 'pro-jec from projectiel "projectile"), independently of phrase-level emphasis. Seeing a speaker thus contributes to spoken-word recognition by providing suprasegmental information about the presence of primary lexical stress.

The occurrence of Aeromonas in drinking water, tap water and the Porsuk River

Directory of Open Access Journals (Sweden)

Merih Kivanc

2011-03-01

Full Text Available The occurrence of Aeromonas spp. in the Porsuk River, public drinking water and tap water in the City of Eskisehir (Turkey was monitored. Fresh water samples were collected from several sampling sites during a period of one year. Total 102 typical colonies of Aeromonas spp. were submitted to biochemical tests for species differentiation and of 60 isolates were confirmed by biochemical tests. Further identifications of isolates were carried out first with the VITEK system (BioMe˜rieux and then selected isolates from different phenotypes (VITEK types were identified using the DuPont Qualicon RiboPrinter® system. Aeromonas spp. was detected only in the samples from the Porsuk River. According to the results obtained with the VITEK system, our isolates were 13% Aeromonas hydrophila, 37% Aeromonas caviae, 35% Pseudomonas putida, and 15% Pseudomonas acidovorans. In addition Pseudomonas sp., Pseudomonas maltophila, Aeromonas salmonicida, Aeromonas hydrophila, and Aeromonas media species were determined using the RiboPrinter® system. The samples taken from the Porsuk River were found to contain very diverse Aeromonas populations that can pose a risk for the residents of the city. On the other hand, drinking water and tap water of the City are free from Aeromonas pathogens and seem to be reliable water sources for the community.

Streptomycin action to the mammalian inner ear vestibular organs: comparison between pigmented guinea pigs and rats.

Science.gov (United States)

Meza, Graciela; Aguilar-Maldonado, Beatriz

2007-01-01

Streptomycin is the antibiotic of choice to treat tuberculosis and other infectious diseases but it causes vestibular malfunction and hipoacusia. Rodents are usually employed as models of drug action to the inner ear and results are extrapolated to what happens in humans. In rats, streptomycin destroys macular sensory cells and does not affect cochlear ones, whereas in guinea pigs the contrary is true. Action on the vestibular cristae cells involved in vestibulo-ocular reflex integrity is less clear. Thus, we compared this response in both pigmented guinea pigs (Cavia cobaya) and rats (Rattus norvegicus) after parallel streptomycin chronic treatment. In guinea pigs, the reflex was obliterated along treatment time; in rats this behavior was not observed, suggesting that the end organ target was diverse. In recent studies, streptidine, a streptomycin derivative found in the blood of humans and rats treated with streptomycin, was the actual ototoxic agent. The putative streptomycin vestibular organ target observed in humans corresponds with the guinea pig observations. Results observed in rats are controversial: streptidine did not cause any damage either to vestibular cristae nor auditory cells. We hypothesize differential drug metabolism and distribution and conclude that results in laboratory animals may not always be applicable in the human situation.

Land fauna composition of small mammals of a fragment of Atlantic Forest in the State of Sao Paulo, Brazil

Directory of Open Access Journals (Sweden)

Darci Moraes Barros-Battesti

2000-03-01

Full Text Available The Atlantic Forest small mammal land fauna, except bats, and the abiotic factors that might have an influence on its composition, were studied in the Itapevi County, State of Sao Paulo, a forested region, partly altered by antropic action, from January, 1995 to June, 1996. The trapping effort consisted of 2,888 trap-nights, resulting in a 4.6% trapping success and consisted of monthly trappings, for five consecutive days. During this period, 134 specimens were captured, of which 46.3% were Didelphimorphia and 53.7% were Rodentia. Eleven species were registered: two Didelphimorphia: Didelphis marsupialis (Linnaeus, 1758 and Marmosops incanus (Lund, 1841, and nine Rodentia: Akodon cursor (Winge, 1887, Bolomys lasiurus (Lund, 1841, Oxymycterus hispidus Pictet, 1843, Oxymycterus nasutus (Waterhouse, 1837, Oligoryzomys nigripes (Olfers, 1818, Oryzomys angouya (Fischer, 1814, Raltus norvegicus (Berkenhout, 1769, Euryzygomatomys spinosus (G. Fischer, 1814 and Cavia aperea Erxleben, 1777. The relative density indices were correlated with meteorological data by Spearman and Pearson coefficients. For marsupials these correlations were not significant. For rodents, the correlations were significant and directly related to lower temperature and rainfall indices (p<0.05. During the dry season the occurrence of small mammals was 50% greater than during the wet season, probably due to foraging strategies in the studied fragment of Atlantic Forest.

Avaliação fototóxica e screening mutagênico de extratos de propolis, Aloe spp. e Hamamelis virginiana

Directory of Open Access Journals (Sweden)

M. F.S. RAMOS

2009-01-01

Full Text Available

A utilização de extratos vegetais em produtos farmacêuticos e cosméticos tem mostrado ser uma tendência mundial e cresceu substancialmente nas duas últimas décadas. No entanto, há ainda poucos relatos na literatura com relação à atividade mutagênica ou fototóxica de extratos vegetais. No presente trabalho foi avaliada a atividade fototóxica e o “screening” mutagênico de extratos fluidos e secos de própolis, Aloe spp. e Hamamelis virginiana. Na investigação de fototoxicidade foram realizados ensaios microbiológicos, utilizando cepas de Candida albicans e Saccharomyces cerevisiae, bem como ensaios biológicos com cobaias albinos. Extratos etanólicos de Ruta graveolens e Citrus spp., além de 8-metoxipsoraleno (fármaco sintético padrão, foram usados como controles positivos em ambos os testes. A atividade mutagênica foi avaliada qualitativamente segundo o “spot test” descrito por Maron & Ames, com cepas de Salmonella typhimurium TA97, TA98, TA100 e TA102, empregando como controle positivo o óxido de 4-nitroquinolina. Não foi observada atividade fototóxica, em ambos os ensaios realizados, para qualquer dos extratos. O ensaio microbiológico demonstrou uma atividade fungistática ou fungicida nos extratos secos de hamamélis. Os resultados obtidos nos ensaios microbiológicos com a levedura S. cerevisiae indicam que este microrganismo apresentou eficiência no procedimento de “screening” de atividade fototóxica comparável à obtida com C. albicans. Os extratos vegetais não apresentaram atividade mutagênica nos ensaios preliminares realizados. Palavras-chave: Aloe spp., Hamamelis virginiana, própolis, fototoxicidade, mutagenicidade.

Application of a continuously stirred tank bioreactor (CSTR) for bioremediation of hydrocarbon-rich industrial wastewater effluents

International Nuclear Information System (INIS)

Gargouri, Boutheina; Karray, Fatma; Mhiri, Najla; Aloui, Fathi; Sayadi, Sami

2011-01-01

A continuously stirred tank bioreactor (CSTR) was used to optimize feasible and reliable bioprocess system in order to treat hydrocarbon-rich industrial wastewaters. A successful bioremediation was developed by an efficient acclimatized microbial consortium. After an experimental period of 225 days, the process was shown to be highly efficient in decontaminating the wastewater. The performance of the bioaugmented reactor was demonstrated by the reduction of COD rates up to 95%. The residual total petroleum hydrocarbon (TPH) decreased from 320 mg TPH l -1 to 8 mg TPH l -1 . Analysis using gas chromatography-mass spectrometry (GC-MS) identified 26 hydrocarbons. The use of the mixed cultures demonstrated high degradation performance for hydrocarbons range n-alkanes (C10-C35). Six microbial isolates from the CSTR were characterized and species identification was confirmed by sequencing the 16S rRNA genes. The partial 16S rRNA gene sequences demonstrated that 5 strains were closely related to Aeromonas punctata (Aeromonas caviae), Bacillus cereus, Ochrobactrum intermedium, Stenotrophomonas maltophilia and Rhodococcus sp. The 6th isolate was affiliated to genera Achromobacter. Besides, the treated wastewater could be considered as non toxic according to the phytotoxicity test since the germination index of Lepidium sativum ranged between 57 and 95%. The treatment provided satisfactory results and presents a feasible technology for the treatment of hydrocarbon-rich wastewater from petrochemical industries and petroleum refineries.

Application of a continuously stirred tank bioreactor (CSTR) for bioremediation of hydrocarbon-rich industrial wastewater effluents

Energy Technology Data Exchange (ETDEWEB)

Gargouri, Boutheina; Karray, Fatma; Mhiri, Najla; Aloui, Fathi [Laboratoire des Bioprocedes Environnementaux, Pole d' Excellence Regional AUF-LBPE, Centre de Biotechnologie de Sfax, Universite de Sfax, BP 1117, 3018 Sfax (Tunisia); Sayadi, Sami, E-mail: sami.sayadi@cbs.rnrt.tn [Laboratoire des Bioprocedes Environnementaux, Pole d' Excellence Regional AUF-LBPE, Centre de Biotechnologie de Sfax, Universite de Sfax, BP 1117, 3018 Sfax (Tunisia)

2011-05-15

A continuously stirred tank bioreactor (CSTR) was used to optimize feasible and reliable bioprocess system in order to treat hydrocarbon-rich industrial wastewaters. A successful bioremediation was developed by an efficient acclimatized microbial consortium. After an experimental period of 225 days, the process was shown to be highly efficient in decontaminating the wastewater. The performance of the bioaugmented reactor was demonstrated by the reduction of COD rates up to 95%. The residual total petroleum hydrocarbon (TPH) decreased from 320 mg TPH l{sup -1} to 8 mg TPH l{sup -1}. Analysis using gas chromatography-mass spectrometry (GC-MS) identified 26 hydrocarbons. The use of the mixed cultures demonstrated high degradation performance for hydrocarbons range n-alkanes (C10-C35). Six microbial isolates from the CSTR were characterized and species identification was confirmed by sequencing the 16S rRNA genes. The partial 16S rRNA gene sequences demonstrated that 5 strains were closely related to Aeromonas punctata (Aeromonas caviae), Bacillus cereus, Ochrobactrum intermedium, Stenotrophomonas maltophilia and Rhodococcus sp. The 6th isolate was affiliated to genera Achromobacter. Besides, the treated wastewater could be considered as non toxic according to the phytotoxicity test since the germination index of Lepidium sativum ranged between 57 and 95%. The treatment provided satisfactory results and presents a feasible technology for the treatment of hydrocarbon-rich wastewater from petrochemical industries and petroleum refineries.

Epidemiologic and clinical characteristics of acute diarrhea with emphasis on Entamoeba histolytica infections in preschool children in an urban slum of Dhaka, Bangladesh.

Science.gov (United States)

Haque, Rashidul; Mondal, Dinesh; Kirkpatrick, Beth D; Akther, Selim; Farr, Barry M; Sack, R Bradley; Petri, William A

2003-10-01

The epidemiology, clinical features, nutritional status, and causative agents of diarrhea were studied in 289 Bangladeshi children (147 boys and 142 girls) 2-5 years old. The use of improved diagnostic tests for amebiasis enabled for the first time analysis of the contribution of Entamoeba histolytica to total diarrheal illness in this community setting. The average incidence rate of diarrhea was 1.8/child-year, and the average number of diarrheal days was 3.7 days/child-year over an average observation period of 2.8 years/child. Seventy-five percent of the diarrheal episodes were sp. (10%), E. histolytica (8.7%), Campylobacter jejunii (5.8%), P. shigelloides (4.3%), and A. caviae (4.3%). The overall incidence rate of E. histolytica-associated diarrhea was 0.08/child-year. Visible blood and hemoccult test-detected blood loss was found in 7% and 25%, respectively, of cases of E. histolytica-associated diarrhea. Children who had recovered from a diarrheal episode with E. histolytica, but not E. dispar, had half the chance of developing subsequent E. histolytica-associated diarrhea, consistent with the development of species-specific acquired immunity. In conclusion, the use of modern diagnostic tests demonstrated that E. histolytica contributed to overall morbidity from diarrheal illness. Understanding the etiology, frequency, and consequences of acute diarrhea in children from a developing country should aid in the design of interventions to improve child health.

Within-litter differences in personality and physiology relate to size differences among siblings in cavies.

Science.gov (United States)

Guenther, A; Trillmich, F

2015-06-01

Many aspects of an animal's early life potentially contribute to long-term individual differences in physiology and behaviour. From several studies on birds and mammals it is known that the early family environment is one of the most prominent factors influencing early development. Most of these studies were conducted on highly altricial species. Here we asked whether in the highly precocial cavy (Cavia aperea) the size rank within a litter, i.e. whether an individual is born as the heaviest, the lightest or an intermediate sibling, affects personality traits directly after birth and after independence. Furthermore, we investigated whether individual states (early growth, baseline cortisol and resting metabolic rate) differ between siblings of different size ranks and assessed their relation to personality traits. Siblings of the same litter differed in personality traits as early as three days after birth. Pups born heaviest in the litter were more explorative and in general more risk-prone than their smaller siblings. Physiological state variables were tightly correlated with personality traits and also influenced by the size rank within litter, suggesting that the size relative to littermates constitutes an important factor in shaping an individual's developmental trajectory. Our data add valuable information on how personalities are shaped during early phases of life and indicate the stability of developmentally influenced behavioural and physiological traits. Copyright © 2015 Elsevier Inc. All rights reserved.

Airport Surface Access and Mobile Apps

Directory of Open Access Journals (Sweden)

Luis Martin-Domingo

2015-02-01

Full Text Available Purpose: Airport Surface Access faces two main opposite issues: (1 cars, being the main transport mode, contribute to the increasing level of congestion and pollution of cities; and (2 simultaneously, parking fees are one important source of airports commercial revenue, creating a dilemma for airports when facing the problem. Following the recent trend of air passengers travelling with Smartphone (78% in 2013, the purpose of this paper is to monitor the adoption of mobile Applications (Apps by airports and to analyze if the information and functions provided in those Apps can help to overcome the above two issues. Design/methodology/approach: 31 iPhone App of some of the largest European airports were evaluated in the lab using the evaluation model of Destinations Mobile Applications (Scolari and Fernández-Cavia 2014 adapted for for the Airport Surface Access on Airport Apps Findings and Originality/value: The Apps evaluated provided a very limited functionality to help passengers to plan and book their trips to/from the airports on public transports and gave high priority to parking information and services. Originality/value: Although Airport Surface Access has been a widely researched, the originality of this paper is the analysis of airport mobile Apps as a potential tool for airports to deal with the surface airport access problems.Access, Airports, Mobile Internet, Commercial Revenues

Processing of Chlamydia abortus polymorphic membrane protein 18D during the chlamydial developmental cycle.

