Kaiser, Tobias S; Heckel, David G
2012-01-01
Circadian rhythms pre-adapt the physiology of most organisms to predictable daily changes in the environment. Some marine organisms also show endogenous circalunar rhythms. The genetic basis of the circalunar clock and its interaction with the circadian clock is unknown. Both clocks can be studied in the marine midge Clunio marinus (Chironomidae, Diptera), as different populations have different local adaptations in their lunar and diurnal rhythms of adult emergence, which can be analyzed by crossing experiments. We investigated the genetic basis of population variation in clock properties by constructing the first genetic linkage map for this species, and performing quantitative trait locus (QTL) analysis on variation in both lunar and diurnal timing. The genome has a genetic length of 167-193 centimorgans based on a linkage map using 344 markers, and a physical size of 95-140 megabases estimated by flow cytometry. Mapping the sex determining locus shows that females are the heterogametic sex, unlike most other Chironomidae. We identified two QTL each for lunar emergence time and diurnal emergence time. The distribution of QTL confirms a previously hypothesized genetic basis to a correlation of lunar and diurnal emergence times in natural populations. Mapping of clock genes and light receptors identified ciliary opsin 2 (cOps2) as a candidate to be involved in both lunar and diurnal timing; cryptochrome 1 (cry1) as a candidate gene for lunar timing; and two timeless (tim2, tim3) genes as candidate genes for diurnal timing. This QTL analysis of lunar rhythmicity, the first in any species, provides a unique entree into the molecular analysis of the lunar clock.
Kaiser, Tobias S; Neumann, Dietrich; Heckel, David G
2011-05-20
The intertidal zone of seacoasts, being affected by the superimposed tidal, diurnal and lunar cycles, is temporally the most complex environment on earth. Many marine organisms exhibit lunar rhythms in reproductive behaviour and some show experimental evidence of endogenous control by a circalunar clock, the molecular and genetic basis of which is unexplored. We examined the genetic control of lunar and diurnal rhythmicity in the marine midge Clunio marinus (Chironomidae, Diptera), a species for which the correct timing of adult emergence is critical in natural populations. We crossed two strains of Clunio marinus that differ in the timing of the diurnal and lunar rhythms of emergence. The phenotype distribution of the segregating backcross progeny indicates polygenic control of the lunar emergence rhythm. Diurnal timing of emergence is also under genetic control, and is influenced by two unlinked genes with major effects. Furthermore, the lunar and diurnal timing of emergence is correlated in the backcross generation. We show that both the lunar emergence time and its correlation to the diurnal emergence time are adaptive for the species in its natural environment. The correlation implies that the unlinked genes affecting lunar timing and the two unlinked genes affecting diurnal timing could be the same, providing an unexpectedly close interaction of the two clocks. Alternatively, the genes could be genetically linked in a two-by-two fashion, suggesting that evolution has shaped the genetic architecture to stabilize adaptive combinations of lunar and diurnal emergence times by tightening linkage. Our results, the first on genetic control of lunar rhythms, offer a new perspective to explore their molecular clockwork.
Moonlight receptor of the '1-h-midge' Clunio marinus studied by micro-XRF
International Nuclear Information System (INIS)
Falkenberg, G; Wellenreuther, G; Alraun, P; Fleissner, Ge; Fleissner, Gue; Neumann, D
2013-01-01
Melanin is a pigment widely occurring in animals, plants, fungi and algae. It does not only colour skin, hair and eyes but serves mainly as photoprotectant and prevents overload with minerals induced by inflammations, infections and degenerative diseases. Therefore, the mechanisms underlying melanisation gained increasing interest in the field of biomedical research and clinic. So far, the processes of melanogenesis are only partly analysed, nearly nothing is known on a putative switch between melanins of different types. Here we offer a model organism to study these mechanisms as part of a naturally cycling change of transparency of the retinal shielding pigment. A marine midge, Clunio marinus, living in coastal regions, underlies a complex timing of its development by solar and lunar climatic periodicities, which synchronise biological clocks. The question was how the animals can discriminate changing sunlight from moonlight intensities. For the first time, we could show a 'moonlight window' in the larval ocelli of this midge, and propose a hypothesis on the underlying mechanisms. Driven by a lunar clock the image forming ocelli become transparent and convert during moonlit nights to a sensitive photometer, which can record the dynamics of environmental light. High resolution X-ray fluorescence (XRF) measurements of the distribution of trace minerals in single melanosomes combined with their fine structural details in various states of the lunar cycle provide a first insight into the enzymatic pathways for the generation of a dark melanin (like eumelanin) and a light coloured melanin (like phaeomelanin). Essential advantage of this approach is the spatial and temporal resolution of the metals associated with melanisation processes, which could never before be demonstrated in these details. The data may stimulate further research projects in biomedicine
Dansmuggen in natuurontwikkelingsgebieden (Chironomidae)
Moller Pillot, H.K.M.
1999-01-01
Chironomidae in newly created nature reserves In a newly created nature reserve near Eindhoven many interesting species of Chironomidae were found. Several new species to the Dutch fauna were identified and one species (of the genus Neozavrelia) proved to be new to science. The fauna of these young
High Tolerance of Hydrogenothermus marinus to Sodium Perchlorate
Directory of Open Access Journals (Sweden)
Kristina Beblo-Vranesevic
2017-07-01
Full Text Available On Mars, significant amounts (0.4–0.6% of perchlorate ions were detected in dry soil by the Phoenix Wet Chemistry Laboratory and later confirmed with the Mars Science Laboratory. Therefore, the ability of Hydrogenothermus marinus, a desiccation tolerant bacterium, to survive and grow in the presence of perchlorates was determined. Results indicated that H. marinus was able to tolerate concentrations of sodium perchlorate up to 200 mM ( 1.6% during cultivation without any changes in its growth pattern. After the addition of up to 440 mM ( 3.7% sodium perchlorate, H. marinus showed significant changes in cell morphology; from single motile short rods to long cell chains up to 80 cells. Furthermore, it was shown that the known desiccation tolerance of H. marinus is highly influenced by a pre-treatment with different perchlorates; additive effects of desiccation and perchlorate treatments are visible in a reduced survival rate. These data demonstrate that thermophiles, especially H. marinus, have so far, unknown high tolerances against cell damaging treatments and may serve as model organisms for future space experiments.
The behavioural response of adult Petromyzon marinus to damage-released alarm and predator cues
Imre, István; Di Rocco, Richard; Belanger, Cowan; Brown, Grant; Johnson, Nicholas S.
2014-01-01
Using semi-natural enclosures, this study investigated (1) whether adult sea lamprey Petromyzon marinus show avoidance of damage-released conspecific cues, damage-released heterospecific cues and predator cues and (2) whether this is a general response to injured heterospecific fishes or a specific response to injured P. marinus. Ten replicate groups of 10 adult P. marinus, separated by sex, were exposed to one of the following nine stimuli: deionized water (control), extracts prepared from adult P. marinus, decayed adult P. marinus (conspecific stimuli), sympatric white sucker Catostomus commersonii, Amazon sailfin catfish Pterygoplichthys pardalis (heterospecific stimuli), 2-phenylethylamine (PEA HCl) solution, northern water snake Nerodia sipedon washing, human saliva (predator cues) and an adult P. marinus extract and human saliva combination (a damage-released conspecific cue and a predator cue). Adult P. marinus showed a significant avoidance response to the adult P. marinus extract as well as to C. commersonii, human saliva, PEA and the adult P. marinus extract and human saliva combination. For mobile P. marinus, the N. sipedon washing induced behaviour consistent with predator inspection. Exposure to the P. pardalis extract did not induce a significant avoidance response during the stimulus release period. Mobile adult female P. marinus showed a stronger avoidance behaviour than mobile adult male P. marinus in response to the adult P. marinus extract and the adult P. marinus extract and human saliva combination. The findings support the continued investigation of natural damage-released alarm cue and predator-based repellents for the behavioural manipulation of P. marinus populations in the Laurentian Great Lakes.
Chironomidae traits and life history strategies as indicators of anthropogenic disturbance.
Serra, Sónia R Q; Graça, Manuel A S; Dolédec, Sylvain; Feio, Maria João
2017-07-01
In freshwater ecosystems, Chironomidae are currently considered indicators of poor water quality because the family is often abundant in degraded sites. However, it incorporates taxa with a large ecological and physiological diversity and different sensitivity to impairment. Yet, the usual identification of Chironomidae at coarse taxonomic levels (family or subfamily) masks genus and species sensitivities. In this study, we investigate the potential of taxonomic and functional (traits) composition of Chironomidae to detect anthropogenic disturbance. In this context, we tested some a priori hypotheses regarding the ability of Chironomidae taxonomic and trait compositions to discriminate Mediterranean streams affected by multiple stressors from least-disturbed streams. Both taxonomic and Eltonian trait composition discriminated sites according to their disturbance level. Disturbance resulted in the predicted increase of Chironomidae with higher number of stages with hibernation/diapause and of taxa with resistance forms and unpredicted increase of the proportion of taxa with longer life cycles and few generations per year. Life history strategies (LHS), corresponding to multivoltine Chironomidae that do not invest in hemoglobin and lack strong spring synchronization, were well adapted to all our Mediterranean sites with highly changeable environmental conditions. Medium-size animals favored in disturbed sites where the Mediterranean hydrological regime is altered, but the reduced number of larger-size/carnivore Chironomids suggests a limitation to secondary production. Results indicate that Chironomidae genus and respective traits could be a useful tool in the structural and functional assessment of Mediterranean streams. The ubiquitous nature of Chironomidae should be also especially relevant in the assessment of water bodies naturally poor in other groups such as the Ephemeroptera, Plecoptera, and Trichoptera, such as the lowland rivers with sandy substrates, lakes
Invloed van inundatie van graslanden op terrestrische dansmuggen (Diptera: Chironomidae)
Moller Pilot, H.
2005-01-01
Influence of flooding on terrestrial chironomids in grassland (Diptera: Chironomidae) Although flooding is an important factor for the invertebrate fauna of grassland, not much is published on this topic. As in other groups the different species of terrestrial Chironomidae display different
Marsh, A G; Gauthier, J D; Vasta, G R
1995-08-01
A 3.2-kb fragment of Perkinsus marinus DNA was cloned and sequenced. A noncoding domain was identified and targeted for the development of a semiquantitative polymerase chain reaction (PCR) assay for the presence of P. marinus in eastern oyster tissues. The assay involves extracting total DNA from oyster hemolymph and using 1 microgram of that DNA as template in a stringent PCR amplification with oligonucleotide primers that are specific for the P. marinus 3.2-kb fragment. With this assay, we can detect 10 pg of total P. marinus DNA per 1 microgram of oyster hemocyte DNA with ethidium bromide (EtBr) staining of agarose gels, 100 fg total P. marinus DNA with Southern blot autoradiography, and 10 fg of total P. marinus DNA with dot-blot hybridizations. We have used the sensitivity of the PCR assay to develop a method for estimating the level of P. marinus DNA in oyster hemolymph and have successfully applied this technique to gill tissues. Our semiquantitative assay uses a dilution series to essentially titrate the point at which a P. marinus DNA target is no longer amplified in a sample. We refer to this technique as "dilution endpoint" PCR. Using hemocytes obtained by withdrawing a 1-ml sample of hemolymph, this assay provides a nondestructive methodology for rapidly screening large numbers of adult oysters for the presence and quantification of P. marinus infection levels. This technique is applicable to other tissues (gills) and could potentially be applied to DNA extracts of whole larvae or spat.
Barnett, Matthew; Imre, Istvan; Wagner, Michael C.; Di Rocco, Richard T.; Johnson, Nicholas; Brown, Grant E.
2016-01-01
Sea lampreys (Petromyzon marinus L., 1758) are nocturnal, so experiments evaluating their behaviour to chemosensory cues have typically been conducted at night. However, given the brief timeframe each year that adult P. marinus are available for experimentation, we investigated whether P. marinus exposed to a 12 h shifted diurnal cycle (reversed photoperiod) could be tested in a darkened arena during the day and show the same response to chemosensory cues as natural photoperiod P. marinus that were tested during the night. Ten replicates of 10 P. marinus, from each photoperiod, were exposed to deionized water (negative control), 2-phenylethylamine hydrochloride (PEA HCl, putative predator cue), or P. marinus whole-body extract (conspecific alarm cue). All P. marinus demonstrated a significant avoidance response to both cues. No significant differences were found in avoidance to PEA HCl between photoperiods. Avoidance of P. marinus whole-body extract was significantly stronger in natural compared with reversed photoperiod P. marinus. The use of reversed photoperiod subjects is suitable for examining the presence or absence of avoidance in response to novel chemosensory alarm cues, or the change in the magnitude of antipredator response. Studies investigating the natural magnitude of antipredator response should use natural photoperiod experimental subjects.
Critical threshold size for overwintering sandeels (Ammodytes marinus)
DEFF Research Database (Denmark)
Deurs, Mikael van; Hartvig, Martin; Steffensen, John Fleng
2011-01-01
scales with body size and increases with temperature, and the two factors together determine a critical threshold size for passive overwintering below which the organism is unlikely to survive without feeding. This is because the energetic cost of metabolism exceeds maximum energy reserves...... independent long-term overwintering experiments. Maximum attainable energy reserves were estimated from published data on A. marinus in the North Sea. The critical threshold size in terms of length (Lth) for A. marinus in the North Sea was estimated to be 9.5 cm. We then investigated two general predictions...
Chironomidae (Diptera, Chironomidae) as biological indicators of water bodies ecological condition
International Nuclear Information System (INIS)
Bakhtin, M.M.; Sejsebaev, A.T.
2002-01-01
The paper presents data confirming that Chironomidae are good to be used as an indicative criterion when classifying lakes. It was found that their quantity and presence of certain species could serve as an index in assessment of water body ecological condition. Results of cytotaxonomic analysis helped to reveal the nature of Chironomini species diversity in STS water bodies. (author)
Chironomidae bloodworms larvae as aquatic amphibian food.
Fard, Mojdeh Sharifian; Pasmans, Frank; Adriaensen, Connie; Laing, Gijs Du; Janssens, Geert Paul Jules; Martel, An
2014-01-01
Different species of chironomids larvae (Diptera: Chironomidae) so-called bloodworms are widely distributed in the sediments of all types of freshwater habitats and considered as an important food source for amphibians. In our study, three species of Chironomidae (Baeotendipes noctivagus, Benthalia dissidens, and Chironomus riparius) were identified in 23 samples of larvae from Belgium, Poland, Russia, and Ukraine provided by a distributor in Belgium. We evaluated the suitability of these samples as amphibian food based on four different aspects: the likelihood of amphibian pathogens spreading, risk of heavy metal accumulation in amphibians, nutritive value, and risk of spreading of zoonotic bacteria (Salmonella, Campylobacter, and ESBL producing Enterobacteriaceae). We found neither zoonotic bacteria nor the amphibian pathogens Ranavirus and Batrachochytrium dendrobatidis in these samples. Our data showed that among the five heavy metals tested (Hg, Cu, Cd, Pb, and Zn), the excess level of Pb in two samples and low content of Zn in four samples implicated potential risk of Pb accumulation and Zn inadequacy. Proximate nutritional analysis revealed that, chironomidae larvae are consistently high in protein but more variable in lipid content. Accordingly, variations in the lipid: protein ratio can affect the amount and pathway of energy supply to the amphibians. Our study indicated although environmentally-collected chironomids larvae may not be vectors of specific pathogens, they can be associated with nutritional imbalances and may also result in Pb bioaccumulation and Zn inadequacy in amphibians. Chironomidae larvae may thus not be recommended as single diet item for amphibians. © 2014 Wiley Periodicals, Inc.
Distribution of Chironomidae in a semiarid intermittent river of Brazil.
Farias, R L; Carvalho, L K; Medeiros, E S F
2012-12-01
The effects of the intermittency of water flow on habitat structure and substrate composition have been reported to create a patch dynamics for the aquatic fauna, mostly for that associated with the substrate. This study aims to describe the spatial distribution of Chironomidae in an intermittent river of semiarid Brazil and to associate assemblage composition with environmental variables. Benthic invertebrates were sampled during the wet and dry seasons using a D-shaped net (40 cm wide and 250 μm mesh), and the Chironomidae were identified to genus level. The most abundant genera were Tanytarsus, Polypedilum, and Saetheria with important contributions of the genera Procladius, Aedokritus, and Dicrotendipes. Richness and density were not significantly different between the study sites, and multiple regression showed that the variation in richness and density explained by the environmental variables was significant only for substrate composition. The composition of genera showed significant spatial segregation across the study sites. Canonical Correspondence Analysis showed significant correspondence between Chironomidae composition and the environmental variables, with submerged vegetation, elevation, and leaf litter being important predictors of the Chironomidae fauna. This study showed that Chironomidae presented important spatial variation along the river and that this variation was substantially explained by environmental variables associated with the habitat structure and river hierarchy. We suggest that the observed spatial segregation in the fauna results in the high diversity of this group of organisms in intermittent streams.
International Nuclear Information System (INIS)
Queiroga, Fernando Ramos; Marques-Santos, Luis Fernando; Hégaret, Hélène; Sassi, Roberto; Farias, Natanael Dantas; Santana, Lucas Nunes
2017-01-01
Highlights: • Synechocystis cyanobacteria cause functional weakness of oysters haemocytes. • Synechocystis cyanobacteria cause a strengthening of Perkinsus marinus. • Synechocystis cyanobacteria may contribute to an imbalance of P. marinus–Crassostrea gasar relationship. - Abstract: Perkinsosis is a disease caused by protozoan parasites from the Perkinsus genus. In Brazil, two species, P. beihaiensis and P. marinus, are frequently found infecting native oysters (Crassostrea gasar and C. rhizophorae) from cultured and wild populations in several states of the Northeast region. The impacts of this disease in bivalves from Brazil, as well as the interactions with environmental factors, are poorly studied. In the present work, we evaluated the in vitro effects of the cyanobacteria Synechocystis spp. on trophozoites of P. marinus and haemocytes of C. gasar. Four cyanobacteria strains isolated from the Northeast Brazilian coast were used as whole cultures (WCs) and extracellular products (ECPs). Trophozoites of P. marinus were exposed for short (4 h) and long (48 h and 7 days, the latter only for ECPs) periods, while haemocytes were exposed for a short period (4 h). Cellular and immune parameters, i.e. cell viability, cell count, reactive oxygen species production (ROS) and phagocytosis of inert (latex beads) and biological particles (zymosan and trophozoites of P. marinus) were measured by flow cytometry. The viability of P. marinus trophozoites was improved in response to WCs of Synechocystis spp., which could be a beneficial effect of the cyanobacteria providing nutrients and reducing reactive oxygen species. Long-term exposure of trophozoites to ECPs of cyanobacteria did not modify in vitro cell proliferation nor viability. In contrast, C. gasar haemocytes showed a reduction in cell viability when exposed to WCs, but not to ECPs. However, ROS production was not altered. Haemocyte ability to engulf latex particles was reduced when exposed mainly to ECPs of
Energy Technology Data Exchange (ETDEWEB)
Queiroga, Fernando Ramos [Laboratório de Imunologia e Patologia de Invertebrados (LABIPI), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Marques-Santos, Luis Fernando [Laboratório de Biologia Celular e do Desenvolvimento (LABID), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Hégaret, Hélène [Laboratoire des Sciences de l' Environnement Marin (LEMAR), UMR 6539 CNRS UBO IRD IFREMER, Institut Universitaire Européen de la Mer, Technopôle Brest-Iroise, 29280, Plouzané (France); Sassi, Roberto [Laboratório de Ambientes Recifais e Biotecnologia de Microalgas (LARBIM), Departamento de Sistemática e Ecologia, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Farias, Natanael Dantas; Santana, Lucas Nunes [Laboratório de Imunologia e Patologia de Invertebrados (LABIPI), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); and others
2017-06-15
Highlights: • Synechocystis cyanobacteria cause functional weakness of oysters haemocytes. • Synechocystis cyanobacteria cause a strengthening of Perkinsus marinus. • Synechocystis cyanobacteria may contribute to an imbalance of P. marinus–Crassostrea gasar relationship. - Abstract: Perkinsosis is a disease caused by protozoan parasites from the Perkinsus genus. In Brazil, two species, P. beihaiensis and P. marinus, are frequently found infecting native oysters (Crassostrea gasar and C. rhizophorae) from cultured and wild populations in several states of the Northeast region. The impacts of this disease in bivalves from Brazil, as well as the interactions with environmental factors, are poorly studied. In the present work, we evaluated the in vitro effects of the cyanobacteria Synechocystis spp. on trophozoites of P. marinus and haemocytes of C. gasar. Four cyanobacteria strains isolated from the Northeast Brazilian coast were used as whole cultures (WCs) and extracellular products (ECPs). Trophozoites of P. marinus were exposed for short (4 h) and long (48 h and 7 days, the latter only for ECPs) periods, while haemocytes were exposed for a short period (4 h). Cellular and immune parameters, i.e. cell viability, cell count, reactive oxygen species production (ROS) and phagocytosis of inert (latex beads) and biological particles (zymosan and trophozoites of P. marinus) were measured by flow cytometry. The viability of P. marinus trophozoites was improved in response to WCs of Synechocystis spp., which could be a beneficial effect of the cyanobacteria providing nutrients and reducing reactive oxygen species. Long-term exposure of trophozoites to ECPs of cyanobacteria did not modify in vitro cell proliferation nor viability. In contrast, C. gasar haemocytes showed a reduction in cell viability when exposed to WCs, but not to ECPs. However, ROS production was not altered. Haemocyte ability to engulf latex particles was reduced when exposed mainly to ECPs of
Chong, Isaac K W; Ho, Wing S
2013-09-01
Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) is known to interact with different biomolecules and was implicated in many novel cellular activities including programmed cell death, nuclear RNA transport unrelated to the commonly known carbohydrate metabolism. We reported here the purification of GAPDH from Chironomidae larvae (Insecta, Diptera) that showed different biologic activity towards heavy metals. It was inhibited by copper, cobalt nickel, iron and lead but was activated by zinc. The GAPDH was purified by ammonium sulphate fractionation and Chelating Sepharose CL-6B chromatography followed by Blue Sepharose CL-6B chromatography. The 150-kDa tetrameric GAPDH showed optimal activity at pH 8.5 and 37°C. The multiple alignment of sequence of the Chironomidae GAPDH with other known species showed 78 - 88% identity to the conserved regions of the GADPH. Bioinformatic analysis unveils substantial N-terminal sequence similarity of GAPDH of Chironomidae larvae to mammalian GADPHs. However, the GADPH of Chironomidae larvae showed different biologic activities and cytotoxicity towards heavy metals. The GAPDH enzyme would undergo adaptive molecular changes through binding at the active site leading to higher tolerance to heavy metals.
[Pilot-scale purification of lipopeptide from marine-derived Bacillus marinus].
Gu, Kangbo; Guan, Cheng; Xu, Jiahui; Li, Shulan; Luo, Yuanchan; Shen, Guomin; Zhang, Daojing; Li, Yuanguang
2016-11-25
This research was aimed at establishing the pilot-scale purification technology of lipopeptide from marine-derived Bacillus marinus. We studied lipopeptide surfactivity interferences on scale-up unit technologies including acid precipitation, methanol extraction, solvent precipitation, salting out, extraction, silica gel column chromatography and HZ806 macroporous absorption resin column chromatography. Then, the unit technologies were combined in a certain order, to remove the impurities gradually, and to gain purified lipopeptide finally, with high recovery rate throughout the whole process. The novel pilot-scale purification technology could effectively isolate and purify lipopeptide with 87.51% to 100% purity in hectograms from 1 ton of Bacillus marinus B-9987 fermentation broth with more than 81.73% recovery rate. The first practical hectogram production of highly purified lipopeptide derived from Bacillus marinus was achieved. With this new purification method, using complex media became possible in fermentation process to reduce the fermentation cost and scale-up the purification for lipopeptide production. For practicability and economy, foaming problem resulting from massive water evaporation was avoided in this technology.
The oyster protozoan parasite, Perkinsus marinus, is one of the two important parasites causing severe mortality in the eastern oysters (Crassostrea virginica) on the US east coast. Our recent study suggests that P. marinus cells and its extracellular products (ECP) could scaveng...
Tlili, Sofiène; Ovaert, Julien; Souissi, Anissa; Ouddane, Baghdad; Souissi, Sami
2016-02-01
Pseudodiaptomus marinus is a marine calanoid copepod originating of the Indo-Pacific region, who has successfully colonized new areas and it was recently observed in the European side of the Mediterranean Sea as well as in the North Sea. Actually, many questions were posed about the invasive capacity of this copepod in several non-native ecosystems. In this context, the main aim of this study was to investigate the tolerance and the bioaccumulation of metallic stress in the invasive copepod P. marinus successfully maintained in mass culture at laboratory conditions since 2 years. In order to study the metallic tolerance levels of P. marinus, an emergent trace metal, the nickel, was chosen. First, lethal concentrations determination experiments were done for 24, 48, 72 and 96 h in order to calculated LC50% but also to select a relevant ecological value for the suite of experiments. Then, three types of experiments, using a single concentration of nickel (correspond the 1/3 of 96 h-LC50%) was carried in order to study the toxico-kinetics of nickel in P. marinus. Concerning lethal concentrations, we observed that P. marinus was in the same range of sensitivity compared to other calanoid copepods exposed to nickel in the same standardized experimental conditions. Results showed that the uptake of nickel in P. marinus depends from the pathways of entrance (water of food), but also that Isochrysis galbana, used as a food source, has an important bioaccumulation capacity and a rapid uptake of nickel. Copyright © 2015 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Anderson, iain J.; Dharmarajan, Lakshmi; Rodriguez, Jason; Hooper, Sean; Porat, Iris; Ulrich, Luke E.; Elkins, James G.; Mavromatis, Kostas; Sun, Hui; Land, Miriam; Lapidus, Alla; Lucas, Susan; Barry, Kerrie; Huber, Harald; Zhulin, Igor B.; Whitman, William B.; Mukhopadhyay, Biswarup; Woese, Carl; Bristow, James; Kyrpides, Nikos
2008-09-05
Staphylothermus marinus is an anaerobic, sulfur-reducing peptide fermenter of the archaeal phylum Crenarchaeota. It is the third heterotrophic, obligate sulfur reducing crenarchaeote to be sequenced and provides an opportunity for comparative analysis of the three genomes. The 1.57 Mbp genome of the hyperthermophilic crenarchaeote Staphylothermus marinus has been completely sequenced. The main energy generating pathways likely involve 2-oxoacid:ferredoxin oxidoreductases and ADP-forming acetyl-CoA synthases. S. marinus possesses several enzymes not present in other crenarchaeotes including a sodium ion-translocating decarboxylase likely to be involved in amino acid degradation. S. marinus lacks sulfur-reducing enzymes present in the other two sulfur-reducing crenarchaeotes that have been sequenced - Thermofilum pendens and Hyperthermus butylicus. Instead it has three operons similar to the mbh and mbx operons of Pyrococcus furiosus, which may play a role in sulfur reduction and/or hydrogen production. The two marine organisms, S. marinus and H. butylicus, possess more sodium-dependent transporters than T. pendens and use symporters for potassium uptake while T. pendens uses an ATP-dependent potassium transporter. T. pendens has adapted to a nutrient-rich environment while H. butylicus is adapted to a nutrient-poor environment, and S. marinus lies between these two extremes. The three heterotrophic sulfur-reducing crenarchaeotes have adapted to their habitats, terrestrial vs. marine, via their transporter content, and they have also adapted to environments with differing levels of nutrients. Despite the fact that they all use sulfur as an electron acceptor, they are likely to have different pathways for sulfur reduction.
DEFF Research Database (Denmark)
Brodersen, Klaus Peter; Lindegaard, C.
1999-01-01
Corynocera ambigua, Chironomidae, zoobenthos, charophytes, palaeolimnology, late-glacial, Denmark......Corynocera ambigua, Chironomidae, zoobenthos, charophytes, palaeolimnology, late-glacial, Denmark...
Opmerkingen over nomenklatuur en determinatie van Chironomidae
Moller Pillot, H.K.M.
1990-01-01
In het onderstaande worden enkele aanvullingen gegeven op de determinatietabellen voor larven van Nederlandse Chironomidae (Moller Pillot, 1984a; 1984b). Tanypodinae Tanypus. Imagines van T. kraatzi en T. punctipennis zijn tot op heden door iedereen onjuist gedetermineerd. Fittkau zal het enige
Thyroid anatomy and topography of toad (Bufo marinus ictericus)
International Nuclear Information System (INIS)
Santos, O.R. dos.
1970-01-01
The autoradiographic method is used for the study of the toad's thyroid of Bufo marinus ictericus by 131 I. Histolological proceedings are done. Comparative evaluations with bibliographic informations are presented. (M.A.C.) [pt
As the agent of Dermo disease, Perkinsus marinus causes significant mortality and reduced fecundity in host populations. Passive dispersal of P. marinus between hosts subjects parasite movements to control by water currents in estuarine systems, potentially limiting connectivity among parasite popul...
Hibernal Emergence of Chironomidae in Ukraine
Directory of Open Access Journals (Sweden)
Viktor Baranov
2013-12-01
Full Text Available Twenty-seven species of Chironomidae were detected emerging in the Crimea during the period from December 2010 to March 2013. Twenty-three are Orthocladiinae and 4 are Chironominae (one Chironomini and three Tanytarsini species. Nine species are recorded for the first time in Crimea. At the genus-level the hibernal emergence in Crimea shows resemblance to the patterns reported for streams in Kansas.
Directory of Open Access Journals (Sweden)
Andrzej Kownacki
2015-07-01
Full Text Available The paper reports on the value of scanning electron microscopy (SEM in the taxonomy and morphology of Chironomidae. This method has been relatively rarely used in Chironomidae studies. Our studies suggest that the SEM method provides a lot of new information. For example, the plastron plate of the thoracic horn of Macropelopia nebulosa (Meigen under light microscopy is visible as points, while under SEM we have found that it consists of a reticular structure with holes. By using SEM a more precise picture of the body structure of Chironomidae can be revealed. It allows researchers to explain inconsistencies in the existing descriptions of species. Another advantage of the SEM method is obtaining spatial images of the body and organs of Chironomidae. However, the SEM method also has some limitations. The main problem is dirt or debris (e.g. algae, mud, secretions, mucus, bacteria, etc., which often settles on the external surface of structures, especially those which are uneven or covered with hair. The dirt should be removed after collection of chironomid material because if left in place it can become chemically fixed to various surfaces. It unnecessarily remains at the surface and final microscopic images may contain artifacts that obscure chironomid structures being investigated. In this way many details of the surface are thus unreadable. The results reported here indicate that SEM examination helps us to identify new morphological features and details that will facilitate the identification of species of Chironomidae and may help to clarify the function of various parts of the body. Fast development of electron microscope technique allows us to learn more about structure of different organisms.
IgG and IgE antibodies to Chironomidae in asthmatic patients.
Yamashita, N; Ito, K; Nakagawa, T; Haida, M; Okudaira, H; Nakada, S; Miyamoto, T; Shibuya, T; Kamei, K; Sasa, M
1987-01-01
IgG antibodies to Chironomidae and its correlations to radioallergosorbent and skin reactions were examined with the aim of clarifying the relationship between asthma and Chironomidae. The level of specific IgG antibody in asthmatic patients (0.698 +/- 0.034, n = 104) was significantly greater than that in normal subjects (0.367 +/- 0.032, n = 52) (P less than 0.01). The specific IgG level was not correlated to skin reaction, nor to IgE RAST scores. Specific IgG1 and IgG4 levels in asthmatic patients were significantly greater than in control subjects (n = 14) (P less than 0.01). Images Fig. 5 PMID:3652516
Ek-Huchim, Juan Pablo; Aguirre-Macedo, Ma Leopoldina; Améndola-Pimenta, Monica; Vidal-Martínez, Victor Manuel; Pérez-Vega, Juan Antonio; Simá-Alvarez, Raúl; Jiménez-García, Isabel; Zamora-Bustillos, Roberto; Rodríguez-Canul, Rossanna
2017-08-02
The protozoan Perkinsus marinus (Mackin, Owen & Collier) Levine, 1978 causes perkinsosis in the American oyster Crassostrea virginica Gmelin, 1791. This pathogen is present in cultured C. virginica from the Gulf of Mexico and has been reported recently in Saccostrea palmula (Carpenter, 1857), Crassostrea corteziensis (Hertlein, 1951) and Crassostrea gigas (Thunberg, 1793) from the Mexican Pacific coast. Transportation of fresh oysters for human consumption and repopulation could be implicated in the transmission and dissemination of this parasite across the Mexican Pacific coast. The aim of this study was two-fold. First, we evaluated the P. marinus infection parameters by PCR and RFTM (Ray's fluid thioglycollate medium) in C. virginica from four major lagoons (Términos Lagoon, Campeche; Carmen-Pajonal-Machona Lagoon complex, Tabasco; Mandinga Lagoon, Veracruz; and La Pesca Lagoon, Tamaulipas) from the Gulf of Mexico. Secondly, we used DNA sequence analyses of the ribosomal non-transcribed spacer (rNTS) region of P. marinus to determine the possible translocation of this species from the Gulf of Mexico to the Mexican Pacific coast. Perkinsus marinus prevalence by PCR was 57.7% (338 out of 586 oysters) and 38.2% (224 out of 586 oysters) by RFTM. The highest prevalence was observed in the Carmen-Pajonal-Machona Lagoon complex in the state of Tabasco (73% by PCR and 58% by RFTM) and the estimated weighted prevalence (WP) was less than 1.0 in the four lagoons. Ten unique rDNA-NTS sequences of P. marinus [termed herein the "P. marinus (Pm) haplotype"] were identified in the Gulf of Mexico sample. They shared 96-100% similarity with 18 rDNA-NTS sequences from the GenBank database which were derived from 16 Mexican Pacific coast infections and two sequences from the USA. The phylogenetic tree and the haplotype network showed that the P. marinus rDNA-NTS sequences from Mexico were distant from the rDNA-NTS sequences of P. marinus reported from the USA. The ten r
Longitudinal distribution of Chironomidae (Diptera) downstream from a dam in a neotropical river.
Pinha, G D; Aviz, D; Lopes Filho, D R; Petsch, D K; Marchese, M R; Takeda, A M
2013-08-01
The damming of a river causes dangerous consequences on structure of the environment downstream of the dam, modifying the sediment composition, which impose major adjustments in longitudinal distribution of benthic community. The construction of Engenheiro Sérgio Motta Dam in the Upper Paraná River has caused impacts on the aquatic communities, which are not yet fully known. This work aimed to provide more information about the effects of this impoundment on the structure of Chironomidae larvae assemblage. The analysis of data of physical and chemical variables in relation to biological data of 8 longitudinal sections in the Upper Paraná River showed that composition of Chironomidae larvae of stations near Engenheiro Sérgio Motta Dam differed of the other stations (farther of the Dam). The predominance of coarse sediments at stations upstream and finer sediments further downstream affected the choice of habitat by different morphotypes of Chironomidae and it caused a change in the structure of this assemblage in the longitudinal stretch.
Chironomid midges (Diptera, chironomidae) show extremely small genome sizes.
Cornette, Richard; Gusev, Oleg; Nakahara, Yuichi; Shimura, Sachiko; Kikawada, Takahiro; Okuda, Takashi
2015-06-01
Chironomid midges (Diptera; Chironomidae) are found in various environments from the high Arctic to the Antarctic, including temperate and tropical regions. In many freshwater habitats, members of this family are among the most abundant invertebrates. In the present study, the genome sizes of 25 chironomid species were determined by flow cytometry and the resulting C-values ranged from 0.07 to 0.20 pg DNA (i.e. from about 68 to 195 Mbp). These genome sizes were uniformly very small and included, to our knowledge, the smallest genome sizes recorded to date among insects. Small proportion of transposable elements and short intron sizes were suggested to contribute to the reduction of genome sizes in chironomids. We discuss about the possible developmental and physiological advantages of having a small genome size and about putative implications for the ecological success of the family Chironomidae.
De Larven der Nederlandse Chironomidae (Diptera) : Orthocladiinae sensu lato
Moller Pillot, H.K.M.
1984-01-01
Systematiek De indeling van de Orthocladiinae levert zo mogelijk nog meer problemen op dan die van de andere subfamilies van de Chironomidae. Momenteel is het algemeen gebruikelijk de groep in vier subfamilies te splitsen: Diamesinae, Prodiamesinae, Orthocladiinae en Telmatogetoninae (zie bijv.
Diversity of Aplochiton fishes (Galaxiidea and the taxonomic resurrection of A. marinus.
Directory of Open Access Journals (Sweden)
Dominique Alò
Full Text Available Aplochiton is a small genus of galaxiid fishes endemic to Patagonia and the Falkland Islands whose taxonomy is insufficiently resolved. Recent genetic analyses confirmed the existence of only two closely related species, Aplochiton taeniatus and Aplochiton zebra, while a third controversial species, Aplochiton marinus, remained lost to synonymy with A. taeniatus. Using an integrative taxonomy framework, we studied original samples and published sequences from a broad range in western Patagonia and the Falkland Islands, and generated robust species hypotheses based on single-locus (Cytochrome Oxidase subunit I; COI species-delineation methods and known diagnostic morphological characters analyzed in a multivariate context. Results revealed three distinct evolutionary lineages that morphologically resemble, in important respects, existing nominal species descriptions. Interestingly, the lineage associated with A. marinus was unambiguously identifiable (100% accuracy both from the genetic and morphological viewpoints. In contrast, the morphology of A. taeniatus and A. zebra overlapped substantially, mainly due to the high variability of A. taeniatus. Discriminant function analysis aided the identification of these species with 83.9% accuracy. Hence, for their unambiguous identification, genetic screening is needed. A. marinus has seldom been documented, and when recorded, it has always been found in sites with clear marine influence. It is possible that only A. marinus preserves a life cycle related to the sea akin to the hypothesized ancestral galaxiid. We did not find evidence of claimed diadromy in A. taeniatus or A. zebra, and, therefore, these should be regarded as freshwater species. Finally, a lack of phylogeographic patterns and overrepresentation of uncommon haplotypes suggested demographic expansions in recent evolutionary time, especially of A. zebra, in line with the hypothesis of large-scale range expansion and lineage spread in
Chironomidae and Oligochaeta for water quality evaluation in an urban river in southeastern Brazil.
Rosa, Beatriz Jabour Figueiraujo Vescovi; Rodrigues, Luciana Falci Theza; de Oliveira, Gilmar Simões; da Gama Alves, Roberto
2014-11-01
Considering the importance of benthic macroinvertebrates for diagnosis of variations in the ecological conditions of aquatic habitats, the aim of this study was to investigate the structure of the Chironomidae and Oligochaeta assemblages along an organic pollution gradient. The fauna specimens were obtained with the use of artificial substrates, and the environmental variables were recorded at five sites of the São Lourenço River, during 12 months. Metrics of the assemblage and detrended correspondence analysis were used to verify the response of the fauna to the pollution gradient. Procrustes analysis was used to verify whether the data on the Chironomidae and Oligochaeta assemblages, as well as the taxonomic and numerical resolution of these groups, provide similar results in relation to the pollution gradient. The richness, evenness, and taxonomic composition of the Chironomidae and Oligochaeta assemblages varied significantly among the collection sites, with distinct conservation conditions. Genera of the subfamilies Orthocladiinae and Tanypodinae were associated with the sites upstream of the urban area, where the dissolved oxygen levels are higher. Species of Oligochaeta and the genus Chironomus were associated with more organically polluted sites. No concordance was observed in the response of the Chironomidae and Oligochaeta assemblages in relation to the environmental variables, indicating the need to use both groups in biomonitoring studies. On the other hand, both the data on composition (presence or absence) and those on the lowest taxonomic resolution (abundance of subfamilies) were effective to diagnose the pollution gradient in the river studied. Therefore, when the environmental conditions along a river's gradient are contrasting, we suggest the use of the lowest taxonomic resolution of Chironomidae and Oligochaeta in biomonitoring. That procedure considerably reduces the assessment time, besides being a method that can be used by people not
Diel drift of Chironomidae larvae in a pristine Idaho mountain stream
Tilley, L.J.
1989-01-01
Simultaneous hourly net collections in a meadow and canyon reach of a mountain stream determined diel and spatial abundances of drifting Chironomidae larvae. Sixty-one taxa were identified to the lowest practical level, 52 in the meadow and 41 in the canyon. Orthocladiinae was the most abundant subfamily with 32 taxa and a 24 h mean density of 294 individuals 100 m-3 (meadow) and 26 taxa and a mean of 648 individuals 100 m-3 (canyon). Chironominae was the second most abundant subfamily. Nonchironomid invertebrates at both sites and total Chironomidae larvae (meadow) were predominantly night-drifting. Parakiefferiella and Psectrocladius were day-drifting (meadow) whereas 8 other chironomid taxa (meadow) and 2 taxa (canyon) were night-drifting. All others were aperiodic or too rare to test periodicity, Stempellinella cf brevis Edwards exhibited catastrophic drift in the canyon only. The different drift patterns between sites is attributed to greater loss of streambed habitat in the canyon compared to the meadow as streamflow decreased. Consequent crowding of chironomid larvae in the canyon caused catastrophic drift or interfered with drift periodicty. This study adds to knowledge of Chironomidae drift and shows influences on drift of hydrologic and geomorphic conditions. ?? 1989 Kluwer Academic Publishers.
De larven der Nederlandse Chironomidae (Diptera) : Inleiding, Tanypodinae & Chironomini
Moller Pillot, H.K.M.
1984-01-01
This first part of 'The larvae of the Dutch Chironomidae' deals with the larvae of Tanypodinae and Chironomini. In chapter I an introduction is given to sampling and handling of chironomid larvae. In chapter II their general morphology and development are described, followed by a key to the
Evaluating potential sources of variation in Chironomidae catch rates on sticky traps
Smith, Joshua T.; Muehlbauer, Jeffrey D.; Kennedy, Theodore A.
2016-01-01
Sticky traps are a convenient tool for assessing adult aquatic insect population dynamics, but there are many practical questions about how trap sampling artefacts may affect observed results. Utilising study sites on the Colorado River and two smaller streams in northern Arizona, USA, we evaluated whether catch rates and sex ratios of Chironomidae, a ubiquitous aquatic insect, were affected by spraying traps with insecticide, placing traps at different heights above ground, and placing traps at different locations within a terrestrial habitat patch. We also evaluated temporal variation in Chironomidae counts monthly over a 9-month growing season. We found no significant variation in catch rates or sex ratios between traps treated versus untreated with insecticide, nor between traps placed at the upstream or downstream end of a terrestrial habitat patch. Traps placed near ground level did have significantly higher catch rates than traps placed at 1.5 m, although sex ratios were similar across heights. Chironomidae abundance and sex ratios also varied from month-to-month and seemed to be related to climatic conditions. Our results inform future sticky trap studies by demonstrating that trap height, but not insecticide treatment or precise trap placement within a habitat patch, is an important source of variation influencing catch rates.
Directory of Open Access Journals (Sweden)
Mariano Donato
2009-06-01
Full Text Available La familia Chironomidae (Diptera: Nematocera es uno de los grupos de insectos más ampliamente distribuidos y abundantes en cuerpos de agua dulce. Los representantes de esta familia pueden explotar áreas con amplios gradientes ambientales. La información que se presenta está basada en la recopilación de datos distribucionales bibliográficos, del estudio del material tipo de las especies de Chironomidae depositadas en el Natural History Museum (UK y del material de colección del Museo de La Plata (Argentina. En la Patagonia, se registran 9 subfamilias, la subfamilia monotípica Chilenomyiinae es endémica de esta área. Dentro de estas subfamilias, 53 de los 111 géneros conocidos para América del Sur están presentes en la Patagonia. Del total de géneros de la Patagonia, el 20 % es endémico y 7 de ellos muestran relaciones transantárticas. En la Patagonia, se registran 177 especies de Chironomidae, el 98% de éstas son endémicas, el 3 % son consideradas nomina dubia y el 17% requiere revisión ya que su ubicación sistemática es dudosa. Las descripciones originales de las especies patagónicas de Chironomidae están basadas principalmente sobre machos (n=58 y machos y hembras (n=43, ambas representan el 57% del total; el resto de las especies han sido descriptas con diferentes combinaciones de estadios del ciclo de desarrollo.The Chironomidae (Diptera: Nematocera family is one of the most widely distributed group of insects and often the most abundant in freshwater environments. Representatives of this family can exploit a wide range of environmental gradients. The information here presented is based on the compilation of distributional data obtained from bibliography, the study of the type material deposited in the Natural History Museum (UK and the collection material from Museo de La Plata (Argentina. Nine subfamilies are recorded from Patagonia, being the monotypic subfamily Chilenomyiinae endemic for the area. From the 111 known
IN VITRO KILLING OF PERKINSUS MARINUS BY HEMOCYTES OF OYSTERS CRASSOSTREA VIRGINICA
A colorimetric microbicidal assay was adapted, optimized and applied in experiments to characterize the in vitro capacity of eastern oyster (Crassostrea virginica) hemocytes to kill cultured isolates of Perkinsus marinus, a protozoan parasite causing a highly destructive disease...
da Silva, Patricia Mirella; Vianna, Rogério Tubino; Guertler, Cristhiane; Ferreira, Liana Pinho; Santana, Lucas Nunes; Fernández-Boo, Sergio; Ramilo, Andrea; Cao, Asunción; Villalba, Antonio
2013-05-01
The present work aimed to study the infection by Perkinsus sp. in the mangrove oysters Crassostrea rhizophorae from the estuary of the Paraíba River (Paraíba State, Brazil). Perkinsosis was detected by incubation of oyster gill pieces in Ray's fluid thioglycollate medium. The monthly prevalence values were all above 70%, thus infection was not likely to be a transient event. Perkinsus sp. parasites isolated from eight oysters were propagated in vitro. PCR-RFLP analysis of in vitro cultured cells as well as the sequences of the rDNA ITS region allowed the identification of the in vitro propagated parasites as Perkinsus marinus. Phylogenetic analyses using rDNA ITS region sequences strongly supported the Perkinsus sp. from Paraíba in a monophyletic group with P. marinus. Thus, the results confirmed the species affiliation of Paraíba Perkinsus sp. as P. marinus. This is the first report of P. marinus in Brazil and South America and the first report of P. marinus naturally infecting C. rhizophorae. Copyright © 2013 Elsevier Inc. All rights reserved.
Manzon, Lori A; Youson, John H; Holzer, Guillaume; Staiano, Leopoldo; Laudet, Vincent; Manzon, Richard G
2014-08-01
Sea lampreys (Petromyzon marinus) are members of the ancient class Agnatha and undergo a metamorphosis that transforms blind, sedentary, filter-feeding larvae into free-swimming, parasitic juveniles. Thyroid hormones (THs) appear to be important for lamprey metamorphosis, however, serum TH concentrations are elevated in the larval phase, decline rapidly during early metamorphosis and remain low until metamorphosis is complete; these TH fluctuations are contrary to those of other metamorphosing vertebrates. Moreover, thyroid hormone synthesis inhibitors (goitrogens) induce precocious metamorphosis and exogenous TH treatments disrupt natural metamorphosis in P. marinus. Given that THs exert their effects by binding to TH nuclear receptors (TRs) that often act as heterodimers with retinoid X receptors (RXRs), we cloned and characterized these receptors from P. marinus and examined their expression during metamorphosis. Two TRs (PmTR1 and PmTR2) and three RXRs (PmRXRs) were isolated from P. marinus cDNA. Phylogenetic analyses group the PmTRs together on a branch prior to the gnathostome TRα/β split. The three RXRs also group together, but our data indicated that these transcripts are most likely either allelic variants of the same gene locus, or the products of a lamprey-specific duplication event. Importantly, these P. marinus receptors more closely resemble vertebrate as opposed to invertebrate chordate receptors. Functional analysis revealed that PmTR1 and PmTR2 can activate transcription of TH-responsive genes when treated with nanomolar concentrations of TH and they have distinct pharmacological profiles reminiscent of vertebrate TRβ and TRα, respectively. Also similar to other metamorphosing vertebrates, expression patterns of the PmTRs during lamprey metamorphosis suggest that PmTR1 has a dynamic, tissue-specific expression pattern that correlates with tissue morphogenesis and biochemical changes and PmTR2 has a more uniform expression pattern. This TR
Directory of Open Access Journals (Sweden)
Thiago Ramos Pinto
2017-01-01
Full Text Available This study reports the presence of the pathogen Perkinsus marinus, notifiable to the World Organization for Animal Health (Office International des Èpizooties = OIE in the oyster Crassostrea rhizophorae in southern Bahia via proteomic analysis. We analyzed Crassostrea brasiliana from a long-line cultivation system and C. rhizophorae from an adjacent mangrove in Porto do Campo, Camamu Bay, Bahia, Brazil. The collections (n = 100 were performed in October 2012. In the laboratory, the oysters were measured and opened to remove the meat, which was steeped in dry ice. For extraction of proteins, adaptation of a protocol used for mussels was used, after which separation in the first dimension was taken by isoelectric focusing (IEF. The peptides were transferred to a Mass Spectrometer. The obtained spectra were analyzed with the ProteinLynx Global Server 4.2 software tool and also by MASCOT (Matrix Science and compared to the databases of the SWISSPROT and NCBI, respectively. The identification was evidenced by beta-tubulin, Perkinsus marinus ATCC 50983 and protein homology code in the database NCBI = gi | 294889481. This is the first record of P. marinus in Bahia and the fourth in Brazil.
Directory of Open Access Journals (Sweden)
Wathsala Wijayalath
Full Text Available Perkinsus marinus (Phylum Perkinsozoa is a marine protozoan parasite responsible for "Dermo" disease in oysters, which has caused extensive damage to the shellfish industry and estuarine environment. The infection prevalence has been estimated in some areas to be as high as 100%, often causing death of infected oysters within 1-2 years post-infection. Human consumption of the parasites via infected oysters is thus likely to occur, but to our knowledge the effect of oral consumption of P. marinus has not been investigated in humans or other mammals. To address the question we used humanized mice expressing HLA-DR4 molecules and lacking expression of mouse MHC-class II molecules (DR4.EA(0 in such a way that CD4 T cell responses are solely restricted by the human HLA-DR4 molecule. The DR4.EA(0 mice did not develop diarrhea or any detectable pathology in the gastrointestinal tract or lungs following single or repeated feedings with live P. marinus parasites. Furthermore, lymphocyte populations in the gut associated lymphoid tissue and spleen were unaltered in the parasite-fed mice ruling out local or systemic inflammation. Notably, naïve DR4.EA(0 mice had antibodies (IgM and IgG reacting against P. marinus parasites whereas parasite specific T cell responses were undetectable. Feeding with P. marinus boosted the antibody responses and stimulated specific cellular (IFNγ immunity to the oyster parasite. Our data indicate the ability of P. marinus parasites to induce systemic immunity in DR4.EA(0 mice without causing noticeable pathology, and support rationale grounds for using genetically engineered P. marinus as a new oral vaccine platform to induce systemic immunity against infectious agents.
Silveira, L S; Rosa, B F J V; Gonçalves, E A; Alves, R G
2015-10-01
Studies on mesohabitat scale have been used to shed light on the ecology and distribution of chironomid larvae in small streams. Thus, the objective of the present study was to examine the diversity and distribution of the Chironomidae assemblage on the mesohabitat scale in three streams located in different preserved areas of southeastern Brazil. In each stream, litter samples were obtained in the dry season of 2010 in ten pools and ten riffles with a Surber sampler (area 0.04 m(2); mesh size 0.21 mm). The abundance was similar among streams and between mesohabitats, while the estimated richness was highest in riffles. There was a difference in the composition of the Chironomidae assemblages between the mesohabitats, although the litter composition was similar between them, indicating the importance of current speed on the distribution of the taxa. The dispersion of the sample units (β-diversity) of riffles and pools was similar, although it was different among the three streams. The results of this study provide further evidence of the importance of habitat heterogeneity within streams as a generator of diversity for Chironomidae in tropical lotic systems.
Estado del conocimiento taxonómico de la fauna de Chironomidae (Diptera: Nematocera de la Patagonia
Directory of Open Access Journals (Sweden)
Mariano DONATO
2009-01-01
Full Text Available La familia Chironomidae (Diptera: Nematocera es uno de los grupos de insectos más ampliamente distribuidos y abundantes en cuerpos de agua dulce. Los representantes de esta familia pueden explotar áreas con amplios gradientes ambientales. La información que se presenta está basada en la recopilación de datos distribucionales bibliográficos, del estudio del material tipo de las especies de Chironomidae depositadas en el Natural History Museum (UK y del material de colección del Museo de La Plata (Argentina. En la Patagonia, se registran 9 subfamilias, la subfamilia monotípica Chilenomyiinae es endémica de esta área. Dentro de estas subfamilias, 53 de los 111 géneros conocidos para América del Sur están presentes en la Patagonia. Del total de géneros de la Patagonia, el 20 % es endémico y 7 de ellos muestran relaciones transantárticas. En la Patagonia, se registran 177 especies de Chironomidae, el 98% de éstas son endémicas, el 3 % son consideradas nomina dubia y el 17% requiere revisión ya que su ubicación sistemática es dudosa. Las descripciones originales de las especies patagónicas de Chironomidae están basadas principalmente sobre machos (n=58 y machos y hembras (n=43, ambas representan el 57% del total; el resto de las especies han sido descriptas con diferentes combinaciones de estadios del ciclo de desarrollo.
Impact of damming on the Chironomidae of the upper zone of a tropical run-of-the-river reservoir.
Brandimarte, A L; Anaya, M; Shimizu, G Y
2016-06-01
We examined the effects of the Mogi-Guaçu river damming (São Paulo State, Brazil) on the Chironomidae fauna. Pre, during, and post-filling sampling was carried out in the main channel and margins of one site in the upper zone of the reservoir, using a modified Petersen grab (325 cm2). We evaluated the total, subfamily, and tribe densities and also their relative abundance. Analysis of genera included densities, relative abundance, richness, and dominance. The Rosso's ecological value index (EVI) determined the ecological importance of each genus. There was a tendency of decrease of the total Chironomidae density, increase in the percentage of Chironomini, and decrease in densities and percentages of Orthocladiinae and Tanytarsini. These changes in percentage were respectively related to Polypedilum, Lopescladius, and Rheotanytarsus, the genera with the highest EVI values. After-filling richness was lower in the margins and dominance of genera did not change significantly. Chironomidae in the margins was more sensitive to damming than in the main channel. This difference in sensibility sustains the use of Chironomidae as bioindicators. Damming impact was indicated by the reduction of both genera richness in the margins and relative abundance of groups typical of faster waters. The results have highlighted the need for multi-habitat analysis combined with a before-after sampling approach in the environmental impact studies concerning the damming impact on the benthic fauna.
Guerra, Alexandra; Leite, Nuno; Marques, João Carlos; Ford, Alex T; Martins, Irene
2014-01-01
Understanding the environmental parameters that constrain the distribution of a species at its latitudinal extremes is critical for predicting how ecosystems react to climate change. Our first aim was to predict the variation in the amphipod populations of Echinogammarus marinus from the southernmost limit of its distribution under global warming scenarios. Our second aim was to test whether sex-ratio fluctuations - a mechanism frequently displayed by amphipods - respond to the variations in populations under altered climate conditions. To achieve these aims, scenarios were run with a validated model of E. marinus populations. Simulations were divided into: phase I - simulation of the effect of climate change on amphipod populations, and phase II - simulation of the effect of climate change on populations with male and female proportions. In both phases, temperature (T), salinity (S) and temperature and salinity (T-S) were tested. Results showed that E. marinus populations are highly sensitive to increases in temperature (>2 °C), which has adverse effects on amphipod recruitment and growth. Results from the climate change scenarios coupled with the sex-ratio fluctuations depended largely on the degree of female bias within population. Temperature increase of 2 °C had less impact on female-biased populations, particularly when conjugated with increases in salinity. Male-biased populations were highly sensitive to any variation in temperature and/or salinity; these populations exhibited a long-term decline in density. Simulations in which temperature increased more than 4 °C led to a continuous decline in the E. marinus population. According to this work, E. marinus populations at their southernmost limit are vulnerable to global warming. We anticipate that in Europe, temperature increases of 2 °C will incite a withdrawal of the population of 5°N from the amphipod species located at southernmost geographical borders. This effect is discussed in relation to the
New Chironomidae (Diptera) with elongate proboscises from the Late Jurassic of Mongolia
Lukashevich, Elena D.; Przhiboro, Andrey A.
2011-01-01
Abstract Four new species of Chironomidae with well-developed elongate proboscises are described from a Late Jurassic site Shar Teg in SW Mongolia. These are named Cretaenne rasnicyni sp. n., Podonomius blepharis sp. n., Podonomius macromastix sp. n., ?Podonomius robustus sp. n. PMID:22259285
Ulrich, Paul N; Ewart, John W; Marsh, Adam G
2007-01-01
Restoration of oyster reef habitat in the Inland Bays of Delaware was accompanied by an effort to detect and determine relative abundance of the bivalve pathogens Perkinsus marinus, Haplosporidium nelsoni, and QPX. Both the oyster Crassostrea virginica and the clam Mercenaria mercenaria were sampled from the bays. In addition, oysters were deployed at eight sites around the bays as sentinels for the three parasites. Perkinsus marinus prevalence was measured with a real-time, quantitative polymerase chain reaction (PCR) methodology that enabled high-throughput detection of as few as 31 copies of the ribosomal non-transcribed spacer region in 500 ng oyster DNA. The other pathogens were assayed using PCR with species-specific primers. Perkinsus marinus was identified in Indian River Bay at moderate prevalence ( approximately 40%) in both an artificial reef and a wild oyster population whereas sentinel oysters were PCR-negative after 3-months exposure during summer and early fall. Haplosporidium nelsoni was restricted to one oyster deployed in Little Assawoman Bay. QPX and P. marinus were not detected among wild clams. While oysters in these bays have historically been under the greatest threat by MSX, it is apparent that P. marinus currently poses a greater threat to recovery of oyster aquaculture in Delaware's Inland Bays.
Butakka, C M M; Ragonha, F H; Train, S; Pinha, G D; Takeda, A M
2016-02-01
Ecological studies on food webs have considerably increased in recent decades, especially in aquatic communities. Because Chironomidae family are highly specious, occurring in almost all aquatic habitats is considered organisms-key to initiate studies on ecological relationships and trophic webs. We tested the hypothesis that the diversity of the morphospecies diet reflects differences on both the food items available among habitats and the preferences of larval feeding. We analyzed the gut content of the seven most abundant Chironomidae morphospecies of the different habitats from the Upper Paraná River. We categorized the food items found into algae, fungal spores, fragments of plants, algae and animal fragments and sponge spicules. We observed the algae predominance in the gut content of morphospecies from lakes. Considering the different regions from each lake, we registered the highest food abundance in the littoral regions in relation to the central regions. From the variety of feeding habits (number of item kinds), we classified Chironomus strenzkei, Tanytarsus sp.1, Procladius sp.1 as generalist morphospecies. We found a nested pattern between food items and Chironomidae morphospecies, where some items were common to all taxa (e.g., Bacillariophyceae algae, especially), while others were found in specific morphospecies (e.g., animals fragments found in Procladius sp.1). The algae represented the most percentage of gut contents of Chironomidae larvae. This was especially true for the individuals from littoral regions, which is probably due to the major densities of algae associated to macrophytes, which are abundant in these regions. Therefore, the feeding behavior of these morphospecies was generalist and not selective, depending only of the available resources.
Larvae of North American Eukiefferiella and Tvetenia (Diptera: Chironomidae). Bulletin No. 452.
Bode, Robert W.