Directory of Open Access Journals (Sweden)

Nick M Wheelhouse

Full Text Available Chlamydia possess a unique family of autotransporter proteins known as the Polymorphic membrane proteins (Pmps. While the total number of pmp genes varies between Chlamydia species, all encode a single pmpD gene. In both Chlamydia trachomatis (C. trachomatis and C. pneumoniae, the PmpD protein is proteolytically cleaved on the cell surface. The current study was carried out to determine the cleavage patterns of the PmpD protein in the animal pathogen C. abortus (termed Pmp18D.Using antibodies directed against different regions of Pmp18D, proteomic techniques revealed that the mature protein was cleaved on the cell surface, resulting in a100 kDa N-terminal product and a 60 kDa carboxy-terminal protein. The N-terminal protein was further processed into 84, 76 and 73 kDa products. Clustering analysis resolved PmpD proteins into three distinct clades with C. abortus Pmp18D, being most similar to those originating from C. psittaci, C. felis and C. caviae.This study indicates that C. abortus Pmp18D is proteolytically processed at the cell surface similar to the proteins of C. trachomatis and C. pneumoniae. However, patterns of cleavage are species-specific, with low sequence conservation of PmpD across the genus. The absence of conserved domains indicates that the function of the PmpD molecule in chlamydia remains to be elucidated.

The Chlamydia psittaci genome: a comparative analysis of intracellular pathogens.

Directory of Open Access Journals (Sweden)

Anja Voigt

Full Text Available Chlamydiaceae are a family of obligate intracellular pathogens causing a wide range of diseases in animals and humans, and facing unique evolutionary constraints not encountered by free-living prokaryotes. To investigate genomic aspects of infection, virulence and host preference we have sequenced Chlamydia psittaci, the pathogenic agent of ornithosis.A comparison of the genome of the avian Chlamydia psittaci isolate 6BC with the genomes of other chlamydial species, C. trachomatis, C. muridarum, C. pneumoniae, C. abortus, C. felis and C. caviae, revealed a high level of sequence conservation and synteny across taxa, with the major exception of the human pathogen C. trachomatis. Important differences manifest in the polymorphic membrane protein family specific for the Chlamydiae and in the highly variable chlamydial plasticity zone. We identified a number of psittaci-specific polymorphic membrane proteins of the G family that may be related to differences in host-range and/or virulence as compared to closely related Chlamydiaceae. We calculated non-synonymous to synonymous substitution rate ratios for pairs of orthologous genes to identify putative targets of adaptive evolution and predicted type III secreted effector proteins.This study is the first detailed analysis of the Chlamydia psittaci genome sequence. It provides insights in the genome architecture of C. psittaci and proposes a number of novel candidate genes mostly of yet unknown function that may be important for pathogen-host interactions.

The involvement of tetA and tetE tetracycline resistance genes in plasmid and chromosomal resistance of Aeromonas in Brazilian strains

Directory of Open Access Journals (Sweden)

Ilana Teruszkin Balassiano

2007-11-01

Full Text Available This study analyzed the involvement of tetA and tetE genes in the tetracycline resistance of 16 strains of genus Aeromonas, isolated from clinical and food sources. Polymerase chain reactions revealed that 37.5% of the samples were positive for tetA, and also 37.5% were tetE positive. One isolate was positive for both genes. Only the isolate A. caviae 5.2 had its resistance associated to the presence of a plasmid, pSS2. The molecular characterization of pSS2 involved the construction of its restriction map and the determination of its size. The digestion of pSS2 with HindIII originated two fragments (A and B that were cloned separately into the pUC18 vector. The tetA gene was shown to be located on the HindIII-A fragment by PCR. After transforming a tetracycline-sensitive strain with pSS2, the transformants expressed the resistance phenotype and harbored a plasmid whose size was identical to that of pSS2. The results confirmed the association between pSS2 and the tetracycline resistance phenotype, and suggest a feasible dissemination of tetA and tetE among strains of Aeromonas. This study suggests the spreading tetA and tetE genes in Aeromonas in Brazil and describes a resistance plasmid that probably contributes to the dissemination of the resistance.

The Chlamydia psittaci genome: a comparative analysis of intracellular pathogens.

Science.gov (United States)

Voigt, Anja; Schöfl, Gerhard; Saluz, Hans Peter

2012-01-01

Chlamydiaceae are a family of obligate intracellular pathogens causing a wide range of diseases in animals and humans, and facing unique evolutionary constraints not encountered by free-living prokaryotes. To investigate genomic aspects of infection, virulence and host preference we have sequenced Chlamydia psittaci, the pathogenic agent of ornithosis. A comparison of the genome of the avian Chlamydia psittaci isolate 6BC with the genomes of other chlamydial species, C. trachomatis, C. muridarum, C. pneumoniae, C. abortus, C. felis and C. caviae, revealed a high level of sequence conservation and synteny across taxa, with the major exception of the human pathogen C. trachomatis. Important differences manifest in the polymorphic membrane protein family specific for the Chlamydiae and in the highly variable chlamydial plasticity zone. We identified a number of psittaci-specific polymorphic membrane proteins of the G family that may be related to differences in host-range and/or virulence as compared to closely related Chlamydiaceae. We calculated non-synonymous to synonymous substitution rate ratios for pairs of orthologous genes to identify putative targets of adaptive evolution and predicted type III secreted effector proteins. This study is the first detailed analysis of the Chlamydia psittaci genome sequence. It provides insights in the genome architecture of C. psittaci and proposes a number of novel candidate genes mostly of yet unknown function that may be important for pathogen-host interactions.

Processing of Chlamydia abortus polymorphic membrane protein 18D during the chlamydial developmental cycle.

Science.gov (United States)

Wheelhouse, Nick M; Sait, Michelle; Aitchison, Kevin; Livingstone, Morag; Wright, Frank; McLean, Kevin; Inglis, Neil F; Smith, David G E; Longbottom, David

2012-01-01

Chlamydia possess a unique family of autotransporter proteins known as the Polymorphic membrane proteins (Pmps). While the total number of pmp genes varies between Chlamydia species, all encode a single pmpD gene. In both Chlamydia trachomatis (C. trachomatis) and C. pneumoniae, the PmpD protein is proteolytically cleaved on the cell surface. The current study was carried out to determine the cleavage patterns of the PmpD protein in the animal pathogen C. abortus (termed Pmp18D). Using antibodies directed against different regions of Pmp18D, proteomic techniques revealed that the mature protein was cleaved on the cell surface, resulting in a100 kDa N-terminal product and a 60 kDa carboxy-terminal protein. The N-terminal protein was further processed into 84, 76 and 73 kDa products. Clustering analysis resolved PmpD proteins into three distinct clades with C. abortus Pmp18D, being most similar to those originating from C. psittaci, C. felis and C. caviae. This study indicates that C. abortus Pmp18D is proteolytically processed at the cell surface similar to the proteins of C. trachomatis and C. pneumoniae. However, patterns of cleavage are species-specific, with low sequence conservation of PmpD across the genus. The absence of conserved domains indicates that the function of the PmpD molecule in chlamydia remains to be elucidated.

Plesiomonasshigelloides and Aeromonadaceae family pathogens isolated from marine mammals of Southern and Southeastern Brazilian coast Plesiomonasshigelloides e patógenos da família Aeromonadaceae isolados de mamíferos marinhos da costa sul e sudeste do Brasil

Directory of Open Access Journals (Sweden)

Christiane S. Pereira

2008-12-01

Full Text Available The aquatic environment is the habitat of many microorganisms, including Plesiomonasshigelloides and Aeromonas species which are pathogenic to human and animals. In the present investigation, we evaluated the occurrence of these pathogens from marine mammals beached or accidentally captured by fishing net in southeastern (RJ and southern (RS coastal Brazilian regions. A total of 198 swabs from 27 specimens of marine mammals, including 11 different species, were collected by DEENSP and GEMARS-CECLIMAR/UFRGS Institutes and sent to LRNCEB/IOC/FIOCRUZ. The samples were enriched in Alkaline Peptone Water (APW added with 1% of sodium chloride (NaCl, APW plus 3% NaCl and incubated at 37ºC for 18-24 hours. Following, samples were streaked onto Pseudomonas-Aeromonas Selective Agar Base (GSP Agar and suspected colonies were biochemically characterized. The results revealed 114 strains, including ten Aeromonas species and P.shigelloides. The main pathogens isolated were A.veronii biogroup veronii (19.3%, A. caviae (12.3%, A. hydrophila (9.6% and P.shigelloides (7%. The pathogens were isolated in both coastal and offshore marine mammals. These data point the importance of epidemiological surveillance and microbiological monitoring and reinforce the need to implement environmental protection programs, especially related to endangered cetacean species.O ambiente aquático é o habitat de vários microrganismos, incluindo Plesiomonasshigelloides e espécies de Aeromonas, os quais são patogênicos para o homem e os animais. Na presente investigação, foi avaliada a ocorrência destes patógenos a partir de swabs coletados de mamíferos marinhos encalhados ou capturados acidentalmente em redes de pesca nas regiões costeiras do sudeste (RJ e sul (RS do Brasil. O total de 198 swabs de 27 espécimes de mamíferos marinhos, incluindo 11 espécies distintas, foi coletado por profissionais dos institutos DEENSP, GEMARS-CECLIMAR/UFRGS e enviado ao LRNCEB

Application of a continuously stirred tank bioreactor (CSTR) for bioremediation of hydrocarbon-rich industrial wastewater effluents.

Science.gov (United States)

Gargouri, Boutheina; Karray, Fatma; Mhiri, Najla; Aloui, Fathi; Sayadi, Sami

2011-05-15

A continuously stirred tank bioreactor (CSTR) was used to optimize feasible and reliable bioprocess system in order to treat hydrocarbon-rich industrial wastewaters. A successful bioremediation was developed by an efficient acclimatized microbial consortium. After an experimental period of 225 days, the process was shown to be highly efficient in decontaminating the wastewater. The performance of the bioaugmented reactor was demonstrated by the reduction of COD rates up to 95%. The residual total petroleum hydrocarbon (TPH) decreased from 320 mg TPH l(-1) to 8 mg TPH l(-1). Analysis using gas chromatography-mass spectrometry (GC-MS) identified 26 hydrocarbons. The use of the mixed cultures demonstrated high degradation performance for hydrocarbons range n-alkanes (C10-C35). Six microbial isolates from the CSTR were characterized and species identification was confirmed by sequencing the 16S rRNA genes. The partial 16S rRNA gene sequences demonstrated that 5 strains were closely related to Aeromonas punctata (Aeromonas caviae), Bacillus cereus, Ochrobactrum intermedium, Stenotrophomonas maltophilia and Rhodococcus sp. The 6th isolate was affiliated to genera Achromobacter. Besides, the treated wastewater could be considered as non toxic according to the phytotoxicity test since the germination index of Lepidium sativum ranged between 57 and 95%. The treatment provided satisfactory results and presents a feasible technology for the treatment of hydrocarbon-rich wastewater from petrochemical industries and petroleum refineries. Copyright © 2011 Elsevier B.V. All rights reserved.

Yaşam Bilimleri ve Biyoteknoloji

Directory of Open Access Journals (Sweden)

Nalan YILMAZ SARIÖZLÜ

2010-10-01

Full Text Available Eskişehir/Türkiye’deki ılıca sularındaki bakteriyel topluluğun ortaya konulması ve incelenmesi için 7 ılıca su örneği 7 farklı ılıcadan toplanmıştır. Tüm örnekler dört farklı besi ortamına (nutrient agar, su-maya ekstraktı agar, triptik soy agar, nişasta-kazein agar inoküle edilmiştir. 50 °C’de 14 günlük inkübasyondan sonra tüm bakteri kolonilerinin sayımı yapılıp saflaştırılmıştır. Tüm izolatların gram reaksiyonları, katalaz veoksidazözellikleri belirlenmişve BIOLOG, VITEK veotomatikribotiplendirme sisteminde (RiboPrinter incelenmişlerdir. Bu bakterilerin ampisilin, gentamisin, trimetoprim-sülfametoksazol ve tetrasiklin antibiyotiklerine karşı dirençliliği incelenmiştir. Sonuç olarak normal insan florasına ilaveten ısıya dirençli patojenik mikroorganizmalar incelenen alandaki ılıca sularında (43-50 °C belirlenmiştir. Altı genusa ait 10 farklı tür Alysiella filiformis, Bordetella bronchiseptica, B. pertussis, Molexalla caprae, M. caviae, M. cuniculi, M. phenylpyruvica, Roseomonas fauriae, Delftia acidovorans ve Pseudomonas taetrolens olarak tanımlanmıştır

Analysis of the Structure and Function of FOX-4 Cephamycinase.

Science.gov (United States)

Lefurgy, S T; Malashkevich, V N; Aguilan, J T; Nieves, E; Mundorff, E C; Biju, B; Noel, M A; Toro, R; Baiwir, D; Papp-Wallace, K M; Almo, S C; Frere, J-M; Bou, G; Bonomo, R A

2016-02-01

Class C β-lactamases poorly hydrolyze cephamycins (e.g., cefoxitin, cefotetan, and moxalactam). In the past 2 decades, a new family of plasmid-based AmpC β-lactamases conferring resistance to cefoxitin, the FOX family, has grown to include nine unique members descended from the Aeromonas caviae chromosomal AmpC. To understand the basis for the unique cephamycinase activity in the FOX family, we determined the first X-ray crystal structures of FOX-4, apo enzyme and the acyl-enzyme with its namesake compound, cefoxitin, using the Y150F deacylation-deficient variant. Notably, recombinant expression of N-terminally tagged FOX-4 also yielded an inactive adenylylated enzyme form not previously observed in β-lactamases. The posttranslational modification (PTM), which occurs on the active site Ser64, would not seem to provide a selective advantage, yet might present an opportunity for the design of novel antibacterial drugs. Substantial ligand-induced changes in the enzyme are seen in the acyl-enzyme complex, particularly the R2 loop and helix H10 (P289 to N297), with movement of F293 by 10.3 Å. Taken together, this study provides the first picture of this highly proficient class C cephamycinase, uncovers a novel PTM, and suggests a possible cephamycin resistance mechanism involving repositioning of the substrate due to the presence of S153P, N289P, and N346I substitutions in the ligand binding pocket. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

Comprehensive in silico prediction and analysis of chlamydial outer membrane proteins reflects evolution and life style of the Chlamydiae

Directory of Open Access Journals (Sweden)

Myers Garry

2009-12-01

Full Text Available Abstract Background Chlamydiae are obligate intracellular bacteria comprising some of the most important bacterial pathogens of animals and humans. Although chlamydial outer membrane proteins play a key role for attachment to and entry into host cells, only few have been described so far. We developed a comprehensive, multiphasic in silico approach, including the calculation of clusters of orthologues, to predict outer membrane proteins using conservative criteria. We tested this approach using Escherichia coli (positive control and Bacillus subtilis (negative control, and applied it to five chlamydial species; Chlamydia trachomatis, Chlamydia muridarum, Chlamydia (a.k.a. Chlamydophila pneumoniae, Chlamydia (a.k.a. Chlamydophila caviae, and Protochlamydia amoebophila. Results In total, 312 chlamydial outer membrane proteins and lipoproteins in 88 orthologous clusters were identified, including 238 proteins not previously recognized to be located in the outer membrane. Analysis of their taxonomic distribution revealed an evolutionary conservation among Chlamydiae, Verrucomicrobia, Lentisphaerae and Planctomycetes as well as lifestyle-dependent conservation of the chlamydial outer membrane protein composition. Conclusion This analysis suggested a correlation between the outer membrane protein composition and the host range of chlamydiae and revealed a common set of outer membrane proteins shared by these intracellular bacteria. The collection of predicted chlamydial outer membrane proteins is available at the online database pCOMP http://www.microbial-ecology.net/pcomp and might provide future guidance in the quest for anti-chlamydial vaccines.