"Eukiefferiella" and "Tvetenia" are closely related genera belonging to the subfamily Orthocladiinae within the Chironomidae, a family of non-biting midges. All known larvae in these genera are aquatic, being found predominantly in running water. Most species prefer cold, swift-flowing, well-oxygenated streams. Although larvae…
da Silveira, Lidimara Souza; Martins, Renato Tavares; da Silveira, Guilherme Augusto; Grazul, Richard Michael; Lobo, Danielle Pinheiro; Alves, Roberto da Gama
2013-01-01
The objective of this study was to analyze the colonization of Chironomidae (Diptera) larvae during the decomposition of Eichhornia azurea (Swartz) Kunth (Commelinales: Pontederiaceae) leaves in a lake in southeastern Brazil in two seasons of the year. The experiment was conducted from September to November 2007 and February to April 2008. In each period, 21 litter bags were used, each containing 10 g of dried leaves. Three bags were removed after 2, 5, 8, 12, 25, 45, and 65 days of colonization. The decomposition rate of the E. azurea leaves was rapid in both seasons, with no significant difference between them. The Chironomidae showed higher density than the other invertebrates. Goeldichironomus, Tonytarsus, and Corynoneura were the most abundant genera of Chironomidae. The invertebrate density increased during the experiment, differing within days but not between seasons. The faunal composition differed between the decomposition phases (initial and final), but did not differ between the seasons (dry and wet). The taxa Ablabesmyia, Caladomyia, Chironomus, Goeldichironomus, and Parachironomus were the most closely related to the final days of the experiment. Litter was the main food item found in the gut contents of the organisms of all the genera analyzed, both at the beginning and end of the decomposition. We believe that the feeding activity combined with the high larval density is an important factor contributing to the rapid decomposition of the E. azurea leaves. In conclusion, the succession process along the detritus chain of E. azurea was more important in structuring the assemblage of Chironomidae larvae than seasonal variations.
Prey or predator – expanding the food web role of sandeel (Ammodytes marinus)
DEFF Research Database (Denmark)
Eigaard, Ole Ritzau; Deurs, Mikael van; Behrens, Jane
2014-01-01
We report an unexpected observation of lesser sandeel Ammodytes marinus foraging on juveniles and late larval stages of the same species. This recording sheds new light on the cannibalistic and piscivorous capacity of forage fish and raises a number of questions about the role of forage fish in m...
Directory of Open Access Journals (Sweden)
Gisele Cristina Rosin
2007-01-01
Full Text Available O presente estudo teve por objetivos, identificar possíveis diferenças na estrutura da comunidade de larvas de Chironomidae em quatro ambientes da planície de inundação do alto rio Paraná com diferentes características e analisar a influência dos fatores abióticos e das variações do nível hidrométrico sobre a comunidade. As coletas foram realizadas em março e setembro de 2003. Em cada um dos 12 pontos coletados foram realizadas quatro amostragens: três para análise biológica e uma para análise sedimentológica. O material biológico foi lavado em conjunto de peneiras com malhas de abertura 2, 1 e 0,2 mm e fixado em álcool 70%. As larvas de Chironomidae foram identificadas até a categoria de gênero. Foram encontradas 1478larvas de Chironomidae pertencentes a 19 gêneros. Polypedilum, Tanytarsus e Chironomus foram registrados em todos os ambientes. As maiores densidades e diversidade de Chironomidae foram registradas nos períodos de águas baixas, especialmente em ambientes lênticos. Avariação da densidade, dominância e diversidade de Chironomidae entre as duas coletas foi influenciada, principalmente, pelo ciclo hidrológico e pelo oxigênio dissolvido, enquanto que a variação espacial esteve associada ao tipo de sedimento, porcentagem de matéria orgânica e a presença ou ausência de macrófitas aquáticas.The present study had the aim to identify possible differences in the community structure of Chironomidae larvae in four different environments of the upper Paraná river floodplain with different characteristics and to analyze the influence of abiotic factors and variations in the hydrometric level of the community. Samplings were carried out in March and September, 2003. Four samplings were taken from each of the 12 collecting points: three for biological analysis and one for sediment analysis. Biological contents were washed with the aid of a system with 2.0; 1.0 and 0.2 mm sieves. Chironomidae larvae were
Rosa, B F J V; Dias-Silva, M V D; Alves, R G
2013-02-01
This study describes the structure of the Chironomidae community associated with bryophytes in a first-order stream located in a biological reserve of the Atlantic Forest, during two seasons. Samples of bryophytes adhered to rocks along a 100-m stretch of the stream were removed with a metal blade, and 200-mL pots were filled with the samples. The numerical density (individuals per gram of dry weight), Shannon's diversity index, Pielou's evenness index, the dominance index (DI), and estimated richness were calculated for each collection period (dry and rainy). Linear regression analysis was employed to test the existence of a correlation between rainfall and the individual's density and richness. The high numerical density and richness of Chironomidae taxa observed are probably related to the peculiar conditions of the bryophyte habitat. The retention of larvae during periods of higher rainfall contributed to the high density and richness of Chironomidae larvae. The rarefaction analysis showed higher richness in the rainy season related to the greater retention of food particles. The data from this study show that bryophytes provide stable habitats for the colonization by and refuge of Chironomidae larvae, mainly under conductions of faster water flow and higher precipitation.
Effects of bioirrigation of non-biting midges (Diptera: Chironomidae) on lake sediment respiration
Baranov, Viktor; Lewandowski, Jörg; Romeijn, Paul; Singer, Gabriel; Krause, Stefan
2016-06-01
Bioirrigation or the transport of fluids into the sediment matrix due to the activities of organisms such as bloodworms (larvae of Diptera, Chironomidae), has substantial impacts on sediment respiration in lakes. However, previous quantifications of bioirrigation impacts of Chironomidae have been limited by technical challenges such as the difficulty to separate faunal and bacterial respiration. This paper describes a novel method based on the bioreactive tracer resazurin for measuring respiration in-situ in non-sealed systems with constant oxygen supply. Applying this new method in microcosm experiments revealed that bioirrigation enhanced sediment respiration by up to 2.5 times. The new method is yielding lower oxygen consumption than previously reported, as it is only sensitive to aerobic heterotrophous respiration and not to other processes causing oxygen decrease. Hence it decouples the quantification of respiration of animals and inorganic oxygen consumption from microbe respiration in sediment.
Energy Technology Data Exchange (ETDEWEB)
Dermott, R.; Kelso, J.R.M.; Douglas, A.
1986-01-01
The benthic fauna of 41 nonhumic, soft water lakes situated north of lakes Superior and Huron were sampled during 1980. The pH range of the lakes sampled was 4.6 to 7.7. The benthic infauna displayed regional differences in abundance and composition, with large variation with each district. Total abundance, biomass, and number of taxa were not correlated with lake pH or alkalinity. The Chironomidae displayed a slight change in percent composition of the major species with lower pH. The Tanytarsini and Chironomus Salinarius group decreased, while C. anthracinus group increased in relative abundance in those lakes with lower pH. Other factors appear to control the distribution of the various invertebrate orders, with depth and sediment nature being important variables.
Directory of Open Access Journals (Sweden)
Daniela Aparecida Silveira Cesar
2017-05-01
Full Text Available Abstract Numerous factors may affect the pattern of distribution of benthic fauna in a river mouth region and, among the macroinvertebrates, Chironomidae and Oligochaeta are the most abundant groups and most tolerant to environmental changes. Aim The aim of this study was to evaluate the controlling factors of and a possible similarity between Chironomidae and Oligochaeta assemblies at two close sites, the mouth of the Guareí River into the Paranapanema River (São Paulo, Brazil and its lateral fluvial area. Methods Fauna samples were collected every three months during one year. Water physical and chemical variables and sediment variables were also determined in the same period. Results Both assemblies presented low density variability over time in the lateral area due to sediment characteristics and environmental factors. Taxa Caladomyia, Parachironomus, Pristina sp., Pristina osborni, Bothrioneurum and Opistocysta funiculus were recorded at this site. The Guareí River presented both greater temporal and spatial variations, attributed mainly to a reduction in the water level. Greater organism abundance, especially of Chironomus and Tubificinae, was observed in the river. Conclusions Dissimilarity in temporal and spatial distributions of Chironomidae and Oligochaeta was attributed to peculiar characteristics of the two study sites, a river channel and a lateral area. Reduction in the water level over the year was the main controlling factor of Chironomidae and Oligochaeta richness and density in the river. In the lateral area, the presence and abundance of certain taxa were determined by the nature of the sediment and water physical and chemical variables.
Chu, Fu-Lin E; Soudant, P; Lund, E D
2003-10-01
The effects of temperature on the uptake and metabolism of fluorescent labeled palmitic acid (FLC16) and phosphatidylcholine (FLPC) and lipase activities in the oyster protozoan parasite, Perkinsus marinus, meront stage were tested at 10, 18, and 28 degrees C. Temperature significantly affected not only the uptake, assimilation, and metabolism of both FLC16 and FLPC in P. marinus, but also its triacylglycerol (TAG) lipase activities. The incorporation of both FLC16 and FLPC increased with temperature and paralleled the increase in the amount of total fatty acids in P. marinus meront cultures. The incorporation of FLC16 was higher than FLPC at all temperatures. The percentage of FLC16 metabolized to TAG was significantly higher at higher temperatures. Trace amounts of incorporated FLC16 were detected in monoacylglycerol (MAG) and PC at 18 and 28 degrees C. P. marinus meronts metabolized FLPC to TAG, diacylglycerol (DAG), monoacylglycerol (MAG), free fatty acids (FFA), phosphatidylethanolamine (PE), and cardiolipin (CL). The conversion of FLPC to TAG and PE was highest at 28 degrees C. The relative proportions of individual fatty acids and total saturated, monounsaturated and polyunsaturated fatty acids changed with temperatures. While total saturated fatty acids (SAFAs) increased with temperature, total monounsaturated fatty acids (MUFAs) decreased with temperature. Total polyunsaturated fatty acids (PUFAs) increased from 28 to 18 degrees C. The findings of increase of total SAFAs and decrease of total MUFAs with the increase of temperatures and upward shift of total PUFAs from 28 to 18 degrees C suggest that, as in other organisms, P. marinus is capable of adapting to changes in environmental temperatures by modifying its lipid metabolism. Generally, higher lipase activities were noted at higher cultivation temperatures. Both TAG lipase and phospholipase activities were detected in P. marinus cells and their extra cellular products (ECP), but phospholipase
Directory of Open Access Journals (Sweden)
Sebastião José de Oliveira
1989-01-01
Full Text Available In this paper we describe a new species of a non-biting midge of the genus Aedokritus Roback, 1958 (Chironominae, Chironomidae from Brazil and Bolívia. That is the fifth species of this genus. The other species of the genus are: A. penicilligerus (Edwards, 1931, from Argentina and Peru; A. pruinescens (Edwards, 1931, from Argentina; A. platycnemis (Edwards, 1931, from Argentina; and A. sartis Roback, 1960, from Brazil.
Da Silva, Fabio Laurindo; Wiedenbrug, Sofia
2015-04-15
A new genus, Amazonimyia, is established for a species of the tribe Pentaneurini (Diptera, Chironomidae, Tanypodinae) from the Amazon Rainforest in northern Brazil. Generic diagnoses for adult male and pupa are provided together with descriptions of a new species, Amazonimyia gigantea.
Kownacki, Andrzej; Woznicka, Olga; Szarek-Gwiazda, Ewa; Michailova, Paraskeva; Czaplicka, Anna
2017-02-27
In this paper, a study of the morphology of the pupa and male imago of Glyptotendipes (G.) glaucus (Meigen 1818) was carried out, with the aid of a scanning electron microscope (SEM). The SEM provided additional valuable information on the morphology of the species. Adult male head, antenna, wing, leg, abdomen, hypopygium, pupal cephalothorax and abdomen were examined. It is emphasized that SEM was not often used in Chironomidae studies. The present results confirm SEM as a suitable approach in carrying out morphological and taxonomical descriptions of Chironomidae species.
Development of sea lamprey (Petromyzon marinus) larvicides
Howell, John H.; Lech, John J.; Allen, John L.
1980-01-01
Larvicides are used to control sea lamprey (Petromyzon marinus) in the Great Lakes. These larvicides are useful because they are more toxic to sea lamprey than fish species found in the same habitat. The lampricides come from two classes of chemical compounds: (1) halonitrophenols, and (2) halonitrosalicylanilides. Selectivity of the larvicides appears to be based on the differences in the ability of sea lamprey larvae and fishes to detoxify and/or excrete the chemicals. Glucuronide conjugation is an important mechanism for detoxification of these larvicides by fish, and selectivity of larvicides may be due to differences in glucuronyl transferase activity between lamprey and fishes. If more detailed information were available on uptake, metabolism, excretion, and the biochemistry and physiology of lamprey as compared to fishes, it might be possible to design chemicals that would be more selective than those now in use.
Beauvesère-Storm, de A.; Tempelman, D.
2009-01-01
De meeste soorten Chironomidae (dans- of vedermuggen) zijn dieren met een aquatische larve. Ze zijn een belangrijk onderdeel van de macrofaunagemeenschap van het zoete water, waarbij ze goede indicatoren zijn voor de milieukwaliteit. Veel soorten zijn met enige moeite goed tot soort of soortgroep te
Directory of Open Access Journals (Sweden)
Sergio Curiel-RamÃrez-Gutiérrez
2012-11-01
Full Text Available In the Gulf of Mexico, the fishery of the oyster Crassostrea virginica is the main resource for you capture volume (42, 796 t. This resource is affected by the disease of the Dermo, which has been little studied in the Gulf of Mexico. The objective of the study was to determine the prevalence and grade of infection of Perkinsus marinus in Tabasco. Samples were realized by Fluid Thioglycolate medium (MFT, histopathology and PCR in oysters of six banks in the lagoon system Carmen-Machona-Pajonal, Tabasco. The results of the MFT after incubation, showed hipnosporas of blue-black. The histopathological analysis revealed alterations in the tissues connective and epithelial, as well as the forms characteristic of P. marinus, such as tomontes and trophozoites. The identity of the parasite was confirmed by PCR analysis. The prevalence of P. marinus registered in times of rain, north-wind and dry was 73.3, 90 and 100%; the degree of infection was 2, 3 and 5 on the scale of Mackin, respectively. There is a relationship of the prevalence and intensity of the infection with respect to increased temperature and salinity, where the dry season was most critical.
Directory of Open Access Journals (Sweden)
Azam Karami
2014-12-01
Full Text Available Chironomidae (Diptera which are distributed worldwide, are the most abundant and diverse insects in many freshwater ecosystems, as well as inland waters of Iran. However, very few researches were done for identification of this group in Iran, and there is a poor knowledge of their faunal diversity distribution in this country. To investigate chironomid larvae in Marbor river, Isfahan Province, seasonal samplings were done (2003-2004 in five selected sites along the river course, using Dredge sampler 3 times for every site. After collecting, the samples were preserved in formaldehyde at the site. Samples were sorted out in laboratory and the Chironomidae larvae were identified down to the generic level using the identification keys, and light and phase-contrast microscopes. Results revealed 39 genera from four subfamilies in Marbor River: Chironominae (15 genera, Diamesinae (2 genera, Orthocladiinae (17 genera and Tanypodinae (5 genera. From these, 13 genera were reported for the first time in Iran. An identification key for the taxon in Marbor river was provided.
De Oliveira, Caroline Silva Neubern; Da Silva, Fabio Laurindo; Trivinho-Strixino, Susana
2013-01-01
One new species of Thalassomya Schiner, 1856 (Diptera: Chironomidae: Telmatogetoninae), T. gutae sp. n. is described and figured as male, pupa and larva. The specimen was collected in the marine zone between tidemarks, in southeastern Brazilian coast and is the first species of this genus recorded to Brazil.
Susan E. Gresens; Kenneth T. Belt; Jamie A. Tang; Daniel C. Gwinn; Patricia A. Banks
2007-01-01
In a longitudinal study of two streams whose lower reaches received unattenuated urban stormwater runoff, physical disturbance by stormflow was less important than the persistant unidentified chemical impacts of urban stormwater in limiting the distribution of Chironomidae, and Ephemeroptera, Trichoptera and Plecoptera (EPT). A hierarchical spatial analysis showed that...
Diversity and distribution of Chironomidae (Insecta: Diptera of protected areas in North Tunisia
Directory of Open Access Journals (Sweden)
Boulaaba S.
2014-01-01
Full Text Available In North Africa seasonal streams called wadi are an unique habitats with serve hydrological and thermal regime. Non-biting midges take an important part of freshwater biodiversity in North Africa. We present new data on the distribution and diversity of Chironomidae in North Tunisia. Larvae, pupal exuviae and adult males of chironomids were collected from a various freshwater ecosystems from May 2005 till April 2006. The aim of this study was to recognize the pattern of midge diversity in North Tunisia to estimate ecological value of running waters in the region. In total, 79 taxa were identified. Nearly all of the taxa were typical representatives of the Palaearctic and Mediterranean complexes. The majority of the investigated sites belonged to the protected areas in North Tunisia, such as the Ichkeul National Park, the Kroumerie Mountains and the El Feija National Park, part of the Intercontinental Reserve of the Mediterranean Biosphere. Altitudinal zonation of the communities composition was found in the lowland (250 m a.s.l. with maximum of 760 m. Whereas among the data 39 species are recorded from Tunisia for the first time, the species richness of Chironomidae is higher than previously estimated.
[Key to chironomid pupal exuviae (Diptera: Chironomidae) of tropical high Andean streams].
Pratt, Narcís; González-Trujillo, Juan David; Ospina-Torres, Rodulfo
2014-12-01
The Chironomidae is a cosmopolitan family of Nematoceran flies with more than 20,000 species described. However the diversity of genera and species of the family in the Andean region beyond the 2,000 m.a.s.l are scarcely known. We conducted faunal surveys and biomonitoring research in different streams of Colombia, Ecuador and Peru from May 2005 to October 2011. Based on specimens collections, a taxonomic key was developed to identify pupae and pupal exuviae of 46 genera of midges (Diptera, Chironomidae) collected from streams at high altitude areas on the Andean tropical mountains. We included illustrations and brief taxonomic descriptions for all genera, of which several ones have not yet been formally described; in this latter case we used the nomenclature of Roback & Coffman (1983). For two genera, Cricotopus and Genus 1, keys to the most com- mon morphospecies were provided. Results showed that in this area the chironomid assemblages are dominated by the members of the subfamily Orthocladiinae (22 genera) followed by the Chironominae (13). Six genera of Tanypodinae were identified, while only three and two genera were present from subfamilies Podonominae and Diamesinae. This key may be very useful for both studies about drift in streams, and for biomonitoring purposes.
Czech Academy of Sciences Publication Activity Database
Felcmanová, Kristina; Lukeš, Martin; Kotabová, Eva; Lawrenz, Evelyn; Halsey, K.H.; Prášil, Ondřej
2017-01-01
Roč. 134, č. 1 (2017), s. 71-82 ISSN 0166-8595 R&D Projects: GA MŠk(CZ) LO1416; GA MŠk(CZ) LH11064 Institutional support: RVO:61388971 Keywords : Prochlorococcus marinus * Cyanobacteria * Primary production Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.864, year: 2016
Eijk, van der R.H.
1987-01-01
Data concerning reproduction, survival and dispersal of the whirligig water beetle Gyrinus marinus Gyll . were collected between 1974 and 1983 by observations and experiments in the laboratory and in a field area with about 10 populations distributed over 15
Czech Academy of Sciences Publication Activity Database
Frouz, Jan; Ali, A.; Lobinske, R. J.
2004-01-01
Roč. 97, č. 6 (2004), s. 1884-1890 ISSN 0022-0493 Institutional research plan: CEZ:AV0Z6066911 Keywords : Chironomidae * algal food * larval development Subject RIV: EH - Ecology, Behaviour Impact factor: 1.283, year: 2004
Scandolera, Amandine; Hubert, Jane; Humeau, Anne; Lambert, Carole; De Bizemont, Audrey; Winkel, Chris; Kaouas, Abdelmajid; Renault, Jean-Hugues; Reynaud, Romain
2018-01-01
The aim of the present study was to investigate the neuro-soothing activity of a water-soluble hydrolysate obtained from the red microalgae Rhodosorus marinus Geitler (Stylonemataceae). Transcriptomic analysis performed on ≈100 genes related to skin biological functions firstly revealed that the crude Rhodosorus marinus extract was able to significantly negatively modulate specific genes involved in pro-inflammation (interleukin 1α encoding gene, IL1A) and pain detection related to tissue inflammation (nerve growth factor NGF and its receptor NGFR). An in vitro model of normal human keratinocytes was then used to evaluate the ability of the Rhodosorus marinus extract to control the release of neuro-inflammation mediators under phorbol myristate acetate (PMA)-induced inflammatory conditions. The extract incorporated at 1% and 3% significantly inhibited the release of IL-1α and NGF secretion. These results were confirmed in a co-culture system of reconstructed human epithelium and normal human epidermal keratinocytes on which a cream formulated with the Rhodosorus marinus extract at 1% and 3% was topically applied after systemic induction of neuro-inflammation. Finally, an in vitro model of normal human astrocytes was developed for the evaluation of transient receptor potential vanilloid 1 (TRPV1) receptor modulation, mimicking pain sensing related to neuro-inflammation as observed in sensitive skins. Treatment with the Rhodosorus marinus extract at 1% and 3% significantly decreased PMA-mediated TRPV1 over-expression. In parallel with these biological experiments, the crude Rhodosorus marinus extract was fractionated by centrifugal partition chromatography (CPC) and chemically profiled by a recently developed 13C NMR-based dereplication method. The CPC-generated fractions as well as pure metabolites were tested again in vitro in an attempt to identify the biologically active constituents involved in the neuro-soothing activity of the Rhodosorus marinus extract
Directory of Open Access Journals (Sweden)
Amandine Scandolera
2018-03-01
Full Text Available The aim of the present study was to investigate the neuro-soothing activity of a water-soluble hydrolysate obtained from the red microalgae Rhodosorus marinus Geitler (Stylonemataceae. Transcriptomic analysis performed on ≈100 genes related to skin biological functions firstly revealed that the crude Rhodosorus marinus extract was able to significantly negatively modulate specific genes involved in pro-inflammation (interleukin 1α encoding gene, IL1A and pain detection related to tissue inflammation (nerve growth factor NGF and its receptor NGFR. An in vitro model of normal human keratinocytes was then used to evaluate the ability of the Rhodosorus marinus extract to control the release of neuro-inflammation mediators under phorbol myristate acetate (PMA-induced inflammatory conditions. The extract incorporated at 1% and 3% significantly inhibited the release of IL-1α and NGF secretion. These results were confirmed in a co-culture system of reconstructed human epithelium and normal human epidermal keratinocytes on which a cream formulated with the Rhodosorus marinus extract at 1% and 3% was topically applied after systemic induction of neuro-inflammation. Finally, an in vitro model of normal human astrocytes was developed for the evaluation of transient receptor potential vanilloid 1 (TRPV1 receptor modulation, mimicking pain sensing related to neuro-inflammation as observed in sensitive skins. Treatment with the Rhodosorus marinus extract at 1% and 3% significantly decreased PMA-mediated TRPV1 over-expression. In parallel with these biological experiments, the crude Rhodosorus marinus extract was fractionated by centrifugal partition chromatography (CPC and chemically profiled by a recently developed 13C NMR-based dereplication method. The CPC-generated fractions as well as pure metabolites were tested again in vitro in an attempt to identify the biologically active constituents involved in the neuro-soothing activity of the Rhodosorus
Moller Pillot, H.K.M.; Wiersma, S.M.
1997-01-01
The larvae of the genus Einfeldia Kieffer, 1924: nomenclature and key to the species (Diptera: Chironomidae). A review is given of the identities of groups and taxa of Einfeldia in the larval stage as given in the literature. Three species remain on the Dutch list: E. carbonaria (Meigen), E.
Directory of Open Access Journals (Sweden)
Leonard Charles Ferrington Jr
2014-12-01
Full Text Available Relative efficiencies of standard dip-net sampling (SDN versus collections of surface-floating pupal exuviae (SFPE were determined for detecting Chironomidae at catchment and site scales and at subfamily/tribe-, genus- and species-levels based on simultaneous, equal-effort sampling on a monthly basis for one year during a biodiversity assessment of Bear Run Nature Reserve. Results showed SFPE was more efficient than SDN at catchment scales for detecting both genera and species. At site scales, SDN sampling was more efficient for assessment of a first-order site. No consistent pattern, except for better efficiency of SFPE to detect Orthocladiinae genera, was observed at genus-level for two second-order sites. However, SFPE was consistently more efficient at detecting species of Orthocladiinae, Chironomini and Tanytarsini at the second order sites. SFPE was more efficient at detecting both genera and species at two third-order sites. The differential efficiencies of the two methods are concluded to be related to stream order and size, substrate size, flow and water velocity, depth and habitat heterogeneity, and differential ability to discriminate species among pupal exuviae specimens versus larval specimens. Although both approaches are considered necessary for comprehensive biodiversity assessments of Chironomidae, our results suggest that there is an optimal, but different, allocation of sampling effort for detecting Chironomidae across stream orders and at differing spatial and taxonomic scales.Article submitted 13. August 2014, accepted 31. October 2014, published 22. December 2014.
Trivinho-Strixino, Susana; Shimabukuro, Erika Mayumi
2017-05-23
Tanytarsini (Diptera: Chironomidae: Chironominae) collected from madicolous habitats in Brazil are analyzed, and three new species of Tanytarsus van der Wulp are described and illustrated: T. angelae sp. n. and T. alaidae sp. n. as adult male and T. alienus sp. n. as male and female. New records of another Brazilian Tanytarsus species are also presented, and immature stages of Paratanytarsus silentii Trivinho-Strixino are described.
DEFF Research Database (Denmark)
Stief, Peter; Nielsen, Lars Peter; Revsbech, Niels Peter
2006-01-01
FROM THE GUT OF AN INSECT TO THE GLOBAL CLIMATE: DENITRIFICATION AND NITROUS OXIDE PRODUCTION INSIDE LAKE CHIRONOMIDAE P. Stief, L.P. Nielsen, N.P. Revsbech, A. Schramm Department of Biological Sciences, Microbiology, University of Aarhus, Denmark Denitrifying bacteria in lake sediments drive...
Directory of Open Access Journals (Sweden)
Alice Michiyo Takeda
2013-05-01
Full Text Available Chironomidae larvae (Diptera are one of the most important families among aquatic insects due to the higher abundance and species richness, considered an important tool for ecological studies. This study evaluated the richness of Chironomidae assemblage and related the distribution with physical and chemical variables in five lakes of the Paraná river, in the Ilha Grande National Park. There were two samplings, one in the central region and another in the marginal area of the floodplain lakes. In each region were collected six samples, five for biological analysis and one for granulometric analysis. The granulometric composition and organic matter content were the principal variables influencing the density and richness of Chironomidae. The scores of the abiotic data distinguished the marginal lakes (São João, Jacaré and Xambrê from the island lakes (Saraiva and Jatobá. The same segregation was observed in the distribution of Chironomidae morphotypes, and environments with higher values of organic matter, presented the lowest density and taxa richness. Thus, in this study the environmental variables directly interfered in the distribution, abundance and richness of Chironomidae of the floodplain lakes from Ilha Grande National Park, contributing to the knowledge of the diversity of this group in this area.
Directory of Open Access Journals (Sweden)
Rieradevall, M.
2007-12-01
Full Text Available A Chironomidae (Diptera fauna list for headwater streams of high altitude areas in Serra da Estrela (Portugal is presented, doubling the previously established species richness for the region. The findings include 17 new records for Portugal, which represent an increase to 219 species for the Continental Portugal Chironomidae fauna. Two new records were detected for the Iberian Peninsula: one species (Tvetenia duodenaria, and one subgenus –Psectrocladius (Mesopsectrocladius–; and the presence of the genus Natarsia is confirmed. The last two occurrences correspond to monoespecific taxa of the Palearctic region. However, as taxonomic identification has been based on larval material, instead of pupae, pupal exuviae or imagoes, species level assignment is still uncertain.
Se presenta una lista de especies de Chironomidae (Diptera recolectadas en los ríos de cabecera de zonas de alta montaña en la Serra da Estrela (Portugal. Con esta aportación se duplica la riqueza de especies regional conocida hasta el momento y se eleva la fauna de quironómidos del Portugal continental a 219 especies. Se incluyen dos nuevas citas para la Península Ibérica, una especie (Tvetenia duodenaria y un subgénero –Psectrocladius (Mesopsectrocladius–, y se confirma la presencia del género Natarsia. En los dos últimos casos se trata de larvas de taxones hasta el momento monoespecíficos en la región paleárctica, pero al no haberse recolectado pupas o adultos no se puede asegurar la identificación específica.
The progression of diseases caused by the oyster parasites, Perkinsus marinus and Haplosporidium nelsoni, were evaluated by periodic sampling (May 1994-Dec. 1995) of oysters, Crassostrea virginica, that set on an artificial reef located in the Piankatank River, Virginia, in Augus...
Heterokont predator Develorapax marinus gen. et sp. nov. – a model of the ochrophyte ancestor
Directory of Open Access Journals (Sweden)
Vladimir V. Aleoshin
2016-08-01
Full Text Available Heterotrophic lineages of Heterokonta (or stramenopiles, in contrast to a single monophyletic group of autotrophs, Ochrophyta, form several clades that independently branch off the heterokont stem lineage. The nearest neighbors of Ochrophyta in the phylogenetic tree appear to be almost exclusively bacterivorous, whereas the hypothesis of plastid acquisition by the ancestors of the ochrophyte lineage suggests an ability to engulf eukaryotic alga. In line with this hypothesis, the heteretrophic predator at the base of the ochrophyte lineage may be regarded as a model for the ochrophyte ancestor. Here we present a new genus and species of marine free-living heterotrophic heterokont Develorapax marinus, which falls into an isolated heterokont cluster, along with the marine flagellate Developayella elegans, and is able to engulf eukaryotic cells. Together with environmental sequences D. marinus and D. elegans form a class-level clade Developea nom. nov. represented by species adapted to different environmental conditions and with a wide geographical distribution. The position of Developea among Heterokonta in large-scale phylogenetic tree is discussed. We propose that members of the Developea clade represent a model for transition from bacterivory to a predatory feeding mode by selection for larger prey. Presumably, such transition in the grazing strategy is possible in the presence of bacterial biofilms, and has likely occured in the ochrophyte ancestor.
Montagna, Matteo; Urbanelli, Sandra; Rossaro, Bruno
2016-11-15
Some rare species from Italian Alps, belonging to the genus Diamesa Meigen, 1835 (Diptera, Chironomidae) are here redescribed as adult males, because only old, incomplete descriptions are available for these taxa. Terminology of male genitalia is reviewed, diagnostic features are illustrated in detail, and notes on biology and geographical distribution of the examined species are provided. An identification key to the known adult males is presented.
The Effects of the Toxic Cyanobacterium Limnothrix (Strain AC0243 on Bufo marinus Larvae
Directory of Open Access Journals (Sweden)
Olivia Daniels
2014-03-01
Full Text Available Limnothrix (strain AC0243 is a cyanobacterium, which has only recently been identified as toxin producing. Under laboratory conditions, Bufo marinus larvae were exposed to 100,000 cells mL−1 of Limnothrix (strain AC0243 live cultures for seven days. Histological examinations were conducted post mortem and revealed damage to the notochord, eyes, brain, liver, kidney, pancreas, gastrointestinal tract, and heart. The histopathological results highlight the toxicological impact of this strain, particularly during developmental stages. Toxicological similarities to β-N-Methylamino-L-alanine are discussed.
The Effects of the Toxic Cyanobacterium Limnothrix (Strain AC0243) on Bufo marinus Larvae
Daniels, Olivia; Fabbro, Larelle; Makiela, Sandrine
2014-01-01
Limnothrix (strain AC0243) is a cyanobacterium, which has only recently been identified as toxin producing. Under laboratory conditions, Bufo marinus larvae were exposed to 100,000 cells mL−1 of Limnothrix (strain AC0243) live cultures for seven days. Histological examinations were conducted post mortem and revealed damage to the notochord, eyes, brain, liver, kidney, pancreas, gastrointestinal tract, and heart. The histopathological results highlight the toxicological impact of this strain, particularly during developmental stages. Toxicological similarities to β-N-Methylamino-l-alanine are discussed. PMID:24662524
Directory of Open Access Journals (Sweden)
Susana Trivinho-Strixino
2012-09-01
Full Text Available First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera. This study constitutes the first record of Temnocephala Blanchard, an ectosymbiont on Corydalidae, as a possible predator of chironomid larvae. Twenty-eight Corydalidae larvae (Corydalus and Protochauliodes were examined under stereomicroscopic in search for Temnocephala and Chironomidae larvae, of which five megalopteran larvae had 24 Temnocephala sp. associated. Furthermore, eight of these Temnocephala worms had chironomid larvae in their gut contents, an interaction previously unknown. Gut content analyses revealed Corynoneura as the commonest chironomid, but larvae of Larsia, Rheotanytarsus and Tanytarsus were recorded as well. This study included Corydalus and Protochauliodes as hosts for Temnocephala, which might be important for this worm dispersion and population dynamics.
Pramual, Pairot; Simwisat, Kusumart; Martin, Jon
2016-01-28
Chironomidae are a highly diverse group of insects. Members of this family are often included in programs monitoring the health of freshwater ecosystems. However, a difficulty in morphological identification, particularly of larval stages is the major obstacle to this application. In this study, we tested the efficiency of mitochondrial cytochrome c oxidase I (COI) sequences as the DNA barcoding region for species identification of Chironomidae in Thailand. The results revealed 14 species with a high success rate (>90%) for the correct species identification, which suggests the potential usefulness of the technique. However, some morphological species possess high (>3%) intraspecific genetic divergence that suggests these species could be species complexes and need further morphological or cytological examination. Sequence-based species delimitation analyses indicated that most specimens identified as Chironomus kiiensis, Tokunaga 1936, in Japan are conspecific with C. striatipennis, Kieffer 1912, although a small number form a separate cluster. A review of the descriptions of Kiefferulus tainanus (Kieffer 1912) and its junior synonym, K. biroi (Kieffer 1918), following our results, suggests that this synonymy is probably not correct and that K. tainanus occurs in Japan, China and Singapore, while K. biroi occurs in India and Thailand. Our results therefore revealed the usefulness of DNA barcoding for correct species identification of Chironomidae, particularly the immature stages. In addition, DNA barcodes could also uncover hidden diversity that can guide further taxonomic study, and offer a more efficient way to identify species than morphological analysis where large numbers of specimens are involved, provided the identifications of DNA barcodes in the databases are correct. Our studies indicate that this is not the case, and we identify cases of misidentifications for C. flaviplumus, Tokunaga 1940 and K. tainanus.
Directory of Open Access Journals (Sweden)
Živić Ivana
2013-01-01
Full Text Available In order to examine how extruded and pelleted feed affects the fatty acid composition of carp meat and Chironomidae larvae, two-month-old carp specimens were set in two fishponds (L1 and L2. The fatty acid composition of extruded and pelleted feed is characterized by a significantly higher content of ω-3 fatty acids and higher ω-3 to ω-6 fatty acids ratio (ω-3/ω-6 in extruded (11.34±0.12% and 0.315±0.005, respectively compared to pelleted feed (7.72±0.08%, 0.180±0.001, respectively. The fatty acid composition of carp meat is characterized by higher ω-3 fatty acid content and ω-3/ω-6 in carp fed with extruded feed (L1, 6.98±0.53% and 0.295±0.022, respectively compared to carp fed with extruded feed (L2, 5.46±0.07% and 0.232±0.009, respectively. Chironomidae larvae from the fishpond L2 had significantly higher ω-3 fatty acid content (8.22±0.89%, and therefore higher ω-3/ω-6 (0.81±0.09 in comparison to Chironomidae from the L1 fishpond where these parameters were 4.48±0.06% and 0.21±0.01, respectively. [Projekat Ministarstva nauke Republike Srbije, br. TR 31075 i br. 173040
González Medina, Alejandro; Soriano Hernando, Óscar; Jiménez Ríos, Gilberto
2015-05-01
Nonbiting midges (Diptera, Chironomidae) are the most abundant members of the fauna associated with submerged carcasses, but their use in the medicolegal context is very restricted because of their complex ontogeny. In this case, the corpse of a woman was recovered in late spring from a river in Granada (Iberian Peninsula). It showed obvious signs of long permanence in the aquatic environment and, along with pulmonary and microscopical analyses, led to the conclusion that the cause of death was drowning. Several larvae-like specimens were sampled from the scalp and later identified by morphological external features as IV instar larvae of Chironomus riparius Meigen, 1804 (Diptera, Chironomidae). Sequencing of cytochrome oxidase subunit I was performed to confirm the identification. The knowledge of the biology of C. riparius at low temperatures was critical to assess a postsubmersion interval of 16-17 days. © 2015 American Academy of Forensic Sciences.
Chironomidae Fauna (Diptera-Insecta) of Gümüldür Stream (İzmir)
USTAOĞLU, Mustafa Ruşen; BALIK, Süleyman; TAŞDEMİR, Ayşe
2014-01-01
Samples were collected monthly from 10 different stations between April, 1993, and March, 1994, in order to determine the Chironomidae fauna of Gümüldür Stream in İzmir, Turkey. Ten species were found in the stream as determined from qualitative analyses of the samples. Of these, 5 species belong to the subfamily Orthocladiinae and the remaining 5 belong to the subfamily Chironominae. This is the first study reporting the existence of these species in Gümüldür Stream.
Chironomidae of semiaquatic lake shore habitats in the Karelian Isthmus (northwestern Russia
Directory of Open Access Journals (Sweden)
Andrey Przhiboro
2012-10-01
Full Text Available Shores of lentic waters are poorly studied as habitats of Chironomidae. We investigated floating shore marsh surrounding the lakes Bol’shoe Rakovoe (Äyräpäänjärvi or Eteläjärvi and Okhotnich’e (Muolaanlampi, shallow mesotrophic wetlands in the Karelian Isthmus. Our research aimed to identify species structure of immature chironomid assemblages in this peculiar habitat and to provide their quantitative assessment. Five sites of the water margin zone (a 20-m part of floating marsh adjoining the lake littoral were studied using two techniques, quantitative samples taken with a grab-net and laboratory rearings of adults from substrata. Thirty-two samples were taken in July and October; 2970 emerging chironomid adults were identified. Nineteen species were found, 3 of Tanypodinae, 10 of Orthocladiinae and 6 of Chironominae. Tavastia yggdrasilia, Thienemanniella minuscula and Polypedilum trigonus are first recorded from Russia, and 8 more species, from NW Russia. Orthocladiinae accounted for over 99% emerging adults, with 3 species predominant and numerous on all sites, Paraphaenocladius impensus, Limnophyes minimus and L. natalensis. Species structure is discussed and compared with the data on similar habitats. Chironomid larvae were most numerous macroinvertebrates. Mean abundance of chironomid immatures varied from 1246 to 32060 ind./m2, mean biomass, 0.104 to 3.591 g(wet weight/m2, depending on site and season. In July, Chironomidae comprised 3-15% of Diptera biomass and 1-5% of macroinvertebrates biomass; in October, 13-49% and 7-20%, respectively.doi: 10.5324/fn.v31i0.1410.Published online: 17 October 2012.
Gauthier, J.D.; Jenkins, J.A.; La Peyre, Jerome F.
2004-01-01
Parasite surface glycoconjugates are frequently involved in cellular recognition and colonization of the host. This study reports on the identification of Perkinsus marinus surface carbohydrates by flow cytometric analyses of fluorescein isothiocyanate-conjugated lectin binding. Lectin-binding specificity was confirmed by sugar inhibition and Kolmogorov-Smirnov statistics. Clear, measurable fluorescence peaks were discriminated, and no parasite autofluorescence was observed. Parasites (GTLA-5 and Perkinsus-1 strains) harvested during log and stationary phases of growth in a protein-free medium reacted strongly with concanavalin A and wheat germ agglutinin, which bind to glucose-mannose and N-acetyl-D-glucosamine (GlcNAc) moieties, respectively. Both P. marinus strains bound with lower intensity to Maclura pomifera agglutinin, Bauhinia purpurea agglutinin, soybean agglutinin (N-acetyl-D-galactosamine-specific lectins), peanut agglutinin (PNA) (terminal galactose specific), and Griffonia simplicifolia II (GlcNAc specific). Only background fluorescence levels were detected with Ulex europaeus agglutinin I (L-fucose specific) and Limulus polyphemus agglutinin (sialic acid specific). The lectin-binding profiles were similar for the 2 strains except for a greater relative binding intensity of PNA for Perkinsus-1 and an overall greater lectin-binding capacity of Perkinsus-1 compared with GTLA-5. Growth stage comparisons revealed increased lectin-binding intensities during stationary phase compared with log phase of growth. This is the first report of the identification of surface glycoconjugates on a Perkinsus spp. by flow cytometry and the first to demonstrate that differential surface sugar expression is growth phase and strain dependent. ?? American Society of Parasitologists 2004.
Vescovi Rosa, Beatriz Figueiraujo Jabour; de Oliveira, Vívian Campos; Alves, Roberto da Gama
2011-01-01
The Chironomidae occupy different habitats along the lotic system with their distribution determined by different factors such as the substrate characteristics and water speed. The input of vegetable material from the riparian forest allows a higher habitat diversity and food to the benthic fauna. The main aim of this paper is to verify the structure and spatial distribution of the Chironomidae fauna in different mesohabitats in a first order stream located at a Biological Reserve in the southeast of Brazil. In the months of July, August, and September 2007, and in January, February, and March 2008, samples were collected with a hand net (250 µm) in the following mesohabitats: litter from riffles, litter from pools, and sediment from pools. The community structure of each mesohabitat was analyzed through the abundance of organisms, taxa richness, Pielou's evenness, Shannon's diversity, and taxa dominance. Similarity among the mesohabitats was obtained by Cluster analysis, and Chironomidae larvae distribution through the Correspondence analysis. Indicator species analysis was used to identify possible taxa preference for a determined mesohabitat. The analyzed mesohabitats showed high species richness and diversity favored by the large environmental heterogeneity. Some taxa were indicators of the type of mesohabitat. The substrate was the main factor that determined taxa distribution in relation to water flow differences (riffle and pool). Stream characteristics such as low water speed and the presence of natural mechanisms of retention may have provided a higher faunistic similarity between the areas with different flows. The results showed that the physical characteristics of each environment presented a close relationship with the structure and spatial distribution of the Chironomidae fauna in lotic systems. PMID:21529258
Shimabukuro, Erika Mayumi; Trivinho-Strixino, Susana
2018-01-01
Abstract Thin layers of water running over rocky surfaces are characteristic of madicolous habitats, which harbor a peculiar Chironomidae community. However, information on the identity, distribution, and ecology of madicolous chironomids in the Neotropical region are still sparse. The main purpose of this research is to reveal and contribute to the ecology of madicolous Chironomidae species, especially regarding their altitudinal distribution in the Atlantic Forest. Sampling was performed using our own designed emergence traps deployed from 0 to 2700 m a.s.l. in 70 sites in three mountains in southeastern Brazil. Sixty taxa of chironomids were collected and identified, of which only 22 are known to science. Most of the species showed a wider distribution than previously known, both in terms of geographic and altitudinal ranges, while others showed significant association with particular altitudinal bands (as evidenced by the indicator species analysis). Atlantic Forest mountainous regions are known to harbor one of the richest fauna in the world and have been suffering from several types of environmental impacts, including climate change, which will especially affect taxa living in specialized habitats. The narrow range of tolerance to environmental conditions verified for mountain species, and the fact that many of them are rare and endemic, make the conservation efforts in these areas indispensable. PMID:29706784
Sakamoto, Hirokazu; Suzuki, Shigeo; Nagamune, Kisaburo; Kita, Kiyoshi; Matsuzaki, Motomichi
2017-07-01
Some organisms have retained plastids even after they have lost the ability to photosynthesize. Several studies of nonphotosynthetic plastids in apicomplexan parasites have shown that the isopentenyl pyrophosphate biosynthesis pathway in the organelle is essential for their survival. A phytohormone, abscisic acid, one of several compounds biosynthesized from isopentenyl pyrophosphate, regulates the parasite cell cycle. Thus, it is possible that the phytohormone is universally crucial, even in nonphotosynthetic plastids. Here, we examined this possibility using the oyster parasite Perkinsus marinus, which is a plastid-harboring cousin of apicomplexan parasites and has independently lost photosynthetic ability. Fluridone, an inhibitor of abscisic acid biosynthesis, blocked parasite growth and induced cell clustering. Nevertheless, abscisic acid and its intermediate carotenoids did not affect parasite growth or rescue the parasite from inhibition. Moreover, abscisic acid was not detected from the parasite using liquid chromatography mass spectrometry. Our findings show that abscisic acid does not play any significant roles in P. marinus. © 2016 The Authors. Journal of Eukaryotic Microbiology published by Wiley Periodicals, Inc. on behalf of International Society of Protistologists.
Czech Academy of Sciences Publication Activity Database
Gilka, W.; Klonowska-Olejnik, M.; Godunko, Roman J.
2007-01-01
Roč. 76, - (2007), s. 285-291 ISSN 0032-3780 R&D Projects: GA AV ČR 1QS500070505 Grant - others:Institute of Environmental Sciences(PL) BW/V/INOS/4/06; Institute of Environmental Sciences(PL) DS/WBiNoZ/INoS/756/06; INTAS Fellowship Grant for Young Scientists(BE) 05-109-4162 Institutional research plan: CEZ:AV0Z50070508 Source of funding: R - rámcový projekt EK Keywords : Diptera * Chironomidae * Symbiocladius rhithrogenae Subject RIV: EG - Zoology
Two new species of Stenochironomus Kieffer (Diptera, Chironomidae) from Zhejiang, China
Qi, Xin; Lin, Xiaolong; Liu, Yuedan; Wang, Xinhua
2015-01-01
Abstract Two new species of Stenochironomus Kieffer (Diptera: Chironomidae: Chironominae), Stenochironomus brevissimus sp. n. and Stenochironomus linanensis sp. n., are described from China and the male imagines are illustrated. Stenochironomus brevissimus sp. n. can be separated from the so far known species by having very short and small, spatulate superior volsella with two long setae, whereas Stenochironomus linanensis sp. n. is easily separated from the other species of Stenochironomus by the following characters: wings transparent, body yellow, superior volsella finger-like, with nine long setae, elongated inferior volsella with four long setae and one well developed terminal spine; tergite IX with 10−15 long setae medially. A key to the males of Stenochironomus occurring in China is given. PMID:25685018
An assessment of Chironomidae as quantitative indicators of past climatic change
Energy Technology Data Exchange (ETDEWEB)
Walker, I.R.; Smol, J.P.; Engstrom, D.R.; Birks, H.J.B. (Queen' s University, Kingston, ON (Canada). Dept. of Biology)
1991-06-01
The distribution among Labrador (Canada) lakes of remains from 21 chironomid taxa (aquatic midges) was analysed by means of canonical correspondence analysis (CCA). Tests with partial CCA of three hypotheses revealed that the distributions of chironomid taxa were significantly correlated with summer surface-water temperature and maximum lake depth, but not sediment organic content. In addition, an exploratory CCA revealed possible relationships of chironomid fauna with residual longitude and Fe concentration. A weighted-averaging-regression/calibration model of the chironomid-temperature relationship (derived from a temperature-constrained CCA) allowed the summer surface-water temperature of lakes to be inferred from chironomid remains. Accurate quantitative reconstructions of late glacial and Holocene temperature variations should be possible from fossil Chironomidae. 60 refs., 7 figs., 6 tabs.
Covelo-Soto, Lara; Saura, María; Morán, Paloma
2015-07-01
Lampreys represent one of the most ancient vertebrate lineages enclosing a special interest for genetic and epigenetic studies. The sea lamprey (Petromyzon marinus) is an anadromous species that experiences metamorphosis all the way up to the adult stage. Although representing a gradual process, metamorphosis in this species involves dramatic conversions with regard to physiological together with structural body changes preparing individuals for a marine and parasitic life; in consequence, multiple gene expression modifications are expected. The implications of thyroid hormones and HOX gene expression changes have previously been reported in this species and also in other vertebrate species. Nonetheless, information lacks on how these genes are regulated in lampreys. We here report about the existence of methylation pattern differences between the adult and the larvae sea lamprey life cycle stages making use of the Methylation-Sensitive Amplified Polymorphism (MSAP) technique. Differentially methylated fragment sequencing allowed to establish homologous identities with HOX genes involved in morphogenesis, along with genes related to the water balance and to the osmotic homoeostasis, all associated to a marine environment adaptation. These results provide evidences revealing that DNA methylation plays a role in the epigenetic regulation of the P. marinus post-natal development representing a starting point for future studies. To the best of our knowledge, this is the first study which detects DNA methylation changes associated with metamorphosis in lampreys. Copyright © 2015 Elsevier Inc. All rights reserved.
Simpson, Karl W.
A generic list of North American Chironomidae (Diptera) is presented to help aquatic biologists quickly locate important taxonomic references for the adults, larvae, and pupae of each genus. The list (in chart format) includes literature published through 1981. When recent literature is available, older references are omitted, since the purpose of…
Kranzfelder, Petra; Anderson, Alyssa M; Egan, Alexander T; Mazack, Jane E; Bouchard, R William; Rufer, Moriya M; Ferrington, Leonard C
2015-07-24
Rapid bioassessment protocols using benthic macroinvertebrate assemblages have been successfully used to assess human impacts on water quality. Unfortunately, traditional benthic larval sampling methods, such as the dip-net, can be time-consuming and expensive. An alternative protocol involves collection of Chironomidae surface-floating pupal exuviae (SFPE). Chironomidae is a species-rich family of flies (Diptera) whose immature stages typically occur in aquatic habitats. Adult chironomids emerge from the water, leaving their pupal skins, or exuviae, floating on the water's surface. Exuviae often accumulate along banks or behind obstructions by action of the wind or water current, where they can be collected to assess chironomid diversity and richness. Chironomids can be used as important biological indicators, since some species are more tolerant to pollution than others. Therefore, the relative abundance and species composition of collected SFPE reflect changes in water quality. Here, methods associated with field collection, laboratory processing, slide mounting, and identification of chironomid SFPE are described in detail. Advantages of the SFPE method include minimal disturbance at a sampling area, efficient and economical sample collection and laboratory processing, ease of identification, applicability in nearly all aquatic environments, and a potentially more sensitive measure of ecosystem stress. Limitations include the inability to determine larval microhabitat use and inability to identify pupal exuviae to species if they have not been associated with adult males.
Czech Academy of Sciences Publication Activity Database
Matěna, Josef; Šímová, I.; Brom, J.; Novotná, K.
2016-01-01
Roč. 113, January (2016), s. 122-129 E-ISSN 1802-8829 Institutional support: RVO:60077344 Keywords : Diptera * Chironomidae * Chironomus aprilinus * coal mining * hydric restoration * saline inland waters * fertilization Subject RIV: EH - Ecology, Behaviour Impact factor: 1.167, year: 2016
Cytogenetics of a parthenogenetic Arctic species of Micropsectra (Diptera, Chironomidae)
Porter, David L.; Martin, Jon
2011-01-01
Abstract Micropsectra sedna (Oliver, 1976) is a parthenogenetic midge from the Canadian Arctic. The parthenogenetic mechanism is apomictic thelytoky, with a restitutional division during oogenesis, as found in other parthenogenetic Chironomidae. It is triploid, with two similar chromosome sets, and the third is relatively dissimilar, pairing little with the diploid set. Two karyotypes were observed: a single individual with eight polytene elements in the salivary glands (3n=12), considered standard, while the majority of larvae showed only seven polytene chromosomes (3n=11). Hybrid speciation is considered likely, although chromosomal recombination following the origin of thelytoky has played some part in karyotype evolution. A single morphologically distinct larva was also found, which might be the donor of the haploid chromosome set. The apomictic restitutional system is compared to that of the other, independently derived, parthenogenetic Chironomids to assess the extent of similarity between species. PMID:24260638
Gray, Brian R.; Bushek, David; Drane, J. Wanzer; Porter, Dwayne
2009-01-01
Infection levels of eastern oysters by the unicellular pathogen Perkinsus marinus have been associated with anthropogenic influences in laboratory studies. However, these relationships have been difficult to investigate in the field because anthropogenic inputs are often associated with natural influences such as freshwater inflow, which can also affect infection levels. We addressed P. marinus-land use associations using field-collected data from Murrells Inlet, South Carolina, USA, a developed, coastal estuary with relatively minor freshwater inputs. Ten oysters from each of 30 reefs were sampled quarterly in each of 2 years. Distances to nearest urbanized land class and to nearest stormwater outfall were measured via both tidal creeks and an elaboration of Euclidean distance. As the forms of any associations between oyster infection and distance to urbanization were unknown a priori, we used data from the first and second years of the study as exploratory and confirmatory datasets, respectively. With one exception, quarterly land use associations identified using the exploratory dataset were not confirmed using the confirmatory dataset. The exception was an association between the prevalence of moderate to high infection levels in winter and decreasing distance to nearest urban land use. Given that the study design appeared adequate to detect effects inferred from the exploratory dataset, these results suggest that effects of land use gradients were largely insubstantial or were ephemeral with duration less than 3 months.
Myofibril Changes in the Copepod Pseudodiaptomus marinus Exposed to Haline and Thermal Stresses.
Ibrahim, Ali; Souissi, Anissa; Leray, Aymeric; Héliot, Laurent; Vandenbunder, Bernard; Souissi, Sami
2016-01-01
Copepods are small crustaceans capable to survive in various aquatic environments. Their responses to changes in different external factors such as salinity and temperature can be observed at different integration levels from copepod genes to copepod communities. Until now, no thorough observation of the temperature or salinity effect stresses on copepods has been done by optical microscopy. In this study, we used autofluorescence to visualize these effects on the morphology of the calanoid copepod Pseudodiaptomus marinus maintained during several generations in the laboratory at favorable and stable conditions of salinity (30 psu) and temperature (18°C). Four different stress experiments were conducted: at a sharp decrease in temperature (18 to 4°C), a moderate decrease in salinity (from 30 to 15 psu), a major decrease in salinity (from 30 to 0 psu), and finally a combined stress with a decrease in both temperature and salinity (from 18°C and 30 psu to 4°C and 0 psu). After these stresses, images acquired by confocal laser scanning microscopy (CLSM) revealed changes in copepod cuticle and muscle structure. Low salinity and/or temperature stresses affected both the detection of fluorescence emitted by muscle sarcomeres and the distance between them. In the remaining paper we will use the term sarcomeres to describe the elements located within sarcomeres and emitted autofluorescence signals. Quantitative study showed an increase in the average distance between two consecutive sarcomeres from 2.06 +/- 0.11 μm to 2.44 +/- 0.42 μm and 2.88 +/- 0.45μm after the exposure to major haline stress (18°C, 0 psu) and the combined stress (4°C, 0 psu), respectively. These stresses also caused cuticle cracks which often occurred at the same location, suggesting the cuticle as a sensitive area for osmoregulation. Our results suggest the use of cuticular and muscle autofluorescence as new biomarkers of stress detectable in formalin-preserved P. marinus individuals. Our
Chordas, Stephen W.; Hudson, Patrick L.; Chapman, Eric G.
2004-01-01
The dipteran fauna of Arkansas is generally poorly known. A previous study of the Aquatic macroinvertebrates of the White River National Wildlife Refuge, the largest refuge in Arkansas, reported only 12 diptera taxa out of 219 taxa collected (Chordas et al., 1996). Most of the dipterans from this study were identified only to the family level. The family Chironomidae is a large, diverse group and was predicted to be much more diverse in the refuge than indicated by previous studies. In this study, Chironomidae were targeted, with other aquatic or semiaquatic dipterans also retained, in collections designed to better define the dipteran fauna of the White River National Wildlife Refuge. Adult dipterans were collected from 22 sites within the refuge using sweep-nets, two types of blacklight traps, and lighted fan traps in June of 2001. Specimens from previous studies were retrieved and identified to the lowest possible taxonomic level. A total of 4,917 specimens representing 122 taxa was collected. The 122 taxa were comprised of the following: two chaoborids, 83 chironomids, 15 culicids, nine tabanids, and 13 tipulids. Of these, 46 species are new state records for Arkansas. Nine undescribed species of chironomids were collected, and eight species records represent significant range extensions.
THE CHIRONOMIDAE ASSEMBLAGES IN SOMESUL MIC RIVER (ROMANIA DURING 1996 AND 1997
Directory of Open Access Journals (Sweden)
Maria-Monica Tudorancea
2001-01-01
Full Text Available The communities of Chironomidae larvae in the Gilau – Gherla sector of the Somesul Mic River (Transylvania, Romania were studied during 1996 and 1997 in order to compare their species composition and to see if their component species could be good indicators for water quality deterioration. A total of 102 species were recorded, out of which 12 are new records for the Romanian fauna. Four of these species are known only from East Asia and from the North America. Some species such as Chironomus thumi, Microcricotopus bicolor, Dicrotendipes nervosus and Dicrotendipes notatus occurred in organically enriched waters. Other species, such as Cricotopus algarum, Cricotopus bicinctus, Cricotopus tremulus and Cricotopus trifasciatus occurred in both clean and organically polluted water which indicate they are not good bioindicators for water quality deterioration.
Elimination of super(14)C-bisazir residues in adult sea lamprey (Petromyzon marinus)
Allen, J.L.; Dawson, V.K.
1987-01-01
Bisazir (P.P-bis(1-aziridinyl)-N-methylphosphinothioic amide), a chemosterilant, was administered to sea lampreys (Petromyzon marinus ) by intraperitoneal injection of 100 mg/kg or by immersion for 2 h in a 100- mg/L aqueous solution of the chemical. Whole body analysis of the injected lampreys showed that total residue concentrations decreased to 4.65 in males and 10.07 in females during the first day after injection, and to 1.46 in males and 3.74 in females after 10 days of withdrawal. Lampreys exposed by bath immersion contained residues of about 25 mu g/g of tissue immediately after exposure. The concentration ( mu g/g) decreased to 1.02 in males and 2.11 in females after 1 day of withdrawal and to 0.51 in males and 0.85 in females after 10 days.
Sghaier, Haïtham
2015-06-30
The Geodermatophilaceae are unique model systems to study the ability to thrive on or within stones and their proteogenomes (referring to the whole protein arsenal encoded by the genome) could provide important insight into their adaptation mechanisms. Here we report the detailed comparative genome analysis of Blastococcus saxobsidens (Bs), Modestobacter marinus (Mm) and Geodermatophilus obscurus (Go) isolated respectively from the interior and the surface of calcarenite stones and from desert sandy soils. The genome-scale analysis of Bs, Mm and Go illustrates how adaptation to these niches can be achieved through various strategies including ‘molecular tinkering/opportunism’ as shown by the high proportion of lost, duplicated or horizontally transferred genes and ORFans. Using high-throughput discovery proteomics, the three proteomes under unstressed conditions were analyzed, highlighting the most abundant biomarkers and the main protein factors. Proteomic data corroborated previously demonstrated stone-related ecological distribution. For instance, these data showed starvation-inducible, biofilm-related and DNA-protection proteins as signatures of the microbes associated with the interior, surface and outside of stones, respectively.
Sghaier, Haï tham; Hezbri, Karima; Ghodhbane-Gtari, Faten; Pujic, Petar; Sen, Arnab; Daffonchio, Daniele; Boudabous, Abdellatif; Tisa, Louis S; Klenk, Hans-Peter; Armengaud, Jean; Normand, Philippe; Gtari, Maher
2015-01-01
The Geodermatophilaceae are unique model systems to study the ability to thrive on or within stones and their proteogenomes (referring to the whole protein arsenal encoded by the genome) could provide important insight into their adaptation mechanisms. Here we report the detailed comparative genome analysis of Blastococcus saxobsidens (Bs), Modestobacter marinus (Mm) and Geodermatophilus obscurus (Go) isolated respectively from the interior and the surface of calcarenite stones and from desert sandy soils. The genome-scale analysis of Bs, Mm and Go illustrates how adaptation to these niches can be achieved through various strategies including ‘molecular tinkering/opportunism’ as shown by the high proportion of lost, duplicated or horizontally transferred genes and ORFans. Using high-throughput discovery proteomics, the three proteomes under unstressed conditions were analyzed, highlighting the most abundant biomarkers and the main protein factors. Proteomic data corroborated previously demonstrated stone-related ecological distribution. For instance, these data showed starvation-inducible, biofilm-related and DNA-protection proteins as signatures of the microbes associated with the interior, surface and outside of stones, respectively.
Observations of cocooned Hydrobaenus (Diptera: Chironomidae) larvae in Lake Michigan
Tucker, Taaja R.; Hudson, Patrick L.; Riley, Stephen
2016-01-01
Larvae of the family Chironomidae have developed a variety of ways to tolerate environmental stress, including the formation of cocoons, which allows larvae to avoid unfavorable temperature conditions, drought, or competition with other chironomids. Summer cocoon formation by younger instars of the genus Hydrobaenus Fries allows persistence through increased temperatures and/or intermittent dry periods in arid regions or temporary habitats, but this behavior was not observed in the Great Lakes until the current study. Cocoon-aestivating Hydrobaenus sp. larvae were found in benthic grab samples collected in 2010–2013 near Sleeping Bear Dunes National Lakeshore in northern Lake Michigan with densities up to 7329/m2. The aestivating species was identified as Hydrobaenus johannseni (Sublette, 1967), and the associated chironomid community was typical for an oligotrophic nearshore system. Hydrobaenus cocoon formation in the Great Lakes was likely previously unnoticed due to the discrepancies between the genus' life history and typical benthos sampling procedures which has consequences for describing chironomid communities where Hydrobaenus is present.
Smith, Jeramiah J; Kuraku, Shigehiro; Holt, Carson; Sauka-Spengler, Tatjana; Jiang, Ning; Campbell, Michael S; Yandell, Mark D; Manousaki, Tereza; Meyer, Axel; Bloom, Ona E; Morgan, Jennifer R; Buxbaum, Joseph D; Sachidanandam, Ravi; Sims, Carrie; Garruss, Alexander S; Cook, Malcolm; Krumlauf, Robb; Wiedemann, Leanne M; Sower, Stacia A; Decatur, Wayne A; Hall, Jeffrey A; Amemiya, Chris T; Saha, Nil R; Buckley, Katherine M; Rast, Jonathan P; Das, Sabyasachi; Hirano, Masayuki; McCurley, Nathanael; Guo, Peng; Rohner, Nicolas; Tabin, Clifford J; Piccinelli, Paul; Elgar, Greg; Ruffier, Magali; Aken, Bronwen L; Searle, Stephen MJ; Muffato, Matthieu; Pignatelli, Miguel; Herrero, Javier; Jones, Matthew; Brown, C Titus; Chung-Davidson, Yu-Wen; Nanlohy, Kaben G; Libants, Scot V; Yeh, Chu-Yin; McCauley, David W; Langeland, James A; Pancer, Zeev; Fritzsch, Bernd; de Jong, Pieter J; Zhu, Baoli; Fulton, Lucinda L; Theising, Brenda; Flicek, Paul; Bronner, Marianne E; Warren, Wesley C; Clifton, Sandra W; Wilson, Richard K; Li, Weiming
2013-01-01
Lampreys are representatives of an ancient vertebrate lineage that diverged from our own ~500 million years ago. By virtue of this deeply shared ancestry, the sea lamprey (P. marinus) genome is uniquely poised to provide insight into the ancestry of vertebrate genomes and the underlying principles of vertebrate biology. Here, we present the first lamprey whole-genome sequence and assembly. We note challenges faced owing to its high content of repetitive elements and GC bases, as well as the absence of broad-scale sequence information from closely related species. Analyses of the assembly indicate that two whole-genome duplications likely occurred before the divergence of ancestral lamprey and gnathostome lineages. Moreover, the results help define key evolutionary events within vertebrate lineages, including the origin of myelin-associated proteins and the development of appendages. The lamprey genome provides an important resource for reconstructing vertebrate origins and the evolutionary events that have shaped the genomes of extant organisms. PMID:23435085
Baker, Leanne F; Mudge, Joseph F; Houlahan, Jeff E; Thompson, Dean G; Kidd, Karen A
2014-09-01
Laboratory and mesocosm experiments have demonstrated that some glyphosate-based herbicides can have negative effects on benthic invertebrate species. Although these herbicides are among the most widely used in agriculture, there have been few multiple-stressor, natural system-based investigations of the impacts of glyphosate-based herbicides in combination with fertilizers on the emergence patterns of chironomids from wetlands. Using a replicated, split-wetland experiment, the authors examined the effects of 2 nominal concentrations (2.88 mg acid equivalents/L and 0.21 mg acid equivalents/L) of the glyphosate herbicide Roundup WeatherMax, alone or in combination with nutrient additions, on the emergence of Chironomidae (Diptera) before and after herbicide-induced damage to macrophytes. There were no direct effects of treatment on the structure of the Chironomidae community or on the overall emergence rates. However, after macrophyte cover declined as a result of herbicide application, there were statistically significant increases in emergence in all but the highest herbicide treatment, which had also received no nutrients. There was a negative relationship between chironomid abundance and macrophyte cover on the treated sides of wetlands. Fertilizer application did not appear to compound the effects of the herbicide treatments. Although direct toxicity of Roundup WeatherMax was not apparent, the authors observed longer-term impacts, suggesting that the indirect effects of this herbicide deserve more consideration when assessing the ecological risk of using herbicides in proximity to wetlands. © 2014 SETAC.
Chu, Fu-Lin E; Lund, Eric; Soudant, Philippe; Harvey, Ellen
2002-02-01
The capability of synthesizing fatty acids de novo in the meront stage of the oyster protozoan parasite, Perkinsus marinus, was investigated employing stable-isotope-labeled precursors (1,2 13C-acetate and palmitic-d(31) acid). Fatty acid methyl esters derived from 1,2 13C-acetate and palmitic-d(31) acid were analyzed using gas chromatography/mass spectrometry and gas chromatography/flame ionization detection. Results revealed that in vitro cultured P. marinus meronts utilized 13C-acetate to synthesize a range of saturated and unsaturated fatty acids. The saturated fatty acids 14:0, 16:0, 18:0, 20:0, 22:0, 24:0 and the unsaturated fatty acids, 18:1(n-9), 18:2(n-6), 20:1(n-9), 20:2(n-6), 20:2(n-9), 20:3(n-6), 20:4(n-6) were found to contain 13C, after 7, 14, and 21 days incubation with the precursor. This indicates that meronts can synthesize fatty acid de novo using acetate as a substrate. Meronts efficiently elongated 16:0-d(31) to 18:0, 20:0, 22:0, 24:0, but desaturation activity was limited, after 7 and 14 days cultivation. Only a small quantity of 18:1-d(29) was detected. This suggests that meronts cannot directly convert exogenous palmitic acid or its products of elongation to unsaturated counterparts. The ability to synthesize 20:4(n-6) from acetate is particularly interesting. No parasitic protozoan has been reported to be capable of synthesizing long chain essential fatty acids, such as 20:4(n-6) de novo. Future study will be directed to determine whether the observed in vitro activities indeed reflect the in vivo activities, when meronts are associated with the host.
Directory of Open Access Journals (Sweden)
- -
2012-06-01
Full Text Available Functional characters of polythene chromosomes and chromosomal rearrangements in salivary glands of 177 larvae of Glyptotendipes glaucus (Diptera, Chironomidae from reservoirs of Russia and Ukraine (Chernobyl have been analysed. Similarity of the populations studied based on a pool of chromosomal reorganizations has been established. The general types of inversions in chromosomal arms A, B, D and E have been detected. Influence of radioactive pollution (Chernobyl on functional changes of a nucleus, Balbiani rings, puffs, morphology of disks and interdisks is revealed.
Chironomidae larvae (Diptera) of Neotropical floodplain: overlap niche in different habitats.
Butakka, C M M; Ragonha, F H; Takeda, A M
2014-05-01
The niche overlap between trophic groups of Chironomidae larvae in different habitats was observed between trophic groups and between different environments in Neotropical floodplain. For the evaluation we used the index of niche overlap (CXY) and analysis of trophic networks, both from the types and amount of food items identified in the larval alimentary canal. In all environments, the larvae fed on mainly organic matter such as plants fragments and algae, but there were many omnivore larvae. Species that have high values of food items occurred in diverse environments as generalists with great overlap niche and those with a low amount of food items with less overlap niche were classified as specialists. The largest number of trophic niche overlap was observed among collector-gatherers in connected floodplain lakes. The lower values of index niche overlap were predators. The similarity in the diet of different taxa in the same niche does not necessarily imply competition between them, but coexistence when the food resource is not scarce in the environment even in partially overlapping niches.
Moses, Sara K; Polkinghorne, Christine N; Mattes, William P; Beesley, Kimberly M
2018-01-01
Mercury concentrations were measured in eggs, larvae, and adult spawning-phase sea lampreys (Petromyzon marinus) collected in tributaries of Lake Superior to investigate spatial and ontogenetic variation. There were significant differences in mercury concentrations between all three life stages, with levels highest in adults (mean = 3.01 µg/g), followed by eggs (mean = 0.942 µg/g), and lowest in larvae (mean = 0.455 µg/g). There were no significant differences in mercury concentrations by location for any life stage or by sex in adults. Mercury was not correlated with adult or larval lamprey length or mass. Mercury levels in adult lampreys exceeded U.S. and Canadian federal guidelines for human consumption. Mercury concentrations in all life stages exceeded criteria for the protection of piscivorous wildlife, posing a threat to local fish, birds, and mammals. High mercury levels in adult lampreys combined with their semelparous life history make them a potential source of lake-derived mercury to spawning streams.
Silva, F L; Wiedenbrug, S
2014-02-01
In this study, we use DNA barcodes for species delimitation to solve taxonomic conflicts in 86 specimens of 14 species belonging to the Corynoneura group (Diptera: Chironomidae: Orthocladiinae), from the Atlantic Forest, Brazil. Molecular analysis of cytochrome c-oxidase subunit I (COI) gene sequences supported 14 cohesive species groups, of which two similar groups were subsequently associated with morphological variation at the pupal stage. Eleven species previously described based on morphological criteria were linked to DNA markers. Furthermore, there is the possibility that there may be cryptic species within the Corynoneura group, since one group of species presented internal grouping, although no morphological divergence was observed. Our results support DNA-barcoding as an excellent tool for species delimitation in groups where taxonomy by means of morphology is difficult or even impossible.
Daytime avoidance of chemosensory alarm cues by adult sea lamprey (Petromyzon marinus)
Di Rocco, Richard; Belanger, Cowan; Imre, István; Brown, Grant; Johnson, Nicholas S.
2014-01-01
Sea lamprey (Petromyzon marinus) avoid damage-released and predator chemosensory cues at night, but their response to these cues during the day is unknown. Here, we explored (i) whether sea lamprey avoid these cues during the day and (ii) the effect of water temperature on the avoidance of chemosensory alarm cues in two diurnal laboratory experiments. We hypothesized that daytime activity would be temperature-dependent and that only sea lamprey vulnerable to predation (i.e., not hiding) would behaviourally respond to chemosensory alarm cues. Ten groups of ten sea lamprey were exposed to one of a variety of potential chemosensory cues. The experiments were conducted over a range of temperatures to quantify the effect of temperature on avoidance behaviour. Consistent with our hypothesis, a higher proportion of animals were active during daytime as water temperature increased. Moving sea lamprey showed an avoidance response to 2-phenylethylamine (a compound found in mammalian urine) and human saliva once water temperatures had risen to mean (±SD) = 13.7 (±1.4) °C. Resting and hiding sea lamprey did not show an avoidance response to any of the experimental stimuli.
Drayson, Nick; Cranston, Peter S; Krosch, Matt N
2015-02-16
The Australian species of the Orthocladiinae genus Cricotopus Wulp (Diptera: Chironomidae) are revised for larval, pupal, adult male and female life stages. Eleven species, ten of which are new, are recognised and keyed, namely Cricotopus acornis Drayson & Cranston sp. nov., Cricotopus albitarsis Hergstrom sp. nov., Cricotopus annuliventris (Skuse), Cricotopus brevicornis Drayson & Cranston sp. nov., Cricotopus conicornis Drayson & Cranston sp. nov., Cricotopus hillmani Drayson & Cranston, sp. nov., Cricotopus howensis Cranston sp. nov., Cricotopus parbicinctus Hergstrom sp. nov., Cricotopus tasmania Drayson & Cranston sp. nov., Cricotopus varicornis Drayson & Cranston sp. nov. and Cricotopus wangi Cranston & Krosch sp. nov. Using data from this study, we consider the wider utility of morphological and molecular diagnostic tools in untangling species diversity in the Chironomidae. Morphological support for distinguishing Cricotopus from Paratrichocladius Santo-Abreu in larval and pupal stages appears lacking for Australian taxa and brief notes are provided concerning this matter.
Czech Academy of Sciences Publication Activity Database
Frouz, Jan; Lobinske, R.J.; Yaqub, A.; Ali, A.
2007-01-01
Roč. 23, č. 3 (2007), s. 355-358 ISSN 8756-971X Institutional research plan: CEZ:AV0Z60660521 Keywords : chironomidae larvae * gut pH * Bacillus thuringiensis serovar israelensis Subject RIV: EH - Ecology, Behaviour Impact factor: 0.706, year: 2007
DEFF Research Database (Denmark)
Christensen, Asbjørn; Jensen, Henrik; Mosegaard, Henrik
2008-01-01
We have calculated a time series of larval transport indices for the central and southern North Sea covering 1970-2004, using a combined three-dimensional hydrodynamic and individual-based modelling framework for studying sandeel (Ammodytes marinus) eggs, larval transport, and growth. The egg phase...... is modelled by a stochastic, nonlinear degree-day model describing the extended hatch period. The larval growth model is parameterized by individually back-tracking the local physical environment of larval survivors from their catch location and catch time. Using a detailed map of sandeel habitats...... analyzed, and we introduce novel a scheme to quantify direct and indirect connectivity on equal footings in terms of an interbank transit time scale....
ALIMENTACIÓN DE BUFO MARINUS (LINNAEUS, 1758 (BUFONIDAE: ANURA, EN UNA LOCALIDAD DE SUCRE, COLOMBIA
Directory of Open Access Journals (Sweden)
Sampedro Alcides
2011-12-01
Full Text Available Se realizaron recolectas nocturnas de Bufo marinus en una localidad del departamento de Sucre. Se recolectaron 197 ejemplares, de los cuales 128 fueron hembras y 69 machos. Los ejemplares fueron medidos y pesados y se les practicó una disección para extraer el estómago y determinar aspectos cualitativos (tipo de presas y cuantitativos (número y tamaño de presas. Insectos del orden Hymenoptera fueron las presas de mayor importancia. Los individuos de mayor tamaño ingieren presas más grandes y en menor cantidad mientras que los de menor talla, presas pequeñas, pero en mayor cantidad. La proporción del peso del contenido estomacal en relación con el peso corporal, tanto para hembras como para machos fue similar (6%. Esta especie no parece representar un peligro para la fauna nativa en el departamento de Sucre.
Chironomid (Diptera, Chironomidae species assemblages in northeastern Algerian hydrosystems
Directory of Open Access Journals (Sweden)
N. Chaib
2013-04-01
Full Text Available The aim of this paper was to analyze the distribution of chironomids (Diptera, Chironomidae, and determine their substrate preferences, from two hydrosystems located in northeastern Algeria: the Kebir-East and the Seybouse wadis. Sixty-five species were recorded in 49 sampling sites distributed along the main courses of the two hydrographic nets and their tributaries. The majority of taxa comprised cosmopolitan species widely distributed along these two hydrosystems. Cricotopus (Cricotopus bicinctus showed the highest abundance and frequency of occurrence (29.52% and was widespread in almost all the sampling sites. Species richness ranged from 4 to 23, Shannon diversity between 0.15 and 0.90, Evenness from 0.23 to 1. A cluster analysis was carried out to represent the different groups of sites sharing similar species composition. Agglomerative cluster analysis grouped the sampling sites into four clusters according to the community data. An Indval analysis was then carried out to detect indicator species for each group of the sampling sites. Cricotopus (Isocladius sylvestris was indicator of the first group of the sampling sites. Orthocladius pedestris, Rheocricotopus chalybeatus and C. bicinctus were indicators of the second group, and Polypedilum cultellatum of the third group. The fourth group was not characterized by any species. Indval analysis allowed also to determine species preferences for substrate size: Corynoneura scutellata and Dicrotendipes nervosus emphasized a preference to fine gravel, and Glyptotendipes pallens to fine sand.
DEFF Research Database (Denmark)
Pedersen, S.A.; Lewy, Peter; Wright, P.
1999-01-01
effort, catch per unit effort, yield, fishing and natural mortality. A better understanding of sandeel growth is important for stock and catch predictions because previous studies indicate that the variability of mean weight-at-age is one of the most important factors influencing the precision......Recent investigations suggest that the current treatment of North Sea sandeel (Ammodytes marinus) as a single unit stock may have little biological basis. In order to study regional effects of the fishery on North Sea lesser sandeel it may therefore be important to assess stock dynamics...... of predictions. The Danish weight-at-age data of sandeel are re- analysed to estimate the mean weight-at-age in the catch and the stock and the precision of the estimates. The reliability of the sandeel assessments is discussed in relation to the data sources available and to the knowledge of sandeel biology...
Temperature effects on egg development and larval condition in the lesser sandeel, Ammodytes marinus
Régnier, Thomas; Gibb, Fiona M.; Wright, Peter J.
2018-04-01
Understanding the influence of temperature on egg development and larval condition in planktonic fish is a prerequisite to understanding the phenological impacts of climate change on marine food-webs. The lesser sandeel, Ammodytes marinus (Raitt 1934), is a key trophic link between zooplankton and many piscivorous fish, sea birds and mammals in the northeast Atlantic. Temperature-egg development relationships were determined for batches of lesser sandeel eggs. Hatching began as early as 19 days post fertilisation at 11 °C and as late as 36 days post fertilisation at 6 °C, which is faster than egg development rates reported for closely related species at the lower end of the tested temperature range. The average size of newly hatched larvae decreased with increasing incubation temperatures in early hatching larvae, but this effect was lost by the middle of the hatching period. While the study revealed important temperature effects on egg development rate, predicted variability based on the range of temperatures eggs experience in the field, suggests it is only a minor contributor to the observed inter-annual variation in hatch date.
Olfactory-mediated stream-finding behavior of migratory adult sea lamprey (Petromyzon marinus)
Vrieze, L.A.; Bergstedt, R.A.; Sorensen, P.W.
2011-01-01
Stream-finding behavior of adult sea lamprey (Petromyzon marinus), an anadromous fish that relies on pheromones to locate spawning streams, was documented in the vicinity of an important spawning river in the Great Lakes. Untreated and anosmic migrating sea lampreys were implanted with acoustic transmitters and then released outside the Ocqueoc River. Lampreys swam only at night and then actively. When outside of the river plume, lampreys pursued relatively straight bearings parallel to the shoreline while making frequent vertical excursions. In contrast, when within the plume, lampreys made large turns and exhibited a weak bias towards the river mouth, which one-third of them entered. The behavior of anosmic lampreys resembled that of untreated lampreys outside of the plume, except they pursued a more northerly compass bearing. To locate streams, sea lampreys appear to employ a three-phase odor-mediated strategy that involves an initial search along shorelines while casting vertically, followed by river-water-induced turning that brings them close to the river's mouth, which they then enter using rheotaxis. This novel strategy differs from that of salmonids and appears to offer this poor swimmer adaptive flexibility and suggests ways that pheromonal odors might be used to manage this invasive species.
Directory of Open Access Journals (Sweden)
Juan P. Zanotto-Arpellino
2015-03-01
Full Text Available Chironomidae es una de las familias más abundantes y diversas en los ecosistemas de agua dulce, sin embargo su complejidad sistemática ha sido motivo de su escaso desarrollo en muchos estudios limnológicos. El objetivo de este estudio fue analizar los ensambles de Chironomidae bentónicos y derivantes de un arroyo serrano de la región central de Argentina evaluando abundancia, diversidad y composición de especies en diferentes hábitats fluviales y distintas estaciones del año. Se tomaron muestras cuantitativas de bentos y deriva en el arroyo Achiras (Córdoba, Argentina en hábitats de rabión y corredera, y se registraron variables ambientales en las cuatro estaciones del año, entre 2007 y 2008. Se registró un total de 25 taxones pertenecientes a cuatro subfamilias. Los quironómidos bentónicos constituyeron el 19% de la comunidad de macroinvertebrados, mientras que en deriva representaron el 33%. En el bentos dominó Thienemannimyia sp. y en la deriva, Corynoneura sp. De acuerdo con los resultados de ANOVAs de dos vías, los mayores valores de riqueza taxonómica y densidad bentónica se registraron en el periodo de aguas bajas (otoño e invierno y la diversidad de quirónomidos bentónicos fue mayor en rabión. Por el contrario, para el ensamble de derivantes sólo la equitatividad fue diferente entre hábitats y entre estaciones. El análisis TWINSPAN mostró una separación espacio-temporal de las muestras de bentos, mientras que las muestras de deriva se segregaron sólo temporalmente lo que sugiere que el transporte aguas abajo de los invertebrados homogeniza la variación espacial observada en el bentos. La densidad de bentos y deriva varió de manera similar a través de las estaciones del año y el coeficiente de Jaccard presentó un alto índice de similitud entre bentos y deriva (86%. Este trabajo posibilitó conocer la dinámica temporal y espacial de los quironómidos bentónicos y derivantes en un arroyo serrano. La
Hanner, R H; Ryan, G B
1980-01-01
Renal juxtaglomerular regions were examined in the axolotl (Ambystoma mexicanum and toad (Bufo marinus). Prominent granulated peripolar epithelial cells were found surrounding the origin of the glomerular tuft in the axolotl. These cells resembled the peripolar cells recently discovered in mammalian species. They contained multiple electron-dense cytoplasmic granules, some of which showed a paracrystalline substructure and signs of exocytoxic activity. Such cells were difficult to find and smaller in the toad. In contrast, granulated juxtaglomerular arteriolar myoephithelial cells were much more readily found and larger in the toad than in the axolotl. No consistent differences were noted in juxtaglomerular cells or their granules in response to changes in environmental chloride concentration. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 PMID:7410189
Directory of Open Access Journals (Sweden)
Adriana Felix dos Anjos
2010-04-01
Full Text Available Este estudo teve como objetivo verificar a influência das fases hídricas sobre a composição, a densidade e a dominância das larvas de Chironomidae em diferentes tipos de substratos artificiais. As coletas foram realizadas quinzenalmente, entre os meses de agosto de2004 e dezembro de 2005. A análise de agrupamento revelou diferenças na composição e densidade das morfoespécies entre as fases hídricas e, de acordo com o índice de dominância de Kownacki, Cricotopus sp. foi dominante ou subdominante em todos os substratos e fases hídricas.Na fase de águas baixas, a maior similaridade foi observada entre os substratos de mesma forma. Nesse período, os maiores valores de riqueza e densidade das larvas foram registrados nos substratos em forma de X. Na fase de águas altas, o aumento no nível do rio Paraná influenciou na redução da densidade média das larvas e somente nos substratos de madeira em forma de X e PVC em forma de tubo, cujos materiais favoreceram a melhor fixação das larvas, foramregistrados maiores valores de densidade.This study investigated the influence of hydrological phases on species composition, density and dominance of Chironomidae larvae indifferent types of artificial substrates. Samplings were undertaken fortnightly, between August 2004 and December 2005. Cluster analysis evidenced differences in the species composition and density of Chironomidae morphospecies among hydrological phases; according to the Kownacki dominance index, Cricotopus sp. was dominant or subdominant in all substrates and hydrological phases. During the low water phase, the greatest similarity was observed among the substrateswith the same shape. In this period, the highest values of species richness and density of larvae were registered in X-shaped substrates. During the high water phase, the rise in the level of the Paraná River influenced on the reduction of mean larvae density, and only in wooden X-shaped and tube-shaped PVC
International Nuclear Information System (INIS)
Helberg, Morten; Bustnes, Jan Ove; Erikstad, Kjell Einar; Kristiansen, Kai Ove; Skaare, Janneche Utne
2005-01-01
The great black-backed gull Larus marinus is a top predator in subarctic and temperate marine ecosystems, and the aim of this study was to investigate if organochlorines (OCs) were related to reproductive performance in this species at the subarctic parts of the Norwegian Coast. We measured blood levels of various OCs in 53 breeding birds. The OC levels were relatively low compared to levels found in nearby arctic areas. In females, however, there was a significant positive relationship between blood concentrations of OCs, especially hexachlorobenzene (HCB) and, p,p'-dichlorodiphenyldichloroethylene (DDE), and egg laying date, and a positive relationship between the probability of nest predation and blood concentration of β-hexachlorocyclohexane (β-HCH), oxychlordane, and DDE. In females with high levels of OCs, especially persistent polychlorinated biphenyls (PCBs), there was also a decline in egg volume as egg laying progressed; i.e. the second and third laid egg were relatively smaller, compared to females with low OC levels. No relationships between reproductive parameters and OC levels were found in males. - Elevated blood concentrations of organochlorine contaminants correlate with poor reproductive performance in female great black-backed gulls
Multiple functions of a multi-component mating pheromone in sea lamprey Petromyzon marinus
Johnson, N.S.; Yun, S.-S.; Buchinger, T.J.; Li, W.
2012-01-01
The role of the C24 sulphate in the mating pheromone component, 7α,12α,24-trihydroxy-5α-cholan-3-one 24-sulphate (3kPZS), to specifically induce upstream movement in ovulated female sea lampreys Petromyzon marinus was investigated. 7α,12α-dihydroxy-5α-cholan-3-one 24-oic acid (3kACA), a structurally similar bile acid released by spermiated males, but lacking the C24 sulphate ester, was tested in bioassays at concentrations between 10−11 and 10−14 molar (M). 3kACA did not induce upstream movement in females or additional reproductive behaviours. In contrast, spermiated male washings induced upstream movement, prolonged retention on a nest and induced an array of nesting behaviours. Differential extraction and elution by solid-phase extraction resins showed that components other than 3kPZS + 3kACA are necessary to retain females on nests and induce nest cleaning behaviours. All pheromone components, including components in addition to 3kPZS + 3kACA that retain females and induce nest cleaning behaviours were released from the anterior region of the males, as had been reported for 3kPZS. It is concluded that the sea lamprey male mating pheromone has multiple functions and is composed of multiple components.
International Nuclear Information System (INIS)
Michailova, P.; Petrova, N.
1994-01-01
A cytogenetic analysis was carried out on a population of Chironomus balatonicus (Chironomidae, Diptera) from Chernobyl, a highly radioactive area of the Kiev region. Several chromosomal aberrations were established unique to a population of Chironomus balatonicus living in an area contaminated by radioactive waste. Five new heterozygous inversions, deficiencies in arms C, D, E, F and chromatid breaks were found in the irradiated population but not in nonirradiated populations. A pericentric inversion in chromosome AB occurred at a relatively high frequency. Genome aberrations expressed by a heterochromatized 'B' chromosome were evident. In the irradiated and nonirradiated populations common inversions occurred showing variation in their frequency depending on specific environmental conditions. The somatic and also the germ cells were characterized by a number of heteropycnotic nuclei and vacuolized chromosomes. Both the somatic and germ cells showed changes in the structural and functional organization of heterochromatin and this was particularly marked in the telomeric sectors of the chromosomes. The heterochromatin which is extremely sensitive to radioactivity appears to protect euchromatin from adverse environmental conditions
Odume, O. N.; Muller, W. J.; Palmer, C. G.; Arimoro, F. O.
Swartkops River is located in Eastern Cape of South Africa and drains a heavily industrialised catchment and has suffered deterioration in water quality due to pollution. Water quality impairment in the Swartkops River has impacted on its biota. Deformities in the mouth parts of larval Chironomidae, particularly of the mentum, represent sub-lethal effects of exposure to pollutants, and were therefore employed as indictors of pollution in the Swartkops River. Chironomid larvae were collected using the South African Scoring System version 5 (SASS5) protocol. A total of 4838 larvae, representing 26 taxa from four sampling sites during four seasons were screened for mentum deformities. The community incidences of mentum deformity were consistently higher than 8% at Sites 2-4, indicating pollution stress in the river. Analysis of variance (ANOVA) conducted on arcsine transformed data revealed that the mean community incidence of mentum deformity was significantly higher (p 0.05) between seasons across sites. Severe deformities were consistently higher at Site 3. Strong correlations were found between deformity indices and the concentrations of dissolved oxygen (DO), total inorganic nitrogen (TIN), orthophosphate-phosphorus (PO4-P), electrical conductivity (EC) and turbidity.
Chondrogenesis of the branchial skeleton in embryonic sea lamprey, Petromyzon marinus.
Morrison, S L; Campbell, C K; Wright, G M
2000-11-01
This study provides concise temporal and spatial characteristics of branchial chondrogenesis in embryonic sea lamprey, Petromyzon marinus, using high resolution light microscopy, transmission electron, and immunoelectron microscopy. Prechondrogenic condensations representing the first branchial arch appeared first in the mid-region of the third pharyngeal arch at 13 days post-fertilization (pf). Cartilage differentiation, defined by the presence of the unique, fibrillar, non-collagenous matrix protein characteristic of branchial cartilage, was first observed at 14 days pf. Development of lamprey branchial cartilage appeared unusual compared to that in jawed fishes, in that precartilage condensations appear as a one-cell wide orderly stack of flattened cells that extend by the addition of one dorsal and one ventral condensation. Development of lamprey gill arches from three condensations that fuse to form a single skeletal element differs from the developing gill arches of jawed fishes, where more than one skeletal element forms from a single condensation. The initial orderly arrangement of cells in the lamprey branchial prechondrogenic condensations remains throughout development. Once chondrification of the condensations begins, the branchial arches start to grow. Initially, growth occurs as a result of matrix secretion and cell migration. Later in development, the arches grow mainly by cell proliferation and enlargement. This study defines the morphology and timing of lamprey branchial chondrogenesis. Studies of lamprey chondrogenesis provide not only insight into the developmental biology of a unique non-collagenous cartilage in a primitive vertebrate but also into the general evolution of the skeletal system in vertebrates. Copyright 2000 Wiley-Liss, Inc.
Sea lamprey (Petromyzon marinus) parasite-host interactions in the Great Lakes
Bence, James R.; Bergstedt, Roger A.; Christie, Gavin C.; Cochran, Phillip A.; Ebener, Mark P.; Koonce, Joseph F.; Rutter, Michael A.; Swink, William D.
2003-01-01
Prediction of how host mortality responds to efforts to control sea lampreys (Petromyzon marinus) is central to the integrated management strategy for sea lamprey (IMSL) in the Great Lakes. A parasite-host submodel is used as part of this strategy, and this includes a type-2 multi-species functional response, a developmental response, but no numerical response. General patterns of host species and size selection are consistent with the model assumptions, but some observations appear to diverge. For example, some patterns in sea lamprey marking on hosts suggest increases in selectivity for less preferred hosts and lower host survival when preferred hosts are scarce. Nevertheless, many of the IMSL assumptions may be adequate under conditions targeted by fish community objectives. Of great concern is the possibility that the survival of young parasites (parasitic-phase sea lampreys) varies substantially among lakes or over time. Joint analysis of abundance estimates for parasites being produced in streams and returning spawners could address this. Data on sea lamprey marks is a critical source of information on sea lamprey activity and potential effects. Theory connecting observed marks to sea lamprey feeding activity and host mortality is reviewed. Uncertainties regarding healing and attachment times, the probability of hosts surviving attacks, and problems in consistent classification of marks have led to widely divergent estimates of damages caused by sea lamprey. Laboratory and field studies are recommended to provide a firmer linkage between host blood loss, host mortality, and observed marks on surviving hosts, so as to improve estimates of damage.
Directory of Open Access Journals (Sweden)
Erica E. Scheibler
2008-12-01
Full Text Available Se realizó un estudio sobre la composición larval de la familia Chironomidae en un arroyo andino en la localidad de Uspallata (Mendoza, Argentina. Se realizaron muestreos estacionales durante un ciclo anual completo (2001/2002 en tres sitios, siguiendo un gradiente altitudinal. Se midieron variables físico-químicas en campo y laboratorio. La relación entre presencia y abundancia de quironómidos y parámetros ambientales se exploró mediante un análisis de Correspondencia Canónica. Se identificaron siete géneros pertenecientes a cuatro subfamilias: Chironominae, Orthocladiinae, Podonominae y Tanypodinae. Orthocladiinae fue la subfamilia que tuvo mayor riqueza genérica (Cricotopus van der Wulp, Onconeura Andersen & Saether y Parametriocnemus Goetghebuer, densidad y frecuencia de aparición a nivel estacional y espacial. Podonominae (Podonomus Philippi y Podonomopsis Brundin se halló únicamente en SA mientras que Chironominae (Polypedilum Kieffer estuvo presente en UD. Tanypodinae (Pentaneura Philippi se encontró en los tres sitios de muestreo aunque con una densidad menor. Se detectó incremento de la conductividad y temperatura del agua, y disminución del tamaño del sustrato desde SA a UD, lo que coincide con la desaparición de Podonomus y Podonomopsis y la aparición de Polypedilum hacia UD. De este estudio se concluye que el sistema presenta baja riqueza genérica comparada con otros sistemas montañosos de Argentina.A study was conducted on the larval composition of the family Chironomidae in an Andean stream in Uspallata locality (Mendoza, Argentina. Seasonal samplings were performed over a full annual cycle (2001/2002 at three sites, along an altitudinal gradient. Physical and chemical variables were measured in both the field and the laboratory. Relationship between presence and abundance of chironomids and environmental parameters was explored using a Canonical Correspondence analysis. Seven genera were identified
Walaszczyk, Erin J.; Johnson, Nicholas S.; Steibel, Juan Pedro; Li, Weiming
2013-01-01
Synchronization of male and female locomotor rhythmicity can play a vital role in ensuring reproductive success. Several physiological and environmental factors alter these locomotor rhythms. As sea lamprey, Petromyzon marinus, progress through their life cycle, their locomotor activity rhythm changes multiple times. The goal of this study was to elucidate the activity patterns of adult female sea lamprey during the sexual maturation process and discern the interactions of these patterns with exposure to male pheromones. During these stages, preovulated and ovulated adult females are exposed to sex pheromone compounds, which are released by spermiated males and attract ovulated females to the nest for spawning. The locomotor behavior of adult females was monitored in a natural stream with a passive integrated tag responder system as they matured, and they were exposed to a sex pheromone treatment (spermiated male washings) or a control (prespermiated male washings). Results showed that, dependent on the hour of day, male sex pheromone compounds reduce total activity (p reproductive synchrony of mature adults, thus increasing reproductive success in this species.
Directory of Open Access Journals (Sweden)
Nadja Gomes Machado
2015-04-01
Full Text Available Anthropogenic interference in urban lotic systems is a factor affecting the biota of waterbodies. Aquatic macro invertebrates are an important food source for fish and are valuable indicators of water quality. The objective of this work was to study Chironomus larvae (Chironomidae: Diptera distribution along an environmental gradient in Barbado Stream, Cuiabá, MT, Brazil. No individual Chironomus was found in the springs of Barbado Stream, which may indicate preservation of the area. During the study period, we found 40.3 and 94.4 individuals/m2 at points 3 and 4 (low course, respectively. There is eutrophication in these sites due to domestic sewage discharges, indicating low quality water. The Barbado Stream needs restoration projects that include an awareness of the residents of their neighborhood’s environmental importance, and investments in the sanitation sector to prioritize the collection and treatment of wastewater and solid waste collection.
PCB concentrations and activity of sea lamprey Petromyzon marinus vary by sex
Madenjian, Charles P.; Johnson, Nicholas S.; Binder, Thomas R.; Rediske, Richard R.; O'Keefe, James P.
2013-01-01
We determined the polychlorinated biphenyl (PCB) concentrations of 40 male and 40 female adult sea lampreys Petromyzon marinus captured in the Cheboygan River, a tributary to Lake Huron, during May 2011. In addition, we performed a laboratory experiment using passive integrated transponder tags to determine whether male adult sea lampreys were more active than female adult sea lampreys. Sex had a significant effect on PCB concentration, and PCB concentration at a given level of sea lamprey condition was approximately 25 % greater in males than in females. Adjusting for the difference in condition between the sexes, males averaged a 17 % greater PCB concentration compared with females. Results from the laboratory experiment indicated that males were significantly more active than females. The observed sex difference in PCB concentrations was not due to female sea lampreys releasing eggs at spawning because the sea lamprey is semelparous, and we caught the sea lampreys before spawning. Rather, we attributed the sex difference in PCB concentrations to a greater rate of energy expenditure in males compared with females. We proposed that this greater rate of energy expenditure was likely due to greater activity. Our laboratory experiment results supported this hypothesis. A greater resting metabolic rate may also have contributed to a greater rate of energy expenditure. Our findings should eventually be applicable toward improving control of sea lamprey, a pest responsible for considerable damage to fisheries in lakes where it is not native.
Kim, Sungmin; Song, Kyo-Hong; Ree, Han-Il; Kim, Won
2012-01-01
Non-biting midges (Diptera: Chironomidae) are a diverse population that commonly causes respiratory allergies in humans. Chironomid larvae can be used to indicate freshwater pollution, but accurate identification on the basis of morphological characteristics is difficult. In this study, we constructed a mitochondrial cytochrome c oxidase subunit I (COI)-based DNA barcode library for Korean chironomids. This library consists of 211 specimens from 49 species, including adults and unidentified larvae. The interspecies and intraspecies COI sequence variations were analyzed. Sophisticated indexes were developed in order to properly evaluate indistinct barcode gaps that are created by insufficient sampling on both the interspecies and intraspecies levels and by variable mutation rates across taxa. In a variety of insect datasets, these indexes were useful for re-evaluating large barcode datasets and for defining COI barcode gaps. The COI-based DNA barcode library will provide a rapid and reliable tool for the molecular identification of Korean chironomid species. Furthermore, this reverse-taxonomic approach will be improved by the continuous addition of other speceis’ sequences to the library. PMID:22138764
Huang, Ying; Zhu, Liyan; Liu, Guangxing
2006-08-01
In order to study the biological effects by bis(tributyltin) oxide (TBTO) exposure, chronic toxicity tests were conducted on the calanoid copepod Pseudodiaptomus marinus over two generations. The results indicated that nauplii were more sensitive than copepodites. F1 copepods were more vulnerable than F0 copepods and a drastic increase in mortality was observed as the TBTO concentration became higher. Exposure of copepods to 60 ng l -1 TBTO concentration reduced the fecundity and resulted in some females being infecund (in the F0 generation). The time to the first egg sac for females in the F1 generation exposed to 6 ng l -1 TBTO concentration was significantly reduced, and the fecundity of this generation was increased. The female-to-male ratio in the F1 generation exposed to 20 ng l -1 TBTO concentration was significantly reduced. These results show that the current ambient TBT concentration may influence populations of copepods in the coastal environment.
Directory of Open Access Journals (Sweden)
Cristina Márcia de Menezes Butakka
2014-09-01
Full Text Available We characterized the local benthic Chironomidae by analyzing the numerical density, biomass, diversity index of Shannon-Wiener and dominance of larvae in the main channel of the Ivinhema River, in a secondary channel, in five lakes connected to the main channel and in five lakes without connection. Of the 68 taxa identified, Aedokritus sp., Tanytarsus sp., Chironomus strenzkei Fittkau, 1968 and Procladius sp.1 were found in all sampling sites and were considered morphospecies with greater of greatest ecological plasticity. Chironomus strenzkei Fittkau, 1968, contributed with the greatest biomass in the central region of lakes without connection, whereas Aedokritus sp. dominated in the littoral of lakes. The greater values of diversity indices in the littoral region of channels were due to the greater water flow and to the higher food availability in these areas. The dominance indices, by contrast, were greater on the central region of these environments. The littoral region has exclusive characteristics, representing habitats that could play important controlling in the numerical density and index diversity on the ecosystem, whereas that the biomass of benthic invertebrates in the central region in some biotopes would have different spatial probably according organisms drift.
Directory of Open Access Journals (Sweden)
Narcís Prat
2014-12-01
Full Text Available Chironomidae es una familia cosmopolita de dípteros nematóceros que comprende más de 20 000 especies descritas. Sin embargo, la diversidad de géneros y especies presentes en la región andina del Neotrópico es poco conocida. Por tal motivo se desarrolló una clave taxonómica para identificar las pupas y exuvias pupales de 46 géneros de la familia Chironomidae presentes en ríos de alta montaña ubicados en la cordillera de los Andes por encima de los 2 000msnm. Se utilizó material de colección obtenido de levantamientos faunísticos y estudios de biomonitoreo en diferentes ríos y quebradas de Colombia, Ecuador y Perú. La clave incluye ilustraciones y breves descripciones taxonómicas de todos los géneros incluyendo algunos que aún no han sido descritos formalmente. Para estos últimos se siguió la nomenclatura usada por Roback & Coffman (1983. Para los géneros Cricotopus y Género 1 se incluyen claves para la determinación de las morfoespecies más comunes. En el ensamblaje de quironómidos de la región altoandina domina la subfamilia Orthocladiinae (22 géneros seguida por Chironominae (13 géneros, patrón que contrasta con la dominancia de Chironominae en las zonas de menor altura de la región Neotropical. Se encontraron seis géneros pertenecientes a la subfamilia Tanypodinae, mientras que para Podonominae y Diamesinae estuvieron presentes tres y dos géneros respectivamente. Esta clave podría llegar a ser muy útil en estudios de la deriva y programas de biomonitoreo de los ríos altoandinos neotropicales.
Conochironomus (Diptera: Chironomidae) in Asia: new and redescribed species and vouchering issues.
Cranston, Peter S
2016-05-09
The presence of the Afro-Australian genus Conochironomus Freeman, 1961 (Diptera: Chironomidae) in Asia has been recognised only informally. An unpublished thesis included Conochironomus from Singapore, and the genus has been keyed from Malaysia without named species. Here, the Sumatran Conochironomus tobaterdecimus (Kikuchi & Sasa, 1980) comb. n. is recorded from Singapore and Thailand. The species is transferred from Sumatendipes Kikuchi & Sasa, 1980, rendering the latter a junior synonym (syn. n.) of Conochironomus Freeman. Conochironomus nuengthai sp. n. and Conochironomus sawngthai sp. n. are described as new to science, based on adult males from Chiang Mai, Thailand. All species conform to existing generic diagnoses for all life stages, with features from male and female genitalia, pupal cephalic tubercles and posterolateral 'spurs' of tergite VIII providing evidence for species distinction. Some larvae are linked to C. tobaterdecimus through molecular barcoding. Variation in other larvae, which clearly belong to Conochironomus and are common throughout Thailand, means that they cannot be segregated to species. Larval habitats include pools in river beds, urban storage reservoirs, drains with moderately high nutrient loadings, and peat swamps. Endochironomus effusus Dutta, 1994 from north-eastern India may be a congener but may differ in adult morphology, thereby precluding formal new combination until discrepancies can be reconciled. Many problems with vouchering taxonomic and molecular material are identified that need to be rectified in the future.
Song, Chao; Wang, Qian; Zhang, Ruilei; Sun, Bingjiao; Wang, Xinhua
2016-02-16
In this study, we tested the utility of the mitochondrial gene cytochrome c oxidase subunit 1 (CO1) as the barcode region to deal with taxonomical problems of Polypedilum (Tripodura) non-biting midges (Diptera: Chironomidae). The 114 DNA barcodes representing 27 morphospecies are divided into 33 well separated clusters based on both Neighbor Joining and Maximum Likelihood methods. DNA barcodes revealed an 82% success rate in matching with morphospecies. The selected DNA barcode data support 37-64 operational taxonomic units (OTUs) based on the methods of Automatic Barcode Gap Discovery (ABGD) and Poisson Tree Process (PTP). Furthermore, a priori species based on consistent phenotypic variations were attested by molecular analysis, and a taxonomical misidentification of barcode sequences from GenBank was found. We could not observe a distinct barcode gap but an overlap ranged from 9-12%. Our results supported DNA barcoding as an ideal method to detect cryptic species, delimit sibling species, and associate different life stages in non-biting midges.
International Nuclear Information System (INIS)
Doi, Hideyuki; Kikuchi, Eisuke; Shikano, Shuichi
2001-01-01
The food sources for Chironomus acerbiphilus larvae (Diptera Chironomidae) were analyzed using carbon and nitrogen stable isotope ratios in Lake Katanuma. Lake Katanuma is a volcanic and strongly acidic lake (average pH 2.2). In Lake Katanuma, potential sources of diets for the chironomid larvae are limited including a benthic diatom (Pinnularia braunii), a phytoplankton (Chlamydomonas acidophila), sulfate oxidizing bacteria, and vascular plants supplied from vegetation surrounding the lake. Based on the average carbon and nitrogen isotope ratios among these potential sources and sediment, benthic diatoms were considered to be most probable food source of the chironomid larvae. δ 13 C values of the chironomid were significantly different among seasons and habitat depths, suggesting that diet of C. acerbiphilus changed seasonally and with habitat depth. (author)
Directory of Open Access Journals (Sweden)
Marcos Callisto
2007-06-01
Full Text Available Our objective was to evaluate the potential use of leaf detritus by chironomid larvae. Field and laboratory experiments were performed using leaves and chironomid species collected in Portugal and Brazil. Laboratory experiments under controlled conditions were done using microbial conditioned senescent leaves of Alnus glutinosa (L. Gaertn, Neriumoleander L., Protium heptaphilum (Aubl. March, Protium brasiliense (Spreng Engl., Myrcia guyanensis(Aubl. DC and Miconia chartacea Triana. Laboratory experiments were performed using specimens collected from leaf litter in local streams. Whenever possible, after the experiments, chironomids were allowed to emerge as adults and identified. In Portugal the following taxa were identified: Micropsectra apposita (Walker, 1856, Polypedilum albicorne (Meigen, 1838,Eukiefferiella claripennis Lundbeck (1898, Rheocricotopus (Psilocricotopus atripes Rempel (1937 and Ablabesmyia Johannsen (1905 (Diptera, Chironomidae. Consumption rates ranged from 0.15 ± 0.10 mg (AFDM of leaf animal-1 day-1 (Micropsectra apposita feeding on Alnus glutinosa up to 0.85 ± 0.33 mg (AFDM of leaf animal-1 day-1 (Polypedilum albicorne feeding on Miconia chartacea. In Brazil, the following taxa were identified from leaves: Phaenopsectra sp., Chironomus spp. and Polypedilum sp. and maximum consumption rates reached 0.47 ± 0.28 (AFDM of leaf mg.animal-1.day-1 (Chironomus Meigen (1803 feeding on Protium heptaphilum. Feeding experiments with laboratory cultured specimens, revealed that some chironomids were unable to feed on decomposing leaves (e.g., C. xanthus Rempel (1939 on P.brasiliensis and M.guyanensis. Our results suggest that some stream chironomids (not typical shredders can use leaf litter of riparian vegetation as a complementary food source.O objetivo foi avaliar o potencial uso de detritos foliares por larvas de Chironomidae. Foram realizados experimentos em campo e em laboratório utilizando folhas e larvas de Chironomidae
Chung-Davidson, Yu-Wen; Davidson, Peter J.; Scott, Anne M.; Walaszczyk, Erin J.; Brant, Cory O.; Buchinger, Tyler; Johnson, Nicholas S.; Li, Weiming
2014-01-01
Biliary atresia is a rare disease of infancy, with an estimated 1 in 15,000 frequency in the southeast United States, but more common in East Asian countries, with a reported frequency of 1 in 5,000 in Taiwan. Although much is known about the management of biliary atresia, its pathogenesis is still elusive. The sea lamprey (Petromyzon marinus) provides a unique opportunity to examine the mechanism and progression of biliary degeneration. Sea lamprey develop through three distinct life stages: larval, parasitic, and adult. During the transition from larvae to parasitic juvenile, sea lamprey undergo metamorphosis with dramatic reorganization and remodeling in external morphology and internal organs. In the liver, the entire biliary system is lost, including the gall bladder and the biliary tree. A newly-developed method called “CLARITY” was modified to clarify the entire liver and the junction with the intestine in metamorphic sea lamprey. The process of biliary degeneration was visualized and discerned during sea lamprey metamorphosis by using laser scanning confocal microscopy. This method provides a powerful tool to study biliary atresia in a unique animal model.
Cranston, Peter S; Martin, Jon; Mulder, Monica; Spies, Martin
2016-08-31
The immature stages are described for the first time for Chironomus (Xenochironomus) australiensis Freeman (Diptera: Chironomidae) and the adult male is redescribed including from type specimens. The species does not belong to Chironomus Meigen or Xenochironomus Kieffer, but is best placed in a modestly expanded Einfeldia Kieffer. Application of this genus name is clarified, including by a lectotype fixation for its type species, E. pectoralis Kieffer, 1924. Einfeldia australiensis (Freeman) comb. n. provides the first record of the genus from Australia; otherwise the genus is reported confidently only from North America, Central America and western Europe to Japan. The immature stages of E. australiensis occur in relatively shallow mesotrophic to eutrophic dune lakes and maars with circum-neutral pH and high conductivity, from southeastern Queensland to southern Australia. The cytology is described briefly from larval salivary glands. Alternative genus placements for the species are discussed, and problems with Einfeldia and connected systematics in the tribe Chironomini are addressed.
Energy Technology Data Exchange (ETDEWEB)
Doi, Hideyuki [Tohoku Univ., Sendai (Japan). Graduate School of Science; Kikuchi, Eisuke; Shikano, Shuichi
2001-12-01
The food sources for Chironomus acerbiphilus larvae (Diptera Chironomidae) were analyzed using carbon and nitrogen stable isotope ratios in Lake Katanuma. Lake Katanuma is a volcanic and strongly acidic lake (average pH 2.2). In Lake Katanuma, potential sources of diets for the chironomid larvae are limited including a benthic diatom (Pinnularia braunii), a phytoplankton (Chlamydomonas acidophila), sulfate oxidizing bacteria, and vascular plants supplied from vegetation surrounding the lake. Based on the average carbon and nitrogen isotope ratios among these potential sources and sediment, benthic diatoms were considered to be most probable food source of the chironomid larvae. {delta}{sup 13}C values of the chironomid were significantly different among seasons and habitat depths, suggesting that diet of C. acerbiphilus changed seasonally and with habitat depth. (author)
A new genus and species of Australian Tanypodinae (Diptera: Chironomidae) tolerant to mine waste.
Cranston, Peter S
2017-05-09
For over 25 years an undescribed Tanypodinae (Diptera: Chironomidae) has been known to dominate the lotic invertebrate assemblage associated with long-term polluting mine adits in Captains Flat, on the Molonglo River, southern New South Wales, Australia. Although known in all life stages, it has been impossible to allocate the species to any described genus. Renewed interest in the taxonomy of the Tanypodinae, particularly associated with molecular investigations and pollution indicator status warrants formal description. All stages conform to tribe Pentaneurini, but each life stage differs in morphological resemblance. Yarrhpelopia Cranston gen. n. is proposed for the taxon previously referred to under the informal code name of 'genus A'. The genus name derives from south-east Australian aboriginal word yarrh, in recognition of its core distribution and presence in flowing waters. A single species, A. norrisi Cranston sp. n., is described, acknowledging the late Professor Richard Norris, an influential Australian limnologist. Larvae dominate the benthos immediately adjacent to mine adits that continue to leach heavy metals (zinc, cadmium, copper and lead) into downstream sediments. A wider distribution includes cleaner near pristine, eastern Australian rivers between 30° and 42°S, but these records are excluded from the type series pending molecular insights into species limits.
Caldwell, Broughton A.; Hudson, Patrick L.; Lenat, David R.; Smith, David
1997-01-01
A revised annotated checklist for the chironomid midges (Diptera: Chironomidae) of the southeastern United States is presented that includes the states of Alabama, Florida, Georgia, North Carolina, South Carolina, and Tennessee. Much of the information concerns occurrence and habitat preference records based upon the authors' data, as well as published and unpublished data. Some information is also presented that includes aspects of biology, habitat preference, bibliographic sources, and nomenclatorial changes. Based upon the present work, the chironomid fauna of the southeastern states is comprised of 189 genera (172 described, 17 informally or unofficially described) and 754 species (505 described, 17 informally or unofficially described, 33 that are assumed for generic or subgeneric presence only, 197 estimated species, and 2 species groups). Several new species synonyms and generic placements are recognized. Thirty-eight genera known from the Nearctic region remain unknown from the southeastern states. Diversity of species was greatest in the subfamily Chironominae, considering named as well as unnamed and estimated species. There were no significant changes in overall regional distribution patterns of subfamilies or habitat preferences form that which has been previously reported. The greatest totals for regional records, habitat types, and state occurrences were the Coastal Plain (378), streams (271), and North Carolina (373), respectively.
Directory of Open Access Journals (Sweden)
Débora Rebechi
2012-04-01
Full Text Available Species of Chironomidae are widely used as bioindicators of water quality, since their larvae undergo morphological deformities when in contact with sediment contaminated with chemicals. In this work we endeavored to study the morphology of head structures (antennae, mandible, mentum, pecten epipharyngis, ventromental plate and premandible throughout the development of the four larval instars of Chironomus sancticaroli Strixino & Strixino, 1981, which can be used in environmental impact analyses. Our results show that it is possible to differentiate among larval instars by doing a quantitative analysis on the number of striae on the ventromental plates. The six structures analyzed changed during larval ontogeny. These changes are part of the ontogeny of the immature stages not exposed to xenobiotics. We believe that the morphological pattern defined in this work can be used for comparisons with ontogenetic changes observed in field studies conducted in polluted environments.
Belyanina, S I
2015-02-01
Cytogenetic analysis was performed on samples of Chironomus plumosus L. (Diptera, Chironomidae) taken from waterbodies of various types in Bryansk region (Russia) and Gomel region (Belarus). Karyotypes of specimens taken from stream pools of the Volga were used as reference samples. The populations of Bryansk and Gomel regions (except for a population of Lake Strativa in Starodubskii district, Bryansk region) exhibit broad structural variation, including somatic mosaicism for morphotypes of the salivary gland chromosome set, decondensation of telomeric sites, and the presence of small structural changes, as opposed to populations of Saratov region. As compared with Saratov and Bryansk regions, the Balbiani ring in the B-arm of chromosome I is repressed in populations of Gomel region. It is concluded that the chromosome set of Ch. plumosus in a range of waterbodies of Bryansk and Gomel regions is unstable.
Epele, Luis Beltrán; Miserendino, María Laura; Brand, Cecilia
2012-01-01
Chironomid substrate—specific associations regarding the nature (organic—inorganic) and stability (stable—unstable) of different habitats were investigated at two low order Patagonian streams, during high and low water periods. Nant y Fall and Glyn rivers were visited twice (October 2007 and March 2008) and seven different habitat types were identified. A total of 60 samples were collected using a Surber sampler (0.09 m -2 and 250 µm) and a set of 23 environmental descriptors including physicochemical parameters and different fractions of particulate organic matter were assessed. 35 Chironomidae taxa were recorded with Orthocladiinae (20), Chironominae (7), and Podonominae (4) being the most well—represented subfamilies. Paratrichocladius sp. 1, Parapsectrocladius sp. 2, Parametriocnemus sp. 1, Pseudochironomus sp., and Rheotanytarsus sp. were the most abundant taxa. According to the relative preference index, at least 14 taxa showed strong affinity for a particular substrate. The structurally complex macrophyte Myriophyllum quitense supported 11 taxa compared with only five taxa found on the less complex Isoetes savatieri. Generally, stable substrates (boulders, cobbles, and rooted plants) supported significantly higher chironomids richness, abundance, and diversity than unstable ones (gravel—sand). Canonical correspondence analysis revealed that detritus (leaves, seeds, and biomass), macrophyte biomass, and secondarily hydraulic variables had high explanatory power on chironomids species composition and structure. This work suggests that more complex substrates showing persistence in the temporal dimension supported a diverse array of chironomids, meaning that the maintenance of natural habitat heterogeneity is essential for the community. Land—use practices having significant effects on ecological stream attributes such as increased turbidity, sediment deposition, and runoff patterns will alter assemblages. Understanding environmental associations
Epele, Luis Beltrán; Miserendino, María Laura; Brand, Cecilia
2012-01-01
Chironomid substrate-specific associations regarding the nature (organic-inorganic) and stability (stable-unstable) of different habitats were investigated at two low order Patagonian streams, during high and low water periods. Nant y Fall and Glyn rivers were visited twice (October 2007 and March 2008) and seven different habitat types were identified. A total of 60 samples were collected using a Surber sampler (0.09 m(-2) and 250 µm) and a set of 23 environmental descriptors including physicochemical parameters and different fractions of particulate organic matter were assessed. 35 Chironomidae taxa were recorded with Orthocladiinae (20), Chironominae (7), and Podonominae (4) being the most well-represented subfamilies. Paratrichocladius sp. 1, Parapsectrocladius sp. 2, Parametriocnemus sp. 1, Pseudochironomus sp., and Rheotanytarsus sp. were the most abundant taxa. According to the relative preference index, at least 14 taxa showed strong affinity for a particular substrate. The structurally complex macrophyte Myriophyllum quitense supported 11 taxa compared with only five taxa found on the less complex Isoetes savatieri. Generally, stable substrates (boulders, cobbles, and rooted plants) supported significantly higher chironomids richness, abundance, and diversity than unstable ones (gravel-sand). Canonical correspondence analysis revealed that detritus (leaves, seeds, and biomass), macrophyte biomass, and secondarily hydraulic variables had high explanatory power on chironomids species composition and structure. This work suggests that more complex substrates showing persistence in the temporal dimension supported a diverse array of chironomids, meaning that the maintenance of natural habitat heterogeneity is essential for the community. Land-use practices having significant effects on ecological stream attributes such as increased turbidity, sediment deposition, and runoff patterns will alter assemblages. Understanding environmental associations of the
Energy Technology Data Exchange (ETDEWEB)
Kennedy, K.; Ciborowski, J. [Windsor Univ., ON (Canada)
2010-07-01
Concerns over the environmental impacts of oil sands extraction in northeastern Alberta has increased as the industry continues to expand. This study examined if the emergence, growth, and dispersal of Chironomidae differ in reclaimed wetlands constructed with oil sands process materials (OSPM) when compared with growth in reference wetlands. Five floating 30 cm diameter halo traps were deployed in various wetlands for a 24 hour period. Exuviae trapped in the surface water film were then collected, identified, and counted. Chironomids grown in laboratories from egg masses collected from 2 OSPM-affected wetlands and 2 reference wetlands were paired according to geographic proximity under controlled conditions for 1 generation. Chironomid larval growth was quantified in situ in the wetlands by reciprocally transferring second instar, second generation culture larva. The dispersal of the larvae was quantified by tabulating the number of adults caught in sticky insect traps located along 3 radially-arranged transects in each wetland. A preliminary analysis has suggested that fewer chironomids emerged from the OSPM-affected wetlands. No differences in dispersal distance between the OSPM-affected and reference wetlands were observed.
International Nuclear Information System (INIS)
Kennedy, K.; Ciborowski, J.
2010-01-01
Concerns over the environmental impacts of oil sands extraction in northeastern Alberta has increased as the industry continues to expand. This study examined if the emergence, growth, and dispersal of Chironomidae differ in reclaimed wetlands constructed with oil sands process materials (OSPM) when compared with growth in reference wetlands. Five floating 30 cm diameter halo traps were deployed in various wetlands for a 24 hour period. Exuviae trapped in the surface water film were then collected, identified, and counted. Chironomids grown in laboratories from egg masses collected from 2 OSPM-affected wetlands and 2 reference wetlands were paired according to geographic proximity under controlled conditions for 1 generation. Chironomid larval growth was quantified in situ in the wetlands by reciprocally transferring second instar, second generation culture larva. The dispersal of the larvae was quantified by tabulating the number of adults caught in sticky insect traps located along 3 radially-arranged transects in each wetland. A preliminary analysis has suggested that fewer chironomids emerged from the OSPM-affected wetlands. No differences in dispersal distance between the OSPM-affected and reference wetlands were observed.