İnek Sütlerinin Hareketli Aeromonas Türleri Yönünden İncelenmesi

Directory of Open Access Journals (Sweden)

Mustafa Alişarlı

2015-02-01

Full Text Available Bu çalışmada, çiğ sütlerde hareketli Aermonas türlerinin bulunma sıklığını ortaya koymak ve ilk sağılan sütün kontaminasyondaki rolünü belirlemek amaçlanmaştır. Bu amaçla, 100 adet sağmal inekten direkt el sağımı ile alınan süt örnekleri incelenmiştir. İncelenen Örneklerin 8 tanesinde (%8 Aeromonas spp.izole edilmiş olup bunlardan 3'ü (%37,5 hareketli Aeromonas olarak belirlenmiştir. Hareketli Aeromonas'ların 2'si (%66,6 A. hydrophila ve1'i (%33,3 A. caviae olarak identifiye edilmiştir. Bu araştırmanın verileri, süt işletmelerine tanker ve güğümlerle getirilen çiğ sütlerden sağlanan örneklerdeki araştırma bulgularıyla kıyaslandığında daha düşük bulunmuştur. Bu da, eğer sağım sonrası hijyen kurallarına gerekli özen gösterilmezse çiğ sütlerin Aeromonas'lar ile kontaminasyon riskinin yüksek olacağını göstermektedir.

Isolation and antibiotic sensitivity of Aeromonas from children with diarrhea

Directory of Open Access Journals (Sweden)

Meiyanti Meiyanti

2016-02-01

Full Text Available Aeromonas species are gram-negative, motile, facultative anaerobic, rod shaped, oxidase positive bacteria of the recently assigned family Aeromonadaceae. The significance of Aeromonas species as causative agent of human diarrhoea has recently been established. The aim of the present study was to investigate the distribution, and antibiotic sensitivity of Aeromonas in nonhospitalized children with diarrhea.One hundred and seventeen rectal swabs from children with diarhhea were cultured for isolation of Aeromonas organisms as the etiological agents. In addition to Aeromonas, other enteric pathogens were also isolated. Overall, the isolates of enteric pathogens amounted to 36.8%, consisting of Salmonella, Shigella, Aeromonas, and Vibrio. Aeromonas was only found in 5.1% of cultures, with a ratio of A. caviae and A. hydrophila of 2:1, while Salmonella made up the majority of causative organisms with an isolation frequency of 18.8%, followed by Shigella with 11.1%. In this study no isolates of Vibrio cholerae O1 were found as etiological agents of diarrhea; however, V. cholerae non-O1 and V. parahaemolyticus were found in small numbers (<1%. All isolates of Aeromonas were resistant to ampicillin and tetracycline, but sensitive to ciprofloxacin and ceftriaxone, as were the other enteric pathogens. Although the frequency of isolation of these enteric pathogens was higher than for Vibrio spp., their role in infective diarrhea was less clearcut in comparison with Salmonella and Shigella.

Aeromonas spp. e Plesiomonas shigelloides isoladas a partir de mexilhões (Perna perna in natura e pré-cozidos no Rio de Janeiro, RJ Aeromonas spp. and Plesiomonas shigelloides isolated from in natura and precooked mussels (Perna perna in Rio de Janeiro, RJ, Brazil

Directory of Open Access Journals (Sweden)

Christiane Soares Pereira

2004-12-01

Full Text Available O ecossistema aquático é o habitat de mexilhões (Perna perna, animais filtradores que refletem a qualidade ambiental através de análise microbiológica de sua carne. No presente trabalho avaliou-se a presença de patógenos emergentes (Aeromonas hydrophila e Plesiomonas shigelloides, em mexilhões in natura e pré-cozidos coletados por pescadores da Estação Experimental de Cultivo de Mexilhões situada em Jurujuba, Niterói, Rio de Janeiro. Foram analisadas 86 amostras de mexilhões (43 in natura e 43 pré-cozidos as quais foram submetidas a enriquecimento em Água Peptonada Alcalina (APA acrescida de 1 e 3% de Cloreto de Sódio (NaCl e em solução Salina de Butterfield, incubadas a 37ºC por 24 horas. Em seguida, foram semeadas em Ágar Seletivo para Pseudomonas-Aeromonas (GSP, Ágar Tiossulfato Citrato Bile Sacarose (TCBS e Ágar Inositol Bile Verde Brilhante (IBB. A análise geral dos resultados permitiu a identificação de Areomonas spp e Plesiomonas shigelloides em 86% das amostras de mexilhões in natura e pré-cozidas avaliadas. A posterior caracterização bioquímica permitiu a identificação das espécies Aeromonas media (37,10%, A. hydrophila (15,50%, A. caviae (14,80%, A. veronii biogrupo veronii (11,60%, Aeromonas sp. (7,36%, A. sobria (4,20%, A. trota (4,20%, A. schubertii (1,31%, A. jandaei (1,31%, A. veronii biogrupo sobria (0,52% e Plesiomonas shigelloides (2,10%. A relevância epidemiológica desses microrganismos em casos de gastrenterite humana, após consumo de mexilhões crus ou parcialmente cozidos, revela a importância de alertar as autoridades de Saúde Pública no Brasil, sobre a presença desses patógenos na cadeia alimentar e seus riscos para a saúde humana.The aquatic ecosystem is the habitat of mussels, filtrating animals that reflect the ambient quality through microbiological analysis. In the present investigation, we evaluated the presence of emergent pathogens (Aeromonas hydrophila and Plesiomonas

Contribuição ao estudo do mal de cadeiras na Ilha de Marajó

Directory of Open Access Journals (Sweden)

Geth Jansen

1941-01-01

Full Text Available Como resultado de inspeções feitas à ilha de Marajó o autor assinala: 1º O mal de cadeiras continua existindo na ilha de Marajó sob a forma enzoótica, ao contrário do que pensavam os criadores, julgando-o extinto. As doenças designadas por estes como "barriga inchada" e "mormo seco", responsaveis pela grande mortalidade dos equinos, foram identificadas pelo autor como tal de cadeiras. 2º O autor considera indispensável para a pesquisa do trypanosoma o processo de inoculação em animais de laboratório, tendo utilizado para esse fim camondongos e ratos brancos. 3º Os surtos epizoóticos anuais coincidem com a época das chuvas, ocasião em que surgem os insetos hematófagos, o que faz pensar no papel desses últimos como transmissores. 4º Os cavalos podem atravessar o ano com trypanosomas no sangue e em estado de saude aparente, constituindo assim depositários do mal de cadeiras. 5º O extermínio da capivara, em consequência do seu aproveitamento econômico não modificou o carater endêmico da doença na ilha de Marajó. 6º O autor observou que os trypanosomas no tubo digestivo de Stomoxys e Tabanideos, ao cabo de 8 horas, apresentavam com movimentos diminuidos e em formas arrendondadas, não conseguindo inoculações positivas com esse material. 7º A saliva de um morcego do gênero Desmodus, que se infectou no laboratório, alimentando-se em animal doente, colhida de modo a evitar lesões da mucosa e consequente contaminação pelos trypanosomas do sangue circulante, mostrou-se incapaz de infectar, por inoculação, animais sensiveis. Este mesmo morcego não transmitiu a doença a um cão, o qual sugou durante 80 dias. Recentemente (1941 empregando um exemplar do gênero Desmodus, também infectado experimentalmente por alimentação em animal de laboratório, conseguimos transmitir o Trypanosoma equinum a uma cobaia normal. Este assunto será ventilado posteriormente.

MICROBIOLOGICAL QUALITY ASSESSMENT OF DRIED YAM CHIPS (Dioscorea rotundata DURING STORAGE

Directory of Open Access Journals (Sweden)

Patricia F. Omojasola

2013-12-01

Full Text Available Microbiological and physico-chemical analyses of dried yam chips (gbodo retailed in four markets in Ilorin and its environs alongside a laboratory – prepared control were carried out over a six month period. Microbiological assay consisted of total viable and coliform counts as well as microbial isolation. A total of 11 fungi and 5 bacteria were isolated from the different samples which included Acremonium sp., Aspergillus fumigatus., A. niger, A. ochraceus, Fusarium solani, Mucor hiemalis, Mucor racemosus, Penicillum notatum, Rhizopus oryzae, Rhizopus stolonifer, Syncephalastrum racemosum and Bacillus cereus, Bacillus subtilis, Erwinia carotovora, Escherichia coli and Staphylococcus aureus respectively. Total Viable Counts ranged from 3.0-120.0 cfu g-1 and coliform counts ranged from 0.00 - 18.80 cfu g-1 pre-storage to 0.10-219 cfu g-1 and 0.0-31.0 cfu g-1 post storage respectively. The physico-chemical parameters analysed were moisture content which ranged between 14.38-17.10% pre-storage to 13.43-24.96% post-storage; crude protein: 5.81-7.53% and 2.11-6.75%; crude fat: 0.35-0.71% and 0.07-0.61%; ash content: 3.30-5.18% and 1.17-4.77%; crude fibre: 0.77-1.45%; carbohydrate: 70.18-74.00% and 70.93-75.17% pre-storage and post-storage content respectively. Levels of Aflatoxin B1 were also monitored throughout the storage period. Insect infestation of the samples occurred during the storage period. Four species were identified; these were Tribolium casteneum, Dinoderus porcellus, Rhyzopertha dominica and Sitophilus zeamais. The traditional practice of open air sun-drying of yam chips should be discouraged, rather oven drying is recommended to minmize microbial contamination. In addition, sorting to exclude extreneous material and minimize mouldiness and insect infestation is suggested.

Incidence and virulence characteristics of Aeromonas spp. in fish

Directory of Open Access Journals (Sweden)

Ashraf M. Abd-El-Malek

2017-01-01

Full Text Available Aim: This study was conducted to evaluate the presence of Aeromonas spp. in raw and ready-to-eat (RTE fish commonly consumed in Assiut city, Egypt, and to determine virulence factors due to they play a key role in their pathogenicity. Materials and Methods: A total of 125 samples of raw and RTE fish samples were taken from different fish markets and fish restaurants in Assiut Governorate and screened for the presence of Aeromonas spp. by enrichment on tryptic soy broth then incubated at 30°C for 24 h. Plating unto the sterile Petri dishes containing Aeromonas agar base to which Aeromonas selective supplement was added. The plates were incubated at 37°C for 24 h. Presumptive Aeromonas colonies were biochemically confirmed and analyzed for pathogenicity by hemolysin production, protease, and lipase detection. Results: The results indicated that raw fish were contaminated with Aeromonas spp. (40% in wild and 36% in cultured Nile tilapia. Regarding RTE, Aeromonas spp. could be isolated with the percentage of 16%, 28% and 20% in fried Bolti, grilled Bolti and fried Bayad, respectively. Out of 35 isolates obtained, 22 were categorized as Aeromonas hydrophila, 12 were classified as Aeromonas sobria and Aeromonas caviae were found in only one isolate. The virulence factors of Aeromonas spp. were detected and the results showed that all isolates produced of hemolysin (91.4%, protease (77.1%, and lipase enzyme (17.1%. Conclusion: This study indicates that the presence of A. hydrophila with virulence potential in fresh and RTE fish may be a major threat to public health.

Microbial production of polyhydroxyalkanoate block copolymer by recombinant Pseudomonas putida.

Science.gov (United States)

Li, Shi Yan; Dong, Cui Ling; Wang, Shen Yu; Ye, Hai Mu; Chen, Guo-Qiang

2011-04-01

Polyhydroxyalkanoate (PHA) synthesis genes phaPCJ(Ac) cloned from Aeromonas caviae were transformed into Pseudomonas putida KTOY06ΔC, a mutant of P. putida KT2442, resulting in the ability of the recombinant P. putida KTOY06ΔC (phaPCJ(A.c)) to produce a short-chain-length and medium-chain-length PHA block copolymer consisting of poly-3-hydroxybutyrate (PHB) as one block and random copolymer of 3-hydroxyvalerate (3HV) and 3-hydroxyheptanoate (3HHp) as another block. The novel block polymer was studied by differential scanning calorimetry (DSC), nuclear magnetic resonance, and rheology measurements. DSC studies showed the polymer to possess two glass transition temperatures (T(g)), one melting temperature (T(m)) and one cool crystallization temperature (T(c)). Rheology studies clearly indicated a polymer chain re-arrangement in the copolymer; these studies confirmed the polymer to be a block copolymer, with over 70 mol% homopolymer (PHB) of 3-hydroxybutyrate (3HB) as one block and around 30 mol% random copolymers of 3HV and 3HHp as the second block. The block copolymer was shown to have the highest tensile strength and Young's modulus compared with a random copolymer with similar ratio and a blend of homopolymers PHB and PHVHHp with similar ratio. Compared with other commercially available PHA including PHB, PHBV, PHBHHx, and P3HB4HB, the short-chain- and medium-chain-length block copolymer PHB-b-PHVHHp showed differences in terms of mechanical properties and should draw more attentions from the PHA research community. © Springer-Verlag 2010

Efficacy and toxicity of iodine disinfection of Atlantic salmon eggs

Science.gov (United States)

Chalupnicki, M.A.; Ketola, H.G.; Starliper, C.E.; Gallagher, D.