Directory of Open Access Journals (Sweden)
Marcos Callisto
2006-06-01
Full Text Available Commensalism between Corydalus Latreille, 1802 (Megaloptera, Corydalidae and Corynoneura Winnertz, 1846 (Diptera, Chironomidae, Orthocladiinae larvae was recorded in Indaiá stream, at 1,380 m a.s.l. (Parque Nacional da Serra do Cipó, 19º-20ºS, 43º-44ºW and in the headwaters of São Francisco river, at 1,300-1,700 m a.s.l. (Parque Nacional da Serra da Canastra, 20º00'-20º30'S, 46º15'-47º00'W, in Minas Gerais state, Brazil. Seventy eight Corydalus larvae (range 22-88 mm were sampled: 61 in the Indaiá stream and 17 in other two streams. Twelve Corydalus larvae (22-79 mm in the Indaiá stream and three out of 15 larvae in the headwaters of São Francisco river (38-50 mm had Corynoneura, larvae and pupae on their gills (3rd to 6th and a few larvae attached to the abdominal segments of larger Corydalus larvae (> 25 mm. Sixty-nine larvae of Corynoneura were found in the regurgitated material from Corydalus. It is remarkable that by attaching to larger body size predators, prey could become free from predator bouts and could also be transported by them.Comensalismo entre Corydalus Latreille, 1802 (Insecta, Megaloptera, Corydalidae e Corynoneura Winnertz, 1846 (Insecta, Diptera, Chironomidae, Orthocladiinae foi registrado no córrego Indaiá situado a 1.380 m de altitude no Parque Nacional da Serra do Cipó (19-20ºS, 43-44ºW e nas nascentes do rio São Francisco a 1.300-1.700 m de altitude no Parque Nacional da Serra da Canastra (20º00'-20º30'S, 46º15'-47º00'W, Minas Gerais, Brasil. Setenta e oito larvas de Corydalus (tamanhos: 22-88 mm foram coletadas: 61 no córrego Indaiá e 17 em outros córregos. Doze larvas de Corydalus (tamanhos: 22-79 mm no córrego Indaiá e três encontradas nas nascentes do rio São Francisco (tamanhos: 38-50 mm apresentaram larvas e pupas de Corynoneura em suas brânquias (3ª a 6ª e algumas larvas fixadas nos segmentos abdominais de grandes Corydalus (> 25 mm. Sessenta e nove larvas de Corynoneura foram
Directory of Open Access Journals (Sweden)
Rezaei M. Kamali A. and Shapoori M.
2012-01-01
Full Text Available Marine ecosystem pollution is one of the important problems of today environment. In this study the existence of heavy metal in the Namrood River, situated in Firoozkooh in Tehran province, Iran has been investigated. The Namrood River is located near Firoozkooh route, and is affected by pollutant from tourist centers, entertainment, gas stations, nearby villages’ sewage systems, farming effluent, and hatchery farms. In some areas, its water is heavily polluted possibly by heavy metals. After selecting two stations in upstream and downstream of the river, they were sampled three times in both cold and hot seasons of year (mid-March, and June for Chironomidae, and Gammarus plux sediments. The measured heavy metals were cadmium and lead. The results showed that the concentration of cadmium in measured samples varied from 0.010-0.2033 ppm. The concentration of lead in samples varied from 0.11-2.16 ppm. The results also indicated that sediments of samples taken from the upper station in the cold season had a higher proportion of cadmium and a higher concentration of lead than sediments in the lower station during the hot season.
Directory of Open Access Journals (Sweden)
Débora Rebechi
2014-09-01
Full Text Available Low malathion concentrations influence metabolism in Chironomus sancticaroli (Diptera, Chironomidae in acute and chronic toxicity tests. Organophosphate compounds are used in agro-systems, and in programs to control pathogen vectors. Because they are continuously applied, organophosphates often reach water sources and may have an impact on aquatic life. The effects of acute and chronic exposure to the organophosphate insecticide malathion on the midge Chironomus sancticaroli are evaluated. To that end, three biochemical biomarkers, acetylcholinesterase (AChE, alpha (EST-α and beta (EST-β esterase were used. Acute bioassays with five concentrations of malathion, and chronic bioassays with two concentrations of malathion were carried out. In the acute exposure test, AChE, EST-α and EST-β activities declined by 66, 40 and 37%, respectively, at 0.251 µg L-1 and more than 80% at 1.37, 1.96 and 2.51 µg L-1. In chronic exposure tests, AChE and EST-α activities declined by 28 and 15% at 0.251 µg L-1. Results of the present study show that low concentrations of malathion can influence larval metabolism, indicating high toxicity for Chironomus sancticaroli and environmental risk associated with the use of organophosphates.
Ekrem, Torbjørn; Stur, Elisabeth
2017-01-01
Abstract Chironomidae (Diptera) pupal exuviae samples are commonly used for biological monitoring of aquatic habitats. DNA barcoding has proved useful for species identification of chironomid life stages containing cellular tissue, but the barcoding success of chironomid pupal exuviae is unknown. We assessed whether standard DNA barcoding could be efficiently used for species identification of chironomid pupal exuviae when compared with morphological techniques and if there were differences in performance between temperate and tropical ecosystems, subfamilies, and tribes. PCR, sequence, and identification success differed significantly between geographic regions and taxonomic groups. For Norway, 27 out of 190 (14.2%) of pupal exuviae resulted in high-quality chironomid sequences that match species. For Costa Rica, 69 out of 190 (36.3%) Costa Rican pupal exuviae resulted in high-quality sequences, but none matched known species. Standard DNA barcoding of chironomid pupal exuviae had limited success in species identification of unknown specimens due to contaminations and lack of matching references in available barcode libraries, especially from Costa Rica. Therefore, we recommend future biodiversity studies that focus their efforts on understudied regions, to simultaneously use morphological and molecular identification techniques to identify all life stages of chironomids and populate the barcode reference library with identified sequences.
Salas-Massó, Nuria; Andree, Karl B; Furones, M Dolors; Figueras, M José
2016-10-01
The genus Arcobacter is a relatively poorly known group of bacteria, and the number of new species and sequences from non-culturable strains has increased considerably in recent years. This study investigates whether using media that contain NaCl might help to improve the recovery of Arcobacter spp. from marine environments. To this aim, 62 water and shellfish samples were analysed in parallel, with both a commonly used culture method (enrichment in Arcobacter-CAT broth followed by culture on Blood Agar) and a new one that supplements the Arcobacter-CAT enrichment broth with 2.5% NaCl (w/v) followed by culturing on Marine Agar. The new method yielded ca. 40% more positive samples and provided a higher diversity of known (11 vs. 7) and unknown (7 vs. 2) Arcobacter species. Among the 11 known species recovered, Arcobacter marinus and Arcobacter halophilus were isolated only by this new method. No more strains of these species have been isolated since their original descriptions, both of which were based only on a single strain. In view of that, the phenotypic characteristics of these species are re-evaluated in the present study, using the new strains. Strains of A. halophilus had the same phenotypic profile as the type strain. However, some strains of A. marinus differed from the type strain in that they did not hydrolyse indoxyl-acetate, becoming, therefore, the first Arcobacter species to show a varying ability to hydrolyse indoxyl-acetate. This study shows to what extent a simple variation to the culture media can have a big influence on positive samples and on the community of species recovered. Copyright © 2016 Elsevier B.V. All rights reserved.
Kownacki, Andrzej; Woznicka, Olga; Szarek-Gwiazda, Ewa; Michailova, Paraskeva
2016-09-21
Larvae belonging to the family Chironomidae are difficult to identify. The aim of the present study was to describe the larval morphology of G. (G.) glaucus with the aid of a Scanning Electron Microscope (SEM), the karyotype and biology based on materials obtained from laboratory culture. Describing the morphology of larvae, special attention was paid to rarely or never described structures like the maxilla (lacinia and maxillary palp), the long plate situated below the ventromental plate, and plate X situated between lacinia and mentum. The use of SEM allowed also to obtain better images of labrum and ventromental plate. Morphological features of this species have been supplemented by karyotype and biology of larvae in laboratory conditions. Under controlled experimental conditions we found non-synchronous development of G. (G.) glaucus larvae hatched from one egg mass reflected in different lengths of larvae and emerged imagoes.
Weaver, Daniel M.; Coghlan, Stephen M.; Zydlewski, Joseph D.
2018-01-01
Aquatic macroinvertebrates respond to patch dynamics arising from interactions of physical and chemical disturbances across space and time. Anadromous fish, such as sea lamprey, Petromyzon marinus, migrate from the ocean and alter physical and chemical properties of recipient spawning streams. Sea lamprey disturb stream benthos physically through nest construction and spawning, and enrich food webs through nutrient deposition from decomposing carcasses. Sea lamprey spawning nests support greater macroinvertebrate abundance than adjacent reference areas, but concurrent effects of stream bed modification and nutrient supplementation have not been examined sequentially. We added carcasses and cleared substrate experimentally to mimic the physical disturbance and nutrient enrichment associated with lamprey spawning, and characterized effects on macroinvertebrate assemblage structure. We found that areas receiving cleared substrate and carcass nutrients were colonized largely by Simuliidae compared to upstream and downstream control areas that were colonized largely by Hydropsychidae, Philopotamidae, and Chironomidae. Environmental factors such as stream flow likely shape assemblages by physically constraining macroinvertebrate establishment and feeding. Our results indicate potential changes in macroinvertebrate assemblages from the physical and chemical changes to streams brought by spawning populations of sea lamprey.
Fossil Chironomidae (Insecta: Diptera) as Paleothermometers in the African Tropics
Eggermont, H.; Heiri, O.; Russell, J.; Vuille, M.; Audenaert, L.; Klaassen, G.; Verschuren, D.
2008-12-01
Reconstruction of Africa's temperature history from natural climate archives such as lake sediments is essential to amend the current scarcity of information on natural tropical climate and ecosystem variability. Chironomids are well-established paleothermometers in north-temperate/boreal regions, but their potential in tropical lakes has never before been assessed. We surveyed sub-fossil chironomid assemblages in surface sediments from 65 lakes and permanent pools in southwestern Uganda and central/southern Kenya, spanning elevations between 489 and 4575 m asl. Using various subsets of lakes and corresponding Surface-Water Temperatures (SWTemp) and Mean Annual Air Temperatures (MATemp), we developed a series of inference models for quantitative paleotemperature reconstruction. Models using both low-, mid- and high-elevation sites suffer to some extent from the small number of samples between 2500 and 3500 m asl, and from the presence of ecologically distinct but morphologically indistinguishable taxa. Models confined to mountain sites produce poorer error statistics, but are less prone to the biogeographical and taxonomic complexities associated with long climatic gradients. Overall, error statistics compare favourably with those of inference models developed for temperate regions, indicating that fossil assemblages of African Chironomidae can be valuable indicators of past temperature change. We subsequently used these models to evaluate whether high-elevation lakes in the Rwenzori Mountains (>3000 m asl) have been impacted by climate warming in recent centuries by comparing temperatures inferred from chironomid assemblages in modern sediments with those derived from chironomid assemblages in sediments deposited within or briefly after the Little Ice Age (1270-1850 AD). Depending on the model used, between 44 and 63% of the 16 lakes studied indicate significantly warmer temperatures in recent times (corresponding with an average MATemp rise of 0.88 ° C, and
Integrated Taxonomy and DNA Barcoding of Alpine Midges (Diptera: Chironomidae).
Montagna, Matteo; Mereghetti, Valeria; Lencioni, Valeria; Rossaro, Bruno
2016-01-01
Rapid and efficient DNA-based tools are recommended for the evaluation of the insect biodiversity of high-altitude streams. In the present study, focused principally on larvae of the genus Diamesa Meigen 1835 (Diptera: Chironomidae), the congruence between morphological/molecular delimitation of species as well as performances in taxonomic assignments were evaluated. A fragment of the mitochondrial cox1 gene was obtained from 112 larvae, pupae and adults (Diamesinae, Orthocladiinae and Tanypodinae) that were collected in different mountain regions of the Alps and Apennines. On the basis of morphological characters 102 specimens were attributed to 16 species, and the remaining ten specimens were identified to the genus level. Molecular species delimitation was performed using: i) distance-based Automatic Barcode Gap Discovery (ABGD), with no a priori assumptions on species identification; and ii) coalescent tree-based approaches as the Generalized Mixed Yule Coalescent model, its Bayesian implementation and Bayesian Poisson Tree Processes. The ABGD analysis, estimating an optimal intra/interspecific nucleotide distance threshold of 0.7%-1.4%, identified 23 putative species; the tree-based approaches, identified between 25-26 entities, provided nearly identical results. All species belonging to zernyi, steinboecki, latitarsis, bertrami, dampfi and incallida groups, as well as outgroup species, are recovered as separate entities, perfectly matching the identified morphospecies. In contrast, within the cinerella group, cases of discrepancy arose: i) the two morphologically separate species D. cinerella and D. tonsa are neither monophyletic nor diagnosable exhibiting low values of between-taxa nucleotide mean divergence (0.94%); ii) few cases of larvae morphological misidentification were observed. Head capsule color is confirmed to be a valid character able to discriminate larvae of D. zernyi, D. tonsa and D. cinerella, but it is here better defined as a color gradient
Johnson, Nicholas S.; Siefkes, Michael J.; Wagner, C. Michael; Dawson, Heather; Wang, Huiyong; Steeves, Todd; Twohey, Michael; Li, Weiming
2013-01-01
Application of chemical cues to manipulate adult sea lamprey (Petromyzon marinus) behavior is among the options considered for new sea lamprey control techniques in the Laurentian Great Lakes. A male mating pheromone component, 7a,12a,24-trihydroxy-3-one-5a-cholan-24-sulfate (3kPZS), lures ovulated female sea lamprey upstream into baited traps in experimental contexts with no odorant competition. A critical knowledge gap is whether this single pheromone component influences adult sea lamprey behavior in management contexts containing free-ranging sea lampreys. A solution of 3kPZS to reach a final in-stream concentration of 10-12 mol·L-1 was applied to eight Michigan streams at existing sea lamprey traps over 3 years, and catch rates were compared between paired 3kPZS-baited and unbaited traps. 3kPZS-baited traps captured significantly more sexually immature and mature sea lampreys, and overall yearly trapping efficiency within a stream averaged 10% higher during years when 3kPZS was applied. Video analysis of a trap funnel showed that the likelihood of sea lamprey trap entry after trap encounter was higher when the trap was 3kPZS baited. Our approach serves as a model for the development of similar control tools for sea lamprey and other aquatic invaders.
Bowen, Anjanette K.; Weisser, John W.; Bergstedt, Roger A.; Famoye, Felix
2003-01-01
Four electrical factors that are used in pulsed DC electrofishing for larval sea lampreys (Petromyzon marinus) were evaluated in two laboratory studies to determine the optimal values to induce larval emergence over a range of water temperatures and conductivities. Burrowed larvae were exposed to combinations of pulsed DC electrical factors including five pulse frequencies, three pulse patterns, and two levels of duty cycle over a range of seven voltage gradients in two separate studies conducted at water temperatures of 10, 15, and 20°C and water conductivities of 25, 200, and 900 μS/cm. A four-way analysis of variance was used to determine significant (α = 0.05) influences of each electrical factor on larval emergence. Multiple comparison tests with Bonferroni adjustments were used to determine which values of each factor resulted in significantly higher emergence at each temperature and conductivity. Voltage gradient and pulse frequency significantly affected emergence according to the ANOVA model at each temperature and conductivity tested. Duty cycle and pulse pattern generally did not significantly influence the model. Findings suggest that a setting of 2.0 V/cm, 3 pulses/sec, 10% duty, and 2:2 pulse pattern seems the most promising in waters of medium conductivity and across a variety of temperatures. This information provides a basis for understanding larval response to pulsed DC electrofishing gear factors and identifies electrofisher settings that show promise to increase the efficiency of the gear during assessments for burrowed sea lamprey larvae.
Proulx, Isabelle; Martin, Jon; Carew, Melissa; Hare, Landis
2013-11-29
Chironomus Meigen (Diptera, Chironomidae) larvae are usually the largest sediment-burrowing chironomids, and as such often constitute a major part of the freshwater infaunal biomass. However, use of this genus in ecological, environmental and paleoecological studies is hampered by the fact that Chironomus larvae are difficult to identify to species because the larvae of many species are morphologically similar. We used a combination of morphological, cytological and genetic techniques to distinguish Chironomus larvae collected from 31 water bodies located in eastern Canada, producing 17 distinguishable groupings. These groups of larvae were ultimately identified as belonging to 14 known species (C. anthracinus, C. bifurcatus, C. cucini, C. decorus-group sp. 2, C. dilutus, C. entis, C. frommeri, C. harpi, C. maturus, C. nr. atroviridis (sp. 2i), C. ochreatus, C. plumosus, C. staegeri and C. 'tigris') and three other species that remain unidentified (C. sp. NAI-III). No single approach served to delimit and identify larvae of all 17 Chironomus species that we collected. Although we expected that morphological criteria alone would be insufficient, our results suggest that DNA barcoding, using either the mitochondrial cox1 or the nuclear gb2β gene, was also inadequate for separating some Chironomus species. Thus we suggest that multiple approaches will often be needed to correctly identify Chironomus larvae to species.
Jordbro, Ethan J.; Di Rocco, Richard T.; Imre, Istvan; Johnson, Nicholas; Brown, Grant E.
2016-01-01
Recent studies proposed the use of chemosensory alarm cues to control the distribution of invasive sea lamprey Petromyzon marinus populations in the Laurentian Great Lakes and necessitate the evaluation of sea lamprey chemosensory alarm cues on valuable sympatric species such as white sucker. In two laboratory experiments, 10 replicate groups (10 animals each) of migratory white suckers were exposed to deionized water (control), conspecific whole-body extract, heterospecific whole-body extract (sea lamprey) and two potential predator cues (2-phenylethylamine HCl (PEA HCl) and human saliva) during the day, and exposed to the first four of the above cues at night. White suckers avoided the conspecific and the sea lamprey whole-body extract both during the day and at night to the same extent. Human saliva did not induce avoidance during the day. PEA HCl did not induce avoidance at a higher concentration during the day, or at night at the minimum concentration that was previously shown to induce maximum avoidance by sea lamprey under laboratory conditions. Our findings suggest that human saliva and PEA HCl may be potential species-specific predator cues for sea lamprey.
Malek, Jennafer C; Breitburg, Denise L
2016-02-25
Spatial distributions of species can be shaped by factors such as parasites, mortality, and reproduction, all of which may be influenced by differences in physical factors along environmental gradients. In nearshore tidal waters, an elevational gradient in aerial exposure during low tide can shape the spatial distributions of benthic marine organisms. The eastern oyster Crassostrea virginica is an ecologically and economically important species that can dominate both subtidal and intertidal habitats along the east coast of the USA. Our goal was to determine whether prevalence and intensity of Perkinsus marinus (the causative agent of Dermo disease) infections vary along intertidal to subtidal gradients during summer. We used (1) field experiments conducted at 4 sites in the Chesapeake Bay and a Virginia coastal bay, (2) a controlled air-exposure experiment, and (3) field surveys from 7 sites ranging from Maine to North Carolina to test for effects of tidal exposure on infection. Results from our field surveys suggested that high intertidal oysters tend to have higher infection prevalence than subtidal oysters, but there was no effect on infection intensity. Field experiments rarely yielded significant effects of tidal exposure on infection prevalence and intensity. Overall, our study shows that exposure to air may not be a strong driver of infection patterns in this host-parasite system.
Serum and hepatic vitamin A levels in captive and wild marine toads (Bufo marinus).
Berkvens, Charlene N; Lentini, Andrew; Dutton, Christopher J; Pearl, David L; Barker, Ian K; Crawshaw, Graham J
2014-01-01
The captive breeding program for the endangered Puerto Rican crested toad (Peltophryne [Bufo] lemur) has been hampered by an undiagnosed condition called "Brown Skin Disease" (BSD). Toads develop widespread skin darkening, skin thickening and abnormal shedding and eventually succumb to a chronic loss of viability. This project evaluated the marine toad (Bufo marinus) as a model for the PRCT, examining vitamin A deficiency as a potential cause of BSD. Wild caught marine toads had significantly higher liver vitamin A concentrations (61.89 ± 63.49 µg/g) than captive born marine toads (0.58 ± 0.59 µg/g); P<0.001). A significant difference in serum vitamin A concentration was found between the captive and wild caught toads (P=0.013) and between the low vitamin A-fed and wild caught toads (P=0.004), when controlling for liver vitamin A concentrations. After captive toads were treated with topical and/or oral vitamin A, their hepatic vitamin A concentrations were similar to those of the wild toads, averaging 48.41 ± 37.03 µg/g. However, plasma vitamin A concentrations pre- and post-vitamin A supplementation did not differ statistically. We concluded that plasma vitamin A concentrations do not provide a linear indication of liver/body vitamin A status, and that both topical and oral supplementation with an oil-based vitamin A formulation can increase liver stores in amphibians. No evidence of BSD or other signs of deficiency were noted in the marine toads, although this feeding trial was relatively short (127 days). To date, clinical, pathological and research findings do not support vitamin A deficiency as a primary factor underlying BSD. © 2014 Wiley Periodicals, Inc.
Prostaglandins as mediators of acidification in the urinary bladder of Bufo marinus
International Nuclear Information System (INIS)
Frazier, L.W.; Yorio, T.
1990-01-01
Experiments were performed to determine whether prostaglandins (PG) play a role in H+ and NH4+ excretion in the urinary bladder of Bufo marinus. Ten paired hemibladders from normal toads were mounted in chambers. One was control and the other hemibladder received PGE2 in the serosal medium (10(-5) M). H+ excretion was measured by change in pH in the mucosal fluid and reported in units of nmol (100 mg tissue)-1 (min)-1. NH4+ excretion was measured colorimetrically and reported in the same units. The control group H+ excretion was 8.4 +/- 1.67, while the experimental group was 16.3 +/- 2.64 (P less than 0.01). The NH4+ excretion in the experimental and control group was not significantly different. Bladders from toads in a 48-hr NH4+Cl acidosis (metabolic) did not demonstrate this response to PGE2 (P greater than 0.30). Toads were put in metabolic acidosis by gavaging with 10 ml of 120 mM NH4+Cl 3 x day for 2 days. In another experiment, we measured levels of PG in bladders from control (N) and animals placed in metabolic acidosis (MA). Bladders were removed from the respective toad, homogenized, extracted, and PG separated using high-pressure liquid chromatography and quantified against PG standards. The results are reported in ng (mg tissue)-1. PGE2 fraction in N was 1.09 +/- 0.14 and in MA was 3.21 +/- 0.63 (P less than 0.01). PGF1 alpha, F2 alpha and I2 were not significantly different in N and MA toads. Bladders were also removed from N and MA toads, and incubated in Ringer's solution containing [3H]arachidonic acid (0.2 microCi/ml) at 25 degrees C for 2 hr. Bladders were then extracted for PG and the extracts separated by thin layer chromatography. PG were identified using standards and autoradiography, scraped from plates, and counted in a scintillation detector. The results are reported in cpm/mg tissue x hr +/- SEM
Kolosov, Dennis; Bui, Phuong; Donini, Andrew; Wilkie, Mike P; Kelly, Scott P
2017-10-15
This study reports on tight junction-associated MARVEL proteins of larval sea lamprey ( Petromyzon marinus ) and their potential role in ammocoete osmoregulation. Two occludin isoforms (designated Ocln and Ocln-a) and a tricellulin (Tric) were identified. Transcripts encoding ocln , ocln-a and tric were broadly expressed in larval lamprey, with the greatest abundance of ocln in the gut, liver and kidney, ocln-a in the gill and skin, and tric in the kidney. Ocln and Ocln-a resolved as ∼63 kDa and ∼35 kDa MW proteins, respectively, while Tric resolved as a ∼50 kDa protein. Ocln immunolocalized to the gill vasculature and in gill mucous cells while Ocln-a localized to the gill pouch and gill epithelium. Both Ocln and Ocln-a localized in the nephron, the epidermis and the luminal side of the gut. In branchial tissue, Tric exhibited punctate localization, consistent with its presence at regions of tricellular contact. Following ion-poor water (IPW) acclimation of ammocoetes, serum [Na + ] and [Cl - ] decreased, but not [Ca 2+ ], and carcass moisture content increased. In association, Ocln abundance increased in the skin and kidney, but reduced in the gill of IPW-acclimated ammocoetes while Ocln-a abundance reduced in the kidney only. Tric abundance increased in the gill. Region-specific alterations in ocln , ocln-a and tric mRNA abundance were also observed in the gut. Data support a role for Ocln, Ocln-a and Tric in the osmoregulatory strategies of a basal vertebrate. © 2017. Published by The Company of Biologists Ltd.
Directory of Open Access Journals (Sweden)
Wilson Michael D
2009-04-01
Full Text Available Abstract Background The control of onchocerciasis in the African region is currently based mainly on the mass drug administration of ivermectin. Whilst this has been found to limit morbidity, it does not stop transmission. In the absence of a macrofilaricide, there is a need for an integrated approach for disease management, which includes vector control. Vector control using chemical insecticides is expensive to apply, and therefore the use of other measures such as biological control agents is needed. Immature stages of Simulium squamosum, reared in the laboratory from egg masses collected from the field at Boti Falls and Huhunya (River Pawnpawn in Ghana, were observed to be attacked and fed upon by larvae of the chironomid Cardiocladius oliffi Freeman, 1956 (Diptera: Chironomidae. Methods Cardiocladius oliffi was successfully reared in the rearing system developed for S. damnosum s.l. and evaluated for its importance as a biological control agent in the laboratory. Results Even at a ratio of one C. oliffi to five S. squamosum, they caused a significant decrease in the number of adult S. squamosum emerging from the systems (treatments. Predation was confirmed by the amplification of Simulium DNA from C. oliffi observed to have fed on S. squamosum pupae. The study also established that the chironomid flies could successfully complete their development on a fish food diet only. Conclusion Cardiocladius oliffi has been demonstrated as potential biological control agent against S. squamosum.
Cranston, Peter S; Martin, Jon; Spies, Martin
2016-02-15
Polypedilum nubifer (Skuse, 1889), originally described from Australia, is an apparently widespread species of Chironomidae (Diptera) that can attain nuisance densities in some eutrophic water bodies. Appropriate management depends upon the identity and ability to distinguish from potential cryptic taxa. A morphological study of larvae, pupae and adults of both sexes confirmed P. nubifer as widely distributed and frequently abundant, but also revealed two previously cryptic species of limited distribution in northern Australia. These species are described as new and illustrated in all stages here. Polypedilum quasinubifer Cranston sp. n. is described from north-west Queensland, Australia and also from Thailand and Singapore. Polypedilum paranubifer Cranston sp. n. is known only from retention ponds of a uranium mine in Northern Territory, Australia. Unusual morphological features of P. nubifer including alternate Lauterborn organs on the larval antenna, cephalic tubules on the pupa and frontal tubercles on the adult head are present in both new species as well. Newly slide-mounted types of Polypedilum pelostolum Kieffer, 1912 (lectotype designated here) confirm synonymy to Chironomus nubifer Skuse, 1889, examined also as newly-slide mounted types. Reviewed plus new evidence does not support recognition of Tripedilum Kieffer, 1921 as a separate taxon; therefore, Tripedilum is returned to junior synonymy with Polypedilum s. str.
Tang, Lili; Zhang, Zenghu; Zhou, Chao; Cui, Rong; Tian, Yu; Zhang, Yongyu
2018-05-01
A novel Gram-stain-negative, aerobic, non-flagellated, pink-pigmented and rod-shaped strain with gliding motility, designated strain CCMM001 T , was isolated from a mixed culture of Synechococcus species PCC7002 and a natural bacterial community from a sample of offshore seawater from Qingdao, China, during September 2014. The strain contained bacteriochlorophyll a with a small peak at 802 nm and a large in vivo absorption band at 870 nm. Strain CCMM001 T grew optimally at pH 7.0 and 30 °C in the presence of 3 % (w/v) NaCl. Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain CCMM001 T is most closely related to the genus Roseicyclus and its type and only species Roseicyclus mahoneyensis ML6 T with 96.9 % sequence similarity. The polar lipids of strain CCMM001 T consisted of phosphatidylethanolamine, phosphatidylcholine, one unidentified aminolipid, and five unidentified lipids. The predominant isoprenoid quinone was Q-10. The major fatty acids included C18 : 1ω7c and C19 : 0cyclo ω8c. The DNA G+C content of strain CCMM001 T was 63.5 mol%. These phylogenetic, physiological and chemotaxonomic data indicated that strain CCMM001 T represents a novel species of the genus Roseicyclus, for which the name Roseicyclus marinus sp. nov. is proposed. The type strain is CCMM001 T (=MCCC 1K03242 T =KCTC 52641 T ).
Santos, Jeannie N; Giese, Elane G; Maldonado, Arnaldo Júnior; Lanfredi, Reinalda M
2008-02-01
Oswaldocruzia belenensis n. sp. (Strongylida: Molineidae) from the small intestine of Chaunus marinus (L.) from Belém, Pará State, Brazil is described and illustrated by light and scanning electron microscopy. Oswaldocruzia belenensis n. sp. is a neotropical species of this genus, harboring caudal bursa Type II, spicules divided in 3 branches, i.e., a blade, shoe, and fork. The blade is divided in 4 points, of which at least 2 are bifurcated. Cervical alae are absent; there is a simple cephalic vesicle and synlophe with low ridges perpendicular to the body without chitinous supports. The most closely related species are O. bonsi and O. lescurei. Oswaldocruzia belenensis n. sp. differs from O. lescurei and O. bonsi by the number and location of cephalic papillae, rays 2-3 and 5-6 running parallel and slightly separated, ray 6 not overlapping ray 8, and body structure morphometry. Oswaldocruzia belenensis n sp. also differs from O. lescurei by the discontinuity of the longitudinal ridges, the number of subdivisions of the blade, and the absence of extra processes at the bifurcation level of the fork of the spicules. The new species differs from O. bonsi by male and female body dimensions, the symmetry of the caudal bursa, dimension and subdivisions of the spicules without extra processes of the fork, 2 extra processes at the distal division of the blade, and location of ray 7 at the anterior margin of the cloacal aperture. Oswaldocruzia belenensis n. sp. represents the 82nd species assigned to the genus.
Why on the snow? Winter emergence strategies of snow-active Chironomidae (Diptera) in Poland.
Soszyńska-Maj, Agnieszka; Paasivirta, Lauri; Giłka, Wojciech
2016-10-01
A long-term study of adult non-biting midges (Chironomidae) active in winter on the snow in mountain areas and lowlands in Poland yielded 35 species. The lowland and mountain communities differed significantly in their specific composition. The mountain assemblage was found to be more diverse and abundant, with a substantial contribution from the subfamily Diamesinae, whereas Orthocladiinae predominated in the lowlands. Orthocladius wetterensis Brundin was the most characteristic and superdominant species in the winter-active chironomid communities in both areas. Only a few specimens and species of snow-active chironomids were recorded in late autumn and early winter. The abundance of chironomids peaked in late February in the mountain and lowland areas with an additional peak in the mountain areas in early April. However, this second peak of activity consisted mainly of Orthocladiinae, as Diamesinae emerged earliest in the season. Most snow-active species emerged in mid- and late winter, but their seasonal patterns differed between the 2 regions as a result of the different species composition and the duration of snow cover in these regions. Spearman's rank correlation coefficient tests yielded positive results between each season and the number of chironomid individuals recorded in the mountain area. A positive correlation between air temperature, rising to +3.5 °C, and the number of specimens recorded on the snow in the mountain community was statistically significant. The winter emergence and mate-searching strategies of chironomids are discussed in the light of global warming, and a brief compilation of most important published data on the phenomena studied is provided. © 2015 Institute of Zoology, Chinese Academy of Sciences.
Fujita, D S; Takeda, A M; Coutinho, R; Fernandes, F C
2015-11-01
We conducted a study about invertebrates on artificial substrates with different antifouling paints in order to answer the following questions 1) is there lower accumulation of organic matter on substrates with antifouling paints, 2) is invertebrate colonization influenced by the release of biocides from antifouling paints, 3) is the colonization of aquatic invertebrates positively influenced by the material accumulated upon the substrate surface and 4) is the assemblage composition of invertebrates similar among the different antifouling paints? To answer these questions, four structures were installed in the Baía River in February 1st, 2007. Each structure was composed of 7 wood boards: 5 boards painted with each type of antifouling paints (T1, T2, T3, T4 and T5), one painted only with the primer (Pr) and the other without any paint (Cn). After 365 days, we observed a greater accumulation of organic matter in the substrates with T2 and T3 paint coatings. Limnoperna fortunei was recorded in all tested paints, with higher densities in the control, primer, T2 and T3. The colonization of Chironomidae and Naididae on the substrate was positively influenced by L. fortunei density. The non-metric multidimensional scaling (NMDS) of the invertebrate community provided evidence of the clear distinction of invertebrate assemblages among the paints. Paints T2 and T3 were the most similar to the control and primer. Our results suggest that antifouling paints applied on substrates hinder invertebrate colonization by decreasing the density and richness of invertebrates.
Chiu, Ming-Chung; Huang, Chin-Gi; Wu, Wen-Jer; Shiao, Shiuh-Feng
2016-06-01
The life cycle of the freshwater horsehair worm typically includes a free-living phase (adult, egg, larva) and a multiple-host parasitic phase (aquatic paratenic host, terrestrial definitive host). Such a life cycle involving water and land can improve energy flow in riparian ecosystems; however, its temporal dynamics in nature have rarely been investigated. This study examined seasonal infection with cysts in larval Chironominae (Diptera: Chironomidae) in northern Taiwan. In the larval chironomids, cysts of 3 horsehair worm species were identified. The cysts of the dominant species were morphologically similar to those of Chordodes formosanus. Infection with these cysts increased suddenly and peaked 2 mo after the reproductive season of the adult horsehair worms. Although adult C. formosanus emerged several times in a year, only 1 distinct infection peak was detected in September in the chironomid larvae. Compared with the subfamily Chironominae, samples from the subfamilies Tanypodinae and Orthocladiinae were less parasitized. This indicates that the feeding behavior of the chironomid host likely affects horsehair worm cyst infections; however, bioconcentration in predatory chironomids was not detected.
Bryan, M B; Zalinski, D; Filcek, K B; Libants, S; Li, W; Scribner, K T
2005-10-01
Invasions by exotic organisms have had devastating affects on aquatic ecosystems, both ecologically and economically. One striking example of a successful invader that has dramatically affected fish community structure in freshwater lakes of North America is the sea lamprey (Petromyzon marinus). We used eight microsatellite loci and multiple analytical techniques to examine competing hypotheses concerning the origins and colonization history of sea lamprey (n = 741). Analyses were based on replicated invasive populations from Lakes Erie, Huron, Michigan, and Superior, populations of unknown origins from Lakes Ontario, Champlain, and Cayuga, and populations of anadromous putative progenitor populations in North America and Europe. Populations in recently colonized lakes were each established by few colonists through a series of genetic bottlenecks which resulted in lower allelic diversity in more recently established populations. The spatial genetic structure of invasive populations differed from that of native populations on the Atlantic coast, reflecting founder events and connectivity of invaded habitats. Anadromous populations were found to be panmictic (theta(P) = 0.002; 95% CI = -0.003-0.006; P > 0.05). In contrast, there was significant genetic differentiation between populations in the lower and upper Great Lakes (theta(P) = 0.007; P freshwater habitats were examined using coalescent-based analyses, and demonstrated that populations likely originated from natural migrations via the St Lawrence River.
Schilf, Paul; Peter, Annette; Hurek, Thomas; Stick, Reimer
2014-07-01
Lamin proteins are found in all metazoans. Most non-vertebrate genomes including those of the closest relatives of vertebrates, the cephalochordates and tunicates, encode only a single lamin. In teleosts and tetrapods the number of lamin genes has quadrupled. They can be divided into four sub-types, lmnb1, lmnb2, LIII, and lmna, each characterized by particular features and functional differentiations. Little is known when during vertebrate evolution these features have emerged. Lampreys belong to the Agnatha, the sister group of the Gnathostomata. They split off first within the vertebrate lineage. Analysis of the sea lamprey (Petromyzon marinus) lamin complement presented here, identified three functional lamin genes, one encoding a lamin LIII, indicating that the characteristic gene structure of this subtype had been established prior to the agnathan/gnathostome split. Two other genes encode lamins for which orthology to gnathostome lamins cannot be designated. Search for lamin gene sequences in all vertebrate taxa for which sufficient sequence data are available reveals the evolutionary time frame in which specific features of the vertebrate lamins were established. Structural features characteristic for A-type lamins are not found in the lamprey genome. In contrast, lmna genes are present in all gnathostome lineages suggesting that this gene evolved with the emergence of the gnathostomes. The analysis of lamin gene neighborhoods reveals noticeable similarities between the different vertebrate lamin genes supporting the hypothesis that they emerged due to two rounds of whole genome duplication and makes clear that an orthologous relationship between a particular vertebrate paralog and lamins outside the vertebrate lineage cannot be established. Copyright © 2014 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Ke Li
Full Text Available A sulphate-conjugated bile alcohol, 3,12-diketo-4,6-petromyzonene-24-sulfate (DKPES, was identified using bioassay-guided fractionation from water conditioned with sexually mature male sea lamprey (Petromyzon marinus. The structure and relative stereochemistry of DKPES was established using spectroscopic data. The electro-olfactogram (EOG response threshold of DKPES was 10(-7 Molar (M and that of 3-keto petromyzonol sulfate (3 KPZS; a known component of the male sea lamprey sex pheromone was 10(-10 M. Behavioural studies indicated that DKPES can be detected at low concentrations by attracting sexually mature females to nests when combined with 3 KPZS. Nests baited with a mixture of DKPES and 3 KPZS (ratio 1∶29.8 attracted equal numbers of sexually mature females compared to an adjacent nest baited with 3 KPZS alone. When DKPES and 3 KPZS mixtures were applied at ratios of 2∶29.8 and 10∶29.8, the proportion of sexually mature females that entered baited nests increased to 73% and 70%, respectively. None of the sexually mature females released were attracted to nests baited with DKPES alone. These results indicated that DKPES is a component of the sex pheromone released by sexually mature male sea lamprey, and is the second biologically active compound identified from this pheromone. DKPES represents the first example that a minor component of a vertebrate pheromone can be combined with a major component to elicit critical sexual behaviors. DKPES holds considerable promise for increasing the effectiveness of pheromone-baited trapping as a means of sea lamprey control in the Laurentian Great Lakes.
Directory of Open Access Journals (Sweden)
Julia Ilkova
2014-04-01
Full Text Available Larvae of Chironomus riparius Mg. (Chironomidae, Diptera collected from two polluted water basins in Bulgaria, the Maritsa and Chaya Rivers (adjacent to Plovdiv and Asenovgrad respectively, a small pool (near Plovdiv plus controls reared in the laboratory were studied. High concentrations of the heavy metals Pb, Cu and Cd were recorded in the sediments of the polluted stations. Marked somatic structural chromosome aberrations were found in C. riparius salivary polytene chromosomes from the field stations and their frequency was significantly higher (p<0.01 compared to the control. The observed somatic chromosome changes are discussed as a response of the chironomid genome to aquatic pollution. A new cytogenetic index based on the number of aberrations found in larvae from polluted regions in comparison with the control was applied to the data to more easily evaluate the degree of heavy metal pollution in aquatic ecosystems. Our study of a polluted site near the River Chaya showed that the somatic index was very high at 3.35 for 2010 and 11.66 for 2013 compared to 0.5 in the control. The cytogenetic index was effective in showing that all studied sites were highly polluted in comparison with the control. To determine the mechanism involved in the concentration of aberration breakpoints within specific regions of the chironomid polytene chromosome the FISH method was applied. The localization of a transposable element TFB1 along the polytene chromosomes of C. riparius was analyzed and the sites of localization were compared with breakpoints of chromosome aberrations. A significant correlation (p<0.05 was found which shows that most of the aberrations do not appear randomly but are concentrated in sites rich in transposable elements.
Stratman, Karen N; Overholt, William A; Cuda, James P; Mukherjee, A; Diaz, R; Netherland, Michael D; Wilson, Patrick C
2014-10-15
A chironomid midge, Cricotopus lebetis (Sublette) (Diptera: Chironomidae), was discovered attacking the apical meristems of Hydrilla verticillata (L.f. Royle) in Crystal River, Citrus Co., Florida in 1992. The larvae mine the stems of H. verticillata and cause basal branching and stunting of the plant. Temperature-dependent development, cold tolerance, and the potential distribution of the midge were investigated. The results of the temperature-dependent development study showed that optimal temperatures for larval development were between 20 and 30°C, and these data were used to construct a map of the potential number of generations per year of C. lebetis in Florida. Data from the cold tolerance study, in conjunction with historical weather data, were used to generate a predicted distribution of C. lebetis in the United States. A distribution was also predicted using an ecological niche modeling approach by characterizing the climate at locations where C. lebetis is known to occur and then finding other locations with similar climate. The distributions predicted using the two modeling approaches were not significantly different and suggested that much of the southeastern United States was climatically suitable for C. lebetis. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.
Johnson, Nicholas S.; Swink, William D.; Brenden, Travis O.; Slade, Jeffrey W.; Steeves, Todd B.; Fodale, Michael F.; Jones, Michael L.
2014-01-01
Sea lamprey Petromyzon marinus control in the Great Lakes primarily involves application of lampricides to streams where larval production occurs to kill larvae prior to their metamorphosing and entering the lakes as parasites (juveniles). Because lampricides are not 100% effective, larvae that survive treatment maymetamorphose before streams are again treated. Larvae that survive treatment have not beenwidely studied, so their dynamics are notwell understood.Wetagged and released larvae in six Great Lake tributaries following lampricide treatment and estimated vital demographic rates using multistate tag-recovery models. Model-averaged larval survivals ranged from 56.8 to 57.6%. Model-averaged adult recovery rates, which were the product of juvenile survivals and adult capture probabilities, ranged from 6.8 to 9.3%. Using stochastic simulations, we estimated production of juvenile sea lampreys from a hypothetical population of treatment survivors under different growth conditions based on parameter estimates from this research. For fast-growing populations, juvenile production peaked 2 years after treatment. For slow-growing populations, juvenile production was approximately one-third that of fast-growing populations,with production not peaking until 4 years after treatment. Our results suggest that dynamics (i.e., survival, metamorphosis) of residual larval populations are very similar to those of untreated larval populations. Consequently, residual populations do not necessarily warrant special consideration for the purpose of sea lamprey control and can be ranked for treatment along with other populations. Consecutive lampricide treatments, which are under evaluation by the sea lamprey control program, would bemost effective for reducing juvenile production in large, fast-growing populations.
Johnson, Nicholas S.; Brenden, Travis O.; Swink, William D.; Lipps, Mathew A.
2016-01-01
Although population demographics of larval lampreys in streams have been studied extensively, demographics in lake environments have not. Here, we estimated survival and rates of metamorphosis for larval sea lamprey (Petromyzon marinus) populations residing in the Great Lakes near river mouths (hereafter termed lentic areas). Tagged larvae were stocked and a Bayesian multi-state tag-recovery model was used to investigate population parameters associated with tag recovery, including survival and metamorphosis probabilities. Compared to previous studies of larvae in streams, larval growth in lentic areas was substantially slower (Brody growth coefficient = 0.00132; estimate based on the recovery of six tagged larvae), survival was slightly greater (annual survival = 63%), and the length at which 50% of the larvae would be expected to metamorphose was substantially shorter (126 mm). Stochastic simulations were used to estimate the production of parasitic stage (juvenile) sea lamprey from a hypothetical population of larvae in a lentic environment. Production of juvenile sea lamprey was substantial because, even though larval growth in these environments was slow relative to stream environments, survival was high and length at metamorphosis was less. However, estimated production of juvenile sea lamprey was less for the lentic environment than for similar simulations for river environments where larvae grew faster. In circumstances where the cost to kill a larva with lampricide was equal and control funds are limited, sea lamprey control effort may be best directed toward larvae in streams with fast-growing larvae, because stream-produced larvae will most likely contribute to juvenile sea lamprey populations.
Directory of Open Access Journals (Sweden)
Alyssa M Anderson
2012-10-01
Full Text Available Collections of Chironomidae surface-floating pupal exuviae (SFPE provide an effective means of assessing water quality in streams. Although not widely used in the United States, the technique is not new and has been shown to be more cost-efficient than traditional dip-net sampling techniques in organically enriched stream in an urban landscape. The intent of this research was to document the efficiency of sorting SFPE samples relative to dip-net samples in trout streams with catchments varying in amount of urbanization and differences in impervious surface. Samples of both SFPE and dip-nets were collected from 17 sample sites located on 12 trout streams in Duluth, MN, USA. We quantified time needed to sort subsamples of 100 macroinvertebrates from dip-net samples, and less than or greater than 100 chironomid exuviae from SFPE samples. For larger samples of SFPE, the time required to subsample up to 300 exuviae was also recorded. The average time to sort subsamples of 100 specimens was 22.5 minutes for SFPE samples, compared to 32.7 minutes for 100 macroinvertebrates in dip-net samples. Average time to sort up to 300 exuviae was 37.7 minutes. These results indicate that sorting SFPE samples is more time-efficient than traditional dip-net techniques in trout streams with varying catchment characteristics.doi: 10.5324/fn.v31i0.1380.Published online: 17 October 2012.
Protein (Cyanobacteria): 470019 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available hypothetical protein Pro1185 Prochlorococcus marinus subsp. marinus str. CCMP1375 MLNGLNLCTLLEKYCYSKKISDKEVEFLERCWLDSLNSLHYNRYPGIAPAIVCDEAGVARGSYWISCNAAILDKLKPLGTTRSRSARIFDVLFQSGLIAA ...
Directory of Open Access Journals (Sweden)
Milca PETROVICI
2012-01-01
Full Text Available Present paper approach the issue of assessing the water quality of tributaries located in the upper basin of the river Mureş, taking into account changes in the value of biotic indices. In this sense, have been selected the next five biotic indices: Ephemeroptera Plecoptera Trichoptera index (EPT, Total Invertebrates index (T, Chironomidae index (Ch, EPT / Total invertebrates index (EPT / T, EPT / Chironomidae index (EPT / Ch and % Chironomidae index (% Chironomidae. Considering all these indices, it was found existence of a medium to best quality water in Mureş tributaries from Harghita Mountains and a good quality water which comes from the Maramureş Mountains and Transylvania Plateau.
Orel, Oksana V; Lobkova, Ludmila E; Zhirov, Sergey V; Petrova, Ninel A
2015-07-03
Morphology, cytology, ecology and biology of Holarctic Chironomus (Chironomus) acidophilus Keyl, 1960 (Diptera, Chironomidae) was examined from material collected in the geothermal Vosmerka Lake (pH=2.0-2.5). An illustrated redescription of C. acidophilus is given on the basis of adult males reared from field-collected pupae, and of simultaneously collected larvae. Additional larvae belonging to the pseudothummi-complex were identified as C. acidophilus on the basis of their karyotype. The karyotype of C. acidophilus (2n=8) and detailed mapping of the 4 chromosome arms A, E, D and F are provided. The population of C. acidophilus from Kamchatka was found to be karyologically monomorphic. Information on distribution and ecology of C. acidophilus from Vosmerka Lake (total mineralization 1583.5 mg/l) is also given. Chironomus acidophilus is the only species of aquatic insects recorded in this lake. Lack of competition and a richness of food resources contribute to the high abundance (35161 ind./m2) and biomass (11.342 g/m2) of the larvae of C. acidophilus in Vosmerka Lake.
Villa, Sara; Di Nica, Valeria; Pescatore, Tanita; Bellamoli, Francesco; Miari, Francesco; Finizio, Antonio; Lencioni, Valeria
2018-07-01
Several studies have indicated the presence of contaminants in Alpine aquatic ecosystems. Even if measured concentrations are far below those that cause acute effects, continuous exposure to sub-lethal concentrations may have detrimental effects on the aquatic species present in these remote environments. This may lead to a cascade of indirect effects at higher levels of the ecological hierarchy (i.e., the community). To improve the determination of ecologically relevant risk endpoints, behavioural alterations in organisms due to pollutants are increasingly studied in ecotoxicology. In fact, behaviour links physiological function with ecological processes, and can be very sensitive to environmental stimuli and chemical exposure. This is the first study on behavioural alteration in a wild population of an Alpine species. In the present study, a video tracking system was standardized and subsequently used to identify contaminant-induced behavioural alterations in Diamesa zernyi larvae (Diptera, Chironomidae). Diamesa zernyi larvae, collected in an Italian Alpine stream (Rio Presena, Trentino Region), were acclimated for 24 h and successively exposed to several aquatic contaminants (pesticides: chlorpyrifos, metolachlor, boscalid, captan; pharmaceuticals: ibuprofen, furosemide, trimethoprim) at concentrations corresponding to their Lowest Observed Effect Concentration (LOEC). After 24, 48, 72, and 96 h of exposure, changes in the distance moved, the average speed, and the frequency of body bends were taken to reflect contaminant- and time-dependent effects on larval behaviour. In general, metolachlor, captan, and trimethoprim tended to reduce all the endpoints under consideration, whereas chlorpyrifos, boscalid, ibuprofen, and furosemide seemed to increase the distances moved by the larvae. This could be related to the different mechanisms of action of the investigated chemicals. Independently of the contaminant, after 72 h a general slowing down of all the
Hansen, Michael J.; Madenjian, Charles P.; Slade, Jeffrey W.; Steeves, Todd B.; Almeida, Pedro R.; Quintella, Bernardo R.
2016-01-01
The sea lamprey Petromyzon marinus (Linnaeus) is both an invasive non-native species in the Laurentian Great Lakes of North America and an imperiled species in much of its native range in North America and Europe. To compare and contrast how understanding of population ecology is useful for control programs in the Great Lakes and restoration programs in Europe, we review current understanding of the population ecology of the sea lamprey in its native and introduced range. Some attributes of sea lamprey population ecology are particularly useful for both control programs in the Great Lakes and restoration programs in the native range. First, traps within fish ladders are beneficial for removing sea lampreys in Great Lakes streams and passing sea lampreys in the native range. Second, attractants and repellants are suitable for luring sea lampreys into traps for control in the Great Lakes and guiding sea lamprey passage for conservation in the native range. Third, assessment methods used for targeting sea lamprey control in the Great Lakes are useful for targeting habitat protection in the native range. Last, assessment methods used to quantify numbers of all life stages of sea lampreys would be appropriate for measuring success of control in the Great Lakes and success of conservation in the native range.
Odume, O. N.; Muller, W. J.
. Results revealed that the family Chironomidae, identified to species or genus, can be use to assess environmental water quality status in South African freshwater ecosystems.
Butakka, C M M; Grzybkowska, M; Pinha, G D; Takeda, A M
2014-05-01
Benthic habitats are linked by physical processes and are essential elements in assessing of the distribution dynamics of Chironomidae dipteran insects and their role in aquatic ecosystems. This work presents results of distribution patterns of chironomids larvae in 38 sites that are abundant in the study site, inhabiting the substrate of the main river channel, rapids, tributary brook, floodplain lakes and reservoir along the Sepotuba River from its mouth at the Paraguay River to the headwater region. A total of 1,247 larvae was registered. The most abundant taxa were Polypedilum (Tripodura) sp. (25.2%), Cricotopus sp.3 (23.0%) and Tanytarsus sp. (15.0%). Fissimentum desiccatum were found only in the reservoir; Fissimentum sp.2 and Tanytarsus cf. T. obiriciae sp.2 in floodplain lakes, and Goeldichironomus sp. in the main channel. The low diversity of the sites S06 and S35 is caused by the near-exclusive presence of the species Cricotopus sp.3, alone or together with one or another taxon (Tanytarsus sp., Djalmabatista sp.3). Collectors-filterers represent 16%, collectors-gatherers 15%, predators 11% and scrapers only 1%. The predators dominated in the secondary channel (±88 ind/m2), corresponding to 40% of the total of this group. Cryptochironomus sp.2 (34%) and Ablasbemyia gr. annulata (26%) were the most abundant among the predators. The differences along the river course are decisive for the formation of distinct or discontinuous communities and the limits become obvious though the interrelations between the populations in the community, as for instance, competition for food and habitats.
Directory of Open Access Journals (Sweden)
Adriana Felix dos Anjos
2009-10-01
Full Text Available No Brasil, estudos sobre hábitos alimentares das larvas de Chironomidae ainda são escassos e estas informações são importantes para entender a estrutura trófica e a organização dos ecossistemas aquáticos. Neste estudo, teve-se como objetivo identificar osprincipais itens alimentares ingeridos por Cricotopus sp. e comparar as possíveis diferenças na dieta das larvas em diferentes substratos artificiais e fases hídricas. Foram utilizados quatro tipos de substratos artificiais: madeira em forma de X (MADX, placas de nitacetal em forma de X (NITX, PVC em forma de tubo (PVCT e metal galvanizado em forma de tubo (METT, cada um com três réplicas. As coletas foram realizadas quinzenalmente, entre os meses de agosto de 2004 e dezembro de 2005. A dieta de Cricotopus sp. foi constituída por detritos, algas e hifas de fungos. Detrito foi o principal item alimentar, com valores superiores a 50% do total consumido. Os resultados indicaram que Cricotopus sp. é uma espécie coletora e, independentemente do substrato, as larvas alimentam-se dos recursos disponíveis no ambiente. Entretanto, mudanças no regime hidrológico do rio Paraná podem influenciar a disponibilidade de alimento, principalmente algumas diatomaceas como Melosira sp., consumidas em maior quantidade apenas na fase de águas baixas.In Brazil, studies on the diet of Chironomidae larvae are still scarce and these data are important to understand the trophic structure and organization of aquatic ecosystems. In this study, we identified the main food items consumed by Cricotopus sp. and compared possible differences in the larval diet at different artificial substrates and hydrological phases. We used four types of artificial substrates: X-shaped wood (MADX; X-shaped nitacetal plates (NITX; tube-shaped PVC (PVCT and tube-shaped galvanizedmetal (METT, each with three replicates. Samplings were undertaken fortnightly, between August 2004 and December 2005. Cricotopus sp. diet was
ORF Alignment: NC_005042 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ator ... [Prochlorococcus marinus subsp. marinus str. CCMP1375] ... Length = 85 ... Query: 9 ... KAIDS...LKALAEPIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS 68 ... KAIDSLKALAE...PIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS Sbjct: 1 ... KAIDSLKALAEPIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS 60 ...
Gad El Rab, M O; Thatcher, D R; Kay, A B
1980-01-01
A major allergen has been identified in an aqueous extract of the 'green nimitti' midge, Cladotanytarsus lewisi (Diptera: Chironomidae). Following chromatography on Sephadex G-100 allergenic activity, as assessed by skin ('prick') testing, eluted as two closely related peaks (pools I and II) at about 50% bed volume. When these pools were applied separately to columns of CM-cellulose, activity in each eluted with 0 . 05 M NaCl. Isoelectric focusing of the unfractionated allergen gave a single peak of activity at pI 4 . 3. By SDS--PAGE, biological activity in the whole 'green nimitti' extract and the material eluting from both pools I and II of the Sephadex G-100 column migrated to the same positions and were associated with a molecular size of 15,000--20,000 daltons. Skin test reactivity of the unfractionated material and the Sephadex G-100 pool I and II eluates were all destroyed following incubation with trypsin, chymotrypsin, thermolysin and neuraminidase. These experiments indicate that a major allergen derived from the 'green nimitti' midge, a cause of widespread and severe immediate-type allergy in the Sudan, is an acidic glycoprotein of 15,000--20,000 molecular weight. Images Fig. 3 PMID:7438559
Ali, Arshad; Leckel, Robert J; Jahan, Nusrad; Al-Shami, Salman A; Rawi, Che Salmah Md
2009-03-01
A 1-year larval and adult population survey of pestiferous chironomids was conducted in 4 man-made wetlands in a resort area of central Florida, USA. Benthic samples were randomly collected from each wetland at least once every month. Geocoordinates, water depth, and physical composition of substrates at each larval sample location were noted. Adult midge populations were sampled weekly around the wetlands by employing 10 New Jersey light traps permanently placed in the area. Chironominae and Tanypodinae midges occurred in the larval and adult samples; a few Orthocladiinae were also taken. Among Chironominae, Chironomini (mostly Polypedilum spp., Cryptochironomus spp., Glyptotendipes paripes, and Goeldichironomus carus) and Tanytarsini (mostly Tanytarsus spp.), and some other Chironomidae were recorded. Tanypodinae were quantitatively not important. Monthly mean number of total adults per trap-night ranged from 23 in February to 211 in October. Annual mean larval density and range of total chironomids in the study wetlands amounted to 1,128/m2, range: 0-12,332/m2. The total larvae were most abundant in May. Tanytarsus spp. and Polypedilum spp. were numerically the most predominant spatially as well as temporally. Mean water depth at the sampled locations was 1.83 m (range: 1-m-deep water. Of all sampled locations, substrates such as sand, mixed substrates, and muck were respectively encountered at 656, 371, and 299 locations. The predominance of sand and mixed substrates was conducive to supporting the numerically dominant Tanytarsus spp. and Polypedilum spp. In laboratory bioassays, Tanytarsus spp., Polypedilum spp., Glyptotendipes paripes, and Goeldichironomus carus were highly susceptible to temephos, as well as to s-methoprene. Bacillus thuringiensis serovar. israelensis was most effective against Tanytarsus spp. and least against Goeldichironomus carus.
African Journal of Science and Technology (AJST) DIVERSITY OF ...
African Journals Online (AJOL)
NORBERT OPIYO AKECH
ABSTRACT: This paper presents the first results on the water quality of the River Niger at Niamey based on the Chironomidae ... Key words: Chironomidae, River Niger, Niamey, water quality ...... of macroinvertebrates assemblages in the Azul-.
Zoobenthic fauna and seasonal changes of mamasin dam lake ...
African Journals Online (AJOL)
STORAGESEVER
2009-09-15
Sep 15, 2009 ... Psammoryctides deserticula (Grimm, 1877). 14. Procladius (Holotanypus) sp. 15. Chironomus plumosus (Linnaeus, 1758). 16. C. anthracinus (Zetterstedt, 1860). Insecta. Chironomidae. 17. Polypedilum nubeculosum (Meigen, 1804). Figure 2. Average numbers (BS/m2) of chironomidae, oligochaeta and ...
Karmokov, Mukhamed Kh.; Akkizov, Azamat Y.
2016-01-01
Abstract Data on the karyotype characteristics, larval morphology and features of chromosomal polymorphism of a population of Glyptotendipes salinus Michailova, 1983 (Diptera, Chironomidae) from Tambukan Lake (on the northern macroslope of the central Caucasus) are presented. It was found that diagnostic larval characters of Glyptotendipes salinus from Caucasus in general are similar to those described in previous studies, but with some significant differences. By some morphological characteristics Caucasian larvae appeared to be closer to Glyptotendipes barbipes than to ones provided for European larvae of Glyptotendipes salinus by Contreras-Lichtenberg (1999). Obtained morphological data make possible to conclude that Caucasian population of Glyptotendipes salinus can be a markedly diverged population of the species, probably even subspecies. In the Caucasian population 12 banding sequences were found: two in arms A, B, C, E, and G, and one in arms D and F. Eight of these are already known for this species, and four, salA2, salB2, salEX, and salG3, are described for the first time. Genetic distances between all the previously studied populations of Glyptotendipes salinus were measured using Nei criteria (1972). The population of the central Caucasus occupies a distinct position on the dendrogram compared with populations from Altai and Kazakhstan. All the obtained morphological and cytogenetic data can indicate the plausible relative isolation and complexity of the Caucasus from the viewpoint of microevolution. More researches are required in other parts of Caucasus and other geographically distant regions for more specific allegations. PMID:28123679
Directory of Open Access Journals (Sweden)
Mukhamed Karmokov
2016-11-01
Full Text Available Data on the karyotype characteristics, larval morphology and features of chromosomal polymorphism of a population of Glyptotendipes salinus Michailova, 1983 (Diptera, Chironomidae from Tambukan Lake (on the northern macroslope of the central Caucasus are presented. It was found that diagnostic larval characters of G. salinus from Caucasus in general are similar to those described in previous studies, but with some significant differences. By some morphological characteristics Caucasian larvae appeared to be closer to G. barbipes than to ones provided for European larvae of G. salinus by Contreras-Lichtenberg (1999. Obtained morphological data make possible to conclude that Caucasian population of G. salinus can be a markedly diverged population of the species, probably even subspecies. In the Caucasian population 12 banding sequences were found: two in arms A, B, C, E, and G, and one in arms D and F. Eight of these are already known for this species, and four, salA2, salB2, salEX, and salG3, are described for the first time. Genetic distances between all the previously studied populations of G. salinus were measured using Nei criteria (1972. The population of the central Caucasus occupies a distinct position on the dendrogram compared with populations from Altai and Kazakhstan. All the obtained morphological and cytogenetic data can indicate the plausible relative isolation and complexity of the Caucasus from the viewpoint of microevolution. More researches are required in other parts of Caucasus and other geographically distant regions for more specific allegations.
Kao, Yung-Hsi; Sheridan, Mark A; Holmes, John A; Youson, John H
2010-11-01
This study was designed to examine the effect of thermal acclimation on the lipid composition of fat depot organs the liver and kidneys of larval sea lamprey, Petromyzon marinus. We found that 21 °C-acclimated larvae possessed lower total lipid amounts in the liver (39% lower) and kidneys (30% lower) than 13 °C-acclimated larvae. Relatively lower lipid contents in the liver and kidneys of 21 °C-acclimated lamprey primarily resulted from a reduction in stored lipid reserve, triacylglycerol, but not the structural lipid, phospholipid. Compared to 21 °C-acclimated larvae, 13 °C-acclimated larvae were found to possess fewer saturated fatty acids (SFAs) and more unsaturated fatty acids (USFAs) in renal triacylglycerol and phospholipid classes, while there were no significant differences in the SFAs and USFAs of hepatic triacylglycerol, phospholipid, cholesteryl ester, fatty acid, and monoacylglycerol classes. Fewer SFAs, found in the kidney triacylglycerol of 13 °C-acclimated lamprey, were due to lower 12:0 and 14:0 fatty acids, but those in the renal phospholipid class were characterized by fewer 14:0, 15:0, and 16:0 fatty acids. More USFAs in renal triacylglycerol, as indicated by a higher unsaturation index, primarily resulted from higher polyunsaturated fatty acids (18:2ω6, 18:3ω3, and 18:4ω3); whereas, in the renal phospholipid class, this was a result of higher monoenes (18:1, 20:1, and 22:1ω9) and ω3 polyunsaturated fatty acids (18:4ω3). These data suggest that the influence of thermal acclimation on the lipid composition of lamprey fat depot organs depends on tissue and lipid class.
Johnson, Nicholas S.; Tix, John A.; Hlina, Benjamin L.; Wagner, C. Michael; Siefkes, Michael J.; Wang, Huiyong; Li, Weiming
2015-01-01
Spermiating male sea lamprey (Petromyzon marinus) release a sex pheromone, of which a component, 7α, 12α, 24-trihydoxy-3-one-5α-cholan-24-sulfate (3kPZS), has been identified and shown to induce long distance preference responses in ovulated females. However, other pheromone components exist, and when 3kPZS alone was used to control invasive sea lamprey populations in the Laurentian Great Lakes, trap catch increase was significant, but gains were generally marginal. We hypothesized that free-ranging sea lamprey populations discriminate between a partial and complete pheromone while migrating to spawning grounds and searching for mates at spawning grounds. As a means to test our hypothesis, and to test two possible uses of sex pheromones for sea lamprey control, we asked whether the full sex pheromone mixture released by males (spermiating male washings; SMW) is more effective than 3kPZS in capturing animals in traditional traps (1) en route to spawning grounds and (2) at spawning grounds. At locations where traps target sea lampreys en route to spawning grounds, SMW-baited traps captured significantly more sea lampreys than paired 3kPZS-baited traps (~10 % increase). At spawning grounds, no difference in trap catch was observed between 3kPZS and SMW-baited traps. The lack of an observed difference at spawning grounds may be attributed to increased pheromone competition and possible involvement of other sensory modalities to locate mates. Because fishes often rely on multiple and sometimes redundant sensory modalities for critical life history events, the addition of sex pheromones to traditionally used traps is not likely to work in all circumstances. In the case of the sea lamprey, sex pheromone application may increase catch when applied to specifically designed traps deployed in streams with low adult density and limited spawning habitat.
Study of Chironomidae Natural Populations of the Former Semipalatinsk Test Site Water Bodies
International Nuclear Information System (INIS)
Aimanova, K.G.; Blinov, A.G.; Kiknadze, I.I.; Bakhtin, M.M.; Seisebaev, A.T.; Rakhimbaeva, K.T.
1998-01-01
The open water bodies as a component of the biosphere serve as the accumulators of artificial radionuclides generated during the nuclear explosions; therefore their radioactive contamination needs to be registered. The assessment of the environmental radioactive contamination consequences for the natural populations of organisms living in water bodies is of particular importance. Chironomini (Diptera, Chironomidae) play an important role as they are a significant component of water and air biocenoses and provide the self-cleaning of water bodies and food chains of industrial fish and bird. Chironomini have been chosen to be a model for the UNESCO International Program titled 'Man and Biosphere' and are used as the biologic indicator for ecological studies of anthropogenic influence on water bodies. The study of Chironomini natural mutagenic process and its alteration due to the radioactive contamination of water bodies is of extreme scientific interest and can serve as the indicator of the scale of genetic damage of water organisms. This work presents the data on natural populations of Chironomini of former STS water bodies: Shagan Lake, Balapan Lake, the artificial water body on the Karazhyra Coal Field, the backwater near the Shagan River, Balykty col Lake, etc. The analysis of morphology and caryotype of Camptochironomus sp. S (S - larvae have been sampled from the Semipalatinsk Test Site) showed that this is a new species as compared to studied species (C. tentans, C. pallidivittatus) of Camptochironomus subfamily. The caryotype Camptochironomus sp. S differs sharply from the caryotypes of other Camptochironomus species due to its strong hetero chromatization of centromeric discs. The immediate molecular analysis of genome DNA of Camptochironomus sp. S larvae sampled from Shagan Lake was performed: the total DNA of larvae of this species was obtained, nucleonic sequences of genes of cytochrome B (Cyt B) and cytochrome I (COI) were determined using methods of
Directory of Open Access Journals (Sweden)
Ruiz Moreno Jeanet Liliana
2000-07-01
Full Text Available A diagnosis of larvae in the subfamilies Tanypodinae and Podonominae (Chironomidae is provided, based on macroscopic and microscopic characters. A key to the genera recorded in streams of the Sabana de Bogotá and surrounding mountains is presented. Additionally, diagnoses are given for the genera Podonomus and Parochlus of the subfamily Podonominae and the genus araheptagyia, of the subfamily Diamesinae.Se presentan diagnosis de las subfamilias Tanypodinae y Podonominae (Diptera: Chironomidael, incluyendo características macroscópicas que diferencian las larvas de la subfamilia y microscópicas que permiten diferenciar los géneros, que hasta el momento se han encontrado en las aguas corrientes de la sabana de Bogotá y sus montañas circundantes. Además, se presenta una clave para la identificación de los diez géneros registrados para la subfamilia Tanypodinae, así como una diagnosis de los géneros: Podonomus y Parochlus, de la subfamilia Podominae y el género Paraheptagyia, de la subfamilia Diamesinae.
Stilborn, S Salina M; Manzon, Lori A; Schauenberg, Jennifer D; Manzon, Richard G
2013-03-01
Thyroid hormones (THs) are crucial for normal vertebrate development and are the one obligate morphogen that drives amphibian metamorphosis. However, contrary to other metamorphosing vertebrates, lampreys exhibit a sharp drop in serum TH early in metamorphosis, and anti-thyroid agents such as potassium perchlorate (KClO(4)) induce metamorphosis. The type 2 deiodinase (D2) enzyme is a key regulator of TH availability during amphibian metamorphosis. We set out to determine how D2 may be involved in the regulation of lamprey metamorphosis and thyroid homeostasis. We cloned a 1.8Kb Petromyzon marinus D2 cDNA that includes the entire protein coding region and a selenocysteine (Sec) codon. Northern blotting indicated that the lamprey D2 mRNA is the longest reported to date (>9Kb). Using real-time PCR, we showed that intestinal and hepatic D2 mRNA levels were elevated prior to and during the early stages of metamorphosis and then declined dramatically to low levels that were sustained for the remainder of metamorphosis. These data are consistent with previously reported changes in serum TH levels and deiodinase activity. Treatment of larvae with either TH or KClO(4) significantly affected D2 mRNA levels in the intestine and liver. These D2 mRNA levels during metamorphosis and in response to thyroid challenges suggest that D2 may function in the regulation of TH levels during lamprey metamorphosis and the maintenance of TH homeostasis. Copyright © 2013 Elsevier Inc. All rights reserved.
Effects of impoundment and regulation upon the stomach contents of fish at Cow Green, Upper Teesdale
Energy Technology Data Exchange (ETDEWEB)
Crisp, D.T.; Mann, R.H.K.; McCormack, J.C.
1978-04-01
The stomach contents of 1003 brown trout, 1551 bullheads and 800 minnows taken from the reservoir basin and below the dam, before and after impoundment of the river Tees, were examined. Their composition reflected observations by other workers on river and reservoir benthos, except for the increase in numbers of Hydra and Nais below the dam, and Mollusca, Hirudinea and oligochaetes in the reservoir. Trout below the dam ate more Ephemeroptera nymphs and Chironomidae larvae but fewer terrestrial casualties after river regulation, whereas bullheads ate more Mollusca but fewer Plecoptera nymphs. In both species Baetidae nymphs increased in numerical importance relative to Ecdyonuridae. Trout, but not bullheads, took zooplankton discharged from the reservoir. Before impoundment, trout within the reservoir basin ate chiefly benthic organisms and terrestrial casualties. Inundated terrestrial material, mainly earthworms, formed the bulk of their food for at least three years after impoundment, whilst from the second year onwards Chironomidae and, in some years, Gammarus became increasingly important. Zooplankton was taken by all sizes of reservoir trout. Bullheads within the reservoir basin ate chiefly river benthos before impoundment, with Ephemeroptera and Plecoptera nymphs predominant in older fish, and aquatic Diptera and Coleoptera also important in the fry. After impoundment, Chironomidae and Gammarus were the main items taken by older bullheads, and Chironomidae and micro-crustacea by the fry. Among all sizes of minnow, Chironomidae, micro-crustacea and detritus increased in numerical importance after impoundment.
Wilkie, Michael P; Claude, Jaime F; Cockshutt, Amanda; Holmes, John A; Wang, Yuxiang S; Youson, John H; Walsh, Patrick J
2006-01-01
The jawless fish, the sea lamprey (Petromyzon marinus), spends part of its life as a burrow-dwelling, suspension-feeding larva (ammocoete) before undergoing a metamorphosis into a free swimming, parasitic juvenile that feeds on the blood of fishes. We predicted that animals in this juvenile, parasitic stage have a great capacity for catabolizing amino acids when large quantities of protein-rich blood are ingested. The sixfold to 20-fold greater ammonia excretion rates (J(Amm)) in postmetamorphic (nonfeeding) and parasitic lampreys compared with ammocoetes suggested that basal rates of amino acid catabolism increased following metamorphosis. This was likely due to a greater basal amino acid catabolizing capacity in which there was a sixfold higher hepatic glutamate dehydrogenase (GDH) activity in parasitic lampreys compared with ammocoetes. Immunoblotting also revealed that GDH quantity was 10-fold and threefold greater in parasitic lampreys than in ammocoetes and upstream migrant lampreys, respectively. Higher hepatic alanine and aspartate aminotransferase activities in the parasitic lampreys also suggested an enhanced amino acid catabolizing capacity in this life stage. In contrast to parasitic lampreys, the twofold larger free amino acid pool in the muscle of upstream migrant lampreys confirmed that this period of natural starvation is accompanied by a prominent proteolysis. Carbamoyl phosphate synthetase III was detected at low levels in the liver of parasitic and upstream migrant lampreys, but there was no evidence of extrahepatic (muscle, intestine) urea production via the ornithine urea cycle. However, detection of arginase activity and high concentrations of arginine in the liver at all life stages examined infers that arginine hydrolysis is an important source of urea. We conclude that metamorphosis is accompanied by a metabolic reorganization that increases the capacity of parasitic sea lampreys to catabolize intermittently large amino acid loads arising
Karmokov, Mukhamed Kh.; Polukonova, Natalia V.; Sinichkina, Olga V.
2015-01-01
Abstract Data about the karyotype characteristics, features of chromosomal polymorphism and larval morphology of populations of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae) from the Central Caucasus (the northern macroslope) and Ciscaucasia are presented. The characteristics of the pericentromeric regions of the long chromosomes of this species from Caucasian populations were very similar to the ones from some European populations (from Poland and Italy), but differed from Swiss and Siberian populations. In the North Caucasian populations 10 banding sequences were found: two in arms A, C, and E, and one in arms B, D, F, and G. Nine of them were already known for this species, and one, berC2, is described for the first time. Cytogenetic distances between all the studied populations of Chironomus bernensis show that close geographical location of all studied populations from the Central Caucasus and Ciscaucasia is reflected in their similar cytogenetic structure, but on the other hand, that they are more closely related to populations from Europe than to populations from Western Siberia. At the same time, all studied larvae from Caucasian populations have a four-bladed premandible, instead of a two-bladed one, as in the description of Chironomus bernensis from Switzerland (Wülker and Klötzli 1973, Polukonova 2005c). These peculiarities may indicate the relative isolation of the Caucasus from the viewpoint of microevolution. Further research on karyological and morphological characteristics of Chironomus bernensis from geographically distant regions is necessary as there is a possibility that the presently known species is actually polytypic and consists of several sibling species. PMID:26312128
Directory of Open Access Journals (Sweden)
Mukhamed Kh. Karmokov
2015-06-01
Full Text Available Data about the karyotype characteristics, features of chromosomal polymorphism and larval morphology of populations of Chironomus bernensis Wülker & Klötzli, 1973 (Diptera, Chironomidae from the Central Caucasus (the northern macroslope and Ciscaucasia are presented. The characteristics of the pericentromeric regions of the long chromosomes of this species from Caucasian populations were very similar to the ones from some European populations (from Poland and Italy, but differed from Swiss and Siberian populations. In the North Caucasian populations 10 banding sequences were found: two in arms A, C, and E, and one in arms B, D, F, and G. Nine of them were already known for this species, and one, berC2, is described for the first time. Cytogenetic distances between all the studied populations of Ch. bernensis show that close geographical location of all studied populations from the Central Caucasus and Ciscaucasia is reflected in their similar cytogenetic structure, but on the other hand, that they are more closely related to populations from Europe than to populations from Western Siberia. At the same time, all studied larvae from Caucasian populations have a four-bladed premandible, instead of a two-bladed one, as in the description of Ch. bernensis from Switzerland (Wülker and Klötzli 1973, Polukonova 2005c. These peculiarities may indicate the relative isolation of the Caucasus from the viewpoint of microevolution. Further research on karyological and morphological characteristics of Chironomus bernensis from geographically distant regions is necessary as there is a possibility that the presently known species is actually polytypic and consists of several sibling species.
Assessment of virally vectored autoimmunity as a biocontrol strategy for cane toads.
Directory of Open Access Journals (Sweden)
Jackie A Pallister
Full Text Available BACKGROUND: The cane toad, Bufo (Chaunus marinus, is one of the most notorious vertebrate pests introduced into Australia over the last 200 years and, so far, efforts to identify a naturally occurring B. marinus-specific pathogen for use as a biological control agent have been unsuccessful. We explored an alternative approach that entailed genetically modifying a pathogen with broad host specificity so that it no longer caused disease, but carried a gene to disrupt the cane toad life cycle in a species specific manner. METHODOLOGY/PRINCIPAL FINDINGS: The adult beta globin gene was selected as the model gene for proof of concept of autoimmunity as a biocontrol method for cane toads. A previous report showed injection of bullfrog tadpoles with adult beta globin resulted in an alteration in the form of beta globin expressed in metamorphs as well as reduced survival. In B. marinus we established for the first time that the switch from tadpole to adult globin exists. The effect of injecting B. marinus tadpoles with purified recombinant adult globin protein was then assessed using behavioural (swim speed in tadpoles and jump length in metamorphs, developmental (time to metamorphosis, weight and length at various developmental stages, protein profile of adult globin and genetic (adult globin mRNA levels measures. However, we were unable to detect any differences between treated and control animals. Further, globin delivery using Bohle iridovirus, an Australian ranavirus isolate belonging to the Iridovirus family, did not reduce the survival of metamorphs or alter the form of beta globin expressed in metamorphs. CONCLUSIONS/SIGNIFICANCE: While we were able to show for the first time that the switch from tadpole to adult globin does occur in B. marinus, we were not able to induce autoimmunity and disrupt metamorphosis. The short development time of B. marinus tadpoles may preclude this approach.
Assessment of virally vectored autoimmunity as a biocontrol strategy for cane toads.
Pallister, Jackie A; Halliday, Damien C T; Robinson, Anthony J; Venables, Daryl; Voysey, Rhonda D; Boyle, Donna G; Shanmuganathan, Thayalini; Hardy, Christopher M; Siddon, Nicole A; Hyatt, Alex D
2011-01-25
The cane toad, Bufo (Chaunus) marinus, is one of the most notorious vertebrate pests introduced into Australia over the last 200 years and, so far, efforts to identify a naturally occurring B. marinus-specific pathogen for use as a biological control agent have been unsuccessful. We explored an alternative approach that entailed genetically modifying a pathogen with broad host specificity so that it no longer caused disease, but carried a gene to disrupt the cane toad life cycle in a species specific manner. The adult beta globin gene was selected as the model gene for proof of concept of autoimmunity as a biocontrol method for cane toads. A previous report showed injection of bullfrog tadpoles with adult beta globin resulted in an alteration in the form of beta globin expressed in metamorphs as well as reduced survival. In B. marinus we established for the first time that the switch from tadpole to adult globin exists. The effect of injecting B. marinus tadpoles with purified recombinant adult globin protein was then assessed using behavioural (swim speed in tadpoles and jump length in metamorphs), developmental (time to metamorphosis, weight and length at various developmental stages, protein profile of adult globin) and genetic (adult globin mRNA levels) measures. However, we were unable to detect any differences between treated and control animals. Further, globin delivery using Bohle iridovirus, an Australian ranavirus isolate belonging to the Iridovirus family, did not reduce the survival of metamorphs or alter the form of beta globin expressed in metamorphs. While we were able to show for the first time that the switch from tadpole to adult globin does occur in B. marinus, we were not able to induce autoimmunity and disrupt metamorphosis. The short development time of B. marinus tadpoles may preclude this approach.
Duchet, Claire; Franquet, Evelyne; Lagadic, Laurent; Lagneau, Christophe
2015-05-01
To optimize their efficacy, some insecticides used for mosquito control are introduced into aquatic ecosystems where mosquito larvae develop (marshes, ponds, sanitation devices) and cannot escape from the treated water. However, this raises the question of possible effects of mosquito larvicides on non-target aquatic species. Bacillus thuringiensis var. israelensis (Bti), which is well-known for its selectivity for Nematocera dipterans, is widely used for mosquito control all over the world. Spinosad, a mixture of spinosyns A and D known as fermentation products of a soil actinomycete (Saccharopolyspora spinosa), is a biological neurotoxic insecticide with a broader action spectrum. It is a candidate larvicide for mosquito control, but some studies showed that it may be toxic to beneficial or non-target species, including non-biting midges. The present study was therefore undertaken to assess the impact of Bti and spinosad on natural populations of Polypedilum nubifer (Skuse) and Tanytarsus curticornis Kieffer (Diptera: Chironomidae) in field enclosures implemented in Mediterranean coastal wetlands. Unlike Bti, spinosad had a strong lethal effect on P. nubifer and seems to affect T. curticornis at presumed recommended rates for field application. Differences in the sensitivity of these two species to spinosad confirm that population dynamics need to be known for a proper assessment of the risk encountered by chironomids in wetlands where larvicide-based mosquito control occurs. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Melissa O. Segura
2007-06-01
Full Text Available Esta nota registra a ocorrência de foresia entre larvas de Rheotanytarsus Thienemann & Bause, 1913 (Chironomidae, Tanytarsini e adultos de Hexacylloepus Hinton, 1940 e Microcylloepus Hinton, 1935 (Coleoptera, Elmidae. Os exemplares foram obtidos em córregos no Parque Estadual de Campos de Jordão, Estado de São Paulo, Brasil.This note reports phoresy between larvae of Rheotanytarsus Thienemann & Bause, 1913 (Chironominae, Tanytarsini and adult of Hexacylloepus Hinton, 1940 and Microcylloepus Hinton, 1935 (Coleoptera, Elmidae. The specimens had been collected in streams from State Park Campos do Jordão, São Paulo State, Brazil.
Matthews-Bird, F.; Gosling, W. D.; Brooks, S. J.; Montoya, E.; Coe, A. L.
2014-12-01
Chironomidae (non-biting midges) is a family of two-winged aquatic insects of the order Diptera. They are globally distributed and one of the most diverse families within aquatic ecosystems. The insects are stenotopic, and the rapid turnover of species and their ability to colonise quickly favourable habitats means chironomids are extremely sensitive to environmental change, notably temperature. Through the development of quantitative temperature inference models chironomids have become important palaeoecological tools. Proxies capable of generating independent estimates of past climate are crucial to disentangling climate signals and ecosystem response in the palaeoecological record. This project has developed the first modern environmental calibration data set in order to use chironomids from the Tropical Andes as quantitative climate proxies. Using surface sediments from c. 60 lakes from Bolivia, Peru and Ecuador we have developed an inference model capable of reconstructing temperatures, with a prediction error of 1-2°C, from fossil assemblages. Here we present the first Lateglacial and Holocene chironomid-inferred temperature reconstructions from two sites in the tropical Andes. The first record, from a high elevation (4153 m asl) lake in the Bolivian Andes, shows persistently cool temperatures for the past 15 kyr, punctuated by warm episodes in the early Holocene (9-10 kyr BP). The chironomid-inferred Holocene temperature trends from a lake sediment record on the eastern Andean flank of Ecuador (1248 m asl) spanning the last 5 millennia are synchronous with temperature changes in the NGRIP ice core record. The temperature estimates suggest along the eastern flank of the Andes, at lower latitudes (~1°S), climate closely resemble the well-established fluctuations of the Northern Hemisphere for this time period. Late-glacial climate fluctuations across South America are still disputed with some palaeoecological records suggesting evidence for Younger Dryas
Macleod, G T; Dickens, P A; Bennett, M R
2001-04-01
A study has been made of the formation and regression of synapses with respect to Schwann cells at the ends of motor nerve terminal branches in mature toad (Bufo marinus) muscle. Synapse formation and regression, as inferred from the appearance and loss of N-(3-triethylammoniumpropyl)-4-(4-(dibutylamino)styryl) pyridinium dibromide (FM1-43)-stained vesicle clusters, occurred at the ends of terminal branches over a 16 hr period. Multiple microelectrodes placed in an array about FM1-43 blobs at the ends of terminal branches detected the electrical signs of neurotransmitter being released onto receptors. Injection of a calcium indicator (Oregon Green 488 BAPTA-1) into the motor nerve with subsequent imaging of the calcium transients, in response to stimulation, often showed a reduced calcium influx in the ends of terminal branches. Injection of a fluorescent dye into motor nerves revealed the full extent of their terminal branches and growing processes. Injection of the terminal Schwann cells (TSCs) often revealed pseudopodial TSC processes up to 10-microm-long. Imaging of these TSC processes over minutes or hours showed that they were highly labile and capable of extending several micrometers in a few minutes. Injection of motor nerve terminals with a different dye to that injected into their TSCs revealed that terminal processes sometimes followed the TSC processes over a few hours. It is suggested that the ends of motor nerve terminals in vivo are in a constant state of remodeling through the formation and regression of processes, that TSC processes guide the remodeling, and that it can occur over a relatively short period of time.
Directory of Open Access Journals (Sweden)
Alice Michiyo Takeda
2009-08-01
Full Text Available No Brasil, estudos sobre hábitos alimentares das larvas de Chironomidae ainda são escassos e estas informações são importantes para entender a estrutura trófica e a organização dos ecossistemas aquáticos. Neste estudo, teve-se como objetivo identificar os principais itens alimentares ingeridos por Cricotopus sp. e comparar as possíveis diferenças na dieta das larvas em diferentes substratos artificiais e fases hídricas. Foram utilizados quatro tipos de substratos artificiais: madeira em forma de X (MADX, placas de nitacetal em forma de X (NITX, PVC em forma de tubo (PVCT e metal galvanizado em forma de tubo (METT, cada um com três réplicas. As coletas foram realizadas quinzenalmente, entre os meses de agosto de 2004 e dezembro de 2005. A dieta de Cricotopus sp. foi constituída por detritos, algas e hifas de fungos. Detrito foi o principal item alimentar, com valores superiores a 50% do total consumido. Os resultados indicaram que Cricotopus sp. é uma espécie coletora e, independentemente do substrato, as larvas alimentam-se dos recursos disponíveis no ambiente. Entretanto, mudanças no regime hidrológico do rio Paraná podem influenciar a disponibilidade de alimento, principalmente algumas diatomaceas como Melosira sp., consumidas em maior quantidade apenas na fase de águas baixasIn Brazil, studies on the diet of Chironomidae larvae are still scarce and these data are important to understand the trophic structure and organization of aquatic ecosystems. In this study, we identified the main food items consumed by Cricotopus sp. and compared possible differences in the larval diet at different artificial substrates and hydrological phases. We used four types of artificial substrates: X-shaped wood (MADX; X-shaped nitacetal plates (NITX; tube-shaped PVC (PVCT and tube-shaped galvanized metal (METT, each with three replicates. Samplings were undertaken fortnightly, between August 2004 and December 2005. Cricotopus sp. diet was
Burger, Joanna; Elbin, Susan
2015-03-01
Birds living in coastal areas are exposed to severe storms and tidal flooding during the nesting season, but also to contaminants that move up the food chain from the water column and sediment to their prey items. We examine metals in Herring Gull (Larus argentatus) and Great Black-backed Gull (Larus marinus) eggs collected from the New York/New Jersey harbor estuary in 2012 and in 2013 to determine if there were significant yearly differences in metal levels. We test the null hypothesis that there were no significant yearly differences in metal levels. We investigate whether there were consistent differences in metals from 2012 to 2013 that might suggest a storm-related effect because Superstorm Sandy landed in New Jersey in October 2012 with high winds and extensive flooding, and view this research as exploratory. Except for arsenic, there were significant inter-year variations in the mean levels for all colonies combined for Herring Gull, and for lead, mercury and selenium for Great Black-backed Gulls. All metal levels in 2013 were less than in 2012, except for lead. These differences were present for individual colonies as well. Metal levels varied significantly among islands for Herring Gulls in both years (except for cadmium in 2013). No one colony had the highest levels of all metals for Herring Gulls. A long term data set on mercury levels in Herring Gulls indicated that the differences between 2012 and 2013 were greater than usual. Several different factors could account for these differences, and these are discussed.
Directory of Open Access Journals (Sweden)
Gerson A. Müller
2010-12-01
Full Text Available The efficiency of an alternative method of collection (by suction of water for the study of Culicidae and Chironomidae (Diptera, Scirtidae (Coleoptera and Coenagrionidae (Odonata in bromeliads with different foliar architecture in a restinga at Florianópolis, SC, Brazil, was studied. The alternative method was less efficient to collect Culicidae and Chironomidae (Wilcoxon test p 0.05 from Aechmea lindenii. This method was less efficient to collect insects of all groups from Vriesea friburgensis (Wilcoxon test p A eficiência do método alternativo de coleta (por sucção da água para o estudo de Culicidae e Chironomidae (Diptera, Scirtidae (Coleoptera e Coenagrionidae (Odonata em bromélias com diferentes estruturas foliares de restinga em Florianópolis, SC, Brasil, foi estudada. O método alternativo foi menos eficiente para coletar Culicidae e Chironomidae (teste de Wilcoxon p 0, 05 a partir de Aechmea lindenii. Esse foi menos eficiente para coletar insetos de todos os grupos a partir de Vriesea friburgensis (teste de Wilcoxon p < 0,05. O método alternativo se mostrou eficiente em estimar a diversidade desses insetos nas duas espécies de bromélias. A alta mobilidade das formas imaturas dos coleópteros e libélulas e a disponibilidade de apenas um tanque em Aechea lindenii, em contraste com as várias axilas e Vriesea friburgensis, facilitando a sucção destas formas imaturas provavelmente influenciaram os resultados. Os resultados indicam que o método de sucção não deve substituir o desmanche no estudo de Culicidae e Chironomidae; ele pode ser útil para a obtenção de formas imaturas de Scirtidae e Coenagrionidae em bromélias de um só tanque.
Baek, Min Jeong; Yoon, Tae Joong; Kang, Hyo Jeong; Bae, Yeon Jae
2014-10-01
Members of the nonbiting midge family Chironomidae have been used worldwide as water-quality indicators or toxicity test organisms. The purpose of this study was to establish the chironomid Glyptotendipes tokunagai Sasa as a new test species by conducting successive rearing under laboratory conditions. We monitored biological and genetic aspects of >42 successive generations over 7 yr, and also compared the development of the 39th generation with the fourth generation under five constant temperatures of 15, 20, 25, 30, and 35°C. We observed that the number of eggs in an egg mass and the adult body sizes decreased rapidly in the early generations, and thereafter tended to stabilize from the fifth generation to the 42nd generation. In all generations, the mean hatching rate was >75%. Males were predominant in the early generations, but the sex ratio increased to 0.5 (ranged 0.24-0.61) in later generations. The genetic divergence of the reared generations, analyzed by using the mitochondrial cytochrome c oxidase subunit I gene, decreased from 0.0049 to 0.0004 as the generations progressed. In comparison with the fourth generation, the mortality and developmental time of the 39th generation were generally greater, and the adult body sizes were generally smaller. The estimated low developmental threshold temperatures of eggs, male larvae to male adults, and female larvae to female adults were 9.6, 11.3, and 9.7°C, respectively. The optimal rearing temperature was determined to be 25°C. This is the first record of domesticated rearing of a wild chironomid species under laboratory conditions for >7 yr.
Brooks, J. R.; Compton, J.; Herlihy, A.; Sobota, D. J.; Stoddard, J.; Weber, M.
2014-12-01
Nitrogen (N) removal in watersheds is an important regulating ecosystem service that can help reduce N pollution in the nation's waterways. However, processes that remove N such as denitrification are generally determined at point locations. Measures that integrate N processing within watersheds and over time would be particularly useful for assessing the degree of this vital service. Because most N removal processes isotopically enrich the N remaining, δ15N from basal food-chain organisms in aquatic ecosystems can provide information on watershed N processing. As part of EPA's National Aquatic Resource Surveys (NARS), we measured δ15N of Chironomidae in lakes, rivers and streams because these larval aquatic insects were found in abundance in almost every lake and stream in the U.S. Using information on nitrogen loading to the watershed, and total N concentrations within the water, we assessed when elevated chironomid δ15N would indicate N removal rather than possible enriched sources of N. Chironomid δ15N values ranged from -4 to +20 ‰, and were higher in rivers and streams than in lakes (median = 7.6 ‰ vs. 4.8 ‰, respectively), indicating that N was processed to a greater degree in lotic chironomids than in lentic ones. For both, δ15N increased with watershed-level agricultural land cover and N loading, and decreased as precipitation increased. In rivers and streams with high synthetic N loading, we found lower N concentrations in streams with higher chironomid δ15N values, suggesting greater N removal. At low levels of synthetic N loading, the pattern reversed, and streams with enriched chironomid δ15N had higher N concentrations, suggesting enriched sources such as manure or sewage. Our results indicate that chironomid δ15N values can provide valuable information about watershed-level N inputs and processing for national water quality monitoring efforts.
De Jonge, M; Belpaire, C; Geeraerts, C; De Cooman, W; Blust, R; Bervoets, L
2012-12-01
The present study investigated to what extent accumulated metal levels in aquatic invertebrates can reflect environmental contamination and how these tissue levels can be related to alterations in macroinvertebrate communities in the dredged River Dommel. Metal accumulation was measured in translocated zebra mussels (Dreissena polymorpha) and resident Chironomidae. Furthermore, macroinvertebrate community composition was assessed. Our results indicated that trends of total metal concentrations in surface water of the Dommel in time are reflected well by metal levels in tissue of D. polymorpha. In contrast, sediment-bound metals were the most dominant exposure route for Chironomidae. Alterations in macroinvertebrate community composition were observed during dredging and significant relations between metal levels in invertebrate tissues and ecological responses were found. Our results demonstrated that metal accumulation in both zebra mussels and Chironomidae can be used as an integrated measure of metal bioavailability and to predict ecological effects of metal toxicity on macroinvertebrate communities. Copyright © 2012 Elsevier Ltd. All rights reserved.
Polukonova, N V; Karmokov, M Kh; Shaternikov, A N
2015-02-01
The karyotype of Camptochironomus pallidivittatus Edwards, 1929 (Diptera, Chironomidae) from five populations of the Lower Volga region and Central Caucasus (the northern macroslope) has been studied. In populations of S. pallidivittatus from the Central Caucasus, 11 banding sequences (BS) were found; one sequence, pal B10, was new to the species. In the Saratov population, 11 BS were also found, three of which were new for the species-pal A3, pal B11, and pal B12. The banding sequences detected for the first time have not yet been found in other parts of the habitat of this species and may be endemic to these regions. In the studied populations ofS. pallidivittatus, banding sequences were found that were nonstandard but fixed in the karyotype. This is indicative of some degree of chromosomal divergence. These banding sequences include pal A2.2 in arm A and pal B10.10 in arm B in the Central Caucasus region, as well as pal B2.2 and pal G2.2 in the Lower Volga region. Arms A, B, D, and G in the Central Caucasian populations and A, B, and D in the Saratov oblast were polymorphic. The composition of heterozygous sequences between populations from different regions coincided only in arm D (pal D 1.2). In arms A and B, the set of heterozygous BS was different: pal A1.2 and pal B1.10 sequences were found in the Central Caucasian populations, and pal A1.3 and B11.12 were found in Saratov oblast. The number of genotypic combinations of S. pallidivittatus was higher in the Central Caucasus region, whereas the number of zygotic combinations was higher in the Saratov population. The percentage of heterozygous larvae in the Central Caucasian populations varied from 20 to 80, whereas all individuals in the Saratov population had heterozygous inversions. Zygotic combinations of larvae in all the studied populations were different.
Mendes, Humberto Fonseca; Pinho, Luiz Carlos
2016-06-14
Only 30 chironomid species distributed in 16 genera and three subfamilies are formally recorded to Colombia. Another 32 genera and two subfamilies have been recorded on larval stage, with no identification at species level. Many new records, genera and species are expected when focusing on systematics of chironomids from Colombia.
International Nuclear Information System (INIS)
De Jonge, M.; Belpaire, C.; Geeraerts, C.; De Cooman, W.; Blust, R.; Bervoets, L.
2012-01-01
The present study investigated to what extent accumulated metal levels in aquatic invertebrates can reflect environmental contamination and how these tissue levels can be related to alterations in macroinvertebrate communities in the dredged River Dommel. Metal accumulation was measured in translocated zebra mussels (Dreissena polymorpha) and resident Chironomidae. Furthermore, macroinvertebrate community composition was assessed. Our results indicated that trends of total metal concentrations in surface water of the Dommel in time are reflected well by metal levels in tissue of D. polymorpha. In contrast, sediment-bound metals were the most dominant exposure route for Chironomidae. Alterations in macroinvertebrate community composition were observed during dredging and significant relations between metal levels in invertebrate tissues and ecological responses were found. Our results demonstrated that metal accumulation in both zebra mussels and Chironomidae can be used as an integrated measure of metal bioavailability and to predict ecological effects of metal toxicity on macroinvertebrate communities. - Highlights: ► The use of tissue concentrations to assess environmental metal pollution was studied. ► Metal accumulation was measured in caged zebra mussels and resident Chironomidae. ► Shell condition of mussels and macroinvertebrate taxa distribution was assessed. ► Different accumulation between biota and relations with community level were found. ► Bioaccumulation is an integrated measure of metal toxicity in aquatic communities. - Metal accumulation in selected aquatic invertebrates can be used as an integrated measure of metal bioavailability and to predict ecological effects of metal toxicity.
Evaluation of long term effects of thermal effluents on stream biota
International Nuclear Information System (INIS)
Sublette, J.E.
1980-10-01
In order to evaluate the effects of energy related developments in aquatic ecosystems, a normal water data base must be established. One approach used is the selection of indicator communities on species with fairly well known environmental tolerances and requirements. The Chironomidae (Order Diptera) dominate the macrobenthic assemblages of many streams. The group offers great potential for water quality assessment. The studies in this report determine the species composition of Chironomidae at stream sites in New Mexico, across the relationship of species composition to water quality parameters, and map karyotypes for the chironomus decorus group
Protein (Cyanobacteria): 408501 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available n Prochlorococcus marinus str. MIT 9211 MPGIGPRTAQRLALHLLRQPEERIKAFANALLNARNQVGQCQQCFHLTEGNECEICLNQNRQRNLICV...VADSRDLLALERTREYKGLYHVLGGLISPMDGIGPELLNISPLVKRITSEETTEVILALTPSVEGDTTSLYLAKLLNAFVKVTRIAYGLPVGSELEYADEVTLARALEGRRTVE ...
Protein (Cyanobacteria): 432519 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available mal protein L18 Prochlorococcus marinus str. MIT 9211 MATLSKKQQTQKRHKRLRRHLNGTNHRPRLAVFRSNNHIYAQVIDDEAQSTICSASTLDKDLREKLKASGGSCDASMAVGALLAQRALAKGIEQVVFDRGGNLYHGRVKALAKSAREAGLKF ...
Protein (Cyanobacteria): 159903630 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 59:965 ... RecR protein Prochlorococcus marinus str. MIT 9211 MPGIGPRTAQRLALHLLRQPEERIKAFANALLNARNQVGQCQQCFHLT...EGNECEICLNQNRQRNLICVVADSRDLLALERTREYKGLYHVLGGLISPMDGIGPELLNISPLVKRITSEETTEVILALTPSVEGDTTSLYLAKLLNAFVKVTRIAYGLPVGSELEYADEVTLARALEGRRTVE
Protein (Cyanobacteria): 78779802 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 1196 ... hypothetical protein PMT9312_1418 Prochlorococcus marinus str. MIT 9312 MKFLTTLFLKLLLLSNFVIAETIPTKSNILKQSSECIKDSQNQICRELVSKLEKLQYVVFDQNRFKCQSSLLGLQSELIEAYFLKSLSKKRISFMIPYVIKNC
ORF Alignment: NC_005071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available coccus ... marinus str. MIT 9313] ... Length = 117 ... Query: 7 ... KVKINALPDNHISIELEVPAARCKSSYDAAL...SRLGSAIRLPGFRPGKIPKQVIIQQIGIA 66 ... KVKINALPDNHISIELEVPAARCKSSYDAALSRLGSA...IRLPGFRPGKIPKQVIIQQIGIA Sbjct: 1 ... KVKINALPDNHISIELEVPAARCKSSYDAALSRLGSAIRLPGFRPGKIPKQVIIQQIGIA 60 ...
Directory of Open Access Journals (Sweden)
Tyas Dita Pramesthy
2014-08-01
Full Text Available As one group of Chironomidae Tanypodinae larvae can be used in biological assessment to detect the heavymetal pollution in aquatic environment, because they could show morphological changes due to the pollution. Thestudy was aimed to describe ligula deformities in Tanypodinae larvae in a heavy metal polluted lake. The study wasconducted in Mei to June 2014 at Lake Lido, West Java. The results showed that lead (Pb concentration in LidoLake was quaite high, i.e. 0.08 0.19 mg/L. Ten of fifty-five collected Tanypodinae larve exhibited deformation in theirligulae. Index of severity of ligula deformation (ILSD was 4.4 indicating the response of the Chironomidae larvae tolead pollution.
ORF Alignment: NC_005071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available lA ... [Prochlorococcus marinus str. MIT 9313] ... Length = 111 ... Query: 41 ... PLEQLARRSLDPDVALTNGRPTVIEFYADWCQACREMAPA...MLKTERDREDQXXXXXXXXX 100 ... PLEQLARRSLDPDVALTNGRPTVIEFYADWCQACREMAPA...MLKTERDREDQ ... Sbjct: 1 ... PLEQLARRSLDPDVALTNGRPTVIEFYADWCQACREMAPAMLKTERDREDQLDVVLVNVD 60 ...
Temporal Analyses of Select Macroinvertebrates in the Upper Mississippi River System, 1992-1995
National Research Council Canada - National Science Library
Sauer, Jennifer
1998-01-01
The annual variability in mayflies (Ephemeroptera), fingernail clams (Sphaeriidae), and midges (chironomidae) in six study areas of the Upper Mississippi River System from 1992 to 1995 was examined...
ORF Alignment: NC_005072 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tein S8 ... [Prochlorococcus marinus subsp. pastoris str. CCMP1986] ... Length = 128 ... Query: 5 ... DPISDMLTRIRNASQKKHTST...AIPASKMSLSIAKVLQKEGFITDINEEGEGYKSQIVLGL 64 ... DPISDMLTRIRNASQKKHTST...AIPASKMSLSIAKVLQKEGFITDINEEGEGYKSQIVLGL Sbjct: 1 ... DPISDMLTRIRNASQKKHTSTAIPASKMSLSIAKVLQKE
Phylogenetic distribution of a male pheromone that may exploit a nonsexual preference in lampreys.
Buchinger, T J; Bussy, U; Li, K; Wang, H; Huertas, M; Baker, C F; Jia, L; Hayes, M C; Li, W; Johnson, N S
2017-12-01
Pheromones are among the most important sexual signals used by organisms throughout the animal kingdom. However, few are identified in vertebrates, leaving the evolutionary mechanisms underlying vertebrate pheromones poorly understood. Pre-existing biases in receivers' perceptual systems shape visual and auditory signalling systems, but studies on how receiver biases influence the evolution of pheromone communication remain sparse. The lamprey Petromyzon marinus uses a relatively well-understood suite of pheromones and offers a unique opportunity to study the evolution of vertebrate pheromone communication. Previous studies indicate that male signalling with the mating pheromone 3-keto petromyzonol sulphate (3kPZS) may exploit a nonsexual attraction to juvenile-released 3kPZS that guides migration into productive rearing habitat. Here, we infer the distribution of male signalling with 3kPZS using a phylogenetic comparison comprising six of 10 genera and two of three families. Our results indicate that only P. marinus and Ichthyomyzon castaneus release 3kPZS at high rates. Olfactory and behavioural assays with P. marinus, I. castaneus and a subset of three other species that do not use 3kPZS as a sexual signal indicate that male signalling might have driven the evolution of female adaptations to detect 3kPZS with specific olfactory mechanisms and respond to 3kPZS with targeted attraction relevant during mate search. We postulate that 3kPZS communication evolved independently in I. castaneus and P. marinus, but cannot eliminate the alternative that other species lost 3kPZS communication. Regardless, our results represent a rare macroevolutionary investigation of a vertebrate pheromone and provide insight into the evolutionary mechanisms underlying pheromone communication. © 2017 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2017 European Society For Evolutionary Biology.
Directory of Open Access Journals (Sweden)
Cibele Bender Raio
2011-06-01
Full Text Available Aquatic communities of macroinvertebrates are influencied by rapid velocity, habitat heterogeneity and other characteristics. This study examined a relationship between aquatic insects diversity with hydrologic order of two streams. We tested following hypothesis: diversity of insects associated with the same substrate in equal parts of streams, classified in different orders, are similar. Samples of litter were collected in middle stretches of stream Cascatinha (first order and stream João Pinheiro (second order, Tibagi river basin, Telêmaco Borba, Paraná, Brazil. Diversity of each stream was obtained by Shannon index. Diversity values were low for both streams (0.8 for the first order stream and 0.89 for the second order stream with no statistical difference (t = -1.12; p = 0. 27. Similarity between the streams was 0.51. These results allowed us to verify that, to studied streams, hydrological order has no effect on aquatic insects diversity (F= 0.14, p= 0.71, so the hypothesis was accepted. The most abundant taxon in both streams was Chironomidae (Diptera, representing 82.7% of total collected. However when Chironomidae was removed from analysis, the hypotesis was refused. An high abundance of Chironomidae individuals had influenced values of local diversity. A estrutura das comunidades de macroinvertebrados aquáticos é influenciada pela velocidade da correnteza do curso d’água e da heterogeneidade de habitats entre outras características. Este trabalho verificou a relação da diversidade de insetos aquáticos com a ordem hidrológica de dois riachos. Para isso, foi testada a seguinte hipótese: a diversidade de insetos associados ao mesmo substrato em trechos equivalentes de riachos classificados em diferentes ordens é semelhante. Amostras de folhiço foram coletas nos trechos médios do riacho Cascatinha (primeira ordem e do riacho João Pinheiro (segunda ordem, pertencentes à bacia do rio Tibagi, Telêmaco Borba, Paran
Dicty_cDB: Contig-U15609-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available H641784 ) CHO_OF4972xp21r1.ab1 CHO_OF4 Nicotiana tabacum ge... 54 0.002 2 ( DY336731 ) OB_SEa04L12.r OB_SEa Ocimum basil...nt WO2007093776. 38 0.029 3 ( DQ508732 ) Perkinsus marinus delta9-elongating activity prot... 38 0.029 3 ( D...Y036171 ) CAIY2568.fwd CAIY Artemisia annua leaf Artemisia ... 42 0.33 2 ( AW6512...9 2 ( EY042621 ) CAIY6316.fwd CAIY Artemisia annua leaf Artemisia ... 42 0.39 2 ( EH069644 ) PMDAD81TO Perki...nsus marinus small insert cDNA lib... 38 0.41 2 ( EY042620 ) CAIY6316.rev CAIY Artemisia annua leaf Artemi
Timmermann, Ute; Becker, Norbert
2017-12-01
Since 1980, mosquito breeding habitats in the Upper Rhine Valley were routinely treated with Bacillus thuringiensis var. israelensis (Bti). Bti is considered to significantly reduce the number of mosquitoes, and - especially when used in higher dosages - to be toxic to other Nematocera species, e.g. Chironomidae, which could be food sources for aerial feeding predators. To investigate direct and indirect effects of routine Bti treatment on food sources for aerial feeding predators, the availability of flying insects in treated and untreated areas was compared. A car trap was used for insect collection, which allowed their exact spatiotemporal assignment. The statistical analysis revealed that insect taxa abundance was influenced differently by the factors season, temperature and time of day. Nematocera (Diptera) were the most frequently collected insects in all areas. Chironomidae were the predominant aquatic Nematocera. The comparison of treated and untreated sites did not show significant differences that would indicate any direct or indirect effect of routine Bti treatment on the availability of flying insects. Additional to food availability, food selection must be considered when investigating food resources for aerial feeding predators. In this study, food selection of Delichon urbicum (House Martin) as an example was investigated with the help of neck ring samples. The preferred prey of the investigated D. urbicum colony consisted of diurnal insects with terrestrial larvae (Aphidina, Brachycera, Coleoptera). Chironomidae were consumed, but not preferred.
Gene : CBRC-PMAR-01-0569 [SEVENS
Lifescience Database Archive (English)
Full Text Available romyzon marinus cDNA, mRNA sequence /gb=CO548425 /gi=51796737 /ug=Pma.8609 /len=962 3e-06 21% MCCIGIADTLALLLHWHCCCIGIAATLA...LLLHWHCCYIGIVATLALLLRWHCCCIGIVDTLALLLHWHCCFIGIVAALALLLHWHCCCIGIVAALALLLHWHCCYIGIVATLA...LLLHWHCCYIRIAATLALLLHWHCCCIGIAAALALLLHWHCCCIGIVDTLALLLHWHCCYIGIAATLALLLHWHCCCIGIVATLALLLHWHCCYIGIAATLA...LLLHWHCCYIGIAATLALLLHWHCCCIGIAATLTLLLHCHSCTVRAPAVADTLGLRPSPNLYKEFTFRG ...
Directory of Open Access Journals (Sweden)
Luiz Ubiratan Hepp
2008-10-01
Full Text Available O objetivo deste estudo foi avaliar os efeitos de metais (Cu e Zn sobre a comunidade de macroinverterados bentônicos. Foram amostrados, trimestralmente, entre setembro de 2006 e junho de 2007, organismos e água em oito trechos de riachos de duas bacias hidrográficas influenciadas por urbanização e agricultura. Foram estimados os valores de densidade de organismos, riqueza taxonômica e diversidade de Shannon. Para avaliação dos dados, foram utilizados testes de variância e regressão linear simples. Os resultados demonstraram variabilidade das concentrações dos metais e da macrofauna entre as estações do ano e riachos estudados. O metal Cobre (Cu apresentou influência apenas sobre a densidade Chironomidae e o metal Zinco (Zn apresentou efeito sobre a densidade total da macrofauna bentônica e de Chironomidae. Nenhum dos metais apresentou efeitos sobre a riqueza e diversidade de macroinvertebrados. Os resultados indicam potencial bioindicador da comunidade bentônica na avaliação da qualidade integrada do ambiente.The aim of this study was to evaluate the effect of metals (Cu and Zn on the benthic macroinvertebrate community. The organisms and water were collected quarterly between September 2006 and June 2007, in eight sites in streams of two hydrographic basins, influenced by urbanization and agriculture. The values of organism density, taxonomic richness and the Shannon diversity index were calculated. For data evaluation, tests of variance and simple linear regression were used. The results showed variability in the metal concentration and benthic community among seasons and studied streams. Cu showed influence only on Chironomidae density. Zn demonstrated effect on the benthic community and Chironomidae density. None of the metals presented effect on the macroinvertebrate richness and diversity. The results indicate a bioindicator potential of the benthic community in the evaluation of integral quality of the environment.
ORF Alignment: NC_005071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Prochlorococcus marinus str. MIT 9313] ... Length = 122 ... Query: 44 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARC...TGDGVLEATVWD 103 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARC...TGDGVLEATVWD Sbjct: 1 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARCTGDGVLEATVWD 60 ... Query: 164 WY 165 ... WY Sbjct: 121 WY 122
Directory of Open Access Journals (Sweden)
Brum Zorrilla N.
1973-09-01
Full Text Available Karyotypes of eight of South American Bufonidae were studied: B.ictericus, B. spinulosus spinulosus, B. arenarum, B. g. fernandezae, B. g. d'orbignyi, B. crucifer, B. paracnemis and B. marinus. In all species 2n = 22 chromosomes were found. Neither heteromorphic pairs of chromosomes nor bivalents with characteristic morphology and behavior of sex chromosomesduring male meiosis were observed in any species.Karyotypes of eight of South American Bufonidae were studied: B.ictericus, B. spinulosus spinulosus, B. arenarum, B. g. fernandezae, B. g. d'orbignyi, B. crucifer, B. paracnemis and B. marinus. In all species 2n = 22 chromosomes were found. Neither heteromorphic pairs of chromosomes nor bivalents with characteristic morphology and behavior of sex chromosomesduring male meiosis were observed in any species.
Natural diet of three species of shrimp in a tropical coastal lagoon
Directory of Open Access Journals (Sweden)
Albertoni Edélti Faria
2003-01-01
Full Text Available The gut content of 495 specimens of Farfantepenaeus brasiliensis, 131 of F. paulensis (Penaeidae and 102 of Macrobrachium acanthurus (Palaemonidae were analyzed to establish the composition of their diets F. brasiliensis had as the most important feeding items in its diet larvae of Chironomidae, Polychaeta and Heleobia australis (Mollusca. For F. paulensis, the most important items were the same as for F. brasiliensis, but the order of importance of H. australis and Polychaeta was inverted. M. acanthurus had detritus as the most important item, followed by Chironomidae larvae, Odonata nymphs, and fragments of the macroalgae Chara. The results showed that the three species were omnivorous, with a varied diet including both components of macrofauna of benthos and associated to the macroalgae Chara and plant fragments and detritus.
Tessier, Laura R; Long, Tristan A F; Wilkie, Michael P
2018-01-01
Invasive sea lamprey (Petromyzon marinus) are controlled in the Great Lakes using the lampricide 3-trifluoromethyl-4-nitrophenol (TFM), which is applied to streams infested with larval lamprey. However, lamprey that survive treatments (residuals) remain a challenge because they may subsequently undergo metamorphosis into parasitic juvenile animals that migrate downstream to the Great Lakes, where they feed on important sport and commercial fishes. The goal of this study was to determine if body size and life stage could potentially influence sea lamprey tolerance to TFM by influencing patterns of TFM uptake and elimination. Because mass specific rates of oxygen consumption (M˙O 2 ) are lower in larger compared to smaller lamprey, we predicted that TFM uptake would be negatively correlated to body size, suggesting that large larvae would be more tolerant to TFM exposure. Accordingly, TFM uptake and M˙O 2 were measured in larvae ranging in size from 0.2-4.2g using radio-labelled TFM ( 14 C-TFM) and static respirometry. Both were inversely proportional to wet mass (M), and could be described usingthe allometric power relationship: Y=aM b , in which M˙O 2 =1.86M 0.53 and TFM Uptake=7.24M 0.34 . We also predicted that body size would extend to rates of TFM elimination, which was measured following the administration of 14 C-TFM (via intraperitoneal injection). However, there were no differences in the half-lives of elimination of TFM (T 1/2 -TFM). There were also no differences in M˙O 2 or TFM uptake amongst size-matched larval, metamorphosing (stages 6-7), or post-metamorphic (juvenile) sea lamprey. However, the T 1/2 -TFM was significantly lower in larval than post-metamorphic lamprey (juvenile), indicating the larval lamprey cleared TFM more efficiently than juvenile lamprey. We conclude that larger larval sea lamprey are more likely to survive TFM treatments suggesting that body size might be an important variable to consider when treating streams with TFM to
South African Journal of Geomatics - Vol 5, No 2 (2016)
African Journals Online (AJOL)
resolution orthophotos, point clouds and surface models for mapping wetlands · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marinus Axel Boon, Richard Greenfield, Solomon Tesfamichael ...
Czech Academy of Sciences Publication Activity Database
Frouz, Jan; Ali, A.; Lobinske, R. J.
2004-01-01
Roč. 20, č. 4 (2004), s. 458-461 ISSN 8756-971X Institutional research plan: CEZ:AV0Z6066911 Keywords : Chironomidae * nuisance midge * cyanobacteria Subject RIV: EH - Ecology, Behaviour Impact factor: 0.691, year: 2004
Gene : CBRC-PMAR-01-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available o Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE272683 /gi=111169662 /ug=Pma.1613 /len=663 1e-08 26% MEVGIS...IMEVAISIMEVDISIMEVDISIMEVGISIMEVGISIMEVGISIMEVDISIMEVGISIMEVAISIMEVAISIMEVGISITEVRISIMEVGIS...IMEVGISITEVGISITEVGISIMEVGISIMEVGISITEVGISITEVGISITEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGIS...ITEVGISIMEVGISITEVRISIMEVGFTITASSTSSLSSLTQARLLHLFPSTLQRTTSSCLMLSSSLSAMNNPLLDENLSTPPPLIILQIRHPSIHPHGGRPLSDAFRPWAAALFLVSAIGHRPSLAVTTRPDKAQISSGAV ...
The influence of freshwater releases and season on disease prevalence and intensity of Perkinsus marinus, condition index, gonadal condition, recruitment potential, and growth of oysters was examined monthly at five locations along the Caloosahatchee estuary, Florida. Temperature...
Indian Academy of Sciences (India)
PRAKASH KUMAR
Since DNA encrypts the genetic code it cannot be a random ... strains of bacteria such as the plant pathogen Xylella fastidiosa, marine Cyanobacteria Prochlorococcus marinus or ..... This holds even for the highly virulent strain Y. pestis which.
An Agar-Based Method for Plating Marine Protozoan Parasites of the Genus Perkinsus.
Directory of Open Access Journals (Sweden)
Emma R Cold
Full Text Available The genus Perkinsus includes protozoan parasites of mollusks responsible for losses in the aquaculture industry and hampering the recovery of natural shellfish beds worldwide, and they are a key taxon for understanding intracellular parasitism adaptations. The ability to propagate the parasite in liquid media, in the absence of the host, has been crucial for improving understanding of its biology; however, alternative techniques to grow the parasite are needed to explore other basic aspects of the Perkinsus spp. biology. We optimized a DME: Ham's F12-5% FBS- containing solid agar medium for plating Perkinsus marinus. This solid medium supported trophozoite propagation both by binary fission and schizogony. Colonies were visible to the naked eye 17 days after plating. We tested the suitability of this method for several applications, including the following: 1 Subcloning P. marinus isolates: single discrete P. marinus colonies were obtained from DME: Ham's F12-5% FBS- 0.75% agar plates, which could be further propagated in liquid medium; 2 Subcloning engineered Perkinsus mediterraneus MOE[MOE]: GFP by streaking cultures on plates; 3 Chemical susceptibility: Infusing the DME: Ham's F12-5% FBS- 0.75% agar plates with triclosan resulted in inhibition of the parasite propagation in a dose-dependent manner. Altogether, our plating method has the potential for becoming a key tool for investigating diverse aspects of Perkinsus spp. biology, developing new molecular tools, and for biotechnological applications.
Assessing estuarine quality: A cost-effective in situ assay with amphipods.
Martinez-Haro, Monica; Acevedo, Pelayo; Pais-Costa, Antónia Juliana; Taggart, Mark A; Martins, Irene; Ribeiro, Rui; Marques, João Carlos
2016-05-01
In situ assays based on feeding depression can be powerful ecotoxicological tools that can link physiological organism-level responses to population and/or community-level effects. Amphipods are traditional target species for toxicity tests due to their high sensitivity to contaminants, availability in the field and ease of handling. However, cost-effective in situ assays based on feeding depression are not yet available for amphipods that inhabit estuarine ecosystems. The aim of this work was to assess a short-term in situ assay based on postexposure feeding rates on easily quantifiable food items with an estuarine amphipod. Experiments were carried out under laboratory conditions using juvenile Echinogammarus marinus as the target individual. When 60 Artemia franciscana nauplii (as prey) were provided per individual for a period of 30 min in dark conditions, feeding rates could be easily quantified. As an endpoint, postexposure feeding inhibition in E. marinus was more sensitive to cadmium contamination than mortality. Assay calibration under field conditions demonstrated the relevance of sediment particle size in explaining individual feeding rates in uncontaminated water bodies. An evaluation of the 48-h in situ bioassay based on postexposure feeding rates indicated that it is able to discriminate between unpolluted and polluted estuarine sites. Using the harmonized protocol described here, the in situ postexposure feeding assay with E. marinus was found to be a potentially useful, cost-effective tool for assessing estuarine sediment and water quality. Copyright © 2016 Elsevier Ltd. All rights reserved.
Diptera Community In The Littoral Zone Of A North East Arid Zone ...
African Journals Online (AJOL)
Maiduguri, Nigeria, were studied between January and June 2002. Dipteran samples were collected every 2 weeks from five different stations. Five groups of diptera organisms simulidae, chironomidae, centrapogo nidae, culicidae and chaoboridae were found in analyzable numbers. The diptera assemblage was ...
Energy Technology Data Exchange (ETDEWEB)
Whelly, M. P.; Ciborowski, J. J. H. [Windsor, Univ., Windsor, ON (Canada)
1998-07-01
The effects of oil sands process water (OSPW) on aquatic invertebrates in wetlands near Fort McMurray, Alberta, are assessed. Principal components analysis and cluster analysis of environmental characteristics of 15 wetlands were used to identify three pairs of environmentally similar wetlands that differed mainly in exposure to or absence of OSPW. Large larvae of Chironomidae were collected and examined for mentum deformities (missing or extra teeth) for use as a biomarker. Invertebrate taxa richness and abundance was only moderately lower at OSPW -affected sites than at corresponding reference sites. The incidence of teeth deformities in midges (Chironomidae spp.) from OSPW-affected and corresponding reference wetlands was found to be moderate, and homogeneous among sites and between paired reference and OSPW-affected wetlands. This finding led to the conclusion that the suspected trace metals and PAHs may not be bioavailable in these highly humic wetlands.