2011-01-01

Recent interest in the restoration of Atlantic salmon Salmo salar in the Great Lakes has given rise to new culture techniques and management programs designed to reduce pathogen transmission while stabilizing and enhancing wild populations. We examined the toxicity of iodine to Atlantic salmon eggs and its effectiveness as a disinfectant against bacteria on egg surfaces. We spawned and fertilized eight gravid Atlantic salmon from Cayuga Lake, New York, and exposed their eggs to 10 concentrations of iodine (5, 10, 50, 75, 100, 500, 750, 1,000, 5,000, and 7,500 mg/L) for 30 min during water hardening. An additional subsample of unfertilized eggs was also exposed to some of the same concentrations of iodine (5, 10, 50, 75, and 100 mg/L) to determine the efficiency of disinfection. Viable eggs were only obtained from four females. Survival of eggs to the eyed stage and hatch tended to be reduced at iodine concentrations of 50 and 75 mg/L and was significantly reduced at concentrations of 100 mg/L iodine or more. We calculated the concentrations of iodine that killed 50% of the Atlantic salmon eggs at eye-up and hatch to be 175 and 85 mg/L, respectively. Aeromonas veronii, A. schubertii, A. hydrophila, A. caviae, Plesiomonas shiggeloides, and Citrobacter spp. were the predominant bacteria present on the surface of green eggs and were significantly reduced by an iodine immersion. The use of iodine as a disinfectant on Atlantic salmon eggs was effective at low concentrations (50–75 mg/L), for which toxicity to Atlantic salmon was minimal.

Vibrio cholerae No O1 en muestras de aguas no cloradas consumidas por pobladores de las localidades de Santa y Coishco (Ancash, 2003 - 2004

Directory of Open Access Journals (Sweden)

Ana García P

2006-07-01

Full Text Available Objetivo: Identificar la presencia de Vibrio cholerae en muestras de agua no cloradas para consumo humano en las localidades de Santa y Coishco. Materiales y métodos: Entre julio de 2003 a junio de 2004 se tomaron muestras de agua, en forma semanal, provenientes de siete pozos con bomba manuable y de seis pozos con reservorio. A cada muestra de agua se le midió in situ el cloro residual mediante un comparador de cloro Hatch, método colorimétrico, usando para ello las pastillas DPD 1. En las muestras con cloro <0,05mg/L se realizó el cultivo según los manuales de procedimientos del Instituto Nacional de Salud (INS, Lima. Las cepas aisladas se enviaron al INS para confirmación diagnóstica y pruebas serológicas. Resultados: Se incluyeron 308 muestras de agua para consumo humano en ambos distritos (201 de pozos con bomba manuable y 107 con reservorio. Se realizó el aislamiento en 70(22,7% muestras: Aeromonas caviae 34(11,0%, Aeromonas hidrophyla 17(5,5% y Vibrio cholerae No O1 19(6,2%, no se encontró V. cholerae del serotipo O139. El Vibrio cholerae No O1 se aisló en 11(5,5% muestras de pozos con bomba manuable y en 8(7,4% pozos con reservorio, respectivamente. Conclusión: El agua de consumo humano proveniente de pozos tubulares representa un reservorio potencial para bacterias como Aeromonas y Vibrio cholerae, resaltando la necesidad de realizar la desinfección correspondiente de ésta antes de su consumo.

Availability of safe drinking-water: the answer to cholera outbreak? Nabua, Camarines Sur, Philippines, 2012

Directory of Open Access Journals (Sweden)

Alethea De Guzman

2015-08-01

Full Text Available Background: In May 2012, there were increasing diarrhoea cases and deaths reported from Nabua, Camarines Sur to the Philippines event-based surveillance system. An investigation was conducted to identify risk factors and determine transmission dynamics. Methods: A suspected case was defined as a resident of Nabua with at least three episodes of watery diarrhoea per day from 16 March to 22 June 2012. A confirmed case was defined as a suspected case positive for Vibrio cholerae. An environmental investigation was conducted and rectal swabs and water samples sent to the national reference laboratory for bacterial isolation. A 1:2 case-control study matching for age and sex was conducted. Data were analyzed using Epi Info. Results: There were 309 suspected cases with two deaths, and the most affected age group was children under five years (45%. Eight cases were positive for Vibrio cholerae Ogawa El Tor and one for Non-01. Water samples were positive for faecal coliforms and Aeromonas caviae. The case-control study showed that cases had a higher odds than controls of using unchlorinated water sources (odds ratio [OR] = 3.6; 95% confidence interval [CI]:1.6–8.5 and having toilets located within 20 metres of a septic tank (OR = 2.7; 95% CI: 1.4–5.3. In multivariate analysis, the only significant factor was drinking from piped water (OR = 0.21; 95% CI: 0.09–0.49. Discussion: In this cholera outbreak, drinking-water from unchlorinated wells was a significant risk factor. Future cholera control efforts should include not just improving water and sanitation systems but also intensified behaviour change campaigns.

Effectiveness of radiation processing in elimination of Aeromonas from food

Science.gov (United States)

Nagar, Vandan; Bandekar, Jayant R.

2011-08-01

Genus Aeromonas has emerged as an important human pathogen because it causes a variety of diseases including gastroenteritis and extra-intestinal infections. Contaminated water, sprouts, vegetables, seafood and food of animal origin have been considered to be the important sources of Aeromonas infection. In the present study, radiation sensitivity of indigenous strains of Aeromonas spp. from different food samples was evaluated. The decimal reduction dose (D10) values of different Aeromonas isolates in saline at 0-4 °C were in the range of 0.031-0.046 kGy. The mixed sprouts, chicken and fish samples were inoculated with a cocktail of five most resistant isolates (A. salmonicida Y567, A. caviae A85, A. jandaei A514A, A. hydrophila CECT 839T and A. veronii Y47) and exposed to γ radiation to study the effectiveness of radiation treatment in elimination of Aeromonas. D10 values of Aeromonas cocktail in mixed sprouts, chicken and fish samples were found to be 0.081±0.001, 0.089±0.003 and 0.091±0.003 kGy, respectively. Radiation treatment with a 1.5 kGy dose resulted in complete elimination of 105 CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples. No recovery of Aeromonas was observed in the 1.5 kGy treated samples stored at 4 °C up to 12 (mixed sprouts) and 7 days (chicken and fish samples), even after enrichment and selective plating. This study demonstrates that a 1.5 kGy dose of irradiation treatment could result in complete elimination of 105 CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples.

Availability of safe drinking-water: the answer to cholera outbreak? Nabua, Camarines Sur, Philippines, 2012.

Science.gov (United States)

De Guzman, Alethea; de los Reyes, Vikki Carr; Sucaldito, Ma Nemia; Tayag, Enrique

2015-01-01

In May 2012, there were increasing diarrhoea cases and deaths reported from Nabua, Camarines Sur to the Philippines event-based surveillance system. An investigation was conducted to identify risk factors and determine transmission dynamics. A suspected case was defined as a resident of Nabua with at least three episodes of watery diarrhoea per day from 16 March to 22 June 2012. A confirmed case was defined as a suspected case positive for Vibrio cholerae. An environmental investigation was conducted and rectal swabs and water samples sent to the national reference laboratory for bacterial isolation. A 1:2 case-control study matching for age and sex was conducted. Data were analysed using Epi Info. There were 309 suspected cases with two deaths, and the most affected age group was children under five years (45%). Eight cases were positive for Vibrio cholerae Ogawa El Tor and one for Non-01. Water samples were positive for faecal coliforms and Aeromonas caviae. The case-control study showed that cases had a higher odds than controls of using unchlorinated water sources (odds ratio [OR] = 3.6; 95% confidence interval [CI]:1.6-8.5) and having toilets located within 20 m of a septic tank (OR = 2.7; 95% CI: 1.4-5.3). In multivariate analysis, the only significant factor was drinking from piped water (OR = 0.21; 95% CI: 0.09-0.49). In this cholera outbreak, drinking-water from unchlorinated wells was a significant risk factor. Future cholera control efforts should include not just improving water and sanitation systems but also intensified behaviour change campaigns.

Chlamydial variants differ in ability to ascend the genital tract in the guinea pig model of chlamydial genital infection.

Science.gov (United States)

Yeruva, Laxmi; Bowlin, Anne K; Spencer, Nicole; Maurelli, Anthony T; Rank, Roger G

2015-08-01

An important question in the study of chlamydial genital tract disease is why some women develop severe upper tract disease while others have mild or even "silent" infections with or without pathology. Animal studies suggest that the pathological outcome of an infection is dependent upon both the composition of the infecting chlamydial population and the genotype of the host, along with host physiological effects, such as the cyclical production of reproductive hormones and even the size of the infecting inoculum or the number of repeated infections. In this study, we compared two variants of Chlamydia caviae, contrasting in virulence, with respect to their abilities to ascend the guinea pig genital tract. We then determined the effect of combining the two variants on the course of infection and on the bacterial loads of the two variants in the genital tract. Although the variants individually had similar infection kinetics in the cervix, SP6, the virulent variant, could be isolated from the oviducts more often and in greater numbers than the attenuated variant, AZ2. SP6 also elicited higher levels of interleukin 8 (IL-8) in the lower genital tract and increased leukocyte infiltration in the cervix and uterus compared to AZ2. When the two variants were combined in a mixed infection, SP6 outcompeted AZ2 in the lower genital tract; however, AZ2 was able to ascend the genital tract as readily as SP6. These data suggest that the ability of SP6 to elicit an inflammatory response in the lower genital tract facilitates the spread of both variants to the oviducts. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

Biodegradación estimulada de los suelos contaminados con pesticidas organoclorados

Directory of Open Access Journals (Sweden)

María Kopytko

2017-06-01

Full Text Available DDT al igual que otros pesticidas organoclorados han sido utilizados extensivamente en Colombia entre los años 1970 y 1980 en cultivos de algodón. DDT es resistente a la degradación y fuertemente relacionado con numerosos problemas de salud y actualmente está  prohibido su uso. El propósito de esta investigación fue evaluar la biodegradación de DDT y de los productos DDD y DDE, presentes en el suelo contaminado durante 16 años en le municipio Agustín Codazzi, Cesar, Colombia. Se llevaron a cabo bioestimulación, bioaumentación y un tratamiento de control bajo condiciones anaerobias y aerobias secuenciales. El proceso de biodegradación anaerobia duró 8 semanas y consecutivamente se realizó el proceso aerobio por 20 semanas. En el proceso de bioestimulación se adicionó fósforo para optimizar la proporción C:N:P en el suelo tratado. De las bacterias nativas se aislaron las cepas bacterianas con la capacidad biodegradadora del DDT y fueron identificadas mediante las características morfológicas y ampliación por PCR de la región de 1465 pb del gen ribosomal 16S y secuenciación. De estas se seleccionaron cuatro cepas bacterianas para el proceso de bioaumentación: Burkholderia cepacia, Pseudomonas fluorescens, Aeromona caviae, y Bacillus sp,  las cuales fueron bioaumentadas en el laboratorio e inoculadas en el suelo tratado en concentración de 108 UFC/ml. La concentración de DDT, DDD y DDE se determinó por medio de cromatografía de gases. Los mejores resultados se obtuvieron durante la fase anaerobia logrando una remoción de DDT, DDD y DDE en un 56,2%, 17,1% y 44,5% respectivamente.

Effectiveness of radiation processing in elimination of Aeromonas from food

International Nuclear Information System (INIS)

Nagar, Vandan; Bandekar, Jayant R.

2011-01-01

Genus Aeromonas has emerged as an important human pathogen because it causes a variety of diseases including gastroenteritis and extra-intestinal infections. Contaminated water, sprouts, vegetables, seafood and food of animal origin have been considered to be the important sources of Aeromonas infection. In the present study, radiation sensitivity of indigenous strains of Aeromonas spp. from different food samples was evaluated. The decimal reduction dose (D 10 ) values of different Aeromonas isolates in saline at 0-4 o C were in the range of 0.031-0.046 kGy. The mixed sprouts, chicken and fish samples were inoculated with a cocktail of five most resistant isolates (A. salmonicida Y567, A. caviae A85, A. jandaei A514A, A. hydrophila CECT 839 T and A. veronii Y47) and exposed to γ radiation to study the effectiveness of radiation treatment in elimination of Aeromonas. D 10 values of Aeromonas cocktail in mixed sprouts, chicken and fish samples were found to be 0.081±0.001, 0.089±0.003 and 0.091±0.003 kGy, respectively. Radiation treatment with a 1.5 kGy dose resulted in complete elimination of 10 5 CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples. No recovery of Aeromonas was observed in the 1.5 kGy treated samples stored at 4 o C up to 12 (mixed sprouts) and 7 days (chicken and fish samples), even after enrichment and selective plating. This study demonstrates that a 1.5 kGy dose of irradiation treatment could result in complete elimination of 10 5 CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples.

Air-dust-borne associations of phototrophic and hydrocarbon-utilizing microorganisms: promising consortia in volatile hydrocarbon bioremediation.

Science.gov (United States)

Al-Bader, Dhia; Eliyas, Mohamed; Rayan, Rihab; Radwan, Samir

2012-11-01

Aquatic and terrestrial associations of phototrophic and heterotrophic microorganisms active in hydrocarbon bioremediation have been described earlier. The question arises: do similar consortia also occur in the atmosphere? Dust samples at the height of 15 m were collected from Kuwait City air, and analyzed microbiologically for phototrophic and heterotrophic hydrocarbon-utilizing microorganisms, which were subsequently characterized according to their 16S rRNA gene sequences. The hydrocarbon utilization potential of the heterotrophs alone, and in association with the phototrophic partners, was measured quantitatively. The chlorophyte Gloeotila sp. and the two cyanobacteria Nostoc commune and Leptolyngbya thermalis were found associated with dust, and (for comparison) the cynobacteria Leptolyngbya sp. and Acaryochloris sp. were isolated from coastal water. All phototrophic cultures harbored oil vapor-utilizing bacteria in the magnitude of 10(5) g(-1). Each phototrophic culture had its unique oil-utilizing bacteria; however, the bacterial composition in Leptolyngbya cultures from air and water was similar. The hydrocarbon-utilizing bacteria were affiliated with Acinetobacter sp., Aeromonas caviae, Alcanivorax jadensis, Bacillus asahii, Bacillus pumilus, Marinobacter aquaeolei, Paenibacillus sp., and Stenotrophomonas maltophilia. The nonaxenic cultures, when used as inocula in batch cultures, attenuated crude oil in light and dark, and in the presence of antibiotics and absence of nitrogenous compounds. Aqueous and diethyl ether extracts from the phototrophic cultures enhanced the growth of the pertinent oil-utilizing bacteria in batch cultures, with oil vapor as a sole carbon source. It was concluded that the airborne microbial associations may be effective in bioremediating atmospheric hydrocarbon pollutants in situ. Like the aquatic and terrestrial habitats, the atmosphere contains dust-borne associations of phototrophic and heterotrophic hydrocarbon

Phenotypic and Genetic Diversity of Aeromonas Species Isolated from Fresh Water Lakes in Malaysia.