Energy Technology Data Exchange (ETDEWEB)
Whelly, M. P.; Ciborowski, J. J. H. [Windsor, Univ., Windsor, ON (Canada)
1998-12-31
The effects of oil sands process water (OSPW) on aquatic invertebrates in wetlands near Fort McMurray, Alberta, are assessed. Principal components analysis and cluster analysis of environmental characteristics of 15 wetlands were used to identify three pairs of environmentally similar wetlands that differed mainly in exposure to or absence of OSPW. Large larvae of Chironomidae were collected and examined for mentum deformities (missing or extra teeth) for use as a biomarker. Invertebrate taxa richness and abundance was only moderately lower at OSPW -affected sites than at corresponding reference sites. The incidence of teeth deformities in midges (Chironomidae spp.) from OSPW-affected and corresponding reference wetlands was found to be moderate, and homogeneous among sites and between paired reference and OSPW-affected wetlands. This finding led to the conclusion that the suspected trace metals and PAHs may not be bioavailable in these highly humic wetlands.
International Nuclear Information System (INIS)
Whelly, M. P.; Ciborowski, J. J. H.
1998-01-01
The effects of oil sands process water (OSPW) on aquatic invertebrates in wetlands near Fort McMurray, Alberta, are assessed. Principal components analysis and cluster analysis of environmental characteristics of 15 wetlands were used to identify three pairs of environmentally similar wetlands that differed mainly in exposure to or absence of OSPW. Large larvae of Chironomidae were collected and examined for mentum deformities (missing or extra teeth) for use as a biomarker. Invertebrate taxa richness and abundance was only moderately lower at OSPW -affected sites than at corresponding reference sites. The incidence of teeth deformities in midges (Chironomidae spp.) from OSPW-affected and corresponding reference wetlands was found to be moderate, and homogeneous among sites and between paired reference and OSPW-affected wetlands. This finding led to the conclusion that the suspected trace metals and PAHs may not be bioavailable in these highly humic wetlands
Directory of Open Access Journals (Sweden)
Ludmilla O. Ribeiro
2005-09-01
Full Text Available A comunidade de macroinvertebrados bentônicos de um riacho de terceira ordem foi analisada em duas estações do ano, chuvosa e seca. Substratos artificiais foram amostrados semanalmente, ao longo de 56 dias para a coleta de macroinvertebrados, nas duas estações do ano. A composição da comunidade foi caracterizada por uma baixa diversidade, ou seja, presença de muitas espécies raras e poucas espécies abundantes nas duas estações do ano. Uma alta dominância de Chironomidae (Diptera nas duas estações, seguida de Baetidae (Ephemeroptera e Ancylidae (Mollusca, respectivamente nas estações chuvosa e seca, foi característico. Os resultados obtidos reforçam a grande importância de Chironomidae na comunidade bentônica de riachos e salientam a influência da sazonalidade sobre a estruturação destes organismos.The benthic macroinvertebrates community of a third order stream was studied during the wet and dry seasons. The community was analyzed using artificial substrates sampled weekly during 56 days in each season. The community composition was characterized by low species diversity, with high number of rare species and few abundant species for both seasons. A high dominance of Chinonomidae (Diptera for both seasons, followed by Baetidae (Ephemeroptera and Ancylidae (Mollusca, respectively for the wet and dry seasons, was found. The results reinforced the high importance of Chironomidae and the seasonal effect determining the stream benthic community structure.
DEFF Research Database (Denmark)
Paludan-Müller, Christine; Dalgaard, Paw; Huss, Hans Henrik
1998-01-01
-packed salmon was dominated by a Vibrio sp., resembling V. marinus, Enterobacteriaceae (Enterobacter agglomerans, Serratia liquefaciens and Rahnella aquatilis) and occasionally Aeromonas hydrophila. Irrespective of the addition of nisin and/or CO2- atmosphere, the LAB microflora was dominated by Carnobacterium...
Collins, S.; van Hilten, J.J.; Marinus, J.J.; Zuurmond, W.W.A.; de Lange, J.J.; Perez, R.S.G.M.
2008-01-01
Collins S, van Hilten JJ, Marinus J, Zuurmond WW, de Lange JJ, Perez RS. Development of a symptoms questionnaire for complex regional pain syndrome and potentially related illnesses: the Trauma Related Neuronal Dysfunction Symptoms Inventory. Objective: To develop a questionnaire to evaluate
Long-term resource limitation reduces insect detritivore growth in a headwater stream
Brent R. Johnson; Wyatt F. Cross; J. Bruce Wallace
2003-01-01
We measured larval growth rates of 2 dominant stream detritivore groups to assess the mechanism underlying declines in invertebrate production following exclusion of terrestrial litter inputs to a forested headwater stream. Larval Tallaperla spp. (P1ecoptera:Peltoperlidae) were chosen as representative shredders and non-Tanypodinae Chironomidae (...
Trophic state changes can affect the importance of methane-derived carbon in aquatic food webs
Schilder, Jos; Van Hardenbroek, M.; Bodelier, P.L.E.; Kirilova, Emiliya P.; Leuenberger, Markus; Lotter, A.F.; Heiri, O.
2017-01-01
Methane-derived carbon, incorporated by methane-oxidizing bacteria, has been identified as a significant source of carbon in food webs of many lakes. By measuring the stable carbon isotopic composition (δ13C values) of particulate organic matter, Chironomidae and Daphnia spp. and their resting eggs
An assessment of Environmental Conditions and the Benthic Fauna ...
African Journals Online (AJOL)
Sensitive taxa of Dytiscidae, Hydropsychidae and Libellulidae were found only upstream from Obommirem to Buade. The mid portion of the Odaw catchment area were dominated by Oligochaeta, Naedidae and Lymnaea while the lower portion was dominated by the Chironomidae. There was no seasonal variation in the ...
Huo, Bin; Xie, Cong Xin; Madenjian, Charles P.; Ma, Bao Shan; Yang, Xue Feng; Huang, Hai Ping
2014-01-01
Feeding habits of Oxygymnocypris stewartii were investigated based on monthly sampling in the Yarlung Zangbo River from August 2008 to August 2009. The gut contents of 194 individuals were analysed and quantified with numerical and gravimetric methods. This species can be considered a generalized and opportunistic predator feeding both on teleosts and aquatic insects. A multivariate analysis revealed noticeable variation in O. stewartii diet composition with fish size and season. The smaller specimens fed primarily on Cobitidae and Hydropsychidae. As they grew, Cyprinidae and Chironomidae larvae became important prey. The preferred food items were teleosts in summer and autumn. For winter and spring, the predominant prey switched to chironomidae larvae. Diet composition did not significantly vary between the sexes. Finally, a significant and positive correlation between predator and prey length was found. These findings provide the fundamental information better understanding the role of this important endemic species in the Yarlung Zangbo River food web.
Nelson, M; Jones, S H; Edwards, C; Ellis, J C
2008-08-19
Due to their opportunistic and gregarious nature, gulls may be important reservoirs and vectors for anthropogenically derived fecal pathogens in coastal areas. We used ribotyping, a genotypic bacterial source tracking method, to compare populations of Escherichia coli among herring gulls Larus argentatus, great black-backed gulls L. marinus, wastewater, and landfill trash in New Hampshire and Maine, USA. Concentrations of E. coli in gull feces varied widely among individuals, but were generally high (6.0 x 10(1) to 2.5 x 10(9) g(-1) wet weight). Of 39 E. coli isolates from L. argentatus, 67% had banding patterns that were > or = 90% similar to those from wastewater and trash, whereas only 39% of 36 L. marinus isolates exhibited > or = 90% similarity to these sources. Strains of E. coli from gulls matched (> or = 90% similarity) more strains from wastewater (39% matching) than from trash (15% matching). E. coli isolates from L. marinus feces exhibited a greater diversity of banding patterns than did isolates from L. argentatus. There were more unique E. coli banding patterns in trash samples than in wastewater, and higher diversity indices in the former compared to the latter. These findings suggest that both species of gulls, especially L. argentatus, obtain fecal bacteria from wastewater and landfill trash, which they may transport to recreational beaches and waters. Our results also indicate that E. coli populations may vary widely between gull species, and between the anthropogenic habitats that they frequent, i.e. landfills and wastewater treatment facilities.
DEFF Research Database (Denmark)
Jacobsen, Dean; Laursen, Søren Kock; Hamerlik, Ladislav
2017-01-01
, but the composition of the stomach contents varied greatly between sites and among individuals. Algal matter was ingested at most sites, but macroinvertebrates (Chironomidae, Baetidae and Simuliidae) dominated the ingestion (average 50–100. The trophic position of Triplophysa, identified from δ15N (‰) of the biota...
Directory of Open Access Journals (Sweden)
Paula Maria Elb
2010-03-01
Full Text Available In specialized literature, reports on anatomy of miners in host plants are few in number. These agents trigger excavations, or paths, by consumption of plant inner tissues by larvae of several insects. The aim of this work was to investigate leaf miner occurrence in Commelina diffusa (a cosmopolitan plant and Floscopa glabrata (an amphibious plant using anatomical techniques. The place where the plants were collected is subjected to seasonal floods, consequently both the species were exposed to the same weather conditions and seasonal floods. This study showed that members of Agromyzidae and Chironomidae families, which are Diptera endophytophagous larvae types, were responsible for the tunnels. Moreover, in Commelina diffusa Agromyzidae larvae were found, while in Floscopa glabrata three Chironomidae cephalic exuviae were found. The miners, as can be seen from anatomical studies, used only mesophyll parenchyma tissues for feeding, causing the formation of linear mines. In addition, in both the species, the epidermis and the medium-sized vascular units were kept intact, showing no structural modification, such as neoformation of tissues.Existem poucos relatos na literatura sobre anatomia de plantas parasitadas por agentes minadores, os quais promovem escavações ou caminhos através do consumo dos tecidos internos das plantas por larvas de diversos insetos. A proposta deste trabalho foi analisar anatomicamente a ocorrência de minas foliares em Commelina diffusa (planta cosmopolita e Floscopa glabrata (planta anfíbia causadas por espécies de larvas endofitófagas de dípteros, pertencentes a duas famílias: Agromyzidae e Chironomidae. O local onde as plantas foram coletas está sujeito a inundações sazonais, e as duas espécies foram submetidas às mesmas condições climáticas. Em Commelina diffusa foram encontradas larvas da família Agromyzidae e, em Floscopa glabrata observaram-se três exuvias cefálicas de Chironomidae. Os dados anat
African Journals Online (AJOL)
Boon, Marinus Axel. Vol 5, No 2 (2016) - Articles Unmanned Aerial Vehicle (UAV) photogrammetry produces accurate high-resolution orthophotos, point clouds and surface models for mapping wetlands. Abstract PDF. ISSN: 2225-8531. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...
Tocqueville's Christian Citizen
Ossewaarde, Marinus R.R.
2005-01-01
Tocqueville's Christian Citizen Marinus Ossewaarde Introduction Alexis De Tocqueville is well known for his critique of democracy. A French statesman, he was left with the legacy of the French Revolution that had torn his fatherland and had changed the course of human history for good. Tocqueville,
Deep ancestry of programmed genome rearrangement in lampreys.
Timoshevskiy, Vladimir A; Lampman, Ralph T; Hess, Jon E; Porter, Laurie L; Smith, Jeramiah J
2017-09-01
In most multicellular organisms, the structure and content of the genome is rigorously maintained over the course of development. However some species have evolved genome biologies that permit, or require, developmentally regulated changes in the physical structure and content of the genome (programmed genome rearrangement: PGR). Relatively few vertebrates are known to undergo PGR, although all agnathans surveyed to date (several hagfish and one lamprey: Petromyzon marinus) show evidence of large scale PGR. To further resolve the ancestry of PGR within vertebrates, we developed probes that allow simultaneous tracking of nearly all sequences eliminated by PGR in P. marinus and a second lamprey species (Entosphenus tridentatus). These comparative analyses reveal conserved subcellular structures (lagging chromatin and micronuclei) associated with PGR and provide the first comparative embryological evidence in support of the idea that PGR represents an ancient and evolutionarily stable strategy for regulating inherent developmental/genetic conflicts between germline and soma. Copyright © 2017 Elsevier Inc. All rights reserved.
Apuntes sobre la reproduccion de algunos Bagres marinos
Luengo, José A.
1973-01-01
Mouthbreeding in the male, and modifications of the pelvic fins of the female are recorded for the first time in Selenaspis herzbergii. The pelvic girdle of Selenaspis herzbergii is compared with those of Sciadeichthys proops, Arius spixii, and Bagre marinus. Data are given on eggs and fry in the
Laura S. Kenefic
2014-01-01
In the 1928 Journal of Forestry, Marinus Westveld commented that logging in the Northeast dating to the mid-1800s had been selective cutting that removed desirable species of large sizes. Later, commercial clearcuts removed progressively smaller trees of merchantable quality and desirable species. Indiscriminate logging damaged young growing stock...
Distribution and abundance of the main insect families in the MUDA area
International Nuclear Information System (INIS)
Maimon Abdullah; Azura Zainal Ratin; Noraini Dan
2002-01-01
Periodic sampling of invertebrates by the Sweeping Method was carried out in the Muda rice area. Two plots with three subplots were chosen incorporating both the recycled and non-recycled irrigation systems. Our results showed that there was a significant difference in abundance and diversity of insect families sampled within plots and between visits undertaken from 19 to 89 days after seeding (DAS). Plot comparison between the two irrigated systems shows that the recycled system supports a higher diversity of insects and arachnids compared to the non-recycled system. From a total of 2418 individuals analysed, some 87.43% was from the recycled plots. Of the four dominant families captured from both types of plots, the most abundant comprised Pyralidae, followed by Chironomidae, Coenagrionidae and Tetragnathidae families for the non-recycled plots, whilst ranking for the recycled plots was Chironomidae followed by Acrididae, Coenagrionidae and Cicadellidae families, respectively. The relative abundance and diversity of the various orders and families are also related to abiotic parameters and planting stage of rice. (Author)
MACROZOOBENTHOS IN CARP FISH FRY
Directory of Open Access Journals (Sweden)
Ljubica Debeljak
1996-12-01
Full Text Available Qualitative and quantitative components of macrozoobenthos was investigated on six fish farms with 8-10 ha-1 each at "Donji Miholjac". The ponds were stocked with 200,000 individuals per ha! of three-day-old carp larvae. The fry were fed with animal protein throughout the culturing season. The qualitative and quabtitative macrozoobenthos components formed mainly due to systematic groups of Oligochaeta and Chironomidae. The average size of Oligohaeta varied in each pond from 119 to 944 individuals per m-2 and from 2.18 to 14.09 g per m-2, and the larvae of Chironomidae from 174 to 1086 ind. per m-2 and from 2.66 to 14.09 g per m-2. Variation s of the total macrozoobenthos was within the amplitude of from 28 to 5805 ind. per m-2 and from 0.11 to 73.72 g. per m-2. In mid summer it was determined that there was a fall in the amount of macrozoobenthos in all fish ponds (Table 6.
DEFF Research Database (Denmark)
Kuhn, J.; Andino, P.; Calvez, R.
2011-01-01
, the three sites were placed at comparable distances from the glacier and were grouped as ‘upper’ (50–200 m), ‘middle’ (1.5 km) and ‘lower’ sites (3.5–5.6 km). 3. In total, 2200 individuals (64% chironomids) were collected and 47 taxa (30 dipterans, 18 of these Chironomidae) identified. Density ranged from...
A tale of two fjords – en analyse af bundfauna samfund i Odense og Roskilde Fjord
DEFF Research Database (Denmark)
Banta, Gary Thomas; Delefosse, Matthieu; Canal Vergés, Paula
gravende muslinger (f.eks. Cerastoderma spp.) mens Odense Fjord (OF) havde flere orme. Ligeledes så vi mange tubificide orme i den indre del af OF. I den indre del af RF så vi i stedet mange dansemyggelarver (Chironomidae). Af de undersøgte miljøvariable var vanddybde og salinitet (både niveauet og...
Atlantis Water Supply Scheme (AWSS) artificial recharge scientific and operational support
CSIR Research Space (South Africa)
Jovanovic, Nebojsa
2012-10-01
Full Text Available Scheme (AWSS) artifi cial recharge scientifi c and operational support N JOVANOVIC1, RDH BUGAN1, S ISRAEL1, C PETERSEN1, B GENTHE1, M STEYN1, G TREDOUX1, D ALLPASS2, R BISHOP2, V MARINUS2, P FLOWER2, 1CSIR, Natural Resources and Environment...
Is Monoglucosyldiacylglycerol a Precursor to Monogalactosyldiacylglycerol in All Cyanobacteria?
Sato, Naoki
2015-10-01
Monogalactosyldiacylglycerol (MGDG) is ubiquitous in the photosynthetic membranes of cyanobacteria and chloroplasts. It is synthesized by galactosylation of diacylglycerol (DAG) in the chloroplasts, whereas it is produced by epimerization of monoglucosyldiacylglycerol (GlcDG) in at least several cyanobacteria that have been analyzed such as Synechocystis sp. PCC 6803. A previous study, however, showed that the mgdE gene encoding the epimerase is absent in some cyanobacteria such as Gloeobacter violaceus, Thermosynechococcus elongatus and Acaryochloris marina. In addition, the N-terminal 'fatty acid hydroxylase' domain is lacking in the MgdE protein of Prochlorococcus marinus. These problems may cast doubt upon the general (or exclusive) role of MgdE in the epimerization of GlcDG to MGDG in cyanobacteria. In addition, GlcDG is usually present at a very low level, and the structural determination of endogenous GlcDG has not been accomplished with cyanobacterial samples. In this study, I determined the structure of GlcDG from Anabaena variabilis by (1)H- and (13)C-nuclear magnetic resonance (NMR) spectroscopy. I then showed that G. violaceus, T. elongatus, A. marina and P. marinus contain GlcDG. In all cases, GlcDG consisted of fewer unsaturated molecular species than MGDG, providing further evidence that GlcDG is a precursor to MGDG. The conversion of GlcDG to MGDG was also demonstrated by radiolabeling and chase experiments in G. violaceus and P. marinus. These results demonstrate that all the analyzed cyanobacteria contain GlcDG, which is converted to MGDG, and suggest that an alternative epimerase is required for MGDG synthesis in these cyanobacteria. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
DEFF Research Database (Denmark)
Deurs, Mikael van; Christensen, Asbjørn; Rindorf, Anna
2013-01-01
of prey. Here we studied zooplankton consumption and energy conversion efficiency of lesser sandeel (Ammodytes marinus) in the central North Sea, using stomach data, length and weight-at-age data, bioenergetics, and hydrodynamic modeling. The results suggested: (i) Lesser sandeel in the Dogger area depend...... sandeel densities and growth rates per area than larger habitats...
Ze Slovníku středověké latiny: sporcia
Czech Academy of Sciences Publication Activity Database
Šedinová, Hana
2017-01-01
Roč. 140, č. 1/2 (2017), s. 233-245 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : porcus marinus * Latin lexicography * ancient and medieval zoology * Latin names of marine animals * Bartholomaeus de Solencia dictus Claretus * Pliny the Elder * Isidorus of Sevilla * Thomas of Cantimpré Subject RIV: AI - Linguistics OBOR OECD: Specific languages
Vandenbossche, Jochen; Deroost, Natacha; Soetens, Eric; Kerckhofs, Eric
2009-01-01
We investigated the influence of the level of cognitive functioning on sequence-specific learning in Parkinson's disease (PD). This was done by examining the relationship between the scales for outcomes in Parkinson's disease-cognition [SCOPA-COG, Marinus, J., Visser, M., Verwey, N. A., Verhey, F. R. J., Middelkoop, H. A. M.,Stiggelbout, A., et…
Directory of Open Access Journals (Sweden)
Erika Mayumi Shimabukuro
2011-06-01
Full Text Available AIM: The aim of the present study was to examine the benthic fauna in a marginal pond lateral to the Paranapanema River and to identify the main controlling factors of its distribution. Considering the small size of the lacustrine ecosystem, we expected that seasonal variations of the benthic community attributes are more important than spatial variations; METHODS: Two samplings, one in March and another in August, were carried out at nine sites in the pond. Sediment samples were obtained through a Van Veen grab for invertebrate sorting, granulometric analysis, and for quantification of organic matter in sediment. Other abiotic factors were measured, such as water transparency, dissolved oxygen, pH, electric conductivity, temperature, and depth of sediment sampling sites. Regarding the comparative analysis at spatial scale, no significant variations in density of the benthic invertebrate community were found. RESULTS: In relation to the studied abiotic factors, only depth presented significant differences among sampling sites; All the measured environmental parameters presented significant differences among sampling months, except depth and the physical and chemical characteristics of the sediment. The abundance of Chaoboridae and Chironomidae was the unique attribute with a significant difference in comparing the two months. A higher abundance of taxa occurred in August, especially for Oligochaeta, Nematoda, Chaoboridae, and Chironomidae; CONCLUSIONS: Because of the low structural complexity of the studied pond, we concluded that the changes in benthic macroinvertebrate community attributes were mainly due to seasonal effects.OBJETIVO: O presente estudo tem por objetivo examinar a fauna bentônica em lagoa marginal ao rio Paranapanema e os principais fatores reguladores da sua distribuição. Devido ao pequeno tamanho do ambiente lacustre, procurou-se mostrar que as variações sazonais dos atributos da comunidade bentônica são mais
Preimpoundment Water Quality Study
1981-12-01
American Elm U. americana Americrn Holly Ilex opaca Persirmnr~ Diospyros virginiana Tulip Rbplar Liriodexniron tul-ipifera Basswoo Tilia americana...Brown Company, Dubuque, Iowa. 977 pp. Roback, S.S. 1963. The genus Xenochironomus (Diptera: Tendipedidae) Kieffer, taxonomy and immature stages...Transactions of the American Entomological Society 88:235-245. Roback, S.S. 1969. The immature stages of the genus Tanypus Meigen (Diptera: Chironomidae
Screening for deformed teeth; Screening for saere taender
Energy Technology Data Exchange (ETDEWEB)
Vermeulen, A.; Dall, P.C.; Hansen, F.G.
1996-04-01
Water pollution by pesticides and heavy metals causes sublethal effects in larvae of the Chironomidae midges. These effects are particularly noticeable in the deformities of the oral parts and antennae. Possibilities of using these deformities for the purpose of water/sediment biomonitoring are very promising. Here the first results of screening in a Danish stream are presented. (EG) 9 refs.
Magnet measuring equipment of SC2
1974-01-01
Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)
Comparison of the abiotic preferences of macroinvertebrates in tropical river basins.
Directory of Open Access Journals (Sweden)
Gert Everaert
Full Text Available We assessed and compared abiotic preferences of aquatic macroinvertebrates in three river basins located in Ecuador, Ethiopia and Vietnam. Upon using logistic regression models we analyzed the relationship between the probability of occurrence of five macroinvertebrate families, ranging from pollution tolerant to pollution sensitive, (Chironomidae, Baetidae, Hydroptilidae, Libellulidae and Leptophlebiidae and physical-chemical water quality conditions. Within the investigated physical-chemical ranges, nine out of twenty-five interaction effects were significant. Our analyses suggested river basin dependent associations between the macroinvertebrate families and the corresponding physical-chemical conditions. It was found that pollution tolerant families showed no clear abiotic preference and occurred at most sampling locations, i.e. Chironomidae were present in 91%, 84% and 93% of the samples taken in Ecuador, Ethiopia and Vietnam. Pollution sensitive families were strongly associated with dissolved oxygen and stream velocity, e.g. Leptophlebiidae were only present in 48%, 2% and 18% of the samples in Ecuador, Ethiopia and Vietnam. Despite some limitations in the study design, we concluded that associations between macroinvertebrates and abiotic conditions can be river basin-specific and hence are not automatically transferable across river basins in the tropics.
Stonlach content analyses of Gilchristella aestuarius and Hepsetia ...
African Journals Online (AJOL)
Apseudes digitalis. 80 2,2. 6. 5. Decapoda. Zoea larvae. 6 1,0. 3. 2. Unidentified larvae. 0,3. 2. 0. Insecta. Chironomidae larvae. 810 8,1. 67. 0. 13,5. 65. 13. Terrestrial insects. 2 0,4. 4. 0. Pupae. 22 1,1. 4. 2. Arachnida. Araneida. <0,05. 2. 0. Mollusca. Lamellibranch veligers. 9 <0,05. 8. 0 2240 7,5. 69. 6. Gastropod veligers.
Influence of on-board irradiation on the shelflife of redfish
International Nuclear Information System (INIS)
Reinacher, E.; Ehlermann, D.
1978-01-01
Continuing former investigations during two voyages of the RV 'Anton Dohrn' redfish (Sebastes marinus) was irradiated on board and stored under different conditions, wrapped and unwrapped under melting ice. A part of the irradiated, unwrapped samples was stored under irradiated ice. As in the former investigations the irradiation treatment effected no prolongation of shelflife in the range of marketable quality. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Morillo, Viviana [Universidade Federal do Rio de Janeiro; Abreu, Fernanda [Universidade Federal do Rio de Janeiro; Araujo, Ana C [Universidade Federal do Rio de Janeiro; de Almeida, Luiz G [Laboratorio Nacional de Computacao Cientifica; Enrich-Prast, Alex [Universidade Federal do Rio de Janeiro; Farina, Marcos [Universidade Federal do Rio de Janeiro; de Vasconcelos, Ana T [Laboratorio Nacional de Computacao Cientifica; Bazylinski, Dennis A [Ames Laboratory; Lins, Ulysses [Universidade Federal do Rio de Janeiro
2014-01-01
Although magnetotactic bacteria (MTB) are ubiquitous in aquatic habitats, they are still considered fastidious microorganisms with regard to growth and cultivation with only a relatively low number of axenic cultures available to date. Here, we report the first axenic culture of an MTB isolated in the Southern Hemisphere (Itaipu Lagoon in Rio de Janeiro, Brazil). Cells of this new isolate are coccoid to ovoid in morphology and grow microaerophilically in semi-solid medium containing an oxygen concentration ([O2]) gradient either under chemoorganoheterotrophic or chemolithoautotrophic conditions. Each cell contains a single chain of approximately 10 elongated cuboctahedral magnetite (Fe3O4) magnetosomes. Phylogenetic analysis based on the 16S rRNA gene sequence shows that the coccoid MTB isolated in this study represents a new genus in the Alphaproteobacteria; the name Magnetofaba australis strain IT-1 is proposed. Preliminary genomic data obtained by pyrosequencing shows that M. australis strain IT-1 contains a genomic region with genes involved in biomineralization similar to those found in the most closely related magnetotactic cocci Magnetococcus marinus strain MC-1. However, organization of the magnetosome genes differs from M. marinus.
Preliminary results of mercury levels in raw and cooked seafood and their public health impact.
Costa, Fernanda do N; Korn, Maria Graças A; Brito, Geysa B; Ferlin, Stacy; Fostier, Anne H
2016-02-01
Mercury is toxic for human health and one of the main routes of exposure is through consumption of contaminated fish and shellfish. The objective of this work was to assess the possible mercury contamination of bivalves (Anomalocardia brasiliana, Lucina pectinata, Callinectes sapidus), crustacean (C. sapidus) and fish (Bagre marinus and Diapterus rhombeus) collected on Salinas da Margarida, BA (Brazil), a region which carciniculture, fishing and shellfish extraction are the most important economic activities. The effect of cooking on Hg concentration in the samples was also studied. The results showed that Hg concentration was generally higher in the cooked samples than in raw samples. This increase can be related to the effect of Hg pre-concentration, formation of complexes involving mercury species and sulfhydryl groups present in tissues and/or loss of water and fat. The highest concentrations were found in B. marinus samples ranging 837.0-1585.3 μg kg(-1), which exceeded those recommended by Brazilian Health Surveillance Agency (ANVISA). In addition, Hg values found in the other samples also suggest the monitoring of the Hg concentrations in seafood consumed from the region. Copyright © 2015 Elsevier Ltd. All rights reserved.
2008-01-01
M.Sc. The occurrence of invertebrates in drinking water supplies is a common consumer complaint with studies showing that very few drinking water distribution networks are totally free of organisms. A detailed investigation of different types of metazoan animals in the drinking water supply networks of South Africa has not been undertaken. In limited worldwide studies, invertebrates (mainly Amphipoda, Chironomidae, Cladocera, Copepoda and Ostracoda) have been detected in produced drinking ...
Directory of Open Access Journals (Sweden)
Araújo-Coutinho Carlos José Pereira da Cunha de
2003-01-01
Full Text Available The study was set up to evaluate the impact of two commercial larvicide formulations, Bacillus thuringiensis serovar israelensis base (Bti at 15 ppm/1 min and temephos at 0.03 ppm of active ingredient, used to control Simulium pertinax populations, on associated non-target entomofauna occupying the same breeding sites. The experiments were carried out on the Pedra Branca and Muricana rivers, on the slopes of Serra do Mar massif, municipality of Paraty, state of Rio de Janeiro, Brazil. Bti was applied to the river Pedra Branca and temephosto theriver Muricana. On both rivers, treatment and control sections were labeled as such, each one with two observation posts: slow moving water and fast water regions respectively. Artificial substrata was used to evaluate the abundance of associated entomofauna. Attached immature stages of arthropods were removed from both of its surfaces fortnightly. Were collected, from the two rivers, 28 477 specimens of the entomofauna associated with S. pertinax. The families Hydropsychidae, Chironomidae, Bactidae, Simuliidae, Blephariceridae and Megapodagrionidae were represented. These was an impact of temephos on the entomofauna associated with S. pertinax only in Simuliidae and Chironomidae, and to Bti only in Simuliidae. However, the reduction in their numbers was not statistically significant.
de Araújo-Coutinho, Carlos José Pereira da Cunha; Cunha, Andrea de Barros Pinto Viviani; Serra-Freire, Nicolau Maués; de Mello, Rubens Pinto
2003-07-01
The study was set up to evaluate the impact of two commercial larvicide formulations, Bacillus thuringiensis serovar israelensis base (Bti) at 15 ppm/1 min and temephos at 0.03 ppm of active ingredient, used to control Simulium pertinax populations, on associated non-target entomofauna occupying the same breeding sites. The experiments were carried out on the Pedra Branca and Muricana rivers, on the slopes of Serra do Mar massif, municipality of Paraty, state of Rio de Janeiro, Brazil. Bti was applied to the river Pedra Branca and temephosto theriver Muricana. On both rivers, treatment and control sections were labeled as such, each one with two observation posts: slow moving water and fast water regions respectively. Artificial substrata was used to evaluate the abundance of associated entomofauna. Attached immature stages of arthropods were removed from both of its surfaces fortnightly. Were collected, from the two rivers, 28 477 specimens of the entomofauna associated with S. pertinax. The families Hydropsychidae, Chironomidae, Bactidae, Simuliidae, Blephariceridae and Megapodagrionidae were represented. These was an impact of temephos on the entomofauna associated with S. pertinax only in Simuliidae and Chironomidae, and to Bti only in Simuliidae. However, the reduction in their numbers was not statistically significant.
Frelik, Anna; Pakulnicka, Joanna
2015-10-01
This paper investigates the relations between the diet structure of predaceous adult water beetles from the Dytiscidae family and the structure of macrofauna inhabiting the same environments. The field studies were carried out from April until September in 2012 and 2013 in 1-mo intervals. In total, >1,000 water beetles and 5,115 benthic macro-invertebrates were collected during the whole period of the study. Subsequently, 784 specimens of adult water beetles (70.6% out of the total sampled) with benthic macro-invertebrates found in their proventriculi, were subject to analysis. The predators were divided into three categories depending on their body size: small beetles (2.3-5.0 mm), medium-sized beetles (13-15 mm), and large beetles (27-37 mm). All adult Dytiscidae consumed primarily Ephemeroptera and Chironomidae larvae. Although Asellidae were numerically dominant inhabitants of the sites, the adult water beetles did not feed on them. The analysis of feeding relations between predators and their prey revealed that abundance of Ephemeroptera, Chironomidae, and larval Dytiscidae between the environment and the diet of adult Dytiscidae were strongly correlated. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
DEFF Research Database (Denmark)
Conlon, J M; Bjørnholm, B; Jørgensen, Flemming Steen
1991-01-01
A peptide belonging to the pancreatic-polypeptide-fold family of regulatory peptides has been isolated from the intestine of an Agnathan, the sea lamprey (Petromyzon marinus). The primary structure of the peptide (termed peptide methionine-tyrosine) was established as Met-Pro-Pro-Lys-Pro-Asp-Asn-...... in a preferred structure in which the conformation of the beta-turn between the two helical domains (residues 9-14) is appreciably different....
Czech Academy of Sciences Publication Activity Database
Hartigan, A.; Fiala, Ivan; Dyková, Iva; Jirků, Miloslav; Okimoto, B.; Rose, K.; Phalen, D. N.; Šlapeta, J.
2011-01-01
Roč. 6, č. 4 (2011), e18871 E-ISSN 1932-6203 R&D Projects: GA AV ČR KJB600960701 Grant - others:GA ČR(CZ) GP204/09/P519 Program:GP Institutional research plan: CEZ:AV0Z60220518 Keywords : EW-SOUTH-WALES * BUFO-MARINUS * BIOLOGICAL INVASIONS * INFECTIOUS-DISEASES * NORTH-AMERICA * TREE FROG * MYXOZOA * SEQUENCES * PHYLOGENY * ECOLOGY Subject RIV: EG - Zoology Impact factor: 4.092, year: 2011
Chironomidae (Insecta: Diptera) Collected from Hydrilla Verticillata ...
African Journals Online (AJOL)
A survey of the aquatic weed Hydrilla verticillata was conducted in selected Kenyan and Ugandan lakes, and emerging chironomid adults were collected from samples of Hydrilla and seven other aquatic macrophytes. Hydrilla was absent from Lake Victoria, in sites where it previously occurred. Hydrilla was found in four of ...
Directory of Open Access Journals (Sweden)
José Antonio Arenas-Ibarra
2012-01-01
Full Text Available O estudo foi realizado em diferentes ambientes da várzea do rio Ivinhema com o intuito de analisar a variação espacial e temporal da assembléia de invertebrados bentônicos, bem como sua relação com as variáveis físicas e químicas e o nível hidrométrico. Foram estudados quatro ambientes, o canal principal do rio, o canal Ipoitã, a lagoa Ventura (sem comunicação e a lagoa dos Patos (com comunicação. As coletas foram realizadas trimestralmente de fevereiro a novembro de 2002. O sistema rio Ivinhema foi caracterizado por um regime de potamofase bimodal com intensidades moderadas e grandes amplitudes, permanecendo em potamofase 184 dias em 2001 e 67 dias em 2002. Foram observadas as variações espacial e temporal, quanto às variáveis físicas e químicas, sumarizadas em uma PCA. Dos 37 táxons registrados, Nematoda, Corbiculidae, Oligochaeta, Acari, Ostracoda e Chironomidae foram os mais abundantes, sendo as larvas de Chironomidae o táxon predominante no canal Ipoitã e na lagoa Ventura. Entretanto, a análise da estrutura da assembléia (CA demonstrou que a assembléia bentônica do rio Ivinhema é dissimilar a das lagoas. A relação entre PCA e CA não foi significativa, indicando que no sistema Ivinhema há uma estrutura complexa e que a uniformidade espacial da densidade e temporal da assembléia bentônica deve-se à maior conectividade entre os ambientes.This study was developed in different environments of the Ivinhema river floodplain in order to analyze the spatial and temporal variation of benthic assemblages and their relationship with physical and chemical variables and water level. Samples were taken quarterly between February and November 2002 in four environments: Ivinhema main channel, Ipoitã channel, Patos lake (with direct connectivity and Ventura lake (without connectivity. The system was characterized by a bimodal potamophase cycle with moderate intensities and large amplitudes, remaining in potamophase for
Parasites infecting the cultured oyster Crassostrea gasar (Adanson, 1757) in Northeast Brazil.
Queiroga, Fernando Ramos; Vianna, Rogério Tubino; Vieira, Cairé Barreto; Farias, Natanael Dantas; Da Silva, Patricia Mirella
2015-05-01
The oyster Crassostrea gasar is a species widely used as food and a source of income for the local population of the estuaries of Northeast Brazil. Perkinsus marinus and Perkinsus olseni are deleterious parasites for oyster farming and were recently detected in Brazil. In this study, a histopathologic survey of the oyster C. gasar cultured in the estuary of the River Mamanguape (Paraíba State) was performed. Adult oysters were collected in December 2011 and March, May, August and October 2012 and processed for histology and Perkinsus sp. identification by molecular analyses. Histopathological analysis revealed the presence of parasitic organisms including viral gametocytic hypertrophy, prokaryote-like colonies, protozoans (Perkinsus sp. and Nematopsis sp.) and metazoans (Tylocephalum sp. and cestodes). Other commensal organisms were also detected (the protozoan Ancistrocoma sp. and the turbellarian Urastoma sp.). The protozoan parasite Perkinsus sp. had the highest overall prevalence among the symbiotic organisms studied (48.9%), followed by Nematopsis sp. (36.3%). The other organisms were only sporadically observed. Only the protozoan Perkinsus sp. caused alterations in the oysters' infected organs. Molecular analyses confirmed the presence of P. marinus, P. olseni and Perkinsus beihaiensis infecting the oyster C. gasar. This is the first report of P. beihaiensis in this oyster species.
Cladocera from bottom deposits as an indicator of changes in climate and ecological conditions
Frolova, L. A.
2018-01-01
Diatoms, pollen, and remains of higher vegetation are used as indicator groups in paleoecological studies. Using certain groups of zoological indicators such as planktonic and benthic organisms (Ostracoda, Cladocera, Chironomidae) has recently become popular in paleolimnology and paleoecology. This study aims to estimate the possibilities, benefits, problems and prospects of Cladocera use in the composition of zoothanatocoenosis of lakes’ sediments as one of the biological indicators in paleoenvironmental studies and paleoreconstructions of abiotic conditions of the past.
Byron S. Wilson; Susan E. Koenig; Rick van Veen; Erika Miersma; D. Craig. Rudolph
2011-01-01
The notorious ââcane toadââ (Bufo marinus) is considered to be one of the 100 worst invasive species in the world. A native of South and Central America, Mexico, and the Rio Grande Valley of the United States, this large toad was intentionally introduced to islands in the Caribbean, and subsequently throughout the southern Pacific, as a biological control agent to...
Rapatsa, M M; Moyo, N A G
2015-08-01
The interaction between the fish Oreochromis mossambicus (Percifomes: Cichlidae) and aquatic insects after application of chicken, cow, and pig manure was studied in 7,000-liter plastic aquadams. Principal component analysis showed that most of the variation in water quality after application of manure was accounted for by potassium, nitrogen, dissolved oxygen, phosphate, and alkalinity. Canonical correspondence analysis showed that Gyrinidae, Elminidae, Hydrophilidae, Hydraenidae, and Athericidae were associated with high nutrient levels (nitrogen, phosphorus, and potassium) characteristic of the chicken manure. However, the most abundant aquatic insects Gerridae, Notonectidae, and Culicidae were close to the centre of the ordination and not defined by any nutrient gradient. The Shannon-Wiener diversity was highest in the aquadams treated with chicken manure. The most frequently occurring aquatic insects in the diet of O. mossambicus were culicid mosquitoes in all the treatments. However, in the laboratory, Chironomidae were the most preferred because they lacked refuge. Notonectidae and Gerridae were not recorded in the diet of O. mossambicus despite their abundance. This may be because of their anti-predation strategies. Laboratory experiments showed that Notonectidae, Gyrinidae, and Gerridae fed on Chironomidae and Culicidae. This implies that aquatic predatory insects competed for food with O. mossambicus. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
James, Daniel A.; Chipps, Steven R.
2016-01-01
We compared diet, stomach fullness, condition, and growth of Brown Trout Salmo trutta among streams with or without blooms of the benthic diatom Didymosphenia geminata in the Black Hills, South Dakota. In Rapid Creek, where D. geminata blooms covered ∼30% of the stream bottom, Brown Trout consumed fewer ephemeropterans (6–8% by weight) than individuals from two stream sections that have not had D. geminatablooms (Castle and Spearfish creeks; 13–39% by weight). In contrast, dipterans (primarily Chironomidae) represented a larger percentage of Brown Trout diets from Rapid Creek (D. geminata blooms present; 16–28% dry weight) compared with diets of trout from streams without D. geminata blooms (6–19% dry weight). Diets of small Brown Trout (100–199 mm TL) reflected the invertebrate species composition in benthic stream samples; in Rapid Creek, ephemeropterans were less abundant whereas dipterans were more abundant than in streams without D. geminata blooms. Stomach fullness and condition of Brown Trout from Rapid Creek were generally greater than those of Brown Trout from other populations. Linkages among invertebrate availability, diet composition, and condition of Brown Trout support the hypothesis that changes in invertebrate assemblages associated with D. geminata (i.e., more Chironomidae) could be contributing to high recruitment success for small Brown Trout in Rapid Creek.
International Nuclear Information System (INIS)
Seysebaev, A.T.; Rakhimbaeva, K. T.; Bakhtin, M.M.
2002-01-01
In the paper genetic variability of natural population of chironomidae inhabiting in waters on the territory of Semipalatinsk test site (STS) is studied. Ten Chironomini species of Chironomidae subfamily and one species of Tanypodinae subfamily were identified using cyto-taxonomic methods of analysis. Cytophotomap of polythene chromosomes of salivary glands were established for four species: Glyptotendipes salinus, Captochironomus setivalva, Camptochriomonus tentas and Chironomus plumosus. For the first time a new previously unknown species of Chironomus gender, and namely C, genelenus 1. sp. n. was described and a cytophotomap of its polythene chromosomes was established. A detailed quantative and qualitative analysis of chromosome polymorphism was carried out and the spectrum and frequency of the disk sequences and genotypic combination were identified. New evidence on change in the polythene chromosomes structure were revealed in certain Chironomini species dwelling in the radioactively contaminated water bodies of STS: rare, unique disk sequences of chromosomes were found, a series of specific homo zygote and heterozygote inversions were observed, which evidently resulted from long-term adaptive selection under conditions of the chronic ionizing radiation. Increase of in frequency of structural mutations of chromosomes was found in mitotic cells of imago disk of Chironomini larvae is revealed. This increase indicates that at the STS many population of benthos organisms are directly affected by the ionizing radiation
Polysaccharide-producing microalgae
Energy Technology Data Exchange (ETDEWEB)
Braud, J.P.; Chaumont, D.; Gudin, C.; Thepenier, C.; Chassin, P.; Lemaire, C.
1982-11-01
The production of extracellular polysaccharides is studied with Nostoc sp (cyanophycus), Porphiridium cruentum, Rhodosorus marinus, Rhodella maculata (rhodophyci) and Chlamydomonas mexicana (chlorophycus). The polysaccharides produced are separated by centrifugation of the culture then precipitation with alcohol. Their chemical structure was studied by infrared spectrometry and acid hydrolysis. By their rheological properties and especially their insensitivity to temperatrure and pH variations the polysaccharides produced by Porphryridium cruentum and Rhodella maculata appear as suitable candidates for industrial applications.
Variation in storage alpha-glucans of the Porphyridiales (Rhodophyta).
Shimonaga, Takahiro; Konishi, Mai; Oyama, Yasunori; Fujiwara, Shoko; Satoh, Aya; Fujita, Naoko; Colleoni, Christophe; Buléon, Alain; Putaux, Jean-Luc; Ball, Steven G; Yokoyama, Akiko; Hara, Yoshiaki; Nakamura, Yasunori; Tsuzuki, Mikio
2008-01-01
Storage glucans were analyzed in the Porphyridiales which include the most primitive and phylogenetically diverged species in the Rhodophyta, to understand early evolution of the glucan structure in the Rhodophyta. The storage glucans of both Galdieria sulphuraria and Cyanidium caldarium consisted of glycogen, while those of Rhodosorus marinus, Porphyridium purpureum, P. sordidum and Rhodella violacea could be defined as semi-amylopectin. X-ray diffraction analysis of the glucans demonstrated variation in the crystalline structure: the patterns in P. purpureum and R. violacea were of A- and B-types, respectively, while alpha-glucans of R. marinus and P. sordidum displayed structures with lower crystallinity. Electron microscopic observations indicated that the alpha-glucans of P. sordidum consisted of two kinds of granules; a minor component of more dense granules with crystalline leaflets and a major component of softer ones without crystalline structure. Gel permeation chromatography showed that all the species containing the semi-amylopectin-type glucans also contained amylose, although the relative amounts of this fraction were different depending on the species. Our results are consistent with two distinct evolution scenarios defined either by the independent acquisition of semi-crystalline starch-like structures in the different plant lineages or more probably by the loss of starch and reversion to glycogen synthesis in cyanidian algae growing in hot and acid environments.
Biota and biological principles of the aquatic environment
International Nuclear Information System (INIS)
Greeson, P.E.
1982-01-01
The first of several compilations of briefing papers on water quality prepared by the U.S. Geological Survey is presented. Each briefing paper is prepared in a simple, nontechnical, easy to understand manner. This U.S. Geological Survey Circular contains papers on selected biota and biological principles of the aquatic environment. Briefing papers are included on Why biology in water quality studies , Stream biology, Phytoplankton, Periphyton, Drift organisms in streams, Family Chironomidae (Diptera), Influences of water temperature on aquatic biota, and Stream channelization: Effects on stream fauna
Parachironomus lenz from china and Japan (Diptera, chironomidae).
Yan, Chun-Cai; Yan, Jiao; Jiang, Li; Guo, Qin; Liu, Ting; Ge, Xin-Yu; Wang, Xin-Hua; Pan, Bao-Ping
2015-01-01
Members of the genus Parachironomus Lenz known from China and Japan are revised, and a key to their male adults is given. Parachironomuspoyangensis sp. n. is described in this life stage. Parachironomusfrequens (Johannsen) and Parachironomusmonochromus (van der Wulp) are recorded from China for the first time, thus are redescribed from Chinese specimens. Parachironomuskamaabeus Sasa & Tanaka and Parachironomustoneabeus Sasa & Tanaka are new junior synonyms of Parachironomusfrequens. Three Chinese or Japanese species formerly placed in Parachironomus are transferred to other genera, resulting in the new combinations Cryptochironomusinafegeus (Sasa, Kitami & Suzuki), Demicryptochironomus (Irmakia) lobus (Yan, Sæther, Jin & Wang), and Microchironomuslacteipennis (Kieffer). Chironomussauteri Kieffer, Parachironomuskisobilobalis Sasa & Kondo and Parachironomuskuramaexpandus Sasa are removed from Parachironomus; the last of these three denotes a valid species of uncertain generic placement, the first two are nomina dubia.
Directory of Open Access Journals (Sweden)
MARÍA DEL ÁNGEL MARTÍNEZ-RODRÍGUEZ
2014-12-01
Full Text Available Se evalúo la calidad de agua de tres ciénagas del departamento del Cesar (Zapatosa, Mata de Palma y La Pachita mediante la caracterización de la comunidad de macroinvertebrados acuáticos asociados a la planta acuática-flotante Eichhornia crassipes (taruya, buchón. Se realizaron dos muestreos en época de aguas altas y dos en el periodo de aguas bajas. Para determinar la calidad del agua se midieron variables fisicoquímicas y se utilizaron el Índice Biótico de Polución (IBP y el Índice de Integridad Biótica de Macroinvertebrados (IIBM, este último desarrollado específicamente para las ciénagas estudiadas. Los individuos encontrados pertenecen a 15 órdenes, 34 familias y 87 morfotipos, y de ellos el orden Coleoptera fue el más diverso con 49 morfotipos (56% del total. Las familias Hydrophilidae y Dytiscidae (Coleptera, Cyclestheriidae (Branchiopoda, Chironomidae (Diptera y Planorbidae (Basommatophora fueron las más representativas en cuanto a la abundancia. Las abundancias por área fluctuaron entre 3130 ind.m-2 en Mata de Palma (27% Conchostraca y 190686 ind.m-2 en La Pachita (95% Chironomidae. El IBP presentó las mayores correlaciones con las variables fisicoquímicas, pero el IIBM fue más flexible y sensible, por lo que se recomienda su utilización.
International Nuclear Information System (INIS)
Kovacik, L.
1987-01-01
The results are presented of a hydrobiological study of three flows and one retention reservoir in the surroundings of the Mochovce nuclear power plant (Western Slovakia) performed in June 1982 and May 1983. The research was aimed at obtaining necessary information on the species composition of the algal flora (include blue-green algae) and selected groups of invertebrate hydrofauna (Sarcodina, Rotatoria, Cladocera, Copepoda, Oligochaeta and Chironomidae) in this territory. Natural waters were classified on the basis of the species composition of water organisms according to saprobiological criteria. (author). 4 refs
Directory of Open Access Journals (Sweden)
Ruth LM Ferreira
2001-11-01
Full Text Available The community structure of insects, especially mosquito larvae, in water held in the fungus Aquascypha hydrophora (Berk. Reid (Stereaceae is reported. The study was done in the Adolpho Ducke Forest Reserve, 26 km east of Manaus, AM, Brazil, from September 1998 through November 1999. The most abundant entomofauna were immature Culicidae (n = 121 91.7%, followed by adult Dytiscidae (n = 3 2.3%, immature Chironomidae (n = 5 3.8% and immature Tipulidae (n = 3 2.3%. Culicidae associated with A. hydrophora comprised species of the subfamilies Anophelinae and Culicinae.
Gram-positive bacteria of marine origin: a numerical taxonomic study on Mediterranean isolates.
Ortigosa, M; Garay, E; Pujalte, M J
1997-12-01
A numerical taxonomic study was performed on 65 Gram-positive wild strains of heterotrophic, aerobic, marine bacteria, and 9 reference strains. The isolates were obtained from oysters and seawater sampled monthly over one year, by direct plating on Marine Agar. The strains were characterized by 96 morphological, biochemical, physiological and nutritional tests. Clustering yielded 13 phena at 0.62 similarity level (Sl coefficient). Only one of the seven phena containing wild isolates could be identified (Bacillus marinus). A pronounced salt requirement was found in most isolates.
Directory of Open Access Journals (Sweden)
C. Henriques-de-Oliveira
2007-02-01
Full Text Available This study was carried out at Imboassica Lagoon, located in an urban zone in the municipality of Macaé, Rio de Janeiro state, Brazil. This lagoon has been subject to anthropogenic impacts due to the increasing city population, such as the input of sewage. Areas of variable degree of anthropogenic influence in the lagoon were compared regarding the structure of the macroinvertebrate community associated to Typha domingensis leaves. For sampling, we used 35 x 20 cm net plastic bags, with 6.8 mm mesh containing T. domingensis leaves for colonization. Two different sampling stations were selected: station A, under direct input of sewage; and station B with lesser sewage influence. The bags were removed after 20, 40 and 75 days of colonization. For each sample the Shannon-Wiever Diversity, Pielou Evenness, Jaccard Similarity Indices, Correspondence Analysis and taxonomic richness were calculated. A total of 31,874 individuals were sampled, belonging to 34 taxa. The main taxonomical groups were: Oligochaeta (41%, Chironomidae (40%, Ancylidae (4.6%, Polymitarcyidae (4% and Thiaridae (3%. At station A, the taxonomic richness, the Evenness and Diversity values were lower than in station B. On the other hand, the total density was three times higher in station A than in B. It was already possible to discriminate the community structure of each sampling station in the first sampling. Trichoptera and Ephemeroptera were the main exclusive groups of station B and are considered good water quality indicators due to their high sensibility to contamination. The major contribution to discriminate between the macroinvertebrate communities of the two sample stations came from Chironomidae, Oligochaeta and Ephemeroptera.O presente estudo foi realizado na Lagoa Imboassica, localizada no perímetro urbano da cidade de Macaé, RJ, Brasil. Esta lagoa vem sofrendo impactos antrópicos com o aumento da cidade, como o aporte de esgotos sem tratamento. Áreas com
Directory of Open Access Journals (Sweden)
Ralf Thiel
2016-09-01
Full Text Available Accurate stock assessments for each of the dominant species of sand lances in the northeast Atlantic Ocean and adjacent areas are not available due to the lack of a reliable identification procedure; therefore, appropriate measures of fisheries management or conservation of sand lances cannot be implemented. In this study, detailed morphological and molecular features are assessed to discriminate between four species of sand lances belonging to the genera Ammodytes and Hyperoplus. Morphological characters described by earlier authors as useful for identification of the genera are confirmed, and two additional distinguishing characters are added. A combination of the following morphological characters is recommended to distinguish between the genera Hyperoplus and Ammodytes: the protrusibility of the premaxillae, the presence of hooked ends of the prevomer, the number of dermal plicae, and the pectoral-fin length as a percentage of the standard length. The discriminant function analysis revealed that morphometric data are not very useful to distinguish the species of each of the two genera. The following meristic characters improve the separation of H. lanceolatus from H. immaculatus: the number of lower arch gill rakers, total number of gill rakers, numbers of caudal vertebrae and total vertebrae, and numbers of dorsal-fin and anal-fin rays. It is confirmed that A. tobianus differs from A. marinus by its belly scales that are organised in tight chevrons, scales which are present over the musculature at the base of the caudal fin, as well as by the lower numbers of dermal plicae, dorsal-fin rays, and total vertebrae. In contrast to the morphological data, mitochondrial COI sequences (DNA barcodes failed to separate unambiguously the four investigated species. Ammodytes tobianus and H. lanceolatus showed an overlap between intraspecific and interspecific K2P genetic distances and cannot be reliably distinguished using the common DNA barcoding
Moravec, Frantisek; Barton, Diane P
2018-04-16
The following six species of the Philometridae (Nematoda: Dracunculoidea) were recorded from marine fishes off the northern coast of Australia in 2015 and 2016: Philometra arafurensis sp. n. and Philometra papillicaudata sp. n. from the ovary and the tissue behind the gills, respectively, of the emperor red snapper Lutjanus sebae (Cuvier); Philometra mawsonae sp. n. and Dentiphilometra malabarici sp. n. from the ovary and the tissue behind the gills, respectively, of the Malabar blood snapper Lutjanus malabaricus (Bloch et Schneider); Philometra sp. from the ovary of the goldbanded jobfish Pristipomoides multidens (Day) (Perciformes: all Lutjanidae); and Digitiphilometroides marinus (Moravec et de Buron, 2009) comb. n. from the body cavity of the cobia Rachycentron canadum (Linnaeus) (Perciformes: Rachycentridae). Digitiphilometroides gen. n. is established based on the presence of unique digital cuticular ornamentations on the female body. New gonad-infecting species, P. arafurensis and P. mawsonae, are characterised mainly by the length of spicules (252-264 µm and 351-435 µm, respectively) and the structure of the gubernaculum, whereas P. papillicaudata is characterised mainly by the body length (70 mm) of gravid female, extent of the oesophageal gland, size of caudal projections and the location in the host. Dentiphilometra malabarici differs from congeners mainly in the arrangement of circumoral teeth (in a single row), extent of the oesophageal gland and the absence of sclerotised teeth or protuberances on the oesophageal lobes in the mouth. Digitiphilometroides marinus has not previously been reported from fishes in Australian waters.
15alpha-Hydroxyprogesterone in male sea lampreys, Petromyzon marinus L
Czech Academy of Sciences Publication Activity Database
Bryan, M. B.; Scott, A. P.; Černý, Ivan; Young, B. A.; Li, W.
2004-01-01
Roč. 69, - (2004), s. 473-481 ISSN 0039-128X Institutional research plan: CEZ:AV0Z4055905 Keywords : steroid * 15alpha-hydroxyprogesterone * sea lamprey Subject RIV: CC - Organic Chemistry Impact factor: 2.337, year: 2004
DEFF Research Database (Denmark)
Munk, Peter; Wright, P.J.; Pihl, Niels Jørgen
2002-01-01
A number of commercially important fish species spawn in the coastal areas of the North Sea in the late winter, including cod (Gadus morhua), plaice (Pleuronectes platessa) and lesser sandeel (Ammodytes marinus). The distribution of the early stages of these species overlap to some extent...... Influence (ROFI), predominantly in the Dogger Bank and German Bight areas. There was a high degree of overlap between the distributions of cod and plaice, while the maximal abundance of lesser sandeel was found inshore of the other species. Larval distributions were to a large extent confined by the frontal...
NHE-1 sequence and expression in toad, snake and fish red blood cells
DEFF Research Database (Denmark)
Thomsen, Steffen Nyegaard; Wang, Tobias; Kristensen, Torsten
Red blood cells (RBC) from reptiles appear not to express regulatory volume increase (RVI) upon shrinkage (Kristensen et al., 2008). In other vertebrates, the RVI response is primarily mediated by activation of the Na+/H+ exchanger (NHE-1) and we, therefore decided to investigate whether red cells...... of reptiles express a different NHE-1 that responds less to volume activation compared to other vertebrates or simply lack the Na+/H+ exchanger. Using various tissues from the ball python (Python regius), Cane toad (Bufo marinus) and European perch (Perca fluviatilis), cDNA libraries were created...
Dicty_cDB: Contig-U02523-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available lorococcus marinus str. NATL2A, complete gen... 48 0.82 1 ( AF211148 ) Carsonella ruddii natural-host Russelliana interm...:none) Leishmania major strain Friedlin... 75 4e-12 CP000384_4494( CP000384 |pid:none) Mycobacterium sp. MCS, compl...elaginella moellendorffii mixe... 34 0.16 2 ( GD178393 ) EST04602 Watermelon fruit normalization and subtr...... 50 0.21 1 ( EJ643566 ) 1093012125502 Global-Ocean-Sampling_GS-29-01-01-1... 34 ...e, co... 48 0.82 1 ( EK325308 ) 1095467004903 Global-Ocean-Sampling_GS-31-01-01-1
Differential effects of a local industrial sand lance fishery on seabird breeding performance
DEFF Research Database (Denmark)
Frederiksen, M.; Jensen, Henrik; Daunt, F.
2008-01-01
fluctuations. We evaluated the effects of an industrial sand lance (Ammodytes marinus) fishery off the North Sea coast of the United Kingdom, which has been opened and closed in a quasi-experimental fashion, on sand-lance-dependent breeding seabirds. Controlling for environmental variation ( sea surface...... tridactyla), but not for four diving species. Analyzing Kittiwake data from 12 colonies inside and outside the closure zone in a replicated before-after control impact design, we again found that breeding productivity was significantly depressed in the closure zone when the fishery was active, whereas...
A new species of Bufo Laurenti (Anura, Bufonidae from northeastern Brazil
Directory of Open Access Journals (Sweden)
Maria Nazaré Stevaux
2002-07-01
Full Text Available A new species of bufonid load, Bufo jimi sp. nov., is described from Maracás and Itagibá, State of Bahia, Brazil. This species shows close relationships to B. paracnemis Lutz, 1925 by sharing the presence of tibial glands and the paratoid glands shape. The new species is a member of the Bufo marinus-group, and is characlerized by having well-defined glands in most part of dorsal faceof the forearms, in the extcrn side of the feet and in both sides of cloacal region.
Directory of Open Access Journals (Sweden)
EF. Albertoni
Full Text Available This study was carried out at the Biguás and Polegar lakes, both small environments but at different successional stages. The main objective was to characterize the macroinvertebrate community associated to the aquatic macrophyte stand in each lake in order for this community, the environmental conditions and their water quality to interact. The samples were taken in 2003. The abiotic variables of N and P totals, the temperature, electrical conductivity, pH and dissolved oxygen, as well as the determined clorophyll a concentration were measured. Macroinvertebrates were sampled with a 500 µ mesh size net, separated under a stereomicroscope and identified at the lowest possible taxonomic level, and their densities were shown as the number of individuals per 100 g of macrophyte dry weight. The Shannon-Wiener Diversity Index (H', Pielou evenness (J, frequency of occurrence, abundance and taxa richness were calculated for each invertebrate community. The Lago dos Biguás is undergoing a process of eutrophication and during the study presented a large Pistia stratiotes stand. The Lago Polegar is oligotrophic and had only a small Nymphoides indica bankwe. The macrophyte associated invertebrate communities in each lake were considered significantly different (p < 0.05. Sixty seven taxa were found for the Lago dos Biguás and 32 for the Lago Polegar. For both lakes, most of the taxa were considered rare, with a low dominance in a few months. The taxa with highest densities at Lago dos Biguás were Chironomidae, Daphniidae and Cyclopidae, and Oligochaeta, Chironomidae and Coenagrionidae for Lago Polegar.
Quantifying climate changes of the Common Era for Finland
Luoto, Tomi P.; Nevalainen, Liisa
2017-10-01
In this study, we aim to quantify summer air temperatures from sediment records from Southern, Central and Northern Finland over the past 2000 years. We use lake sediment archives to estimate paleotemperatures applying fossil Chironomidae assemblages and the transfer function approach. The used enhanced Chironomidae-based temperature calibration set was validated in a 70-year high-resolution sediment record against instrumentally measured temperatures. Since the inferred and observed temperatures showed close correlation, we deduced that the new calibration model is reliable for reconstructions beyond the monitoring records. The 700-year long temperature reconstructions from three sites at multi-decadal temporal resolution showed similar trends, although they had differences in timing of the cold Little Ice Age (LIA) and the initiation of recent warming. The 2000-year multi-centennial reconstructions from three different sites showed resemblance with each other having clear signals of the Medieval Climate Anomaly (MCA) and LIA, but with differences in their timing. The influence of external forcing on climate of the southern and central sites appeared to be complex at the decadal scale, but the North Atlantic Oscillation (NAO) was closely linked to the temperature development of the northern site. Solar activity appears to be synchronous with the temperature fluctuations at the multi-centennial scale in all the sites. The present study provides new insights into centennial and decadal variability in air temperature dynamics in Northern Europe and on the external forcing behind these trends. These results are particularly useful in comparing regional responses and lags of temperature trends between different parts of Scandinavia.
Kuş Gölü (Bandırma Makrobentik Omurgasız Faunası Hakkında Bir Ön Araştırma.
Directory of Open Access Journals (Sweden)
Süleyman Balık
2015-12-01
Full Text Available Kuş Gölü’nün makrobentik omurgasız faunasını belirlemek amacıyla 1987 ve 1988 yılları arasında aylık periyotlar halinde, bir yıl süre ile 5 istasyonda arazi çalışması yapılmıştır. Ekman grab ile alınan çamur örnekleri 500 μm göz açıklığındaki elekten geçirilmiş ve örnekler %4’lük formaldehit solüsyonunda tespit edilmiştir. Araştırma sonucunda, Oligochaeta sınıfından 10, Chironomidae familyasından 5 ve Ceratopogonidae familyasından 1 olmak üzere toplam 16 takson tespit edilmiştir. Kuş gölü’nde metrekarede ortalama 6759 birey tespit edilmiş, grupların oransal dağılımında %81,94 ile Oligochaeta bireylerinin en baskın grubu oluşturduğu, bu grubu Chironomidae (%17,90 ve Ceratopogonidae (%0,16 larvalarının takip ettiği saptanmıştır. Tespit edilen grupların istasyonlara göre oransal dağılımlarında ise, 1. istasyonun en zengin (%28,71, 4. istasyonun en fakir (%12,77 istasyon olduğu gözlenmiştir
Directory of Open Access Journals (Sweden)
M. CALLISTO
Full Text Available The influence of Eucalyptus plantations on the structure and composition of macroinvertebrate communities associated with the aquatic fern Salvinia auriculata Aublet were investigated in a high altitude lake bordered by either secondary Atlantic forest or Eucalyptus plantations. Comparisons of the diversity of Chironomidae (Diptera, Insecta larvae in the littoral zone between these two vegetation types showed higher diversity of larvae in waters bordered by Eucalyptus. The results demonstrated that the predominance of carnivorous taxa among the macroinvertebrate fauna appears to be the major controlling factor for limiting diversity in lake areas bordered by Eucalyptus.
Directory of Open Access Journals (Sweden)
CALLISTO M.
2002-01-01
Full Text Available The influence of Eucalyptus plantations on the structure and composition of macroinvertebrate communities associated with the aquatic fern Salvinia auriculata Aublet were investigated in a high altitude lake bordered by either secondary Atlantic forest or Eucalyptus plantations. Comparisons of the diversity of Chironomidae (Diptera, Insecta larvae in the littoral zone between these two vegetation types showed higher diversity of larvae in waters bordered by Eucalyptus. The results demonstrated that the predominance of carnivorous taxa among the macroinvertebrate fauna appears to be the major controlling factor for limiting diversity in lake areas bordered by Eucalyptus.
Metriocnemus carmencitabertarum, een nieuwe dansmug voor Nederland (Diptera: Chironomidae)
Kuper, J.T.; Moller Pillot, H.K.M.
2012-01-01
In augustus 2011 werd een larve van een dansmug gevonden in een emmer onder een dakgoot in Appingedam. Na uitkweken bleek het te gaan om Metriocnemus carmencitabertarum, een nieuwe soort voor Nederland. In het buitenland komt deze soort voor in met water gevulde natuurlijke kommen in rotsen en
Chironomus polonicus sp. n. (Diptera: Chironomidae) from southern Poland.
Michailova, Paraskeva; Kownacki, Andrzej; Langton, Peter H
2013-01-10
The paper describes larval, pupal and adult morphology as well as the karyotype of Chironomus polonicus sp. n. from southern Poland. The material has been obtained from reared egg masses collected in Bolesław pool, near Kraków. The species belongs to the pseudothummi cytocomplex with 2n = 8 and chromosome arm combinations AE, BF, CD, G. Several homozygous inversions distinguish arm A of the new species from that of C. pseudothummi Strenzke. Arm F is similar to that of C. aprilinus Meigen and differs from it by few steps of homozygous inversions. Few morphological differences in the pupa and adult are also presented.
A new species of Dicrotendipes (Diptera: Chironomidae) from Florida.
Epler, J H
2016-12-14
A new species of Dicrotendipes is described in all life stages from Florida. Adults of this new species are nearly identical to D. modestus (Say); pupae are similar to D. modestus, D. neomodestus (Malloch) and D. tritomus (Kieffer); while the larvae are unique and were keyed by Epler (1992, 1995, 2001) as Dicrotendipes sp. A. The taxonomic status of D. modestus and D. pulsus (Walker) is discussed.
Karyotype and chromosomal polymorphism of Camptochironomous tentans (diptera, chironomidae)
International Nuclear Information System (INIS)
Sejsebaev, A.T.; Bakhtin, M.M.; Rakhimbaeva, K.T.
2000-01-01
Particular features of chromosomal polymorphism and cytogenetic differentiations have been studied in three natural populations of Camptochironomous tentans affecting the Semipalatinsk test site. For the first time C. tentans population from water-bodies of the Degelen mountain massif was found to contain a unique rarely observed inverse sequence of chromosomal disks (p'ten B85, p'ten D3, p'ten Ck, p'ten FK) and a series of special homozygous (p'ten C1.1; p'ten D2.2) and heterozygous (p'ten B1.5; p'ten D1.2; p'ten D1.3; p'ten F1.3; p'ten F1K) inversions which could be the result of Chironomini adaptation to the radioactive environment. (author)
Spatial patterns and trends in abundance of larval sandeels in the North Sea: 1950–2005
DEFF Research Database (Denmark)
Lynam, Christopher P.; Halliday, Nicholas C.; Höffle, Hannes
2013-01-01
0-group trawl data at the east Fair Isle ground (since 1984), and with recruitment data (since 1983) for the Dogger Banks stock assessment area. Therefore, CPR data may provide an early recruit index of relative abundance for the Dogger Banks assessment area, where the majority of the commercial...... catch of A. marinus is taken, and the Wee Bankie area that is particularly important for seabird foraging. While warm conditions may stimulate the production of sandeel larvae, their natural mortality is typically greater, in the Dogger Banks and Wadden Sea areas, when the larvae are hatched in warm...
Differential effects of a local industrial sand lance fishery on seabird breeding performance
DEFF Research Database (Denmark)
Frederiksen, M.; Jensen, Henrik; Daunt, F.
2008-01-01
fluctuations. We evaluated the effects of an industrial sand lance (Ammodytes marinus) fishery off the North Sea coast of the United Kingdom, which has been opened and closed in a quasi-experimental fashion, on sand-lance-dependent breeding seabirds. Controlling for environmental variation ( sea surface...... or to the fact that only one study colony in the control zone was exposed to high fishery effort within the typical foraging range of Kittiwakes during the breeding season. The strong impact on Kittiwakes, but not on diving species, could result from ( 1) inherently high sensitivity to reduced prey availability...
Effects of changes in sandeel availability on the reproductive output of seabirds
DEFF Research Database (Denmark)
Rindorf, Anna; Wanless, S.; Harris, M.P.
2000-01-01
The lesser sandeel Ammodytes marinus is a key prey species for many marine birds in the North Sea. This fish is currently the target of the largest single species fishery in the area, and this has led to concern about the potential impact of the fishery on seabirds. There are 2 critical issues...... productivity, breeding effort and diet in 3 species of seabird with contrasting foraging and dietary characteristics (common guillemot Uria aalge, black-legged kittiwake Rissa tridactyla, and European shag Phalacrocorax aristotelis) and an index of availability of 1 group and older sandeels derived from catch...
Directory of Open Access Journals (Sweden)
HS Santana
Full Text Available Alterations in aquatic systems and changes in water levels, whether due to rains or dam-mediated control can cause changes in community structure, forcing the community to readjust to the new environment. This study tested the hypothesis that there is an increase in the richness and abundance of aquatic insects during the rainy season in the Serra da Mesa Reservoir, with the premise that increasing the reservoir level provides greater external material input and habitat diversity, and, therefore, conditions that promote colonization by more species. We used the paired t test to test the differences in richness, beta diversity, and abundance, and a Non-metric Multidimensional Scaling (NMDS was performed to identify patterns in the community under study. Additionally, Pearson correlations were analyzed between the richness, abundance, and beta diversity and the level of the reservoir. We collected 35,028 aquatic insect larvae (9,513 in dry period and 25,515 in the rainy season, predominantly of the Chironomidae family, followed by orders Ephemeroptera, Trichoptera, and Odonata. Among the 33 families collected, only 12 occurred in the dry season, while all occurred in the rainy season. These families are common in lentic environments, and the dominance of Chironomidae was associated with its fast colonization, their behavior of living at high densities and the great tolerance to low levels of oxygen in the environment. The hypothesis was confirmed, as the richness, beta diversity, and abundance were positively affected by the increase in water levels due to the rainy season, which most likely led to greater external material input, greater heterogeneity of habitat, and better conditions for colonization by several families.
Santana, H S; Silva, L C F; Pereira, C L; Simião-Ferreira, J; Angelini, R
2015-01-01
Alterations in aquatic systems and changes in water levels, whether due to rains or dam-mediated control can cause changes in community structure, forcing the community to readjust to the new environment. This study tested the hypothesis that there is an increase in the richness and abundance of aquatic insects during the rainy season in the Serra da Mesa Reservoir, with the premise that increasing the reservoir level provides greater external material input and habitat diversity, and, therefore, conditions that promote colonization by more species. We used the paired t test to test the differences in richness, beta diversity, and abundance, and a Non-metric Multidimensional Scaling (NMDS) was performed to identify patterns in the community under study. Additionally, Pearson correlations were analyzed between the richness, abundance, and beta diversity and the level of the reservoir. We collected 35,028 aquatic insect larvae (9,513 in dry period and 25,515 in the rainy season), predominantly of the Chironomidae family, followed by orders Ephemeroptera, Trichoptera, and Odonata. Among the 33 families collected, only 12 occurred in the dry season, while all occurred in the rainy season. These families are common in lentic environments, and the dominance of Chironomidae was associated with its fast colonization, their behavior of living at high densities and the great tolerance to low levels of oxygen in the environment. The hypothesis was confirmed, as the richness, beta diversity, and abundance were positively affected by the increase in water levels due to the rainy season, which most likely led to greater external material input, greater heterogeneity of habitat, and better conditions for colonization by several families.
Chironomus alchichica sp. n. (Diptera: Chironomidae) from Lake Alchichica, Mexico.
Acosta, Raúl; Prat, Narcís; Ribera, Carles; Michailova, Paraskeva; Hernández-Fonseca, María Del Carmen; Alcocer, Javier
2017-12-15
Morphological analysis of all developmental stages (except female), mitochondrial DNA sequences from cytochrome c oxidase subunit I (cox1) and cytological analysis of the polytene chromosomes were used to describe a new species of Chironomus found in the littoral and profundal zones of an endorheic, warm-monomictic lake in Mexico. Male imago is distinguished by the shape of superior volsella and by an antennal and bristle ratio lower than two. The pupa is characterized by the spur morphology of abdominal segment VIII. There is also a continuous row of hooklets on abdominal segment II. The larva is distinguished by a combination of antenna, mentum, mandible, and pecten epipharyngis characteristics, and abdominal ventral tubules. Molecular and cytological analysis supported the morphological differences found. The maximum likelihood tree obtained shows that Chironomus alchichica sp. n. clusters together with Chironomus decorus-group sp. 2 Butler et al. (1995) (bootstrap support = 92%), but genetic p-distances within C. alchichica sp. n. (0.004) were lower than the p-distances between other species of the decorus-group (C. decorus-group sp. 2, Chironomus bifurcatus Wülker et al., 2009 and Chironomus maturus Johannsen, 1908) confirming that it is a different species. The new species belongs to thummi cytocomplex, (decorus-group), with chromosome set- 2n = 8 and chromosome arm combinations: AB CD EF G. Karyologically, the species is closest to Chironomus riihimaekiensis Wülker (1973). This species has very compact salivary gland chromosomes with well heterochromatinized centromere regions in chromosomes AB CD G. Several fixed homozygous inversions distinguish arm A of the species from that of C. riihimaekiensis. Arm E differs from that of C. riihimaekiensis by simple fixed homozygous inversion. Some similarities in band sequences of this arm were found with species from the decorus-group as Chironomus blaylocki Wülker et al., 2009 and C. bifurcatus (decorus-group). The position of the key constrictions in chromosome G: Nucleolar organizer (NOR) and Balbiani rings (BRs) is similar to the species of decorus-group. C. alchichica sp. n. has been found in soft sediments rich in organic matter in well mineralized waters (where conductivity >10 mS cm-1) and with a high pH (≥9). The profundal zone is inhabited only during the mixing period, when dissolved oxygen is present.
Review of genus Pseudorthocladius Goetghebuer, 1943 (Diptera, Chironomidae from China
Directory of Open Access Journals (Sweden)
Jing Ren
2014-03-01
Full Text Available The genus Pseudorthocladius Goetghebuer, 1943 from China, including 12 species, is reviewed. Five new species, P. (P. binarius sp. n., P. (P. cylindratus sp. n., P. (P. digitus sp. n., P. (P. ovatus sp. n. and P. (P. paucus sp. n. are described and illustrated as adult males. P. (P. cristagus Stur & Sæther, 2004, P. (P. jintutridecima (Sasa, 1996, P. (P. macrovirgatus Sæther & Sublette, 1983, P. (P. morsei Sæther & Sublette, 1983, P. (P. uniserratus Sæther & Sublette, 1983, P. (L. wingoi Sæther & Sublette, 1983 are newly recorded in Oriental Region. A key to the males of Pseudorthocladius in China is presented.
Status report of the Pacific lamprey (Lampetra tridentata) in the Columbia River Basin
International Nuclear Information System (INIS)
Close, D.A.; Fitzpatrick, M.; Li, H.; James, G.
1995-07-01
The widespread decline of Pacific lamprey (Lampetra tridentata) in the Pacific Northwest, especially in the Columbia River system has led to concerns and questions from a number of regional agencies, Native American tribes, and the public. To address these concerns, new research efforts must focus on specific problems associated with this understudied species. The preservation and restoration of this species is critical for a number of reasons, including its importance to the tribes and its importance as an indicator of ecosystem health. Historically lamprey have been labeled a pest species due to the problems associated with the exotic sea lamprey, (Petromyzon marinus), invading the Great Lakes
Status Report of the Pacific Lamprey (Lampetra Trzdentata) in the Columbia River Basin.
Energy Technology Data Exchange (ETDEWEB)
Close, David A.; Parker, Blaine; James, gary
1995-07-01
The widespread decline of Pacific lamprey (Lampetra tridentata) in the Pacific Northwest, especially in the Columbia River system has led to concerns and questions from a number of regional agencies, Native American tribes, and the public. To address these concerns, new research efforts must focus on specific problems associated with this understudied species. The preservation and restoration of this species is critical for a number of reasons, including its importance to the tribes and its importance as an indicator of ecosystem health. Historically lamprey have been labeled a pest species due to the problems associated with the exotic sea lamprey, (Petromyzon marinus), invading the Great Lakes.
Directory of Open Access Journals (Sweden)
Salomé Córdova
2009-01-01
Full Text Available Se evaluó la calidad de las aguas del estero Limache en cinco estaciones de muestreo en el período de bajo caudal. En cada estación se colectaron macroinvertebrados acuáticos, se midió in situ pH, conductividad, oxígeno disuelto, y sólidos disueltos totales. En el laboratorio se determinó la demanda biológica de oxígeno (DBO, fósforo total y nitrógeno total. También se determinó la toxicidad del agua mediante bioensayos con la microalga Pseudokirchrneriella subcapitata. Se determinaron 33 familias de macroinvertebrados, los taxa dominantes fueron Dugessidae, Oligochaeta y Chironomidae. Se encontró correlación significativa entre el índice biótico de familias (ChIBF, la conductividad eléctrica y los sólidos disueltos totales (r = 0,92; p The water quality in the Limache stream was evaluated at five sampling stations during the pe-riod of low water flow. At each station, aquatic macroinvertebrates were collected and the following parame-ters were measured in situ: pH, conductivity, dissolved oxygen, and total dissolved solids. The biological oxy-gen demand, total phosphorus, and total nitrogen were determined in the laboratory. Water toxicity was deter-mined through toxicity bioassays with the microalga Pseudokirchrneriella subcapitata. Thirty-three macroin-vertebrate families were found and the dominant taxa were Dugessidae, Oligochaeta and Chironomidae. A significant correlation was found among the Family Biotic índex ChFBI, conductivity, and total dissolved solids (r = 0.92; p < 0.05. Species diversity was lowest, as was the growth rate of P. subcapitata, at the stations with the greatest anthropogenic activity and in the discharge zone of a domestic wastewater treatment plant.
Energy Technology Data Exchange (ETDEWEB)
Lax, H.G.; Koskenniemi, E.; Sevola, P.; Bagge, P.
1993-01-01
The macrozoobenthos of the subarctic river Tenojoki and some of its tributaries was studied in June and September 1989 as a part of the environmental monitoring programme. The river (F = 16 386 km[sup 2], length 300 km, L = 2.4 %, Q varies between 30-400 m[sup 3]/s) is situated on the Finnish-Norwegian border and is characterized by sand bottoms interrupted by shorter reaches of gravel and stone bottoms. The water is usually clear (colour < 40 mg Pt/l) and oligotrophic (tot-P < 10 [mu]g/l). The bottom fauna was sampled from 9 stations in the main river and from one station in each of the 5 major tributaries. The sampling methods used were: kick-sampling and imago hand netting from all stations, colonization substrates (stone baskets and bricks) at 9 stations in the main river. The tax a number of the kick-samples varied from 10-15/station in spring (totally 51 taxa) and from 15-25/station in autumn (totally 69 taxa). In spring the river margin (depth 0-25 cm) seemed to be an important habitat for many species especially in the upper parts of the river. In autumn most of the species occurred on deeper bottoms (depth 50-100 cm). The most common feeding types in spring were the collectors (Amaletus inopinatus, Chironomidae) and in autumn the scrapers (Elmidae, Baetidae, Hydroptllidae) and collectors (Chironomidae). The pollution index (LongScoreSystem) indicated that the conditions in the lower part of the main river was more stressing for the bottom fauna than in the upper part. But up to now it seems as if the organic pollution from settlements have had only positive effects on the benthic community
Energy Technology Data Exchange (ETDEWEB)
Henrikson, B.-I. (Dept. of Zoology, Sect. of Animal Ecology, Univ. of Goeteborg, Goeteborg (Sweden))
1993-01-01
The increase of peat mosses, Sphagnum spp., in acidified lakes leads to a changed microhabitat structure for benthic invertebrates. The importance of this change was investigated for some benthic invertebrates. Comparisons between quantitative samples of Sphagnum and debris within the acidified Lake Stora Haestevatten, in the Lake Gaardsjoen catchment of SW Sweden, showed significantly higher abundances of Chironomidae, Ceratopogonidae, Odonata, Trichoptera, Cladocera and Argyroneta aquatica (Araneae) in Sphagnum. For chironomidae and Cladocera the differences were tenfold. Special reference was made to the libellulid Leucorrhinia dubia which is common in acid lakes. In a laboratory test, late instar larvae of L. dubia were shown to change colour to correspond to the brown and green colour of Sphagnum. This result was completed with a field test where larvae of L. dubia were significantly more common in Sphagnum of the same colour as the larvae. The ability to change colour may have an adaptive value when coexisting with visual predators. Small larvae were more prevalent in Sphagnum and they also showed a preference for this substrate in the laboratory test. Laboratory tests showed mediumsized larvae preferred Sphagnum. Larvae of L. dubia were more successful as predators on Asellus aquaticus in Sphagnum substrate than in debris in the laboratory test. Laboratory predation tests with notonecta glauca, Corixa dentipes, Acilius sulcatus, Hyphydrus ovatus and L. dubia showed that they could all feed on larvae of L. dubia. The complex habitat structure of Sphagnum is probably the reason for the high abundance of invertebrates since it may serve as both shelter against predation and as foraging sites. it is probably important as a key habitat for young instars of, for example, L. dubia. In lakes with large Sphagnum mats, L. dubia can coexist with fish. The expansion of Sphagnum due to acidification will probably benefit many acid-tolerant invertebrate species. (au)
Directory of Open Access Journals (Sweden)
Juan Carlos GARCIA-R
2015-01-01
Estudiamos la dieta de 15 especies de ranas montanas del género Pristimantis (Craugastoridae en la Cordillera Occidental de Colombia para determinar su variación, amplitud y traslape de nicho. En los contenidos estomacales e intestinales de 154 especímenes se identificaron 499 presas que fueron organizadas en 74 categorías diferentes. Las 15 categorías de presas más comunes representaron el 65 % de la dieta. Las familias de invertebrados Isotomidae, Chironomidae, Formicidae y Tipulidae fueron las más abundantes, representando el 32 % de la dieta de las ranas. Diez de las 15 especies de ranas presentaron al menos un ítem de Araneae. Coleoptera y Tipulidae fueron otras categorías frecuentemente encontradas en los tractos digestivos de las ranas (nueve especies de ranas presentaron estos ítems, seguidas de Acari y Carabidae (ocho especies. En general, los escarabajos fueron encontrados en los tractos gastrointestinales de todas las especies, excepto en P. quantus, pero este resultado debe tratarse con precaución porque solo un individuo de esta especie fue capturado. Pristimantis hectus mostró una dieta especializada consumiendo principalmente dípteros de la familia Chironomidae, mientras que las especies restantes mostraron una dieta generalista. Pristimantis palmeri presentó superposiciones de nicho con P. erythropleura (Фjk = 0,69, P. myops (Фjk = 0,64, y P. orpacobates (Фjk = 0,64. Nuestros resultados sugieren que la mayoría de las especies estudiadas son generalistas que se alimentan de manera oportunista de dípteros, arácnidos, colémbolos, coleópteros e himenópteros. Aquí, reportamos la dieta de especies montanas de Pristimantis y discutimos los resultados con datos de otros estudios en especies relacionadas de regiones montanas y tierras bajas
Eldridge, J.L.; Krapu, G.L.; Johnson, D.H.
2009-01-01
We evaluated food habits of 4 species of spring-migrant calidrid sandpipers in the Prairie Pothole Region (PPR) of North Dakota. Sandpipers foraged in several wetland classes and fed primarily on aquatic dipterans, mostly larvae, and the midge family Chironomidae was the primary food eaten. Larger sandpiper species foraged in deeper water and took larger larvae than did smaller sandpipers. The diverse wetland habitats that migrant shorebirds use in the PPR suggest a landscape-level approach be applied to wetland conservation efforts. We recommend that managers use livestock grazing and other tools, where applicable, to keep shallow, freshwater wetlands from becoming choked with emergent vegetation limiting chironomid production and preventing shorebird use.
Aquatic insect populations in the MUDA rice agroecosystem
International Nuclear Information System (INIS)
Rozilah Ismail; Ahyaudin Ali
2002-01-01
Periodic sampling of aquatic insects was carried out in an experimental plot of the Muda rice agroecosystem. The study which was conducted from August to December 1995, investigated the impact of the pesticides Broadox and Trebon on aquatic insect populations during the rice growing period. The results indicated that there was no significant difference in abundance and diversity of aquatic insects between the treated and non-treated area. The four dominant aquatic insects were from the families; Chironomidae, Dysticidae, Corixidae and Belostomatidae. Water temperature and dissolved oxygen showed changes throughout the rice growing season and the values of these parameters decreased gradually towards the end of the rice growing season in January when the rice plants were maturing. (Author)
Feeding ecology of waterfowl wintering on evaporation ponds in California
Euliss, N.H.; Jarvis, R.L.; Gilmer, D.S.
1991-01-01
We examined the feeding ecology of Northern Pintails (Anas acuta), Northern Shovelers (A. clypeata), and Ruddy Ducks (Oxyura jamaicensis) wintering on drainwater evaporation ponds in California from 1982 through 1984. Pintails primarily consumed midges (Chironomidae) (39.3%) and widegeongrass (Ruppia maritima) nutlets (34.6%). Shovelers and Ruddy Ducks consumed 92.5% and 90.1% animal matter, respectively. Water boatmen (Corixidae) (51.6%), rotifers (Rotatoria) (20.4%), and copepods (Copepoda) (15.2%) were the most important Shoveler foods, and midges (49.7%) and water boatmen (36.0%) were the most important foods of Ruddy Ducks. All three species were opportunistic foragers, shifting their diets seasonally to the most abundant foods given their behavioral and morphological attributes.
An anti-steroidogenic inhibitory primer pheromone in male sea lamprey (Petromyzon marinus)
Chung-Davidson, Yu-Wen; Wang, Huiyong; Bryan, Mara B.; Wu, Hong; Johnson, Nicholas S.; Li, Weiming
2013-01-01
Reproductive functions can be modulated by both stimulatory and inhibitory primer pheromones released by conspecifics. Many stimulatory primer pheromones have been documented, but relatively few inhibitory primer pheromones have been reported in vertebrates. The sea lamprey male sex pheromone system presents an advantageous model to explore the stimulatory and inhibitory primer pheromone functions in vertebrates since several pheromone components have been identified. We hypothesized that a candidate sex pheromone component, 7α, 12α-dihydroxy-5α-cholan-3-one-24-oic acid (3 keto-allocholic acid or 3kACA), exerts priming effects through the hypothalamic-pituitary-gonadal (HPG) axis. To test this hypothesis, we measured the peptide concentrations and gene expressions of lamprey gonadotropin releasing hormones (lGnRH) and the HPG output in immature male sea lamprey exposed to waterborne 3kACA. Exposure to waterborne 3kACA altered neuronal activation markers such as jun and jun N-terminal kinase (JNK), and lGnRH mRNA levels in the brain. Waterborne 3kACA also increased lGnRH-III, but not lGnRH-I or -II, in the forebrain. In the plasma, 3kACA exposure decreased all three lGnRH peptide concentrations after 1 h exposure. After 2 h exposure, 3kACA increased lGnRHI and -III, but decreased lGnRH-II peptide concentrations in the plasma. Plasma lGnRH peptide concentrations showed differential phasic patterns. Group housing condition appeared to increase the averaged plasma lGnRH levels in male sea lamprey compared to isolated males. Interestingly, 15α-hydroxyprogesterone (15α-P) concentrations decreased after prolonged 3kACA exposure (at least 24 h). To our knowledge, this is the only known synthetic vertebrate pheromone component that inhibits steroidogenesis in males.
Streptomyces ovatisporus sp. nov., isolated from deep marine sediment.
Veyisoglu, Aysel; Cetin, Demet; Inan Bektas, Kadriye; Guven, Kiymet; Sahin, Nevzat
2016-11-01
The taxonomic position of a Gram-staining-positive strain, designated strain S4702T was isolated from a marine sediment collected from the southern Black Sea coast, Turkey, determined using a polyphasic approach. The isolate was found to have chemotaxonomic, morphological and phylogenetic properties consistent with its classification as representing a member of the genus Streptomyces and formed a distinct phyletic line in the 16S rRNA gene tree. S4702T was found to be most closely related to the type strains of Streptomyces marinus(DSM 41968T; 97.8 % sequence similarity) and Streptomyces abyssalis (YIM M 10400T; 97.6 %). 16S rRNA gene sequence similarities with other members of the genus Streptomyces were lower than 97.5 %. DNA-DNA relatedness of S4702T and the most closely related strain S. marinus DSM 41968T was 21.0 %. The G+C content of the genomic DNA was 72.5 mol%. The cell wall of the strain contained l,l-diaminopimelic acid and the cell-wall sugars were glucose and ribose. The major cellular fatty acids were identified as anteiso-C15 : 0, iso-C16 : 0, anteiso-C17 : 0 and iso-C15 : 0. The predominant menaquinone was MK-9(H8). The polar lipid profile of S4702T consisted of diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylglycerol, phosphatidylinositol and phosphatidylinositol mannoside. S4702T could be distinguished from its closest phylogenetic neighbours using a combination of chemotaxonomic, morphological and physiological properties. Consequently, it is proposed that S4702T represents a novel species of the genus Streptomyces, for which the name Streptomyces ovatisporus sp. nov. is proposed. The type strain is S4702T (DSM 42103T=KCTC 29206T=CGMCC 4.7357T).
Directory of Open Access Journals (Sweden)
Maria Auxiliadora de Sousa
1974-01-01
Full Text Available A ocorrência de hemagregarinas no sangue dos sapos que examinamos (Bufo crucifer, B. marinus e Melanophryniscus moreirae revelou-se extremamente rara; apenas um exemplar de B. crucifer procedente de Manguinhos (Rio de Janeiro, Guanabara apresentou-se parasitado. As formas sanguíneas encontradas eram intra-eritrocitárias, medindo em média 10,8/ 3,6µ; não as identificamos como trofozoítos ou gametócitos e discutimos este fato. As hemácias parasitadas tinham dimensões normais, porém podiam ter o núcleo deslocado. Supomos ser esta a primeira referência a hemogregarinas neste hospedeiro. Não encontramos identidade entre as formas que descrevemos e aquelas referidas em outras espécies de sapos; fornecemos uma lista das hemogregarinas achadas nestes hospedeiros. Denominamos provisoriamente os parasitos que encontramos Haemogregarina "sensu lato", até que novos dados sobre seu ciclo evolutivo sejam conhecidos.The occurrence of hemogregarines in the blood of Brazilian toads that we have examined (Bufo crucifer, B. Marinus and Melanophryniscus moreirae has displayed very scarce; only one specimen of B. crucifer from Manguinhos (Rio de Janeiro, Guanabara was infected. The blood forms that we found were intraerythrocytic, averaging 10,8 by 3,6µ; we did not differenciate them as thophozoites or as gametocytes and we discuss this fact. The infected erythrocytes were not hypertrophied and their nucleus was normal and sometimes displaced. We think that it is the first reference to hemogregarines in this host. We did not evidence identity among the forms that we described and those reported in other species of toads; we give a list of hemogregarines found in those hosts. We provisorily named the parasites that we found Haemogregarina "sensu lato", until new data about their life cycle become known.
Busarakam, Kanungnid; Bull, Alan T; Trujillo, Martha E; Riesco, Raul; Sangal, Vartul; van Wezel, Gilles P; Goodfellow, Michael
2016-06-01
A polyphasic study was designed to determine the taxonomic provenance of three Modestobacter strains isolated from an extreme hyper-arid Atacama Desert soil. The strains, isolates KNN 45-1a, KNN 45-2b(T) and KNN 45-3b, were shown to have chemotaxonomic and morphological properties in line with their classification in the genus Modestobacter. The isolates had identical 16S rRNA gene sequences and formed a branch in the Modestobacter gene tree that was most closely related to the type strain of Modestobacter marinus (99.6% similarity). All three isolates were distinguished readily from Modestobacter type strains by a broad range of phenotypic properties, by qualitative and quantitative differences in fatty acid profiles and by BOX fingerprint patterns. The whole genome sequence of isolate KNN 45-2b(T) showed 89.3% average nucleotide identity, 90.1% (SD: 10.97%) average amino acid identity and a digital DNA-DNA hybridization value of 42.4±3.1 against the genome sequence of M. marinus DSM 45201(T), values consistent with its assignment to a separate species. On the basis of all of these data, it is proposed that the isolates be assigned to the genus Modestobacter as Modestobacter caceresii sp. nov. with isolate KNN 45-2b(T) (CECT 9023(T)=DSM 101691(T)) as the type strain. Analysis of the whole-genome sequence of M. caceresii KNN 45-2b(T), with 4683 open reading frames and a genome size of ∽4.96Mb, revealed the presence of genes and gene-clusters that encode for properties relevant to its adaptability to harsh environmental conditions prevalent in extreme hyper arid Atacama Desert soils. Copyright © 2016. Published by Elsevier GmbH.
Directory of Open Access Journals (Sweden)
Sebastião José de Oliveira
1992-01-01
Full Text Available A new neotropical genus and a new species of a non-biting midge for the subfamily Tanypodinae from Brazil are described. The new genus is near Tanypus Meigen, 1803 and Procladius Skuse, 1889, but differs of both by wings and male terminalia.
Muzzall, Patrick M.; Hudson, Patrick L.
2004-01-01
Ergasilus megaceros (Copepoda: Ergasilidae) was recovered from the nasal fossae (lamellae) of the olfactory sac in 1 (1.8%) of 56 sea lampreys, Petromyzon marinus Linne, 1758, collected in May 2002 from the Cheboygan River, Michigan. Although the sea lamprey is a new host record for E. megaceros, this fish species may not be a preferred host because of its low prevalence. Ergasilus megaceros is the second ergasilid species reported from the sea lamprey in North America. This is the third report of an ergasilid species infecting the nasal fossae of fishes in North America, with E. rhinos being the only other species reported from this site.
International Nuclear Information System (INIS)
Arthur, W.
2014-07-01
Fish is one of the major sources of animal protein in Ghana and the fisheries industry is vital to the economy of the country. Unfortunately, most of the aquatic systems in Ghana are being polluted with domestic and industrial wastes which results in bioaccumulation of heavy metals in fish species. The traditional method for preserving fish in the country is by hot smoking or smoke drying, through freezing may be preferred where facilities are available. The presence of high levels of heavy metals in both fresh and smoked fish as well as other fish products is a matter of public health concern in Ghana. Variations in the level of bioaccumulation of heavy metals in both fresh and smoked marine fish, Sebastes marinus (red fish) and fresh water fish, Oreochromis niloticus (tilapia) caught off the coast of James Town in Accra and from the Volta river at Kpong respectively were monitored monthly from September 2013 to March 2014. Extension of two shelf life of the smoked fish species by gamma irradiation was also studied during 4 weeks of low temperature (5± 1 C ) storage by refrigeration. The total concentration of Iron (Fe), Zinc (Zn), Copper (Cu), Magnesium (Mg), Manganese (Mn), Cobalt (Co), Cadmium (Cd), Chromium (Cr), Arsenic (As) and Mercury (Hg) in the fish species as well as in their muscles, gills and bones were determined by Flame or Hydride Generation Atomic Absorption Spectrophotometry. The moisture content, pH, sensory analysis and population of aerobic mesophiles (on PCA), yeast and moulds (on OGYE), Escherichia coli (on EMB), Staphylococcus aureus (on BPA) and Salmonella (on XLD) in fresh fish, and smoked fish after treatment with 1, 2 and 3kGy of gamma irradiation and during storage were determined. Four patterns in the bioaccumulation of heavy metals in both Sebastes marinus and Oreochromis niloticus were observed over the 6 months monitoring period. Fe, Cu, Co and Cr accumulated heavily in the fish species during September and October after which the
Contamination of harbor sediments in the eastern Gulf of Finland (Neva Bay), Baltic Sea
Energy Technology Data Exchange (ETDEWEB)
Ussenkov, S.M. [Dept. of Lithology and Marine Geology, Faculty of Geology, St. Petersburg State Univ. (Russian Federation)
1997-11-01
The areal distribution of oil products and various trace metals have been studied in bottom surface deposits from the harbors of Neva Bay. The data of contents were normalized to natural background concentrations. Also the size and biomass of benthos groups were analyzed. The results show clearly that industrial discharges have elevated levels of contamination in the sediments. Few efficient measures against environmental contamination have been taken. The sediments contain very high concentrations of oil products and such heavy metals as Hg, Pb, Cu, and Zn. The benthic organisms most sensitive to heavy metal contamination are Chironomidae. The dredging and dumping of the contaminated deposits can lead to secondary contamination of the Gulf of Finland and the Baltic proper. (orig.)
Directory of Open Access Journals (Sweden)
Elena-Andreea GHIBUŞI
2012-01-01
Full Text Available 35 qualitative macrozoobentonic samples were collected in 2011 from many Siret river tributaries coming from the Harghita Mountains (5 stations, Maramureş Mountains (14 stations, Moldavian Plateau (4 stations and Vrancea Mountains (12 stations. Laboratory analysis of samples revealed the existence of the following 15 groups of benthic invertebrates: Ephemeroptera, Plecoptera, Trichoptera, Oligochaeta, Diptera (Chironomidae, Simuliidae, Ceratopogonidae, Limoniidae, Gastropoda, Bivalva, Coleoptera, Acarina, Odonata, Hirudinea, Isopoda, Heteroptera, Turbellariata and Collembola. Groups that have the highest frequencies were mayflies and dipterans (each with a frequency of 97.1%, followed by caddisflies (80%, amphipods (68.6%, oligochaetes (57.1% and stoneflies (54.3%. Presence of sensitive groups to water quality degradation (Ephemeroptera, Trichoptera and Plecoptera with high frequency shows good quality water at most stations investigated.
Feeding of two Cichlidae species (Perciformes in an hypertrophic urban lake
Directory of Open Access Journals (Sweden)
Yafe Alejandro
2002-01-01
Full Text Available Diet of two cichlid species, Cichlasoma facetum (Jenyns, 1842, and Gymnogeophagus rhabdotus Hensel, 1870, was studied in Rodó Lake, an urban hypertrophic lake in Uruguay. The stomach contents from 192 individuals of C. facetum and 202 of G. rhabdotus, obtained through seasonal sampling in the year 2000, were analyzed. The occurrence frequency and the alimentary importance index of each food item were calculated for each season and size class in both species. Cichlasoma facetum fed upon insects (mainly chironomid larvae and pupae, fish (Cnesterodon decemmaculatus Jenyns, 1842, and vegetals (algae, periphyton and macrophytes debris; large individuals also fed upon the freshwater shrimp Palaemonetes argentinus Nobili, 1901. Gymnogeophagus rhabdotus consumed zooplankton (mainly copepods, vegetals (algae and detritus and Chironomidae larvae in a lesser extent.
Chilton, E.W.; Lowe, R.L.; Schurr, K.M.
1986-01-01
The appearance of the marine alga Bangia atropurpurea (Rhodophyta) in Lake Erie has been followed by its rapid dispersal throughout the eulittoral zone of the lake. Bangia was extensively sampled to determine its suitability as a habitat for littoral organisms. Present data indicate that the only organisms capable of maintaining populations on Bangia filaments are larval Chironomidae. Cladophora supports a larger and more diverse community. It is concluded that the mucilaginous cell wall of Bangia provides a less stable substrate for attached or clinging organisms than does the cellulose cell wall of Cladophora. The presence of Bangia in the littoral zone of Lake Erie results in a reduction of the quantity and diversity of algal epiphytes and may negatively impact the littoral food web.
Radioactive background in principal components of the Jihlava River ecosystem
International Nuclear Information System (INIS)
Stanek, Z.; Penaz, M.; Trnkova, J.; Wohlgemuth, E.
1980-01-01
In 1976 through to 1978, the radioactive background was investigated in the various components of the Jihlava River ecosystem. The investigations involved total β-activity, 40 K, residual β-activity, sup(nat)U, 226 Ra and, in some of the samples, also 210 Pb, 90 Sr and 137 Cs. The analyses included water, bottom sediments, samples of aquatic macrophytes (Batrachium fluitans), samples of aquatic invertebrates (Herpobdella octoculata, Anodonta cygnea, Asellus aquaticus, larval Ephemeroptera, larval Trichoptera, exuviae of pupae of Chironomidae) and samples of the tissues of 8 species of fishes (Salmo trutta m. fario, Cyprinus carpio, Rutilus rutilus, Leuciscus cephalus, Leuciscus leuciscus, Chondrostoma nasus, Gobio gobio, Barbus barbus). The activity of the radionuclides under study corresponded to the values reported for uncontaminated streams. (author)
Diversity of the chironomidae (diptera) of river Niger related to water ...
African Journals Online (AJOL)
Organic pollution and nutrients loading were the main factors explaining the differences in spatial distribution. Some taxa, e.g. Chironomus gr. plumosus and Microchironomus sp. are positively correlated to those factors, while others as Tanytarsini, Nilodosis sp., Micropelopinae and Procladius sp. are negatively correlated.
Diplosmittia caribensis, a new Orthocladiinae (Diptera: Chironomidae) from the Dominican Republic.
Wiedenbrug, Sofia; Silva, Fabio Laurindo Da
2016-04-11
The genus Diplosmittia was erected by Sæther (1981) based on Diplosmittia harrisoni from St. Lucia and St. Vincent in the British West Indies. Prior to the present study the genus comprised nine species, all except D. carinata Sæther were known only from Neotropical Region (Ashe & O'Connor, 2012). During sampling in the surroundings of a highly organic polluted river, in the National Botanical Garden in Santo Domingo, Dominican Republic, the present second author collected several imagines of Diplosmittia that did not fit any taxon treated in the recent review of the genus (Pinho et al. 2009). In the present paper, the male of this new species is described and illustrated.
De larven der Nederlandse Chironomidae (Diptera) Deel C: Autoekologie en verspreiding
Moller Pillot, H.K.M.; Buskens, R.F.M.
1990-01-01
Chironomid larvae occur in nearly all kinds of fresh and brackish waters as well as in semiterrestrial environments. The authors treat the autecology and the distribution of more than 200 taxa in the Netherlands. Except for the tribe Tanytarsini (Chironominae) all the subfamilies occurring in the
New gnat-midge species chironomus degelenus i sp. n. (diptera chironomidae)
International Nuclear Information System (INIS)
Sejsebaev, A.T.; Bakhtin, M.M.; Siirin, M.T.
2001-01-01
For the first time the morphology of larvae, pupae, imago and karyotype of Chironomus degelenus I Sp. n. collected from Water-Body D-3-3 of the Degelen Mountain Massif has been described. The larvae have a species-specific structure and color of the head capsule, ventral-mental blades, and mandibula hamuli. The male gnat is characterized for grid structure in IX tergite. The karyotype of C. degelenus I Sp. n. has the following combination of chromosome arms: AB, CD, EF, and G (thummi complex), which is typical for Chironomus species. It was concluded that the origin of the new species of Chironomus degelenus I Sp. N. is related to the long-term genetic processes of Chironomini adaptation to the elevated radiation background level. (author)
Some new records of chironomids (Diptera: Chironomidae from the Czech Republic
Directory of Open Access Journals (Sweden)
Bitušík Peter
2016-09-01
Full Text Available Six chironomid species: Paraboreochlus minutissimus (Strobl, 1894, Trissopelopia longimanus (Staeger 1839, Boreoheptagyia monticola (Serra-Tosio, 1964, Cricotopus (s.str. similis Goetghebuer 1921, Heleniella serratosioi Ringe, 1976, Krenosmittia camptophleps (Edwards, 1929, were recorded in Czech Republic for the first time. The pupal exuviae were collected in July 2009 from Otava River in the vicinity of Rejštejn village in the central part of the Bohemian Forest. The notes on known distribution and ecology of the species are presented.
Two New and Four Unrecorded Species of Chironomidae (Diptera in Korea
Directory of Open Access Journals (Sweden)
Han-Il Ree
2012-01-01
Full Text Available Chironomid adults attracted to the light were collected at Dangsan-ri, Muju-eup, Muju-gun, Jeollabuk-do in 2008-2009. Two new species, Lymnophyes parakitanaides sp. nov. and Parakiefferiella mujuensis sp. nov., and four unrecorded species, Cardiolcladius capusinus, Thienemanniella vittata, Conchapelopia pallidula, and Nilotanypus dubius were found and are described with illustrations. The genera Thienemanniella and Nilotanypus have not been previously reported in Korea. The genus Thienemanniella which belongs to Orthocladiinae is characterized by the radial sector retracted and apically fused with the costa, and the genus Nilotanypus which belongs to Tanypodinae is characterized by the absence of R2+3, pubescent eyes and lack of the gonocoxal lobes.
Exotic Amphibians in the Pet Shops of Taiwan
Directory of Open Access Journals (Sweden)
Ping-Chun Lucy Hou
2006-06-01
Full Text Available Pet trade is an important mechanism for introducing alien species. We surveyed a total of 434 pet shops in major cities of Taiwan and found 49 species of alien amphibians belonging to 14 families and 31 genera. Two of the alien species, Rana catesbeiana and Kaloula pulchra, have established in the fields and the other three, Bufo marinus, Xenopus laevis, and Dendrobates auratus, have invasion records in other countries. There were 16 CITES Appendix II species. The most frequently displayed species were the horned frogs, eratophrys spp. And the most abundant species was the American Bullfrog, Rana catesbeiana. We urge the authority of Taiwan establishing regulations on pet trade and enforcing the wildlife conservation law to reduce the risks of alien species invasions.
Directory of Open Access Journals (Sweden)
Norma Segatti Hahn
2005-11-01
Full Text Available The aim of this work was to evaluate the relationship between diet and features of the trophic ecomorphology of Satanoperca pappaterra (Heckel, 1840 in an impacted environment. Samples were collected from March 2000 to February 2003 in Manso Reservoir, Cuiabá River, Mato Grosso State. Analysis of 93 stomachs contents showed that food resources associated with the substrate, such as plant remains, detritus, fish scales and Chironomidae larvae, dominated the diet. Consequently this species was characterized as a detritivorous-invertivorous. However, individuals collected in 2003 showed a greater selection of benthic organisms in relation to previous periods. Morphological structures such as position of the mouth, form of the lips, gill rakers and pharyngeal teeth, in addition to the length of the intestine, showed specializations correlated with the diet. However, as long as the food was associated with the substrate, it seemed to be selected according to its abundance in the environment.O objetivo deste estudo foi descrever e avaliar as relações entre dieta e traços da ecomorfologia trófica de Satanoperca pappaterra (Heckel, 1840 em ambiente impactado. As coletas foram realizadas no reservatório de Manso, MT., entre março/2000 a fevereiro/2003. A análise de 93 estômagos, mostrou que recursos alimentares associados ao substrato, tais como restos vegetais, detritos, escamas e larvas de Chironomidae, predominaram na dieta, caracterizando esta espécie como detritívora-invertívora. Entretanto, indivíduos coletados em 2003 mostraram maior seleção de organismos bentônicos em relação aos períodos anteriores. As estruturas morfológicas, como posição da boca, forma dos lábios, rastros branquiais e dentes faríngeos, além do comprimento do intestino mostram um certo grau de especialização ao tipo de dieta. No entanto, o alimento, desde que associado ao substrato, parece ser selecionado de acordo com sua abundância no ambiente.
An Asiatic Chironomid in Brazil: morphology, DNA barcode and bionomics
Directory of Open Access Journals (Sweden)
Gizelle Amora
2015-07-01
Full Text Available In most freshwater ecosystems, aquatic insects are dominant in terms of diversity; however, there is a disproportionately low number of records of alien species when compared to other freshwater organisms. The Chironomidae is one aquatic insect family that includes some examples of alien species around the world. During a study on aquatic insects in Amazonas state (Brazil, we collected specimens of Chironomidae that are similar, at the morphological level, to Chironomus kiiensis Tokunaga and Chironomus striatipennis Kieffer, both with distributions restricted to Asia. The objectives of this study were to provide morphological information on this Chironomus population, to investigate its identity using DNA barcoding and, to provide bionomic information about this species. Chironomus DNA barcode data were obtained from GenBank and Barcode of Life Data Systems (BOLD and, together with our data, were analyzed using the neighbor-joining method with 1000 bootstrap replicates and the genetic distances were estimated using the Kimura-2-parameter. At the morphological level, the Brazilian population cannot be distinguished either from C. striatipennis or C. kiiensis, configuring a species complex but, at the molecular level our studied population is placed in a clade together with C. striatipennis, from South Korea. Bionomic characteristics of the Brazilian Chironomus population differ from the ones of C. kiiensis from Japan, the only species in this species complex with bionomic information available. The Brazilian Chironomus population has a smaller size, the double of the number of eggs and inhabits oligotrophic water, in artificial container. In the molecular analysis, populations of C. striatipennis and C. kiiensis are placed in a clade, formed by two groups: Group A (which includes populations from both named species, from different Asiatic regions and our Brazilian population and Group B (with populations of C. kiiensis from Japan and South Korea
Directory of Open Access Journals (Sweden)
Alexandre Monkolski
2006-03-01
Full Text Available A colonização de invertebrados durante o período de 56 dias de decomposição de duas espécies de plantas aquáticas (Eichhornia azurea e Polygonum ferrugineum foi investigada para determinar o papel de macroinvertebrados no processo de fragmentação da folha. Durante a análise do material, foi constatado um total de 2096 invertebrados, associados a E.azurea e 6154 invertebrados associados a P. ferrugineum, identificados dentro de 18 táxons, com predominância de larvas de Diptera da família Chironomidae, seguido por espécimes de Oligochaeta, microcrustáceos como Cladocera e Copepoda. Em ambas as plantas, os macroinvertebrados mostraram um aumento significativo de densidade ao longo do processo de decomposição, o que provavelmente está associado à perda de compostos fenólicos. Os resultados sugerem que as espécies de macrófitas apresentam associações específicas com seus consumidores, ou seja, o processo de sucessão da colonização torna-se diferenciado de acordo com as características fenológicas da planta.The invertebrate colonization was investigated during 56-day decomposition of two macrophytes species (Eichhornia azurea and Polygonum ferrugineum. The aim was to determine the role of macroinvertebrates in the process of leaf fragmentation. During material analysis, 2096 invertebrates were associated with E.azurea and 6154 were associated with P. ferrugineum, identified in 18 taxons, with predominance of Diptera larvae (Chironomidae family specially, followed by Oligochaeta species and microcrustaceans such as Cladocera and Copepoda. In both macrophytes the macroinvertebrates showed a significant increase of density through the process of decomposition, which is probably associated with the loss of phenolic compounds. Results suggest that macrophytes specimens show specific associations with their consumers, i.e., the succession process of colonization becomes singular according to the phenolic characteristics of the
Directory of Open Access Journals (Sweden)
CUPŞA Diana
2005-09-01
Full Text Available In the Nimăieşti Valley river we found in a number of four sample sites a community of benthic macroinvertebrates represented by Oligochaeta, Ephemeroptera larva, Trichoptera larva, Chironomida larva and Hidracarina species. The communities structure vary depending on season and the sampling site acording to the water quality and trophic condition of the substrate. The greatest diversity was recorded during the summer months (may-august and comparing the sample sites, we found that the first three sampling sites are very similar from the point of view of the macroinvertebrate community, but the fourth sampling site the community is different because the river pases through the town of Beiuş and as a consequence the water quality is lower that at the other three sample sites.
New records of non-biting midges (Diptera: Chironomidae, Orthocladiinae from Mallorca, Spain
Directory of Open Access Journals (Sweden)
Viktor Baranov
2016-09-01
Full Text Available Ten species of non-biting midges belonging to the subfamily Orthocladiinae were found in samples from predominantly madicolous habitats in Mallorca, Spain. One species, Bryophaenocladius nidorum (Edwards, 1929, has not previously been recorded from Spain, while Smittia pratorum (Goetghebuer, 1927, Bryophaenocladius inconstans (Brundin, 1947, Orthocladius (O. maius Goetghebuer, 1942, Paracladius conversus (Walker, 1856 and Paraphaenocladius impensus (Walker, 1856 are recorded for the first time from the Balearic Islands.
Salmelin, Johanna; Vuori, Kari-Matti; Hämäläinen, Heikki
2015-08-01
The incidence of morphological deformities of chironomid larvae as an indicator of sediment toxicity has been studied for decades. However, standards for deformity analysis are lacking. The authors evaluated whether 25 experts diagnosed larval deformities in a similar manner. Based on high-quality digital images, the experts rated 211 menta of Chironomus spp. larvae as normal or deformed. The larvae were from a site with polluted sediments or from a reference site. The authors revealed this to a random half of the experts, and the rest conducted the assessment blind. The authors quantified the interrater agreement by kappa coefficient, tested whether open and blind assessments differed in deformity incidence and in differentiation between the sites, and identified those deformity types rated most consistently or inconsistently. The total deformity incidence varied greatly, from 10.9% to 66.4% among experts. Kappa coefficient across rater pairs averaged 0.52, indicating insufficient agreement. The deformity types rated most consistently were those missing teeth or with extra teeth. The open and blind assessments did not differ, but differentiation between sites was clearest for raters who counted primarily absolute deformities such as missing and extra teeth and excluded apparent mechanical aberrations or deviations in tooth size or symmetry. The highly differing criteria in deformity assignment have likely led to inconsistent results in midge larval deformity studies and indicate an urgent need for standardization of the analysis. © 2015 SETAC.
A generic guide to the larvae of the Nearctic Tanytarsini, (Chironomidae:diptera)
Steiner, J.W.; Doughman, J.S.; Moore, C.R.
1982-01-01
Larvae of the tribe Tanytarsini occur in nearly every aquatic habitat in North America where they act as primary consumers in the food chain. This new taxonomic guide overcomes some deficiencies in existing keys to this tribe and the reviewed and updated taxonomy enables identification of the larvae that may be useful as ecological indicators. Over 2,000 specimens from 26 states were examined, identified and measured in this study. The following genera were included: Stempellinell, Zavrelia, Stempellina, Constempellina, Corynocera, Cladotanytarsus,.. Paratanytarsus, Rheotanytarsus,. Micropsectra, Lauterbornia, Nimbocera, Tanytarsus and Neozavrelia. Photographs illustrate mature larvae of these genera with the exception of Zavrelia and Neozavrelia which are not known to exist in North America. The morphological data, Which are summarized in a table of distinctive characteristics and the dichotomous key, enable identification to genus. Notes on range, habitat and food preference are included, and species identifications are presented where applicable.
A New Species of Corynoneura Winnertz from Oriental China (Diptera: Chironomidae: Orthocladiinae).
Fang, Xiangliang; Wang, Xinhua; Fu, Yue
2014-11-19
A new species of Corynoneura Winnertz (1846) from Oriental China, C. ecphora sp. n. is described and illustrated as male. A distribution map of adult males in Oriental China is given. A key to known males of Oriental China is provided.
Donato, Mariano; Mauad, Melina; Fuentes, María Cecilia
2015-01-21
Parapsectrocladius setosus sp. n. is described and figured as pupa and male imago, based on material collected in Patagonia, Argentina. The male of the new species groups with P. escondido Cranston & Añón Suárez by having the anal point tapering triangular; inferior volsella simple, rounded, without any dorsal ridge and apically blunt. It can be distinguished from P. escondido by the possession of strong setae on the inner margin of inferior volsella. New material of Parapsectrocladius belonging from several localities allows us to emend the generic diagnosis of the adult male, female and larva of Parapsectrocladius, discuss its phylogenetic position and to expand the geographic distribution of P. acuminatus Cranston, P. escondido and P. reissi. Cranston.
Life-cycle effects of sediment-associated uranium on Chironomus riparius (diptera: chironomidae)
Energy Technology Data Exchange (ETDEWEB)
Dias, V.; Ksas, B.; Camilleri, V.; Bonzom, J.M. [CEA Cadarache (DEI/SECRE/LRE), Laboratory of Radioecology and Ecotoxicology, Institute for Radioprotection and Nuclear Safety, 13 - Saint-Paul-lez-Durance (France)
2004-07-01
In aquatic ecosystems, sediments function as reservoir for many of the more persistent chemicals that are introduced into surface waters. Sediments provide a habitat for various benthic macro-invertebrates, which are exposed to sediment-associated chemicals both directly and via food intake. These chemicals may be directly toxic to benthic macro-invertebrates and can be integrated into food chain. Benthic macro-invertebrates play an important role in the ecosystem structure and functioning. In particular, they represent an important component of aquatic food chains. Among the non biologically essential metals, data concerning uranium fate and effects on freshwater benthic invertebrates are sparse. The present study aimed to estimate effects of a chronic uranium exposure on life-cycle traits of Chironomus riparius. To achieve this goal, (i) first instar larvae were exposed to a series of concentrations of uranium via the sediment, and (ii) a number of developmental (e.g. growth) and reproductive (e.g. emergence, fecundity, viability) endpoints, through parental and into F1 generations, were evaluated. Within the framework of ecological risk assessment, these data will help the derivation of a sediment guideline value for uranium that does not currently exist in France or elsewhere due to a lack of toxicity data. (author)
Genotoxic effects of vinclozolin on the aquatic insect Chironomus riparius (Diptera, Chironomidae).
Aquilino, Mónica; Sánchez-Argüello, Paloma; Martínez-Guitarte, José-Luis
2018-01-01
Vinclozolin (Vz) is a pollutant found in aquatic environments whose antiandrogenic effects in reproduction are well known in mammals. Although its reproductive effects have been less studied in invertebrates, other effects, including genotoxicity, have been described. Therefore, in this work, we studied the genotoxic effects of Vz in the freshwater benthic invertebrate Chironomus riparius. DNA damage was evaluated with the comet assay (tail area, olive moment, tail moment and % DNA in tail), and the transcriptional levels of different genes involved in DNA repair (ATM, NLK and XRCC1) and apoptosis (DECAY) were measured by RT-PCR. Fourth instar larvae of C. riparius, were exposed to Vz for 24 h at 20 and 200 μg/L. The Vz exposures affected the DNA integrity in this organism, since a dose-response relationship occurred, with DNA strand breaks significantly increased with increased dose for tail area, olive moment and tail moment parameters. Additionally, the lower concentration of Vz produced a significant induction of the transcripts of three genes under study (ATM, NLK and XRCC1) showing the activation of the cellular repair mechanism. In contrast, the expression of these genes with the highest concentration were downregulated, indicating failure of the cellular repair mechanism, which would explain the higher DNA damage. These data report for the first time the alterations of Vz on gene transcription of an insect and confirm the potential genotoxicity of this compound on freshwater invertebrates. Copyright © 2017 Elsevier Ltd. All rights reserved.
Photoreactivation of RNA in UV-irradiated insect eggs (Smittia SP., Chironomidae, Diptera)
International Nuclear Information System (INIS)
Kalthoff, K.; Urban, K.; Jaeckle, H.
1978-01-01
Two biological effects of UV radiation upon Smittia eggs are observed, both of which seem to be associated with the formation of pyrimidine dimers in the RNA (largely ribosomal) of the eggs. While irradiation of the anterior pole region causes the formation of an aberrant segment pattern (double abdomen induction), irradiation of entire eggs leads to an arrest of their development (inactivation). Both UV effects are photoreversible with different action spectra of the photoreactivating light. A dose rate dependence of the photoreactivation can be observed after both UV effects. The saturating dose rate is about 6 W/m 2 (at 440 nm) after UV induction of double abdomens. Upon UV inactivation, the saturating dose rate level for the photoreactivating light is much higher, and a single light flash causes both a considerable biological reactivation and the disappearance of about 7 x 10 9 pyrimidine dimers from the total RNA per egg. The results indicate the presence of heterogeneous light-dependent repair activities acting upon UV induced pyrimidine dimers in the RNA of the eggs. (author)
Photoreactivation of RNA in UV-irradiated insect eggs (Smittia SP., Chironomidae, Diptera)
International Nuclear Information System (INIS)
Jaeckle, H.; Kalthoff, K.