Directory of Open Access Journals (Sweden)

Wei Ching Khor

Full Text Available Gram-negative bacilli of the genus Aeromonas are primarily inhabitants of the aquatic environment. Humans acquire this organism from a wide range of food and water sources as well as during aquatic recreational activities. In the present study, the diversity and distribution of Aeromonas species from freshwater lakes in Malaysia was investigated using glycerophospholipid-cholesterol acyltransferase (GCAT and RNA polymerase sigma-factor (rpoD genes for speciation. A total of 122 possible Aeromonas strains were isolated and confirmed to genus level using the API20E system. The clonality of the isolates was investigated using ERIC-PCR and 20 duplicate isolates were excluded from the study. The specific GCAT-PCR identified all isolates as belonging to the genus Aeromonas, in agreement with the biochemical identification. A phylogenetic tree was constructed using the rpoD gene sequence and all 102 isolates were identified as: A. veronii 43%, A. jandaei 37%, A. hydrophila 6%, A. caviae 4%, A. salmonicida 2%, A. media 2%, A. allosaccharophila 1%, A. dhakensis 1% and Aeromonas spp. 4%. Twelve virulence genes were present in the following proportions--exu 96%, ser 93%, aer 87%, fla 83%, enolase 70%, ela 62%, act 54%, aexT 33%, lip 16%, dam 16%, alt 8% and ast 4%, and at least 2 of these genes were present in all 102 strains. The ascV, aexU and hlyA genes were not detected among the isolates. A. hydrophila was the main species containing virulence genes alt and ast either present alone or in combination. It is possible that different mechanisms may be used by each genospecies to demonstrate virulence. In summary, with the use of GCAT and rpoD genes, unambiguous identification of Aeromonas species is possible and provides valuable data on the phylogenetic diversity of the organism.

Characterization of Aeromonas hydrophila Wound Pathotypes by Comparative Genomic and Functional Analyses of Virulence Genes

Science.gov (United States)

Grim, Christopher J.; Kozlova, Elena V.; Sha, Jian; Fitts, Eric C.; van Lier, Christina J.; Kirtley, Michelle L.; Joseph, Sandeep J.; Read, Timothy D.; Burd, Eileen M.; Tall, Ben D.; Joseph, Sam W.; Horneman, Amy J.; Chopra, Ashok K.; Shak, Joshua R.

2013-01-01

ABSTRACT Aeromonas hydrophila has increasingly been implicated as a virulent and antibiotic-resistant etiologic agent in various human diseases. In a previously published case report, we described a subject with a polymicrobial wound infection that included a persistent and aggressive strain of A. hydrophila (E1), as well as a more antibiotic-resistant strain of A. hydrophila (E2). To better understand the differences between pathogenic and environmental strains of A. hydrophila, we conducted comparative genomic and functional analyses of virulence-associated genes of these two wound isolates (E1 and E2), the environmental type strain A. hydrophila ATCC 7966T, and four other isolates belonging to A. aquariorum, A. veronii, A. salmonicida, and A. caviae. Full-genome sequencing of strains E1 and E2 revealed extensive differences between the two and strain ATCC 7966T. The more persistent wound infection strain, E1, harbored coding sequences for a cytotoxic enterotoxin (Act), a type 3 secretion system (T3SS), flagella, hemolysins, and a homolog of exotoxin A found in Pseudomonas aeruginosa. Corresponding phenotypic analyses with A. hydrophila ATCC 7966T and SSU as reference strains demonstrated the functionality of these virulence genes, with strain E1 displaying enhanced swimming and swarming motility, lateral flagella on electron microscopy, the presence of T3SS effector AexU, and enhanced lethality in a mouse model of Aeromonas infection. By combining sequence-based analysis and functional assays, we characterized an A. hydrophila pathotype, exemplified by strain E1, that exhibited increased virulence in a mouse model of infection, likely because of encapsulation, enhanced motility, toxin secretion, and cellular toxicity. PMID:23611906

Functional genomic characterization of virulence factors from necrotizing fasciitis-causing strains of Aeromonas hydrophila.

Science.gov (United States)

Grim, Christopher J; Kozlova, Elena V; Ponnusamy, Duraisamy; Fitts, Eric C; Sha, Jian; Kirtley, Michelle L; van Lier, Christina J; Tiner, Bethany L; Erova, Tatiana E; Joseph, Sandeep J; Read, Timothy D; Shak, Joshua R; Joseph, Sam W; Singletary, Ed; Felland, Tracy; Baze, Wallace B; Horneman, Amy J; Chopra, Ashok K

2014-07-01

The genomes of 10 Aeromonas isolates identified and designated Aeromonas hydrophila WI, Riv3, and NF1 to NF4; A. dhakensis SSU; A. jandaei Riv2; and A. caviae NM22 and NM33 were sequenced and annotated. Isolates NF1 to NF4 were from a patient with necrotizing fasciitis (NF). Two environmental isolates (Riv2 and -3) were from the river water from which the NF patient acquired the infection. While isolates NF2 to NF4 were clonal, NF1 was genetically distinct. Outside the conserved core genomes of these 10 isolates, several unique genomic features were identified. The most virulent strains possessed one of the following four virulence factors or a combination of them: cytotoxic enterotoxin, exotoxin A, and type 3 and 6 secretion system effectors AexU and Hcp. In a septicemic-mouse model, SSU, NF1, and Riv2 were the most virulent, while NF2 was moderately virulent. These data correlated with high motility and biofilm formation by the former three isolates. Conversely, in a mouse model of intramuscular infection, NF2 was much more virulent than NF1. Isolates NF2, SSU, and Riv2 disseminated in high numbers from the muscular tissue to the visceral organs of mice, while NF1 reached the liver and spleen in relatively lower numbers on the basis of colony counting and tracking of bioluminescent strains in real time by in vivo imaging. Histopathologically, degeneration of myofibers with significant infiltration of polymorphonuclear cells due to the highly virulent strains was noted. Functional genomic analysis provided data that allowed us to correlate the highly infectious nature of Aeromonas pathotypes belonging to several different species with virulence signatures and their potential ability to cause NF. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

A comparison of brain gene expression levels in domesticated and wild animals.

Directory of Open Access Journals (Sweden)

Frank W Albert

2012-09-01

Full Text Available Domestication has led to similar changes in morphology and behavior in several animal species, raising the question whether similarities between different domestication events also exist at the molecular level. We used mRNA sequencing to analyze genome-wide gene expression patterns in brain frontal cortex in three pairs of domesticated and wild species (dogs and wolves, pigs and wild boars, and domesticated and wild rabbits. We compared the expression differences with those between domesticated guinea pigs and a distant wild relative (Cavia aperea as well as between two lines of rats selected for tameness or aggression towards humans. There were few gene expression differences between domesticated and wild dogs, pigs, and rabbits (30-75 genes (less than 1% of expressed genes were differentially expressed, while guinea pigs and C. aperea differed more strongly. Almost no overlap was found between the genes with differential expression in the different domestication events. In addition, joint analyses of all domesticated and wild samples provided only suggestive evidence for the existence of a small group of genes that changed their expression in a similar fashion in different domesticated species. The most extreme of these shared expression changes include up-regulation in domesticates of SOX6 and PROM1, two modulators of brain development. There was almost no overlap between gene expression in domesticated animals and the tame and aggressive rats. However, two of the genes with the strongest expression differences between the rats (DLL3 and DHDH were located in a genomic region associated with tameness and aggression, suggesting a role in influencing tameness. In summary, the majority of brain gene expression changes in domesticated animals are specific to the given domestication event, suggesting that the causative variants of behavioral domestication traits may likewise be different.

Effectiveness of radiation processing in elimination of Aeromonas from food

Energy Technology Data Exchange (ETDEWEB)

Nagar, Vandan [Food Technology Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Bandekar, Jayant R., E-mail: jrb@barc.gov.i [Food Technology Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

2011-08-15

Genus Aeromonas has emerged as an important human pathogen because it causes a variety of diseases including gastroenteritis and extra-intestinal infections. Contaminated water, sprouts, vegetables, seafood and food of animal origin have been considered to be the important sources of Aeromonas infection. In the present study, radiation sensitivity of indigenous strains of Aeromonas spp. from different food samples was evaluated. The decimal reduction dose (D{sub 10}) values of different Aeromonas isolates in saline at 0-4 {sup o}C were in the range of 0.031-0.046 kGy. The mixed sprouts, chicken and fish samples were inoculated with a cocktail of five most resistant isolates (A. salmonicida Y567, A. caviae A85, A. jandaei A514A, A. hydrophila CECT 839{sup T} and A. veronii Y47) and exposed to {gamma} radiation to study the effectiveness of radiation treatment in elimination of Aeromonas. D{sub 10} values of Aeromonas cocktail in mixed sprouts, chicken and fish samples were found to be 0.081{+-}0.001, 0.089{+-}0.003 and 0.091{+-}0.003 kGy, respectively. Radiation treatment with a 1.5 kGy dose resulted in complete elimination of 10{sup 5} CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples. No recovery of Aeromonas was observed in the 1.5 kGy treated samples stored at 4 {sup o}C up to 12 (mixed sprouts) and 7 days (chicken and fish samples), even after enrichment and selective plating. This study demonstrates that a 1.5 kGy dose of irradiation treatment could result in complete elimination of 10{sup 5} CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples.

A molecular study on the prevalence and virulence potential of Aeromonas spp. recovered from patients suffering from diarrhea in Israel.

Directory of Open Access Journals (Sweden)

Yigal Senderovich

Full Text Available BACKGROUND: Species of the genus Aeromonas are native inhabitants of aquatic environments and have recently been considered emerging human pathogens. Although the gastrointestinal tract is by far the most common anatomic site from which aeromonads are recovered, their role as etiologic agents of bacterial diarrhea is still disputed. Aeromonas-associated diarrhea is a phenomenon occurring worldwide; however, the exact prevalence of Aeromonas infections on a global scale is unknown. METHODOLOGY/PRINCIPAL FINDINGS: The prevalence and virulence potential of Aeromonas in patients suffering from diarrhea in Israel was studied using molecular methods. 1,033 diarrheal stools were sampled between April and September 2010 and Aeromonas species were identified in 17 (∼2% patients by sequencing the rpoD gene. Aeromonas species identity and abundance was: A. caviae (65%, A. veronii (29% and Aeromonas taiwanensis (6%. This is the first clinical record of A. taiwanensis as a diarrheal causative since its recent discovery from a wound infection in a patient in Taiwan. Most of the patients (77% from which Aeromonas species were isolated were negative for any other pathogens. The patients ranged from 1 to 92 years in age. Aeromonas isolates were found to possess different virulence-associated genes: ahpB (88%, pla/lip/lipH3/apl-1 (71%, act/hlyA/aerA (35%, alt (18%, ast (6%, fla (65%, lafA (41%, TTSS ascV (12%, TTSS ascF-ascG (12%, TTSS-dependent ADP-ribosylating toxins aexU (41% and aexT (6% in various combinations. Most of the identified strains were resistant to beta-lactam antibiotics but susceptible to third-generation cephalosporin antibiotics. CONCLUSIONS: Aeromonas may be a causative agent of diarrhea in patients in Israel and therefore should be included in routine bacteriological screenings.

Multi locus sequence typing of Chlamydia reveals an association between Chlamydia psittaci genotypes and host species.

Science.gov (United States)

Pannekoek, Yvonne; Dickx, Veerle; Beeckman, Delphine S A; Jolley, Keith A; Keijzers, Wendy C; Vretou, Evangelia; Maiden, Martin C J; Vanrompay, Daisy; van der Ende, Arie

2010-12-02

Chlamydia comprises a group of obligate intracellular bacterial parasites responsible for a variety of diseases in humans and animals, including several zoonoses. Chlamydia trachomatis causes diseases such as trachoma, urogenital infection and lymphogranuloma venereum with severe morbidity. Chlamydia pneumoniae is a common cause of community-acquired respiratory tract infections. Chlamydia psittaci, causing zoonotic pneumonia in humans, is usually hosted by birds, while Chlamydia abortus, causing abortion and fetal death in mammals, including humans, is mainly hosted by goats and sheep. We used multi-locus sequence typing to asses the population structure of Chlamydia. In total, 132 Chlamydia isolates were analyzed, including 60 C. trachomatis, 18 C. pneumoniae, 16 C. abortus, 34 C. psittaci and one of each of C. pecorum, C. caviae, C. muridarum and C. felis. Cluster analyses utilizing the Neighbour-Joining algorithm with the maximum composite likelihood model of concatenated sequences of 7 housekeeping fragments showed that C. psittaci 84/2334 isolated from a parrot grouped together with the C. abortus isolates from goats and sheep. Cluster analyses of the individual alleles showed that in all instances C. psittaci 84/2334 formed one group with C. abortus. Moving 84/2334 from the C. psittaci group to the C. abortus group resulted in a significant increase in the number of fixed differences and elimination of the number of shared mutations between C. psittaci and C. abortus. C. psittaci M56 from a muskrat branched separately from the main group of C. psittaci isolates. C. psittaci genotypes appeared to be associated with host species. The phylogenetic tree of C. psittaci did not follow that of its host bird species, suggesting host species jumps. In conclusion, we report for the first time an association between C. psittaci genotypes with host species.

Multi locus sequence typing of Chlamydia reveals an association between Chlamydia psittaci genotypes and host species.

Directory of Open Access Journals (Sweden)

Yvonne Pannekoek

2010-12-01

Full Text Available Chlamydia comprises a group of obligate intracellular bacterial parasites responsible for a variety of diseases in humans and animals, including several zoonoses. Chlamydia trachomatis causes diseases such as trachoma, urogenital infection and lymphogranuloma venereum with severe morbidity. Chlamydia pneumoniae is a common cause of community-acquired respiratory tract infections. Chlamydia psittaci, causing zoonotic pneumonia in humans, is usually hosted by birds, while Chlamydia abortus, causing abortion and fetal death in mammals, including humans, is mainly hosted by goats and sheep. We used multi-locus sequence typing to asses the population structure of Chlamydia. In total, 132 Chlamydia isolates were analyzed, including 60 C. trachomatis, 18 C. pneumoniae, 16 C. abortus, 34 C. psittaci and one of each of C. pecorum, C. caviae, C. muridarum and C. felis. Cluster analyses utilizing the Neighbour-Joining algorithm with the maximum composite likelihood model of concatenated sequences of 7 housekeeping fragments showed that C. psittaci 84/2334 isolated from a parrot grouped together with the C. abortus isolates from goats and sheep. Cluster analyses of the individual alleles showed that in all instances C. psittaci 84/2334 formed one group with C. abortus. Moving 84/2334 from the C. psittaci group to the C. abortus group resulted in a significant increase in the number of fixed differences and elimination of the number of shared mutations between C. psittaci and C. abortus. C. psittaci M56 from a muskrat branched separately from the main group of C. psittaci isolates. C. psittaci genotypes appeared to be associated with host species. The phylogenetic tree of C. psittaci did not follow that of its host bird species, suggesting host species jumps. In conclusion, we report for the first time an association between C. psittaci genotypes with host species.

Search for Mycobacterium leprae in wild mammals

Directory of Open Access Journals (Sweden)

Sílvia Cristina Barboza Pedrini

Full Text Available Leprosy is still a worldwide public health problem. Brazil and India show the highest prevalence rates of the disease. Natural infection of armadillos Dasypus novemcinctus with Mycobacterium leprae has been reported in some regions of the United States. Identification of bacilli is difficult, particularly due to its inability to grow in vitro. The use of molecular tools represents a fast and sensitive alternative method for diagnosis of mycobacteriosis. In the present study, the diagnostic methods used were bacilloscopy, histopathology, microbiology, and PCR using specific primers for M. leprae repetitive sequences. PCR were performed using genomic DNA extracted from 138 samples of liver, spleen, lymph nodes, and skin of 44 D. novemcinctus, Euphractus sexcinctus, Cabassous unicinctus, and C. tatouay armadillos from the Middle Western region of the state of São Paulo and from the experimental station of Embrapa Pantanal, located in Pantanal da Nhecolândia of Mato Grosso do Sul state. Also, the molecular analysis of 19 samples from internal organs of other road killed species of wild animals, such as Nasua nasua (ring-tailed coati, Procyon cancrivoros (hand-skinned, Cerdocyon thous (dog-pity-bush, Cavia aperea (restless cavy, Didelphis albiventris (skunk, Sphigurrus spinosus (hedgehog, and Gallictis vittata (ferret showed PCR negative data. None of the 157 analyzed samples had shown natural mycobacterial infection. Only the armadillo inoculated with material collected from untreated multibacillary leprosy patient presented PCR positive and its genomic sequencing revealed 100% identity with M. leprae. According to these preliminary studies, based on the used methodology, it is possible to conclude that wild mammals seem not to play an important role in the epidemiology of leprosy in the Middle Western region of the São Paulo state and in the Pantanal of Mato Grosso do Sul state.

Clinical manifestations of bacteremia caused by Aeromonas species in southern Taiwan.

Directory of Open Access Journals (Sweden)

Hung-Jen Tang

Full Text Available This study is conducted to investigate the clinical characteristics of patients with bacteremia caused by Aeromonas species.Patients with bacteremia caused by Aeromonas species during the period 2009 to 2013 were identified from a computerized database of a regional hospital in southern Taiwan. The medical records of these patients were retrospectively reviewed.A total of 91 patients with bacteremia due to Aeromonas species were identified. In addition to 16 (17.6% primary bacteremia, the most common source of secondary infection is peritonitis (n = 27, 29.7%, followed by biliary tract infection (n = 18, 19.8%, and SSTI (n = 12, 13.2%, pneumonia (n = 9, 9.9%, catheter-related bloodstream infection (n =  5, 5.5%, and genitourinary tract infection (n = 4, 4.4%. A. hydrophila (n = 35, 38.5% was the most common pathogen, followed by A. veronii biovar sobria (n = 31, 34.1%, A. caviae (n = 14, 15.4%, and A. veronii biovar veronii (n = 9, 9.9%. Forty-three (47.3% patients were classified as healthcare-associated infections (HCAI causes by Aeromonas species, and patients with HCAI were more likely to have cancer, and receive immunosuppressant than patients with community-acquired bacteremia. The overall outcomes, including rate of ICU admission, acute respiratory failure, and mortality were 33.3%, 28.6%, and 23.1%, respectively. Multivariate analysis showed that the in-hospital day mortality was significantly associated only with underlying cancer (P <.001, and initial shock (P <.001.Aeromonas species should be considered one of the causative pathogens of healthcare-associated bacteremia, especially in immunocompromised patients. In addition, it can be associated with high fatality. Cancer and initial shock were the poor prognostic factors.

Dieta de Leopardus colocolo (Carnivora: Felidae en la Reserva Nacional de Junín, Junín, Perú

Directory of Open Access Journals (Sweden)

Ursula Fajardo

2014-05-01

Full Text Available Este estudio caracteriza la dieta de Leopardus colocolo en los alrededores del lago Junín, en el centro del Perú, a partir de los restos de las presas presentes en 43 heces. El origen de las heces del predador se determinó a partir del ADN mitocondrial de las células epiteliales intestinales adheridas a la superficie de las heces, utilizando como marcador la región de control. Los restos de las presas fueron identificados utilizando literatura especializada y la comparación con especímenes de colección, identificando un total of 14 ítems alimenticios pertenecientes a mamíferos de las familias Cricetidae (6, Chinchillidae (1 y Caviidae (1 y aves de las familias Anatidae (3 y Rallidae (2, y un grupo de aves no identificadas (1. Los roedores fueron el principal componente de la dieta de L. colocolo, en frecuencia y biomasa, seguido por las aves. Entre los ítems alimenticios consumidos, el roedor cricétido pequeño Calomys sp. fue el más frecuente; sin embargo, el mayor aporte de biomasa relativa fue proporcionado por el roedor mediano Cavia tschudii. La amplitud de nicho obtenida fue baja (Bsta= 0.17, indicando una dieta especializada. Nuestros resultados confirman que, como ocurre con la mayoría de felinos pequeños neotropicales, L. colocolo es un predador especializado en la captura de vertebrados, principalmente mamíferos pequeños. No se registró variación estacional en la dieta y el análisis de las clases de edad de los roedores cricétidos mostró que los adultos fueron los más consumidos. Se infiere que L. colocolo tiene un patrón de actividad diurno y nocturno.

Estudo sobre a associação de cerâmica a plasma rico em plaquetas na coluna vertebral de ratos Study about fusion using ceramic with platelet-rich plasma in the spine of rats

Directory of Open Access Journals (Sweden)

Rita Delgado

2009-01-01

Full Text Available OBJETIVO: Analisar o efeito osteoindutor dos fatores de crescimento contidos no plasma rico em plaquetas (PRP quando associados a cerâmicas no processo de fusão na coluna vertebral de ratos. MATERIAL E MÉTODO: Laminectomia lombar foi realizada em 16 ratos Lewis isogênicos para implantar cerâmica. O PRP foi preparado no ato operatório a partir do sangue de outras duas cobaias.os grupos estudo e controle foram estabelecidos por randomização, recebendo o grupo estudo cerâmica associada a PRP e o controle apenas cerâmica. Os animais foram sacrificados após 10 semanas e as colunas enviadas para análise histopatológica. RESULTADOS: Intensa atividade osteoblástica e osteoclástica e completa reabsorção da cerâmica foram achados no grupo estudo. No grupo controle havia ilhotas de osso em meio a tecido fibroso e cerâmica não reabsorvida. Discussão: Os fatores de crescimento liberados pelas plaquetas agem ligando-se à superfície de osteoblastos e fibroblastos, estimulando a síntese de colágeno para formação de matriz óssea. macrófagos ativados continuam secretando os fatores de crescimento e estimulando a osteogênese. CONCLUSÃO: O uso de PRP associado a cerâmica mostrou maior atividade osteoblástica e osteoclástica e completa reabsorção da cerâmica em relação à enxertia da mesma isoladamente na coluna vertebral de ratos.OBJECTIVE: To assess the osteoinductive action of platelet-rich plasma when associated to ceramics in the spine of rats. MATERIAL AND METHOD: Laminectomy was performed in 16 isogenic Lewis rats for posterior ceramic grafting. PRP was prepared intraoperatively using blood collected from two other rats. Study and control groups were set by randomization, with the study group receiving ceramics associated to PRP, and the control group receiving only ceramics. The animals were sacrificed for histopathological analysis after 10 weeks. RESULTS: Strong osteoblastic and osteoclastic activity and full re

Identificação e resistência a antimicrobianos de espécies de Aeromonas móveis isoladas de peixes e ambientes aquáticos Identification and antimicrobial resistance of motile Aeromonas isolated from fish and aquatic environment

Directory of Open Access Journals (Sweden)

Daniela Hirsch

2006-12-01

Full Text Available Com o objetivo de se verificar a diversidade de espécies de Aeromonas móveis e seu perfil de susceptibilidade a antimicrobianos em pisciculturas comerciais, foram selecionadas oito tilapiculturas localizadas na região do Alto Rio Grande, Minas Gerais. De cada propriedade foram coletadas três amostras de peixes em estádio de pré-abate (vivos e saudáveis, uma amostra de água do tanque e uma amostra da água de abastecimento do sistema. De cada peixe foram coletadas amostras de lavado superficial e do parênquima renal. Diluições seriadas adequadas de cada amostra foram plaqueadas em TSA-ampicilina (10 mg/l e as amostras de rim em Ágar Sangue de cavalo a 5%. A partir de colônias isoladas positivas para o teste da oxidase foram realizados testes para identificação do gênero (testes presuntivos e das espécies de Aeromonas (testes bioquímicos. O perfil de antibiograma foi obtido pelo teste de difusão de discos de antibióticos em Ágar Mueller Hinton. Foram obtidos 75 isolados diferenciados em nove espécies de Aeromonas: A. jandaei, A. hydrophila, A. trota, A. caviae, A. sobria, A. eucrenophila, A. veronii bt veronii, A. schubertii, A. media, além de amostras classificadas como Aeromonas atípicas. Do total isolado, oito amostras foram provenientes da superfície corpórea de peixes, 14 da água de abastecimento e 53 da água do tanque. Não houve isolamento a partir dos espécimes de parênquima renal. Em relação ao perfil de resistência, 93% dos isolados foram resistentes à eritromicina, 36% à tetraciclina, 13% ao ác. nalidíxico, 9% à gentamicina, 8% à nitrofurantoína, 8% à canamicina, 5% à norfloxacina, 4% ao cloranfenicol e 3% às sulfonamidas. Dentre os isolados analisados, 43% apresentaram índice de múltipla resistência a antimicrobianos (MAR igual ou superior a 22%, ou seja, resistência a dois ou mais drogas das nove testadas. Os dados apontam para um risco iminente, tanto pelo isolamento de amostras

CARDIOTHORACIC RATIO AND VERTEBRAL HEART SCALE IN CLINICALLY NORMAL BLACK-RUMPED AGOUTIS (DASYPROCTA PRYMNOLOPHA, WAGLER 1831).

Science.gov (United States)

de Moura, Charlys Rhands Coelho; das Neves Diniz, Anaemilia; da Silva Moura, Laecio; das Chagas Araújo Sousa, Francisco; Baltazar, Pollyana Irene; Freire, Larisse Danielle; Guerra, Porfírio Candanedo; de Sousa, João Macedo; Giglio, Robson Fortes; Pessoa, Gerson Tavares; de Sá, Renan Paraguassu; Alves, Flávio Ribeiro

2015-06-01

Wild rodents, such as the lowland paca (Cuniculus paca), capybara (Hydrochoerus hydrochaeris), rock cavy (Kerodon rupestris), guinea pig (Cavia aperea), and black-rumped agouti (Dasyprocta prymnolopha) are intensely hunted throughout Amazonia and at the semiarid regions of northeastern Brazil. To contribute to the preservation of these species, more information about their anatomy, physiology and pathophysiology is needed. The aim of this study was to standardize the vertebral heart scale (VHS) and cardiothoracic ratio (CTR) in clinically normal black-rumped agouti, as well as to compare the results of these two methods, which are commonly used to evaluate the cardiac silhouette in domestic animals. Twelve healthy black-rumped agoutis, divided into two groups (six males and six females), obtained from the Nucleus for Wild Animal Studies and Conservation at the Federal University of Piauí, were radiographed in right and left lateral and dorsoventral projections. The values of the VHS were 8.00±0.31v (the number of thoracic vertebral length spanned by each dimension, starting at T4) for males and 8.11±0.41v for females, and there was no statistical difference between the decubitus (right and left) or between males and females (P>0.05). The CTR mean values obtained were 0.51±0.03 for males, and 0.52±0.02 for females, and there was no statistical difference between the genders (P>0.05). However, there was positive correlation between VHS and CTR (r=0.77 right decubitus and r=0.82 left decubitus). The thoracic and heart diameter had mean values of 6.72±0.61 and 3.48±0.30 cm (males), and for the females, it was 6.61±0.51 and 3.5±0.30 cm, respectively, and there was statistical difference between the genders. The results demonstrated high correlation between the VHS and CTR producing similar results, indicating similar clinical precision for assessing the size of the cardiac silhouette in the black-rumped agoutis.

Waste cooking oil as substrate for biosynthesis of poly(3-hydroxybutyrate and poly(3-hydroxybutyrate-co-3-hydroxyhexanoate: Turning waste into a value-added product

Directory of Open Access Journals (Sweden)

Yang, T. A.

2013-01-01

Full Text Available Aims: Improper disposal of domestic wastes, such as waste cooking oil (WCO, contributes to the deterioration of the environment and may lead to health problems. In this study, we evaluated the potential of plant-based WCO as a carbon source for the commercial biosynthesis of the bio-plastics, poly(3-hydroxybutyrate and poly(3-hydroxybutyrate-co-3-hydroxyhexanoate. The consumption of WCO for this purpose would mitigate their pollution of the environment at the same time.Methodology and Results: WCO collected from several cafeterias in USM was tested as the carbon source for polyhydroxyalkanoates (PHA production. A selection of suitable nitrogen source was first conducted in order to obtain an acceptable number of dry cell weight (DCW and PHA content. Urea was found to be a suitable nitrogen source for the two bacterial strains used in our study, Cupriavidus necator H16 and its transformed mutant, C. necator PHB¯4 harboring the PHA synthase gene of Aeromonas caviae (PHB¯4/pBBREE32d13. With WCO as the sole carbon source, C. necator H16 yielded a relatively good dry cell weight (DCW=25.4 g/L, with 71 wt% poly(3-hydroxybutyrate P(3HBcontent. In comparison, the DCW obtained with fresh cooking oil (FCO was 24.8 g/L. The production of poly(3 hydroxybutyrate-co-3- hydroxyhexanoate [P(3HB-co-3HHx] from WCO by the transformant C. necator PHB¯4 was comparable, yielding a DCW of 22.3 g/L and P(3HB-co-3HHx content of 85 wt%. Lipase activities for both bacterial strains reached a maximum after 72 h of cultivation when time profile was conducted. Conclusion, significance and impact of study: The use of WCO as a carbon source in the biosynthesis of the bioplastic, PHA, turns a polluting domestic waste into a value-added biodegradable product. This renewable source material can thus be exploited for the low cost production of PHA.

Occurrence of potential pathogenic Aeromonas species in tropical seafood, aquafarms and mangroves off Cochin coast in South India

Directory of Open Access Journals (Sweden)

Alphonsa Vijaya Joseph

2013-12-01

Full Text Available Background: The genus Aeromonas include gram-negative, motile, facultative anaerobic, rod shaped and oxidase positive bacteria comprising several species, associated with the aquatic environment. Aeromonas species have been implicated in human pathogenesis and are linked with gastroenteritis, muscle infections, septicemia, and skin diseases. In fish they are renowned as enteric pathogens causing haemorrhagic septicemia, fin rot, soft tissue rot and furunculosis resulting in major die-offs and fish kills. Aim: This study reports the occurrence of potential pathogenic Aeromonas sp. in tropical seafood (Squids, Prawns and Mussels, aquafarms and mangroves of Cochin, Kerala, South India. Materials and Methods :Tropical seafood (Squid, Prawn and Mussel, sediment and water samples from aquafarms and associated mangroves were screened for Aeromonas contamination. The isolates were identified by 16S rDNA sequence analysis and subjected to morphological and biochemical characterization. Haemolytic assay was used for determining pathogenicity of the organisms. Antibiotic susceptibility against 12 antibiotics were performed and the MAR index was calculated. Results: A total of 134 isolates were recovered from the samples of which 15 were identified as Aeromonas species by 16S rDNA sequence analysis and were assigned to 5 species namely, A. hydrophila, A. enteropelogenes, A. caviae, A. punctataand A. aquarorium. Morphological, biochemical and phylogenetic analyses revealed relatedness and variability among the strains. All the isolates were haemolytic on blood agar indicating their pathogenicity. The isolates exhibited varying degrees of resistance to vancomycin (86.66%, ampicillin (46.66%, nalidixic acid (20%, tetracycline (6.66%, co-trimaxozole (6.66% and rifampicin (6.66% and were susceptible to antibiotics like gentamycin, streptomycin, trimethoprim, azithromycin, cefixime and chloramphenicol. 20% of Aeromonas sp. showed MAR index > 0.2 indicative of the

Multi locus sequence typing of Chlamydiales: clonal groupings within the obligate intracellular bacteria Chlamydia trachomatis

Directory of Open Access Journals (Sweden)

Langerak Ankie A

2008-02-01

Full Text Available Abstract Background The obligate intracellular growing bacterium Chlamydia trachomatis causes diseases like trachoma, urogenital infection and lymphogranuloma venereum with severe morbidity. Several serovars and genotypes have been identified, but these could not be linked to clinical disease or outcome. The related Chlamydophila pneumoniae, of which no subtypes are recognized, causes respiratory infections worldwide. We developed a multi locus sequence typing (MLST scheme to understand the population genetic structure and diversity of these species and to evaluate the association between genotype and disease. Results A collection of 26 strains of C. trachomatis of different serovars and clinical presentation and 18 strains of C. pneumoniae were included in the study. For comparison, sequences of C. abortus, C. psittaci, C. caviae, C. felis, C. pecorum (Chlamydophila, C. muridarum (Chlamydia and of Candidatus protochlamydia and Simkania negevensis were also included. Sequences of fragments (400 – 500 base pairs from seven housekeeping genes (enoA, fumC, gatA, gidA, hemN, hlfX, oppA were analysed. Analysis of allelic profiles by eBurst revealed three non-overlapping clonal complexes among the C. trachomatis strains, while the C. pneumoniae strains formed a single group. An UPGMA tree produced from the allelic profiles resulted in three groups of sequence types. The LGV strains grouped in a single cluster, while the urogenital strains were distributed over two separated groups, one consisted solely of strains with frequent occurring serovars (E, D and F. The distribution of the different serovars over the three groups was not consistent, suggesting exchange of serovar encoding ompA sequences. In one instance, exchange of fumC sequences between strains of different groups was observed. Cluster analyses of concatenated sequences of the Chlamydophila and Chlamydia species together with those of Candidatus Protochlamydia amoebophila and Simkania

Multi locus sequence typing of Chlamydiales: clonal groupings within the obligate intracellular bacteria Chlamydia trachomatis.

Science.gov (United States)

Pannekoek, Yvonne; Morelli, Giovanna; Kusecek, Barica; Morré, Servaas A; Ossewaarde, Jacobus M; Langerak, Ankie A; van der Ende, Arie

2008-02-28

The obligate intracellular growing bacterium Chlamydia trachomatis causes diseases like trachoma, urogenital infection and lymphogranuloma venereum with severe morbidity. Several serovars and genotypes have been identified, but these could not be linked to clinical disease or outcome. The related Chlamydophila pneumoniae, of which no subtypes are recognized, causes respiratory infections worldwide. We developed a multi locus sequence typing (MLST) scheme to understand the population genetic structure and diversity of these species and to evaluate the association between genotype and disease. A collection of 26 strains of C. trachomatis of different serovars and clinical presentation and 18 strains of C. pneumoniae were included in the study. For comparison, sequences of C. abortus, C. psittaci, C. caviae, C. felis, C. pecorum (Chlamydophila), C. muridarum (Chlamydia) and of Candidatus protochlamydia and Simkania negevensis were also included. Sequences of fragments (400 - 500 base pairs) from seven housekeeping genes (enoA, fumC, gatA, gidA, hemN, hlfX, oppA) were analysed. Analysis of allelic profiles by eBurst revealed three non-overlapping clonal complexes among the C. trachomatis strains, while the C. pneumoniae strains formed a single group. An UPGMA tree produced from the allelic profiles resulted in three groups of sequence types. The LGV strains grouped in a single cluster, while the urogenital strains were distributed over two separated groups, one consisted solely of strains with frequent occurring serovars (E, D and F). The distribution of the different serovars over the three groups was not consistent, suggesting exchange of serovar encoding ompA sequences. In one instance, exchange of fumC sequences between strains of different groups was observed. Cluster analyses of concatenated sequences of the Chlamydophila and Chlamydia species together with those of Candidatus Protochlamydia amoebophila and Simkania negevensis resulted in a tree identical to that

Caveolin-2 associates with intracellular chlamydial inclusions independently of caveolin-1

Directory of Open Access Journals (Sweden)

Norkin Leonard C

2004-07-01

Full Text Available Abstract Background Lipid raft domains form in plasma membranes of eukaryotic cells by the tight packing of glycosphingolipids and cholesterol. Caveolae are invaginated structures that form in lipid raft domains when the protein caveolin-1 is expressed. The Chlamydiaceae are obligate intracellular bacterial pathogens that replicate entirely within inclusions that develop from the phagocytic vacuoles in which they enter. We recently found that host cell caveolin-1 is associated with the intracellular vacuoles and inclusions of some chlamydial strains and species, and that entry of those strains depends on intact lipid raft domains. Caveolin-2 is another member of the caveolin family of proteins that is present in caveolae, but of unknown function. Methods We utilized a caveolin-1 negative/caveolin-2 positive FRT cell line and laser confocal immunofluorescence techniques to visualize the colocalization of caveolin-2 with the chlamydial inclusions. Results We show here that in infected HeLa cells, caveolin-2, as well as caveolin-1, colocalizes with inclusions of C. pneumoniae (Cp, C. caviae (GPIC, and C. trachomatis serovars E, F and K. In addition, caveolin-2 also associates with C. trachomatis serovars A, B and C, although caveolin-1 did not colocalize with these organisms. Moreover, caveolin-2 appears to be specifically, or indirectly, associated with the pathogens at the inclusion membranes. Using caveolin-1 deficient FRT cells, we show that although caveolin-2 normally is not transported out of the Golgi in the absence of caveolin-1, it nevertheless colocalizes with chlamydial inclusions in these cells. However, our results also show that caveolin-2 did not colocalize with UV-irradiated Chlamydia in FRT cells, suggesting that in these caveolin-1 negative cells, pathogen viability and very likely pathogen gene expression are necessary for the acquisition of caveolin-2 from the Golgi. Conclusion Caveolin-2 associates with the chlamydial

Effect of b-Propiolactone treatment on the complement activation mediated by equine antisera

Directory of Open Access Journals (Sweden)

Rosalvo GUIDOLIN

1997-03-01

Full Text Available Reduction of complement activation through an alteration of the Fc fragment of immunoglobulins by b-propiolactone treatment was carried out in equine antisera raised against rabies virus, Bothrops venoms and diphtherial toxin. Results were evaluated by means of an anaphylactic test performed on guinea-pigs, and compared to the ones obtained with the same sera purified by saline precipitation (ammonium sulfate, followed or not by enzymatic digestion with pepsin. Protein purity levels for antibothropic serum were 184.5 mg/g and 488.5 mg/g in b-propiolactone treated and pepsin-digested sera, respectively. The recovery of specific activity was 100% and 62.5% when using antibothropic serum treated by b-propiolactone and pepsin digestion, respectively. The antidiphtherial and anti-rabies sera treated with b-propiolactone and pepsin presented protein purity levels of 5,698 and 7,179 Lf/g, 16,233 and 6,784 IU/g, respectively. The recovery of specific activity for these antisera were 88.8%, 77.7%, 100% and 36,5%, respectively. b-propiolactone treatment induced a reduction in complement activation, tested "in vivo", without significant loss of biological activity. This treatment can be used in the preparation of heterologous immunoglobulins for human use.Efeito do tratamento de antissoros equinos pela b-propiolactona na ativação do complemento. A redução da ativação do complemento através de uma alteração do fragmento Fc das imunoglobulinas pela b-propiolactona foi obtida em soros hiperimunes equinos antivirus rábico, venenos Bothrops e toxina diftérica. Os resultados foram avaliados por teste de anafilaxia em cobaias, e comparados com aqueles obtidos com os mesmos soros purificados por precipitação salina (sulfato de amônio, seguidos ou não por digestão enzimática com pepsina. Os níveis de pureza protéica foram para o soro antibotrópico de 184.5 mg/g e 488.5 mg/g tratado pela b-propiolactona e digeridos pela pepsina, respectivamente

Diagnóstico e estudo sorológico da infecção pelo parvovírus canino em cães de Passo Fundo, Rio Grande do Sul, Brasil Diagnosis and serological study of canine parvovirus infection in dogs from Passo Fundo, Rio Grande do Sul, Brazil

Directory of Open Access Journals (Sweden)

Daisy Maria Strottmann

2008-04-01

Full Text Available A reação em cadeia da polimerase (PCR e o ensaio de hemaglutinação (HA foram comparados para a identificação de parvovírus canino (CPV em fezes de cães com gastrenterite. A prevalência de anticorpos anti-CPV em uma população de cães sem histórico de vacinação foi avaliada pelo ensaio de inibição da hemaglutinação (HI. A variabilidade fenotípica entre uma amostra vacinal e isolados de campo foi investigada utilizando soro hiperimune. Trinta amostras fecais foram obtidas de cães com diarréia e submetidas à PCR e ao HA, e 185 amostras de soro de cães foram submetidas à HI para detectar anticorpos anti-CPV. Considerando-se somente como positivas as amostras que apresentaram HA na diluição igual ou superior a 1:64, detectou-se CPV em 9 (30% das amostras fecais. Nove amostras fecais apresentaram HA nas diluições entre 1:2 e 1:32 e foram consideradas negativas nesse teste. Todas as amostras que apresentaram HA na diluição igual ou superior a 1:64 foram positivas pela PCR e, das nove amostras que apresentaram HA nas diluições entre 1:2 e 1:32, seis também foram positivas para CPV na amplificação pela PCR. A pesquisa sorológica de amostras de soros caninos indicou que 178 (96,2% cães tiveram contato prévio com o vírus. Os soros hiperimunes produzidos em cobaias contra a cepa vacinal e dois isolados de campo indicaram possíveis diferenças fenotípicas entre isolados.The polymerase chain reaction (PCR and hemaglutination (HA assay were used to detect canine parvovirus (CPV in feces from young dogs with gastroenteritis. The hemaglutination inhibition (HI assay was used to detect the prevalence of anti-CPV antibodies in a non-vaccinated dog population. In addition, hiperimmune serum was used to investigate the phenotypic variability of a vaccine strain and two field isolates of CPV. Thirty fecal samples obtained from dogs with diarrhea were submitted to PCR and HA, and 185 serum samples were submitted to HI to detect

Avaliação biológica de Foeniculum vulgare (Mill. (Umbelliferae/Apiaceae Biological evaluation of Foeniculum vulgare (Mill. (Umbelliferae/Apiaceae

Directory of Open Access Journals (Sweden)

O. Araujo R

2013-01-01

Full Text Available Foeniculum vulgare Mill. é espécie herbácea da família Umbelliferae, nativa da região do Mediterrâneo e da Ásia Menor, amplamente distribuída em todo o território brasileiro. É conhecida popularmente como funcho ou erva-doce e usada na medicina como analgésico, digestivo, carminativo, diurético, expectorante, lactígeno, anti-inflamatório, e antiespasmódico. O extrato bruto etanólico para a verificação das atividades biológicas foi preparado a partir de sementes compradas no comércio. Para a realização do perfil fitoquímico foi utilizada a cromatografia em camada delgada analítica; a atividade antimicrobiana foi determinada pelo teste de difusão em disco de papel e da concentração inibitória mínima (CIM; a atividade antinociceptiva foi realizada pelo método de contorções abdominais em cobaias. Os micro-organismos testados foram isolados clínicos multirresistentes obtidos do Setor de Bacteriologia do Hospital das Clínicas de Pernambuco. O estudo fitoquímico identificou a maioria dos compostos secundários presentes na fração metanólica das sementes, sendo eles: triterpenos, glicosídeos de flavanóides, terpenos menores (monoterpenóides, sesquiterpenóide e diterpenóides, e açúcares redutores. Os resultados obtidos mostraram que o extrato etanólico apresentou maior atividade frente à Micrococcus spp. (CIM=250µg/mL. Os resultados da avaliação da atividade antinociceptiva demonstraram que apenas a dosagem de 298 mg/Kg quando comparado com o padrão indometacina conseguiu uma redução significativa no número de contorções abdominais dos animais. Estudos posteriores deverão ser realizados para a identificação e isolamento de alguns compostos secundários, bem como a realização de outros protocolos de analgesia.Foeniculum vulgare Mill. (Umbelliferae is a herbaceous plant of the family Umbelliferae, native to the Mediterranean and Asia Minor region and widely distributed all over the Brazilian

Ototoxicidade da cisplatina e otoproteção pelo extrato de ginkgo biloba às células ciliadas externas: estudo anatômico e eletrofisiológico Cisplatin ototoxycity and otoprotector to cilliated cells by ginkgo biloba extract: anatomic and eletrophisiologic study

Directory of Open Access Journals (Sweden)

Miguel Angelo Hyppolito

2003-08-01

Full Text Available A Cisplatina é uma potente droga antineoplásica, largamente utilizada para o tratamento do câncer, tanto em adultos quanto em crianças. Dentre seus efeitos colaterais, a ototoxicidade se apresenta como um dos mais importantes e leva à perda auditiva irreversível, bilateral, para as altas freqüências (4KHz#8KHz. Estudos têm tentado identificar drogas que, associadas à cisplatina possam atuar como otoprotetores. Sabe-se que o mecanismo da ototoxicidade pela cisplatina está relacionado a alterações nos mecanismos antioxidantes das células ciliadas, principalmente as células ciliadas externas da cóclea. OBJETIVO: Nossa proposta foi de avaliar através de emissões otoacústicas, por produtos de distorção (EOAPD e por microscopia eletrônica de superfície (ME, a ação do extrato de ginkgo biloba (EGB 761, que tem conhecida ação antioxidante, como possível otoprotetor, utilizando como modelo experimental cobaias albinas. FORMA DE ESTUDO: Experimental. MATERIAL E MÉTODO: Observamos EOAPD presentes pré e pós tratamento no grupo EGB (100 mg/Kg/dia via oral e 90 minutos após cisplatina (80 mg/Kg/dia via intraperitoneal por 8 dias. RESULTADO: Houve também manutenção da arquitetura ciliar nas células ciliadas externas em todas as espiras da cóclea, enquanto que no grupo tratado somente com cisplatina (80 mg/Kg/dia via intraperitoneal por 8 dias, houve desaparecimento das EOAPD pós tratamento, com desaparecimento dos cilios das células ciliadas externas e distorção na arquitetura dos cílios remanescentes à ME. CONCLUSÃO: Concluímos que a EGB, por sua ação antioxidante, atua como fator otoprotetor à ototoxicidade pela cisplatina, devendo ser testada tal ação na prática clínica em pacientes que utilizam a cisplatina, pois o uso do EGB está extremamente difundido no tratamento de diferentes doenças.Cisplatin is an antineoplastic drug for cancer treatment in children and adults. The side effects of cisplatin

Characterization of Aeromonas hydrophila wound pathotypes by comparative genomic and functional analyses of virulence genes.

Science.gov (United States)

Grim, Christopher J; Kozlova, Elena V; Sha, Jian; Fitts, Eric C; van Lier, Christina J; Kirtley, Michelle L; Joseph, Sandeep J; Read, Timothy D; Burd, Eileen M; Tall, Ben D; Joseph, Sam W; Horneman, Amy J; Chopra, Ashok K; Shak, Joshua R

2013-04-23

Aeromonas hydrophila has increasingly been implicated as a virulent and antibiotic-resistant etiologic agent in various human diseases. In a previously published case report, we described a subject with a polymicrobial wound infection that included a persistent and aggressive strain of A. hydrophila (E1), as well as a more antibiotic-resistant strain of A. hydrophila (E2). To better understand the differences between pathogenic and environmental strains of A. hydrophila, we conducted comparative genomic and functional analyses of virulence-associated genes of these two wound isolates (E1 and E2), the environmental type strain A. hydrophila ATCC 7966(T), and four other isolates belonging to A. aquariorum, A. veronii, A. salmonicida, and A. caviae. Full-genome sequencing of strains E1 and E2 revealed extensive differences between the two and strain ATCC 7966(T). The more persistent wound infection strain, E1, harbored coding sequences for a cytotoxic enterotoxin (Act), a type 3 secretion system (T3SS), flagella, hemolysins, and a homolog of exotoxin A found in Pseudomonas aeruginosa. Corresponding phenotypic analyses with A. hydrophila ATCC 7966(T) and SSU as reference strains demonstrated the functionality of these virulence genes, with strain E1 displaying enhanced swimming and swarming motility, lateral flagella on electron microscopy, the presence of T3SS effector AexU, and enhanced lethality in a mouse model of Aeromonas infection. By combining sequence-based analysis and functional assays, we characterized an A. hydrophila pathotype, exemplified by strain E1, that exhibited increased virulence in a mouse model of infection, likely because of encapsulation, enhanced motility, toxin secretion, and cellular toxicity. Aeromonas hydrophila is a common aquatic bacterium that has increasingly been implicated in serious human infections. While many determinants of virulence have been identified in Aeromonas, rapid identification of pathogenic versus nonpathogenic

Sanitary evaluation of domestic water supply facilities with storage tanks and detection of Aeromonas, enteric and related bacteria in domestic water facilities in Okinawa Prefecture of Japan.

Science.gov (United States)

Miyagi, Kazufumi; Sano, Kouichi; Hirai, Itaru

2017-08-01

To provide for temporary restrictions of the public water supply system, storage tanks are commonly installed in the domestic water systems of houses and apartment buildings in Okinawa Prefecture of Japan. To learn more about the sanitary condition and management of these water supply facilities with storage tanks (hereafter called "storage tank water systems") and the extent of bacterial contamination of water from these facilities, we investigated their usage and the existence of Aeromonas, enteric and related bacteria. Verbal interviews concerning the use and management of the storage tank water systems were carried out in each randomly sampled household. A total of 54 water samples were collected for bacteriological and physicochemical examinations. Conventional methods were used for total viable count, fecal coliforms, identification of bacteria such as Aeromonas, Enterobacteriaceae and non-fermentative Gram-negative rods (NF-GNR), and measurement of residual chlorine. On Aeromonas species, tests for putative virulence factor and an identification using 16S rRNA and rpoB genes were also performed. Water from the water storage systems was reported to be consumed directly without boiling in 22 of the 54 houses (40.7%). 31 of the sampled houses had installed water storage tanks of more than 1 cubic meter (m 3 ) per inhabitant, and in 21 of the sampled houses, the tank had never been cleaned. In all samples, the total viable count and fecal coliforms did not exceed quality levels prescribed by Japanese waterworks law. Although the quantity of bacteria detected was not high, 23 NF-GNR, 14 Enterobacteriaceae and 5 Aeromonas were isolated in 42.6%, 7.4% and 3.7% of samples respectively. One isolated A. hydrophila and four A. caviae possessed various putative virulence factors, especially A. hydrophila which had diverse putative pathogenic genes such as aer, hlyA, act, alt, ast, ser, and dam. Many bacteria were isolated when the concentration of residual chlorine

Tratamento cirúrgico da otite média com efusão: tubo de ventilação versus aplicação tópica de mitomicina C Surgical treatment of otitis media with effusion: ventilation tube versus topical application of mitomycin C

Directory of Open Access Journals (Sweden)

Celso G. Becker

2003-08-01

Full Text Available O uso do tubo de ventilação (TV da orelha média, tratamento cirúrgico eleito da otite média com efusão (OME, não é isento de complicações, promovendo ainda limitação social pela necessidade de abandono dos banhos de imersão. A mitomicina C (MMC é um antineoblástico, cuja aplicação tópica retarda a fibrose e previne a estenose cicatricial. Em cobaias, retardou o fechamento de timpanotomias, permitindo maior tempo de aeração da orelha média, à semelhança dos tubos de ventilação. FORMA DE ESTUDO: Clínico prospectivo. OBJETIVO: Comparar a eficácia entre timpanotomia, aspirado da efusão e inserção de tubo de ventilação (grupo TV versus timpanotomia, aspirado da efusão e aplicação tópica de mitomicina C (grupo MMC. Comparar o tempo de manutenção da timpanotomia e a incidência de complicações nos dois grupos. RESULTADOS: O grupo MMC apresentou eficácia significativamente menor (52% versus 80% que o grupo TV (p= 0,34. A presença de timpanometria tipo "B" e a ausência de comprometimento do óstio faríngeo tubário pelo tecido adenóide no pré-operatório representaram fatores de mau prognóstico. A aplicação tópica de MMC nas bordas da timpanotomia proporcionou um tempo de abertura da membrana timpânica por duas a três semanas. No grupo TV, a otorréia foi observada em 13,3% dos pacientes. No grupo MMC, apesar da menor eficácia, nenhum paciente apresentou complicações nem sofreu prolongada proibição dos banhos de imersão. CONCLUSÃO: Apesar de concluirmos que o TV apresenta maior eficácia, novos estudos utilizando maior concentração, maior tempo de aplicação ou o uso seriado de MMC no tratamento da otite média com efusão devem ser realizados.The insertion of the ventilation tube (VT, which is the surgical treatment for otitis media with effusion (OME, is not free from complications and also limits social life because of the need of abandoning immersion baths. Mitomycin C is an antineoblastic

Clinical Procedures Training for Veterinary Technicians and Investigators using Common Laboratory Animal Species, including: Mice (Mus musculus), Rats (Rattus norvegicus), Hamsters (Mesocricetus auratus), Guinea Pigs (Gavia porcellus), Rabbits (Otyctolagus cuniculus), Ferrets (Mustela putorius furo), Pigs (Sus scrofa), Sheep (Ovis aries), and Goats (Capra hircus)

Science.gov (United States)

2016-08-30

60th Medical Group (AMC), Travis AFB, CA INSTITUTIONAL ANIMAL CARE AND USE COMMITTEE (IACUC) FINAL REPORT SUMMARY (Please !ml all information. Use...Technicians and Investigators using Common Laboratory Animal Species, including: Mice (Mus muscu/us), Rats (Rattus norvegicus), Hamsters (Mesocricetus auratus...DATE: 14 November 2016 FUNDING SOURCE: SG O&M funds LAST TRIENNIAL REVISION DATE: 15 October 2015 1. RECORD OF ANIMAL USAGE: Animal Species: Total

Identificação sorológica intratípica de poliovírus pelo "método da comparação dos índices de neutralização" Intratypic serodifferentiation of polioviruses by comparison of neutralization indices

Directory of Open Access Journals (Sweden)

Klaus Eberhard Stewien

1971-12-01

Full Text Available O método da comparação dos índices de neutralização (SMIT & WILTERDINK, 1966 foi utilizado na identificação sorológica intratípica de 49 poliovírus, pertencentes aos três tipos imunológicos e isolados de casos clínicos com e sem contato conhecido com a vacina oral de Sabin. O método foi também comparado com o método de Wecker e com o marcador RCT40 no estudo da identificação intratípica das estirpes do tipo 3. Os soros imunes necessários às reações de neutralização foram preparados em cobaias com as estirpes vacinais LSc2ab, P712Ch2ab e Leon 12a1b. As estirpes - dos tipos 1 e 3 - isoladas dos indivíduos sem contato conhecido com a vacina oral, foram todas identificadas como heterólogas às respectivas estirpes vacinais e as provenientes dos indivíduos com contato (recém-vacinados e contatos foram identificadas como isólogas às respectivas estirpes vacinais, exceto duas, das quais uma (do tipo 1 foi identificada como intermediária e a outra (do tipo 3 como heteróloga. Não foi possível interpretar convenientemente os resultados das provas de identificação das estirpes do tipo 2, porque o índice de neutralização do protótipo Lansing, ao contrário dos índices das estirpes de referência dos tipos 1 e 3, não deu resultados constantes em provas consecutivas na presença do sôro anti-P712Ch2ab. No estudo da identificação intratípica dos poliovírus do tipo 3, o método da comparação dos índices de neutralização forneceu resultados plenamente concordantes com os obtidos pelo método de Wecker, com isto evidenciando ser um método igualmente satisfatório e, devido à relativa simplicidade de sua técnica, melhor indicado para inquéritos epidemiológicos, quando se examina a procedência de numerosas estirpes. Os resultados obtidos com o marcador RCT40 mostraram a importância de utilizar provas de diferenciação sorológica intratípica na identificação dos vírus da poliomielite em áreas de

Mielencefalite espontânea dos camundongos

Directory of Open Access Journals (Sweden)

Hermínio Linhares

1944-02-01

ástrica deu sempre resultados negativos. Camundongos muito jovens são mais suscetíveis do que os adultos. 9 — O vírus foi sempre isolado ate 90 dias pos-inoculação, do cérebro e da medula de camundongos com paralisia. Animais inoculados por via i.c., que permaneceram aparentemente normais, albergam o vírus no cérebro pelo menos durante 30 dias. 10 — Não foi possível isolar vírus do fígado, pulmão, bago, rim e sangue de camundongos infetados por via intracerebral. 11 — Camundongos que foram inoculados por via i.c. e não apresentaram sintomas de infecção, mostraram-se em geral imunes a uma posterior inoculação de vírus. Os soros de animais convalescentes apresentam anticorpos neutralizantes verificados por provas de proteção. 12 — A inoculação intracerebral do vírus em macaco, coelho, cobaia e rato, todos jovens, não produziu infecção. 13 — As lesões encontradas foram de poliomielencefalite aguda, com atrofia do corno anterior da medula. Ao nível da substancia cinzenta medular e cerebral encontram-se abundantes focos inflamatórios, com predominância de mononucleares, bem como em torno de numerosos vasos. Em certos pontos do cérebro, sobretudo no rinencéfalo, foram vistos focos extensos de encefalite hemorrágica. É evidente que em torno do foco e participando das infiltrações celulares, muitos elementos microgliais puderam ser reconhecidos. As meninges, especialmente a pia-máter, mostraram-se levemente alteradas e assim mesmo em focos esparsos.1 — Two strains of virus which produce myeloencephalitis were isolated from two white swiss mice, from breeding, spontaneously infected, among 7000 mice examined; another strain was obtained by trituration and filtration of the intestines of normal mice. 2 — There were made separately ten serial passages in young and adult mice by intracerebral route. By crossed immunological test it was verified that the three strains were identical, and so only one was continued. 3 — The infective