1978-01-01
Irradiation of Smittia eggs with UV during intravitelline cleavage causes the formation of pyrimidine dimers in the (largely ribosomal) RNA of the eggs. The yield of dimers is wavelength-dependent in a way that strongly suggests the involvement of photosensitizing egg components. Illumination of UV-irradiated eggs with light (380 or 400 nm) causes both photoreactivation of the eggs and monomerization of the pyrimidine dimers in their RNA. The photoreactivable sector of the biological damage is correlated with the amount of pyrimidine dimers present in the RNA after inactivation of the eggs with UV of different wavelengths. The data are regarded as the first direct evidence that the photoreactivation of a eukaryotic organism is correlated with the light-dependent (and apparently enzymatic) monomerization of pyrimidine dimers in RNA. (author)
Life-cycle effects of sediment-associated uranium on Chironomus riparius (diptera: chironomidae)
International Nuclear Information System (INIS)
Dias, V.; Ksas, B.; Camilleri, V.; Bonzom, J.M.
2004-01-01
In aquatic ecosystems, sediments function as reservoir for many of the more persistent chemicals that are introduced into surface waters. Sediments provide a habitat for various benthic macro-invertebrates, which are exposed to sediment-associated chemicals both directly and via food intake. These chemicals may be directly toxic to benthic macro-invertebrates and can be integrated into food chain. Benthic macro-invertebrates play an important role in the ecosystem structure and functioning. In particular, they represent an important component of aquatic food chains. Among the non biologically essential metals, data concerning uranium fate and effects on freshwater benthic invertebrates are sparse. The present study aimed to estimate effects of a chronic uranium exposure on life-cycle traits of Chironomus riparius. To achieve this goal, (i) first instar larvae were exposed to a series of concentrations of uranium via the sediment, and (ii) a number of developmental (e.g. growth) and reproductive (e.g. emergence, fecundity, viability) endpoints, through parental and into F1 generations, were evaluated. Within the framework of ecological risk assessment, these data will help the derivation of a sediment guideline value for uranium that does not currently exist in France or elsewhere due to a lack of toxicity data. (author)
Survival strategies of chironomids (Diptera: Chironomidae) living in temporary habitats: a review
Czech Academy of Sciences Publication Activity Database
Frouz, Jan; Matěna, Josef; Ali, A.
2003-01-01
Roč. 100, - (2003), s. 459-465 ISSN 1210-5759 R&D Projects: GA ČR GA526/98/P156; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6066911; CEZ:AV0Z6017912; CEZ:MSM 124100001 Keywords : insect ecology * midges * colonization Subject RIV: EH - Ecology, Behaviour Impact factor: 0.741, year: 2003
Adaptive Evolution of Phosphorus Metabolism in Prochlorococcus
DEFF Research Database (Denmark)
Casey, John R; Mardinoglu, Adil; Nielsen, Jens
2016-01-01
Inorganic phosphorus is scarce in the eastern Mediterranean Sea, where the high-light-adapted ecotype HLI of the marine picocyanobacterium Prochlorococcus marinus thrives. Physiological and regulatory control of phosphorus acquisition and partitioning has been observed in HLI both in culture...... and in the field; however, the optimization of phosphorus metabolism and associated gains for its phosphorus-limited-growth (PLG) phenotype have not been studied. Here, we reconstructed a genome-scale metabolic network of the HLI axenic strain MED4 (iJC568), consisting of 568 metabolic genes in relation to 794...... through drastic depletion of phosphorus-containing biomass components but also through network-wide reductions in phosphate-reaction participation and the loss of a key enzyme, succinate dehydrogenase. These alterations occur despite the stringency of having relatively few pathway redundancies...
Directory of Open Access Journals (Sweden)
Elena Daniela MITITELU
2012-01-01
Full Text Available The wide distribution of benthic invertebrates and their different sensitivity shown upon modifying the qualitative parameters of aquatic ecosystems led to a frequent use of these group as bioindicators in different studies. The present study aims at presenting a list concerning the different macroinvertebrates identified in the larva stage in three watersheds (Jiu, Olt, Ialomiţa and establishing the water quality of the monitored sections using this benthic macroinvertebrates. The sample collecting points were represented by 23 stations. The abundance and frequency values recorded for benthic communities varied according to the physical-chemical conditions specific to each sample collecting station. There were identified 15 groups in total. The most frequent were Ephemeroptera, Plecoptera, Trichoptera, Diptera (Chironomidae and others. The deterioration of water quality is marked by the decrease in the biotic index EPT/Ch value.
The macroinvertebrates of Magela Creek, Northern Territory
International Nuclear Information System (INIS)
Marchant, R.
1982-04-01
The littoral zones of five permanent billabongs in Magela Creek were sampled monthly for macroinvertebrates. Greatest numbers of taxa and individuals were caught in the late wet season and early dry season in the shallow billabongs; in the deep billabongs, seasonal variations were not so marked. These changes appeared to be associated with the development of macrophytes, which offered food and shelter to the invertebrate fauna. The dominant groups were the Chironomidae, Oligochaetae and Ephemeroptera. The seasonal patterns of the catches were sufficiently consistent for future samples to be able to be compared with these initial ones with some confidence that any changes are real. This work is part of a larger study into the biota and water quality of Magela Creek designed to provide data on aquatic communities before mining of the Ranger uranium deposit starts
Farrell, Julianne F; Whittington, Andrew E; Zalucki, Myron P
2015-12-01
A review of insects collected from decomposing human remains in south-east Queensland yielded 32 species in three orders (Diptera, Coleoptera, Hymenoptera) and 11 families (Calliphoridae, Sarcophagidae, Muscidae, Phoridae, Sepsidae, Chironomidae, Dermestidae, Cleridae, Histeridae, Staphylinidae, Encyrtidae). There were 15 cases where remains were located indoors and five cases where remains were outdoors, in both terrestrial and aquatic environments. Coleoptera were strongly associated with outdoors remains, while dipteran species composition was similar in both indoor and outdoor habitats. Some Diptera were only associated with indoors remains, while others were similarly restricted to remains recovered outdoors. Hymenopteran parasitoids were active in both habitats. Comparative collections were made from other vertebrate remains, including road-kill and farmed animals throughout south-east Queensland (Qld) and northern New South Wales (NSW) during the same period. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Environmental fate and effects of the lampricide TFM: A review
Hubert, T.D.
2003-01-01
Use of 3-trifluoromethyl-4-nitrophenol (TFM) is limited geographically to the Great Lakes basin where it is the principal agent used in control of the sea lamprey (Petromyzon marinus). It is clear from available data that TFM has effects on the environment, but the effects reported are transient. Individual organisms and aquatic communities return to pretreatment conditions after lampricide treatments have concluded. TFM is not persistent, is detoxified, and presents minimal long-term toxicological risk. TFM is relatively nontoxic to mammals. Treatment levels do not pose a threat to wildlife. However, TFM is an estrogen agonist and additional testing to define the nature and magnitude of this effect will likely be required. Because stream treatments are done on 3 to 5 year cycles, and exposures are limited to approximately 12 h, minimal risk to aquatic organisms is expected.
Does copepod size determine food consumption of particulate feeding fish?
DEFF Research Database (Denmark)
Deurs, Mikael van; Koski, Marja; Rindorf, Anna
2014-01-01
on adult particulate feeding fish is unknown. In the present study, we investigated the hypothesis that the availability of the large copepods determines food consumption and growth conditions of lesser sandeel (Ammodytes marinus) in the North Sea. Analysis of stomach content suggested that food...... consumption is higher for fish feeding on large copepods, and additional calculations revealed how handling time limitation may provide part of the explanation for this relationship. Comparing stomach data and zooplankton samples indicated that lesser sandeel actively target large copepods when......The climate-induced reduction in the mean copepod size, mainly driven by a decrease in the abundance of the large Calanus finmarchicus around 1987, has been linked to the low survival of fish larvae in the North Sea. However, to what extent this sort of reduction in copepod size has any influence...
Directory of Open Access Journals (Sweden)
Danielle Peretti
1999-01-01
Full Text Available Studies were performed on various aspects related to the feeding of Eigenmannia trilineata in the upper Paraná River floodplain, from June 1993 to July 1994, at four places with different types of bottom and waters speed. A number of 279 fish had its stomachal contents analyzed by occurence and point methods in which it was applied on its frequencies the feeding index. Two hundred an sixty two specimens were utilized to the analysis of the feeding activity that it was based on frequency and middle degree of stomach repletion. For the morfological analyse utilized 12 individuals. It was verified fourteen items on species diet which it was found chiefly Chironomidae (Diptera and detritus. Seasonal, area variations were verified in feeding activity and the participation of constituent items in diet. The results showed that the species presents nightly and benthophagous habits, with morfological characters of the carnivorous species.Os estudos foram realizados sob vários aspectos relacionados à alimentação de Eigenmannia trilineata na planície de inundação do alto rio Paraná, de junho de 1993 a julho de 1994 em quatro locais com diferentes tipos de fundo e velocidade de águas. Um número de 279 peixes tiveram seus estômagos analisados pelos métodos de ocorrência e pontos sendo aplicado sobre suas frequências o índice alimentar. Duzentos e sessenta e dois indivíduos foram utilizados para a análise da atividade alimentar, a qual foi baseada sobre a freqüência e grau de repleção médio dos estômagos. Para a análise morfológica foram utilizados 12 indivíduos. Foi verificado 14 itens na dieta da espécie, encontrando-se principalmente Chironomidae (Diptera e detritos. Variações sazonais e de área foram verificados na atividade alimentar e na participação dos itens constituintes da dieta. Os resultados mostraram que a espécie apresenta hábitos noturno e bentófago, com características morfológicas de espécies carnívoras.
OIL DECONTAMINATION OF BOTTOM SEDIMENTS EXPERIMENTAL WORK RESULTS
Directory of Open Access Journals (Sweden)
Lushnikov Sergey V.
2006-08-01
Full Text Available This article presents the results of experimental work during 2004-2005 on oil decontamination of bottom sediments of Lake Schuchye, situated in the Komi Republic (Northern Russia. The cause of thecontamination were huge oil spills occurred after a series of accidental ruptures on the Harjaga-Usinsk and Vozej-Usinsk oil-pipe lines in 1994. Flotation technology was used for the cleaning of bottom sediments.157 tons of crude oil were removed during the course of 2-year experimental work from an area of 4,1 ha.The content of aliphatic and alicyclic oil hydrocarbons was reduced from 53,3 g/kg to 2,2 g/kg, on average.Hydrobiological investigations revealed that bottom sediments started to be inhabited by benthos organisms, dominantly Oligochaeta. Besides Oligochaeta, Chironomidae maggots and Bivalvia were detected. Theappearance of Macrozoobenthos organisms can serve as a bioindicator of water quality.
Hahn, S.M.; Reinhardt, K.
2006-01-01
We provide the first comprehensive account of habitat preference, mating, oviposition and developmental stages of Parochlus steinenii. There are eight records from the South Shetland Islands. On King George Island, none out of 40 temporary ponds and 9% out of 44 lakes with variable water levels were
Two new species of genus Hydrosmittia Ferrington & Sæther (Diptera: Chironomidae) from China.
Zhang, Ruilei; Liu, Wenbin; Ferrington, Leonard C Jr; Wang, Xinhua
2016-06-08
The genus Hydrosmittia from China is reviewed. Two new species H. continalinea sp. n. and H. sipinata sp. n. are described and illustrated based on male imagines. Key to known male imagines of genus Hydrosmittia worldwide is provided.
International Nuclear Information System (INIS)
Freitas, F. de; Leoncini, O.
1985-01-01
The chromosome complement of a Brazilian Chironomus Species, C. Sancticaroli, was analyzed cytochemically. The polytene Chromosomes were identified and characterized and the nucleolus organizer regions (NORs) were located by a technique of in situ hybridization and immunofluorescence. Constitutive heterochromatin and its distribution in relation to the NORs were studied. (Author) [pt
Pinho, Luiz Carlos; Andersen, Trond
2015-04-20
A new species of Limnophyes Eaton collected in the Corvo Branco Mountains in Santa Catarina State is described and figured, based on male and female adults, larva and pupa. The species groups with L. griseata (Edwards) and L. bidumus Sæther as the adults have a pronounced humeral pit with lanceolate setae and an additional group of lanceolate setae just posterior to antepronotum. The adults are, however, distinctly smaller, have a lower AR and have more lanceolate setae in the group just posterior to antepronotum than the two other species. The pupa can easily be separated from the pupa of L. bidumus as the anal macroseta is longer than the anal lobe. The larva lives hygropetric on vertical rock surfaces. A key to male adults of Neotropical Limnophyes is given.
New species and records of Goeldichironomus Fittkau, 1965 from Brazil (Diptera: Chironomidae).
Amora, Gizelle; Hamada, Neusa; Pinho, Luiz Carlos
2015-12-22
One new species named Goeldichironomus adhaerens sp. n. is described from urban area in Manaus, Brazilian Amazon, based on male adult, pupa and larva. New records of G. neopictus Trivinho-Strixino & Strixino, G. maculatus Trivinho-Strixino & Strixino, G. pictus Reiss and G. fluctuans Reiss are also provided.
Eonandeva gen. nov., a new distinctive genus from Eocene Baltic amber (Diptera: Chironomidae).
Zakrzewska, Marta; Giłka, Wojciech
2015-11-20
A new fossil genus, Eonandeva gen. nov., with two new species: E. helva sp. nov. (type for the genus) and E. latistyla sp. nov., is described from Eocene Baltic amber (~45-40 Ma). Adult males of both new species show the wing venation pattern, shape and chaetotaxy typical for the tribe Tanytarsini. The characters defined as prior apomorphies for the new genus--the gonostylus with a subapical flattened lobe and the stout, strongly elongated superior volsella--separate Eonandeva from the closely related extant genus Nandeva Wiedenbrug, Reiss et Fittkau, 1998.
A new species of Metapelopia Silva, Oliveira & Trivinho-Strixino (Diptera: Chironomidae) from Peru.
Dantas, Galileu P S; Hamada, Neusa; Araujo, Ana A Huamantinco
2016-07-08
A new species of the monotypic genus Metapelopia is described and illustrated based on all life stages. Adults of the Metapelopia peruensis sp. n. can be easily distinguished from those of M. corbii by the color pattern of the legs and abdomen. Larvae and pupae were collected associated with algae accumulated on rocks.
Stenochironomus munteanpurin sp. n., a new leaf-mining species from Brazil (Diptera: Chironomidae).
Amora, Gizelle; Hamada, Neusa; Pinho, Luiz C
2018-02-21
Stenochironomus munteanpurin sp. n. is described and illustrated in all life stages, except eggs, from Brazil. The male is very similar to Stenochironomus quadrinotatus Borkent, 1984 due to same overall pattern of pigmentation. The new species can be distinguished from the other related species principally in immature stages: larva with labral lamella arranged in two groups with one or two conical-shaped teeth, spicules of pecten epipharyngis arranged in a row, unequal and irregularly distributed sizes, SI bifurcated, SII pinnate, SIII pinnate setae and, larval exuviae is compacted; pupa with shagreens being in all TI, less number of hooklets in TII, TVII without shagreens and presence of shagreen in conjunctive III/IV and IV/V. Adult male is very similar to the one of S. quadrinotatus but can be distinguished by combination of the TIX with more than 25 setae medially and phallapodeme curved anteriorly. The new species were collected in the following Brazilian states: Rio de Janeiro, Santa Catarina, Bahia and Acre.
Czech Academy of Sciences Publication Activity Database
Frouz, Jan; Lobinske, R.J.; Ali, A.
2009-01-01
Roč. 43, č. 2 (2009), s. 487-500 ISSN 1386-2588 Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z6066911 Keywords : food availability * Glyptotendipes paripes * larval density Subject RIV: EH - Ecology, Behaviour Impact factor: 1.549, year: 2009
Chromosomal organization of the ribosomal RNA genes in the genus Chironomus (Diptera, Chironomidae
Directory of Open Access Journals (Sweden)
Larisa Gunderina
2015-05-01
Full Text Available Chromosomal localization of ribosomal RNA coding genes has been studied by using FISH (fluorescence in situ hybridization in 21 species from the genus Chironomus Meigen, 1803. Analysis of the data has shown intra- and interspecific variation in number and location of 5.8S rDNA hybridization sites in 17 species from the subgenus Chironomus and 4 species from the subgenus Camptochironomus Kieffer, 1914. In the majority of studied species the location of rDNA sites coincided with the sites where active NORs (nucleolus organizer regions were found. The number of hybridization sites in karyotypes of studied chironomids varied from 1 to 6. More than half of the species possessed only one NOR (12 out of 21. Two rDNA hybridization sites were found in karyotypes of five species, three – in two species, and five and six sites – in one species each. NORs were found in all chromosomal arms of species from the subgenus Chironomus with one of them always located on arm G. On the other hand, no hybridization sites were found on arm G in four studied species from the subgenus Camptochironomus. Two species from the subgenus Chironomus – Ch. balatonicus Devai, Wuelker & Scholl, 1983 and Ch. “annularius” sensu Strenzke, 1959 – showed intraspecific variability in the number of hybridization signals. Possible mechanisms of origin of variability in number and location of rRNA genes in the karyotypes of species from the genus Chironomus are discussed.
Energy Technology Data Exchange (ETDEWEB)
Freitas, F. de; Leoncini, O.; Floeter-Winter, L.M.
1985-03-01
The chromosome complement of a Brazilian Chironomus Species, C. Sancticaroli, was analyzed cytochemically. The polytene Chromosomes were identified and characterized and the nucleolus organizer regions (NORs) were located by a technique of in situ hybridization and immunofluorescence. Constitutive heterochromatin and its distribution in relation to the NORs were studied.
Fusari, Lívia Maria; Pinho, Luiz Carlos; Lamas, Carlos José Einicker
2017-01-19
A new species of Zavreliella Kieffer, Zavreliella kambeba sp. n., is described, based on male adults collected in the Amazon rainforest, Brazil. Further seven Zavreliella species are recorded for new localities in Brazil, with the first Neotropical record of Z. marmorata (van der Wulp). The genus Zavreliella is now composed of 15 species, of which adult males are reviewed in a key to their identification.
Prochlorococcus as a Possible Source for Transparent Exopolymer Particles (TEP
Directory of Open Access Journals (Sweden)
Susana Agustí
2017-04-01
Full Text Available Transparent exopolymer particles (TEP, usually associated with phytoplankton blooms, promote the formation of marine aggregates. Their exportation to deep waters is considered a key component of the biological carbon pump. Here, we explored the role of solar radiation and picocyanobacteria in the formation of TEP in oligotrophic surface waters of the Atlantic and Pacific Oceans in ten on-deck incubation experiments during the Malaspina 2010 Expedition. TEP concentrations were low on the ocean’s surface although these concentrations were significantly higher on the surface of the Pacific (24.45 ± 2.3 μg XG Eq. L-1 than on the surface of the Atlantic Ocean (8.18 ± 4.56 μg XG Eq. L-1. Solar radiation induced a significant production of TEP in the on-deck experiments from the surface water of the Pacific Ocean, reaching values up to 187.3 μg XG Eq. L-1 compared with the low production observed in the dark controls. By contrast, TEP production in the Atlantic Ocean experiments was lower, and its formation was not related to the light treatments. Prochlorococcus sp. from the surface ocean was very sensitive to solar radiation and experienced a high cell decay in the Pacific Ocean experiments. TEP production in the on-deck incubation experiments was closely related to the observed cell decay rates of Prochlorococcus sp., suggesting that this picocyanobacteria genus is a potential source of TEP. The evidence to propose such potential role was derived experimentally, using natural communities including the presence of several species and a variety of processes. Laboratory experiments with cultures of a non-axenic strain of Prochlorococcus marinus were then used to test TEP production by this genus. TEP concentrations in the culture increased with increasing cell abundance during the exponential phase, reaching the highest TEP concentration at the beginning of the stationary phase. The average TEP concentration of 1474 ± 226 μg XG Eq. L-1 (mean
Prochlorococcus as a Possible Source for Transparent Exopolymer Particles (TEP)
Agusti, Susana; Iuculano, Francesca; Mazuecos, Ignacio P.; Reche, Isabel
2017-01-01
Transparent exopolymer particles (TEP), usually associated with phytoplankton blooms, promote the formation of marine aggregates. Their exportation to deep waters is considered a key component of the biological carbon pump. Here, we explored the role of solar radiation and picocyanobacteria in the formation of TEP in oligotrophic surface waters of the Atlantic and Pacific Oceans in ten on-deck incubation experiments during the Malaspina 2010 Expedition. TEP concentrations were low on the ocean’s surface although these concentrations were significantly higher on the surface of the Pacific (24.45 ± 2.3 μg XG Eq. L-1) than on the surface of the Atlantic Ocean (8.18 ± 4.56 μg XG Eq. L-1). Solar radiation induced a significant production of TEP in the on-deck experiments from the surface water of the Pacific Ocean, reaching values up to 187.3 μg XG Eq. L-1 compared with the low production observed in the dark controls. By contrast, TEP production in the Atlantic Ocean experiments was lower, and its formation was not related to the light treatments. Prochlorococcus sp. from the surface ocean was very sensitive to solar radiation and experienced a high cell decay in the Pacific Ocean experiments. TEP production in the on-deck incubation experiments was closely related to the observed cell decay rates of Prochlorococcus sp., suggesting that this picocyanobacteria genus is a potential source of TEP. The evidence to propose such potential role was derived experimentally, using natural communities including the presence of several species and a variety of processes. Laboratory experiments with cultures of a non-axenic strain of Prochlorococcus marinus were then used to test TEP production by this genus. TEP concentrations in the culture increased with increasing cell abundance during the exponential phase, reaching the highest TEP concentration at the beginning of the stationary phase. The average TEP concentration of 1474 ± 226 μg XG Eq. L-1 (mean ± SE) observed at
Signature proteins for the major clades of Cyanobacteria
Directory of Open Access Journals (Sweden)
Mathews Divya W
2010-01-01
Full Text Available Abstract Background The phylogeny and taxonomy of cyanobacteria is currently poorly understood due to paucity of reliable markers for identification and circumscription of its major clades. Results A combination of phylogenomic and protein signature based approaches was used to characterize the major clades of cyanobacteria. Phylogenetic trees were constructed for 44 cyanobacteria based on 44 conserved proteins. In parallel, Blastp searches were carried out on each ORF in the genomes of Synechococcus WH8102, Synechocystis PCC6803, Nostoc PCC7120, Synechococcus JA-3-3Ab, Prochlorococcus MIT9215 and Prochlor. marinus subsp. marinus CCMP1375 to identify proteins that are specific for various main clades of cyanobacteria. These studies have identified 39 proteins that are specific for all (or most cyanobacteria and large numbers of proteins for other cyanobacterial clades. The identified signature proteins include: (i 14 proteins for a deep branching clade (Clade A of Gloebacter violaceus and two diazotrophic Synechococcus strains (JA-3-3Ab and JA2-3-B'a; (ii 5 proteins that are present in all other cyanobacteria except those from Clade A; (iii 60 proteins that are specific for a clade (Clade C consisting of various marine unicellular cyanobacteria (viz. Synechococcus and Prochlorococcus; (iv 14 and 19 signature proteins that are specific for the Clade C Synechococcus and Prochlorococcus strains, respectively; (v 67 proteins that are specific for the Low B/A ecotype Prochlorococcus strains, containing lower ratio of chl b/a2 and adapted to growth at high light intensities; (vi 65 and 8 proteins that are specific for the Nostocales and Chroococcales orders, respectively; and (vii 22 and 9 proteins that are uniquely shared by various Nostocales and Oscillatoriales orders, or by these two orders and the Chroococcales, respectively. We also describe 3 conserved indels in flavoprotein, heme oxygenase and protochlorophyllide oxidoreductase proteins that
Prochlorococcus as a Possible Source for Transparent Exopolymer Particles (TEP)
Agusti, Susana
2017-04-26
Transparent exopolymer particles (TEP), usually associated with phytoplankton blooms, promote the formation of marine aggregates. Their exportation to deep waters is considered a key component of the biological carbon pump. Here, we explored the role of solar radiation and picocyanobacteria in the formation of TEP in oligotrophic surface waters of the Atlantic and Pacific Oceans in ten on-deck incubation experiments during the Malaspina 2010 Expedition. TEP concentrations were low on the ocean’s surface although these concentrations were significantly higher on the surface of the Pacific (24.45 ± 2.3 μg XG Eq. L-1) than on the surface of the Atlantic Ocean (8.18 ± 4.56 μg XG Eq. L-1). Solar radiation induced a significant production of TEP in the on-deck experiments from the surface water of the Pacific Ocean, reaching values up to 187.3 μg XG Eq. L-1 compared with the low production observed in the dark controls. By contrast, TEP production in the Atlantic Ocean experiments was lower, and its formation was not related to the light treatments. Prochlorococcus sp. from the surface ocean was very sensitive to solar radiation and experienced a high cell decay in the Pacific Ocean experiments. TEP production in the on-deck incubation experiments was closely related to the observed cell decay rates of Prochlorococcus sp., suggesting that this picocyanobacteria genus is a potential source of TEP. The evidence to propose such potential role was derived experimentally, using natural communities including the presence of several species and a variety of processes. Laboratory experiments with cultures of a non-axenic strain of Prochlorococcus marinus were then used to test TEP production by this genus. TEP concentrations in the culture increased with increasing cell abundance during the exponential phase, reaching the highest TEP concentration at the beginning of the stationary phase. The average TEP concentration of 1474 ± 226 μg XG Eq. L-1 (mean ± SE) observed at
Connectivity in the early life history of sandeel inferred from otolith microchemistry
Gibb, Fiona M.; Régnier, Thomas; Donald, Kirsty; Wright, Peter J.
2017-01-01
Connectivity is a central issue in the development, sustainability and effectiveness of networks of Marine Protected Areas (MPAs). In populations with site attached adults, connectivity is limited to dispersal in the pelagic larval stage. While biophysical models have been widely used to infer early dispersal, empirical evidence through sources such as otolith microchemistry can provide a means of evaluating model predictions. In the present study, connectivity in the lesser sandeel, Ammodytes marinus, was investigated using LA-ICP-MS otolith microchemistry. Otoliths from juveniles (age 0) were examined from four Scottish spawning areas predicted to differ in terms of larval retention rates and connectivity based on past biophysical models. There were significant spatial differences in otolith post-settled juvenile chemistry among locations at a scale of 100-400 km. Differences in near core chemistry pointed to three chemically distinct natal sources, as identified by a cluster analysis, contributing to settlement locations.
Spatial differences in growth of lesser sandeel in the North Sea
DEFF Research Database (Denmark)
Rindorf, Anna; Wright, Peter J.; Jensen, Henrik
2016-01-01
Lesser sandeel, Ammodytes marinus, is a key prey to a variety of North Sea predators, including species such as single load seabirds which are highly sensitive to prey size and condition. Whilst differences in weight at age across the North Sea have been investigated previously, the scale and cause...... of this variation as well as the potential link to spatial differences in predator performance remains unknown. This study presents an analysis of spatial patterns in length and condition of the lesser sandeel in the North Sea and the relationship of these with physical and biological factors. Both mean length...... considerably both spatially and temporally, resulting in 4 fold and 1.9 fold variations in the number of sandeels required to obtain a specific weight, respectively. Hence, the value of sandeel as prey to single load predators varies considerably with values in central and northeastern North Sea being...
Directory of Open Access Journals (Sweden)
Gísli A Víkingsson
2003-07-01
Overall capelin (Mallotus villosus comprised the predominant prey, followed by sandeel (Ammodytidae sp., then gadids, cephalopods and redfish (Sebastes marinus, while other taxa were of less importance. Differences were detected in diet composition among 5 areas around Iceland with redfish and gadids more prominent in the northern areas. Off SW Iceland there was considerable seasonal variation in the porpoise diet, where capelin appeared to be dominant in late winter and spring and sandeel in the summer through early winter. Predominance of capelin in the diet coincided with the spawning migration of capelin from northern waters along the east, south and west coasts of Iceland. Mature females appeared to have a more diverse diet than other reproductive classes. The length distributions of fish consumed by the porpoises ranged from 1 to 51 cm although most fish prey were less than 30 cm.
Saiki, M.K.; Castleberry, D. T.; May, T. W.; Martin, B.A.; Bullard, F. N.
1995-01-01
Metals enter the Upper Sacramento River above Redding, California, primarily through Spring Creek, a tributary that receives acid-mine drainage from a US EPA Superfund site known locally as Iron Mountain Mine. Waterweed (Elodea canadensis) and aquatic insects (midge larvae, Chironomidae; and mayfly nymphs, Ephemeroptera) from the Sacramento River downstream from Spring Creek contained much higher concentrations of copper (Cu), cadmium (Cd), and zinc (Zn) than did similar taxa from nearby reference tributaries not exposed to acid-mine drainage. Aquatic insects from the Sacramento River contained especially high maximum concentrations of Cu (200 mg/kg dry weight in midge larvae), Cd (23 mg/kg dry weight in mayfly nymphs), and Zn (1,700 mg/kg dry weight in mayfly nymphs). Although not always statistically significant, whole-body concentrations of Cu, Cd, and Zn in fishes (threespine stickleback, Gasterosteus aculeatus; Sacramento sucker, Catostomus occidentalis; Sacramento squawfish, Ptychocheilus grandis; and chinook salmon, Oncorhynchus tshawytasch) from the Sacramento River were generally higher than in fishes from the reference tributaries.
Mortality of nontarget arthropods from an aerial application of pyrethrins.
Kwan, Jonathan A; Novak, Mark G; Hyles, Timothy S; Niemela, Michael K
2009-06-01
Mortality of nontarget organisms from an ultra-low volume (ULV) aerial application of pyrethrins (Evergreen EC 60-6) was monitored by collecting arthropods from ground tarps placed at the interface of open and canopy areas. A larger number and greater diversity of arthropods were recovered from tarps in the ULV spray area. The observed mortality was approximately 10-fold greater than in the control area. Kruskal-Wallis tests revealed a significant difference in the abundance and diversity of arthropods collected at treatment and control sites at 1 and 12 h postspray. Arthropods, primarily insects, from the treatment area included representatives from 12 orders and > or = 34 families, as compared to 7 orders and 12 families in the control area. Chironomidae (midges) and Formicidae (ants) were the most commonly represented families, accounting for 61% of the arthropods collected from the treatment area; no large-bodied insects (>8 mm) were recovered. Mortality of sentinel mosquitoes in the treatment and control areas averaged 96% and arthropods.
Directory of Open Access Journals (Sweden)
Urszula Janas
2008-06-01
Full Text Available Palaemon elegans, a new component of the Gulf of Gdańsk macrozoobenthos,colonised the southern Baltic coastal zone in the late 20th and early 21stcentury. Analysis of the stomach contents of P. elegans revealed 16plant and animal taxa that these prawns had fed on. The principal dietarycomponent was detritus, with a mean frequency of occurrence in stomachs of > 80%.The most frequently occurring plant components in the diet were algaefrom the genus Cladophora and the family Ectocarpaceae, while the mostsignificant animal components were Harpacticoida, Chironomidae, Ostracoda andGammarus spp. The results of the study show that the dietary composition ofP. elegans differed significantly between stations and months. The foraging area consisted of two distinctive regions - the Inner Puck Bay, and the Outer Puck Bay together with the Dead Vistula River; two of the stations - Gdynia and Sopot - were distinctfrom all the others. However, no obvious seasonality in the food compositioncould be demonstrated.
May, Thomas W.; Walther, Michael J.; Saiki, Michael K.; Brumbaugh, William G.
2007-01-01
This report presents the results for two sampling periods during a 4-year monitoring survey to provide a characterization of selenium concentrations in selected irrigation drains flowing into the Salton Sea, California. Total selenium, selenium species, and total suspended solids were determined in water samples, and total selenium was determined in sediment, detritus, and biota that included algae, plankton, midge larvae (family, Chironomidae), and two fish species-western mosquitofish (Gambusia affinis), and sailfin molly (Poecilia latipinna). In addition, sediments were analyzed for percent total organic carbon and particle size. Total selenium concentrations in water for both sampling periods ranged from 1.43 to 47.1 micrograms per liter, predominately as selenate, which is typical of waters leached out of selenium-contaminated marine shales under alkaline and oxidizing conditions. Total selenium concentrations ranged from 0.88 to 20.2 micrograms per gram in biota, and from 0.15 to 28.9 micrograms per gram in detritus and sediment.
Midges (Diptera:Chironomidae) as indicators of wetland viability in the Alberta Oil Sands region
Energy Technology Data Exchange (ETDEWEB)
Ciborowski, J. J. H.; Whelly, M. P.; Leonhardt, C.; Laing, D. [Windsor Univ., Dept. of Biological Sciences, ON (Canada)
1999-07-01
Thirty-three wetlands northeast of Fort McMurray, Alberta, ten of which are receiving oil sands mine process-affected water (OSPW), have been examined to assess their biological integrity. Physico-chemical and environmental attributes were measured, sediment, zoobenthic, plankton and chlorophyll samples were analyzed. Results of principal component analysis indicated that the wetlands could be categorized into three classes on the basis of three independent combinations of environmental features, namely pH/size/dissolved oxygen; conductivity; and sediment composition. Cluster analysis identified four groups of wetlands. High conductivity wetlands were found to support greater density but reduced richness of benthic population, irrespective of the presence of OSPW. To evaluate OSPW wetland ability to support and maintain benthic populations chironomid larval morphology, density, adult emergence, flight activity, egg-laying behaviour and the ability of eggs to hatch in OSPW were monitored. Results indicated no inhibition of adult chironomid flight activity, egg-laying or hatching by OSPW, although there was some evidence of OSPW reducing chironomid density, diversity and secondary production.
To systematics of the genus Saetheria Jackson (Diptera, Chironomidae) from the Russian Far East.
Orel, Oksana V
2014-05-23
The genus Saetheria Jackson from the Russian Far East is reviewed. The males of S. reissi Jackson, 1977, S. tamanipparai (Sasa, 1983) and S. tylus (Townes, 1945) are redescribed and figured. The pupa of S. reissi is redescribed and illustrated. The larva of S. reissi Jackson is described for the first time. Comments on the systematics and distribution of each species are provided. Paracladopelma kisopediformis Sasa, Kondo, 1993 is designated a new junior synonym of S. reissi Jackson, 1977. Keys to the males, pupae and larvae of the Russian Saetheria are given.
The response of chironomidae (Diptera) to a long-term exclusion of terrestrial organic matter
Sally A. Entrekin; J. Bruce Wallace; Susan L. Eggert
2007-01-01
We examined the effects of a seven-year detrital exclusion on chironomid assemblages in an Appalachian headwater stream. We hypothesized that litter exclusion would lead to a reduction in all chironomids at both the subfamily and generic levels because organic matter serves as both food and habitat in these headwater streams. Tanytarsini total abundance and biomass...
International Nuclear Information System (INIS)
Jaeckle, H.; Kalthoff, K.
1980-01-01
Smittia embryos were UV-irradiated during intravitelline cleavage while nuclei are heavily shielded by yolk-rich cytoplasm and do not synthesize detectable amounts of RNA. Irradiation at 265, 285 and 295 nm wavelength caused biological inactivation, and pyrimidine dimer formation in maternal RNA. Marked effects on protein synthesis were also observed: (1) the overall rate of 35 S-methionine incorporation in vivo was reduced to less than half of the normal rate, (2) two dimensional gel electrophoresis revealed quantitative variations in the synthetic rate of some polypeptides and the appearance of new ones in UV-irradiated embryos, (3) translation of polyadenylated RNA from Smittia embryos in a cell-free system was inhibited by UV-irradiation in vivo, (4) the apparent degradation during early embryogenesis, of maternal polyadenylated RNA was retarded in UV-irradiated embryos. Exposure to light (400 nm) after UV caused partial photoreversal of all UV effects observed. This is the first data showing that animal mRNA, after UV-irradiation, can be photoreactivated in vivo. The results also strongly suggest that the photorepairable lesions consist of pyrimidine dimers generated in a photosensitized reaction. (author)
Bellodi, Carolina Ferraz; Fusari, Lívia Maria; Roque, Fabio De Oliveira
2016-02-09
Two new species of Oukuriella, O. angelomachadoi sp. nov. (Holotype male deposited in MZUSP: BRAZIL, Paraná State) and O. plumaterata sp. nov. (Holotype male deposited in MZUSP: BRAZIL, São Paulo State), and the immatures stages of O. sublettei are described and figured. The larvae of O. sublettei were collected from submerged woods in low-order streams in the Atlantic Forest. In addition new records of several described species, including the first records of Oukuriella from Mexico and Bolivia are given.
Directory of Open Access Journals (Sweden)
Débora Rebechi-Baggio
Full Text Available ABSTRACT Changes in physiology of the nervous system and metabolism can be detected through the activity of acetylcholinesterase (AChE, alpha esterase (EST-a and beta esterase (EST-ß in chironomids exposed to pollutants. However, to understand the real effect of xenobiotics on organisms, it is important to investigate how certain factors can interfere with enzyme activity. We investigated the effects of different temperatures, food stress and two steps of the enzymatic protocol on the activity of AChE, EST-a and EST-ß in Chironomus sancticaroli. In experiment of thermal stress individuals from the egg stage to the fourth larval instar were exposed to different temperatures (20, 25 and 30 °C. In food stress experiment, larvae were reared until IV instar in a standard setting (25 °C and 0.9 g weekly ration, but from fourth instar on they were divided into groups and offered different feeding regimes (24, 48 and 72 h with/without food. In sample freezing experiment, a group of samples was processed immediately after homogenization and another after freezing for 30 days. To test the effect of centrifugation on samples, enzyme activity was quantified from centrifuged and non-centrifuged samples. The activity of each enzyme reached an optimum at a different temperature. The absence of food triggered different changes in enzyme activity depending on the period of starvation. Freezing and centrifugation of the samples significantly reduced the activity of three enzymes. Based on these results we conclude that the four factors studied had an influence on AChE, EST-a and EST-ß and this influence should be considered in ecotoxicological approaches.
A new species of the genus Microtendipes Kieffer, 1915 (Diptera, Chironomidae from Oriental China
Directory of Open Access Journals (Sweden)
Xin Qi
2012-07-01
Full Text Available A new species of the genus Microtendipes Kieffer, 1915, M. zhejiangensis sp.n., is described, and its morphological description and illustrations are given. A catalogue of the genus in Oriental Region is provided and a key to the males of Microtendipes in the Oriental Region is given.
International Nuclear Information System (INIS)
Jacobsen, R.E.; Perry, S.A.
2007-01-01
We document the first record of Polypedilum nubifer in Pan-America. This eurytopic species often reaches severe nuisance population sizes in Australia, Asia, and Hawaii in warm, shallow, eutrophic waters subject to drying. A large population was discovered in newly-constructed infiltration basins and neighboring marshes along the eastern boundary of Everglades National Park. Presently, this population appears minimally invasive to Park marshes and is far removed from urban areas. However, we anticipate this species could disperse and attain nuisance population sizes in suitable urban and agricultural habitats in south Florida. (author)
Structural basis for energy transduction by respiratory alternative complex III.
Sousa, Joana S; Calisto, Filipa; Langer, Julian D; Mills, Deryck J; Refojo, Patrícia N; Teixeira, Miguel; Kühlbrandt, Werner; Vonck, Janet; Pereira, Manuela M
2018-04-30
Electron transfer in respiratory chains generates the electrochemical potential that serves as energy source for the cell. Prokaryotes can use a wide range of electron donors and acceptors and may have alternative complexes performing the same catalytic reactions as the mitochondrial complexes. This is the case for the alternative complex III (ACIII), a quinol:cytochrome c/HiPIP oxidoreductase. In order to understand the catalytic mechanism of this respiratory enzyme, we determined the structure of ACIII from Rhodothermus marinus at 3.9 Å resolution by single-particle cryo-electron microscopy. ACIII presents a so-far unique structure, for which we establish the arrangement of the cofactors (four iron-sulfur clusters and six c-type hemes) and propose the location of the quinol-binding site and the presence of two putative proton pathways in the membrane. Altogether, this structure provides insights into a mechanism for energy transduction and introduces ACIII as a redox-driven proton pump.
South, J.; Welsh, D.; Anton, A.; Sigwart, J. D.; Dick, J. T. A.
2017-01-01
Interactions between Lipophrys pholis and its amphipod prey Echinogammarus marinus were used to investigate the effect of changing water temperatures, comparing current and predicted mean summer temperatures. Contrary to expectations, predator attack rates significantly decreased with increasing temperature. Handling times were significantly longer at 19° C than at 17 and 15° C and the maximum feeding estimate was significantly lower at 19° C than at 17° C. Functional-response type changed from a destabilizing type II to the more stabilizing type III with a temperature increase to 19° C. This suggests that a temperature increase can mediate refuge for prey at low densities. Predatory pressure by teleosts may be dampened by a large increase in temperature (here from 15 to 19° C), but a short-term and smaller temperature increase (to 17° C) may increase destabilizing resource consumption due to high maximum feeding rates; this has implications for the stability of important intertidal ecosystems during warming events.
Directory of Open Access Journals (Sweden)
Ilan Paperna
2011-07-01
Full Text Available Lankesterella poeppigii n. sp. is described from Bufo poeppigii (Tschudi, 1845 from Peru. Merogony and oogony occur in the capillary endothelium and the macrophages in the liver, spleen and kidneys. Meronts are oval, 25,2–29,4 x 15,7–16,8 μm in size and yield 35–46 merozoites. Oocysts are 26,3–29,4 x 15,1–17,6 μm in size; sporozoites 9,2-9,8 x 4,2–5,0 μm in size, assemble in macrophages. Released 8,7–9,8 x 2,8–3,1 μm sporozoites enter erythrocytes. L. poeppigii is compared with Lankesterella petiti Lainson & Paperna, 1995 infecting Bufo marinus (Linnaeus, 1758 in Brazil. The above mentioned specific characters, added to differences in hosts and geographical location warrant the description of Lankesterella poeppigii from B. poeppigii as a new species.
Pangenomic Definition of Prokaryotic Species and the Phylogenetic Structure of Prochlorococcus spp.
Directory of Open Access Journals (Sweden)
Mikhail A. Moldovan
2018-03-01
Full Text Available The pangenome is the collection of all groups of orthologous genes (OGGs from a set of genomes. We apply the pangenome analysis to propose a definition of prokaryotic species based on identification of lineage-specific gene sets. While being similar to the classical biological definition based on allele flow, it does not rely on DNA similarity levels and does not require analysis of homologous recombination. Hence this definition is relatively objective and independent of arbitrary thresholds. A systematic analysis of 110 accepted species with the largest numbers of sequenced strains yields results largely consistent with the existing nomenclature. However, it has revealed that abundant marine cyanobacteria Prochlorococcus marinus should be divided into two species. As a control we have confirmed the paraphyletic origin of Yersinia pseudotuberculosis (with embedded, monophyletic Y. pestis and Burkholderia pseudomallei (with B. mallei. We also demonstrate that by our definition and in accordance with recent studies Escherichia coli and Shigella spp. are one species.
South, J.
2017-11-15
Interactions between Lipophrys pholis and its amphipod prey Echinogammarus marinus were used to investigate the effect of changing water temperatures, comparing current and predicted mean summer temperatures. Contrary to expectations, predator attack rates significantly decreased with increasing temperature. Handling times were significantly longer at 19° C than at 17 and 15° C and the maximum feeding estimate was significantly lower at 19° C than at 17° C. Functional-response type changed from a destabilizing type II to the more stabilizing type III with a temperature increase to 19° C. This suggests that a temperature increase can mediate refuge for prey at low densities. Predatory pressure by teleosts may be dampened by a large increase in temperature (here from 15 to 19° C), but a short-term and smaller temperature increase (to 17° C) may increase destabilizing resource consumption due to high maximum feeding rates; this has implications for the stability of important intertidal ecosystems during warming events.
Corresponding long-term shifts in stream temperature and invasive fish migration
McCann, Erin L.; Johnson, Nicholas; Pangle, Kevin
2018-01-01
By investigating historic trapping records of invasive sea lamprey (Petromyzon marinus) throughout tributaries to the Laurentian Great Lakes, we found that upstream spawning migration timing was highly correlated with stream temperatures over large spatial and temporal scales. Furthermore, several streams in our study exceeded a critical spring thermal threshold (i.e., 15°C) and experienced peak spawning migration up to 30 days earlier since the 1980s, whereas others were relatively unchanged. Streams exhibiting warming trends and earlier migration were spatially clustered and generally found on the leeward side of the Great Lakes where the lakes most affect local climate. These findings highlight that all streams are not equally impacted by climate change and represent, to our knowledge, the first observation linking long-term changes in stream temperatures to shifts in migration timing of an invasive fish. Earlier sea lamprey migration in Great Lakes tributaries may improve young of the year growth and survival, but not limit their spatial distribution, making sea lamprey control more challenging.
Salinity effect on the maximal growth temperature of some bacteria isolated from marine enviroments.
Stanley, S O; Morita, R Y
1968-01-01
Salinity of the growth medium was found to have a marked effect on the maximal growth temperature of four bacteria isolated from marine sources. Vibrio marinus MP-1 had a maximal growth temperature of 21.2 C at a salinity of 35% and a maximal growth temperature of 10.5 C at a salinity of 7%, the lowest salinity at which it would grow. This effect was shown to be due to the presence of various cations in the medium. The order of effectiveness of cations in restoring the normal maximal growth temperature, when added to dilute seawater, was Na(+) > Li(+) > Mg(++) > K(+) > Rb(+) > NH(4) (+). The anions tested, with the exception of SO(4)=, had no marked effect on the maximal growth temperature response. In a completely defined medium, the highest maximal growth temperature was 20.0 C at 0.40 m NaCl. A decrease in the maximal growth temperature was observed at both low and high concentrations of NaCl.
Eleutherodactylus frog introductions to Hawaii
Kraus, Fred; Campbell, Earl W.; Allison, Allen; Pratt, Thane K.
1999-01-01
As an oceanic archipelago isolated from continental source areas, Hawaii lacks native terrestrial reptiles and amphibians, Polynesians apparently introduced seven gecko and skink species after discovering the islands approximately 1500 years ago, and another 15 reptiles and five frogs have been introduced in the last century and a half (McKeown 1996). The Polynesian introductions are probably inadvertent because the species involved are known stowaway dispersers (Gibbons 1985; Dye and Steadman 1990), In contrast, most of the herpetological introductions since European contact with Hawaii have been intentional. Several frog species were released for biocontrol of insects (e.g., Dendrobates auratus, Bufo marinus, Rana rugosa, Bryan 1932; Oliver and Shaw 1953), and most of the remaining species are released or escaped pets (e.g., Phelsuma spp., Chamaeleo jacksonii, Iguana iguana, McKeown 1996), Government-approved releases have not occurred for many years, but the rate of establishment of new species has increased in the past few decades because of the importation and subsequent release of pets.
Macroinvertebrados bentónicos del humedal de Palo Verde, Costa Rica
Directory of Open Access Journals (Sweden)
F.A Trama
2009-11-01
Full Text Available El humedal de Palo Verde es uno de los más importantes de Centro America para aves acuáticas. Durante el período 2002 y 2005, se llevaron a cabo actividades de manejo para controlar la invasión de Typha domingensis. Con el fin de establecer una línea base para monitoreos futuros, en el 2003 se realizó una evaluación de macroinvertebrados acuáticos. Se efectuó un muestreo mensual durante un año, usando el método de sustratos artificiales. Se identificaron 116 táxones pertenecientes a 47 familias y a 18 órdenes. La mayor abundancia se encontró en la clase Conchostraca y la familia Chironomidae que juntas representaron casi la mitad de todos los individuos colectados. En contraste, el 97% de los táxones tuvieron, cada uno, menos del 1% del total de la abundancia. La diversidad de táxones, así como la abundancia de individuos y el número de especies, fueron mayores en la época seca que en la lluviosa. La curva acumulada de especies indicó que se hubiera registrado una mayor cantidad de táxones si los muestreos se hubieran extendido por más tiempo. Con este trabajo damos a conocer la primera lista de macroinvertebrados para el humedal de Palo Verde.Benthic macroinvertebrates of the Palo Verde wetland, Costa Rica. Palo Verde, Costa Rica, is one of the most important wetlands in the region now recovering from some invasive plants, especially Typha domingensis, and monitoring programs were started, including studies on the aquatic macoinvertebrate fauna. We sampled benthic macroinvertebrates monthly for more than a year with artificial substrates, and identified 116 taxa from 57 families and 18 orders, with 90 morfospecies of insects. The highest abundances were in the class Conchostraca (typical in seasonal wetlands and in the family Chironomidae (Diptera, Insecta, which together represent almost half of all individuals collected. In contrast, 97 taxa were less than 1% of total abundance each. Number of individuals and number of
Directory of Open Access Journals (Sweden)
Joele Baumart
2011-06-01
Full Text Available AIM: This study evaluated the effect of the insecticide carbofuran and the herbicide metsulfuron-methyl on the abundance and diversity of benthic macroinvertebrates in a paddy ricefield. METHODS: To achieve this goal, two pesticide treatments [the insecticide carbofuran (IC and the herbicide metsulfuron-methyl (HM] and a control (Co treatment with no added pesticide were established in an experimental area of the Plant Science Department of the Federal University of Santa Maria. Soil samples were collected in triplicate from each treatment 30 days before and 1, 10, and 51 days after the pesticide application, for macrofauna identification. RESULTS: Among the 21 taxa identified, Trichoceridae was present only in Co, Hydroptilidae was recorded only in IC, and Corixidae in HM. In Co, the most abundant group was Annelida, while in IC and HM Diptera (Chironomidae was dominant. Significant differences were observed between Co and IC, in the density of Odontoceridae (Control>IC and Hydrophilidae (ControlHM and Hirudinea (ControlOBJETIVO: O objetivo desse estudo foi avaliar o efeito do inseticida carbofurano e do herbicida metsulfuron-methyl na abundância e diversidade de macroinvertebrados bentônicos em campo de arroz irrigado. MÉTODOS: Para isto, dois tratamentos com agrotóxicos [o inseticida carbofurano (IC e o herbicida metsulfuron-methyl (HM] e um controle (Co, tratamento sem pesticida, foram aplicados em uma área experimental no Departamento de Fitotecnia da Universidade Federal de Santa Maria. Amostras de solo foram coletadas em triplicatas em cada tratamento 30 dias antes (DBA e 1, 10 e 51 dias após a aplicação dos pesticidas, posteriormente a macrofauna foi identificada. RESULTADOS: Vinte e um (21 taxa foram identificados, entre esses Trichoceridae esteve presente apenas em Co, enquanto que Hydroptilidae foi coletado apenas em IC, e Corixidae em HM. Em Co e IC, o grupo mais abundante foi Annelida, e em HM foi Diptera (Chironomidae que
Endoparasites must breach host barriers to establish infection and then must survive host internal defenses to cause disease. Such barriers may frustrate attempts to experimentally transmit parasites by ?natural' methods. In addition, the host's condition may affect a study's out...
Macroinvertebrates associated with bryophyta in a first-order Atlantic Forest stream
Directory of Open Access Journals (Sweden)
Beatriz F. J. V. Rosa
2011-06-01
Full Text Available This study describes the composition and structure of the benthic community associated with bryophytes in a first-order stream, located in a biological reserve of the Atlantic Forest, during two seasons. During three months of the dry season of 2007 and three months of the rainy season of 2008, samples of bryophytes attached to stones were collected randomly, along a 100 m stream reach. The structure of the community was analyzed through the mean density of individuals, Shannon's diversity index, Pielou's evenness, family richness, dominance index, and the percentage of Ephemeroptera, Plecoptera and Trichoptera (% EPT. Chironomidae larvae were dominant in the two periods of study, followed by Ceratopogonidae in the rainy season, and Naididae in the dry season. The orders EPT contributed 14 families. The results showed that bryophytes constitute suitable habitat which is able to shelter an abundant and diversified benthic fauna in a small extension of the stream. This habitat provides refuge during spates, and thus minimizes downstream transport of the macroinvertebrate fauna.
Effect of habitat improvement on Atlantic salmon in the regulated river Suldalslaagen
International Nuclear Information System (INIS)
Raastad, J.E.; Lillehammer, A.; Lillehammer, L.; Eie, J.A.
1993-01-01
The River Suldaalslagen, which holds a population of large Atlantic salmon, has been regulated twice for hydropower production. The first regulation occurred in 1968 and the second in 1980. Present problems include the reduced density of benthic fauna, the reduced growth rate of young salmon, the low survival of 0 + fish and the increased time required for smoltification. A programme of habitat restoration includes building a rearing channel system where water flow and the substrate can be controlled. The salmon fry are stocked in the rearing channel and in an adjacent tributary stream. The effects on macrobenthos of introduced dead organic material were also studied. Improvement of physical habitat increased the density of benthic animals, and the survival of 1 + salmon was about 30%. Experiments that included adding 115 g wheat/m 2 resulted in a threefold increase in benthic fauna compared with a control area. The largest increase in numbers was Chironomidae in August-September, when benthic Crustacea also showed a significant increase. An increase in macrobenthos is expected to increase the growth and survival of young salmon fry. (Author)
Trophic relationships between macroinvertebrates and fish in a pampean lowland stream (Argentina
Directory of Open Access Journals (Sweden)
María V. López van Oosterom
2013-03-01
Full Text Available The diet and trophic relationships between the macroinvertebrates Phyllogomphoides joaquini Rodrigues Capítulo, 1992 and Coenagrionidae (Odonata, Chironomidae (Diptera, Diplodon delodontus (Lamarck, 1919 (Bivalvia: Hyriidae, and Pomacea canaliculata (Lamarck, 1822 (Gastropoda: Ampulariidae and the fishes Pimelodella laticeps Eigenmann, 1917 (Heptapteridae and Bryconamericus iheringii (Boulenger, 1887 (Characidae in a temperate lowland lotic system in Argentina were assessed on the basis of gut contents and stable-isotope analyses. The feeding strategies were analyzed by the AMUNDSEN method. Relative food items contribution for the taxa studied indicated a generalist-type trophic strategy. In macroinvertebrates, in general, the values of stable isotope confirmed the result of the analysis of gut contents. With the fish, stable-isotope analysis demonstrated that both species are predators, although B. iheringii exhibited a more omnivorous behaviour. These feeding studies allowed us to determine the trophic relationships among taxa studied. Detritus and diatoms were a principal source of food for all the macroinvertebrates studied. In La Choza stream the particulate organic matter is a major no limited food resource, has a significant influence upon the community.
Energy Technology Data Exchange (ETDEWEB)
Kefford, Ben J., E-mail: ben.kefford@rmit.edu.a [Biotechnology and Environmental Biology, School of Applied Sciences, RMIT University, PO Box 71, Bundoora, Victoria 3083 (Australia); Zalizniak, Liliana [Biotechnology and Environmental Biology, School of Applied Sciences, RMIT University, PO Box 71, Bundoora, Victoria 3083 (Australia); Dunlop, Jason E. [Department of Environment and Resource Management (DERM), 120 Meiers Rd, Indooroopilly, Queensland 4068 (Australia); Smart Water Research Facility, Griffith University, Queensland (Australia); Nugegoda, Dayanthi [Biotechnology and Environmental Biology, School of Applied Sciences, RMIT University, PO Box 71, Bundoora, Victoria 3083 (Australia); Choy, Satish C. [Department of Environment and Resource Management (DERM), 120 Meiers Rd, Indooroopilly, Queensland 4068 (Australia)
2010-02-15
The effects of suspended and deposited sediments on the macroinvertebrates are well documented in upland streams but not in slower flowing lowland rivers. Using species found in lowland lotic environments, we experimentally evaluate mechanisms for sediments to affect macroinvertebrates, and in one experiment whether salinity alters the effect of suspended sediments. Suspended kaolin clay reduced feeding of Ischnura heterosticta (Odonata: Coenagrionidae) at high turbidity (1000-1500 NTU) but had no effects on feeding of Hemianax papuensis (Odonata: Aeshnidae) and Micronecta australiensis (Hemiptera: Corixidae). In freshwater (0.1 mS/cm), survival of Ischnura aurora was poor in clear water, but improved with suspended kaolin. Growth and feeding of I. aurora were unaffected by suspended sediments and salinity. Burial (1-5 mm) of eggs with kaolin or sand reduced hatching in Physa acuta (Gastropoda: Physidae), Gyraulus tasmanica (Gastropoda: Planorbidae) and Chironomus cloacalis (Diptera: Chironomidae). Settling sediments may pose greater risk to lowland lotic invertebrates than suspended sediments. - Sediment deposition may be more directly detrimental to macroinvertebrates of lowland rivers than suspended sediments.
Biodiversity of Aquatic Insects of Zayandeh Roud River and Its Branches, Isfahan Province, Iran.
Directory of Open Access Journals (Sweden)
Mansoreh Shayeghi
2014-12-01
Full Text Available Aquatic insects are the major groups of arthropods that spend some parts of their life cycle in the water. These insects play an important role for transmission of some human and animal diseases. There is few information about the aquatic insects fauna of Iran.To study the aquatic insects fauna, adult, nymphal and larval collections were carried out from different habitats using the standard technique in Zayandeh Roud River, Isfahan Province,central Iran, during summer 2011.In total, 741 speimens of aquatic insects were collected and morphologically identified. They include 7 families and 12 genera representing 2 Orders. The order of Diptera (92.31% and Coleoptera (7.69%. The families Culicidae, Syrphidae and Chironomidae from Diptera order, Gyrinidae, Dytiscidae, Haliplidae, Hydrophilidae from Coleoptera order were identified.Some aquatic insects play an important role for transmission of human and animal diseases. These insects also are important for biological control. Therefore ecological study on aquatic insects can provide information about ecology of insects in an area for any decision making.
DEFF Research Database (Denmark)
Hamerlik, Ladislav; Jacobsen, Dean; Brodersen, Klaus Peter
2011-01-01
Chironomid assemblages of 22 artificial water bodies, mainly fountains, in two South American cities were surveyed. We found surprisingly low diversities, with a total of 11 taxa, averaging two taxa per site. The typical fountain assemblages mainly consisted of common species that have a wide...... distribution pattern and are tolerant to organic pollution. Also taxa independent of the natural aquatic sources, such as tap-water and semi-terrestrial species were represented. There was no significant difference between the taxa richness of the two S. American regions, however, the assemblage structures...
Energy Technology Data Exchange (ETDEWEB)
Rosenberg, D.M.; Wiens, A.P.; Bilyj, B. [Department of Fisheries and Oceans, Winnipeg, MB (Canada). Central and Arctic Region; Armstrong, L. [Department of Fisheries and Oceans, Winnipeg, MB (Canada). Central and Arctic Region
1995-10-01
The effects of experimental acidification and N fertilization on chironomid emergence from a poor fen in northwestern Ontario were studied from 1984 to 1989. Experimental treatments did not affect the numbers of chironomids emerging weekly, the timing of emergence, or the species composition of emergence during the study period. Weekly emergence counts were higher (P<0.05) from the periphery of the fen than the central part. Total seasonal emergence was higher from an area that was previously burned than from the rest of that swamp, though the difference was not statistically significant. Stability of species composition, despite experimental treatments and physiographic differences in the fen, may be a widespread characteristic of Canadian acidic peatlands. 7 tabs., 4 figs., 23 refs.
Yan, Chuncai; Zhao, Guangjun; Liu, Ting; Guo, Qin; Hou, Ziyuan; Wang, Xinhua; Pan, Baoping
2016-12-19
Two new species of the genus Cryptochironomus Kieffer, C. maculus Yan & Wang sp. n. and C. protuberans Yan & Wang sp. n. are described and illustrated as adult males. C. albofasciatus (Staeger) is recorded from China for the first time. A key to the males of Cryptochironomus in China is presented and generic diagnosis is emended.
Paul, Nilotpol; Mazumdar, Abhijit
2015-05-06
A new genus, Chaudhuriomyia in the tribe Macropelopiini belonging to subfamily Tanypodinae is described and illustrated in all life stages. The genus can be distinguished from all the other known Macropelopiini by the presence of a blunt claw on fore leg and a smooth surface of tibial spur in adult male, seminal capsules without proper neck in adult female, round anal lobe in pupa, and slightly inwardly bent inner tooth of ligula in larva. Generic diagnoses for larva, pupa and adult are provided. Taxonomic position and distribution of the genus are discussed along with a new adult key of tribe Macropelopiini. The specimens were collected from a stream in Indo-Bhutan border area of Eastern Himalaya in Indian Subcontinent. A note on the ecology and biology of the new genus is included.
Fu, Yue; Huang, Jingli; Liu, Wenbin; Fang, Xiangliang; Wang, Xinhua
2016-05-24
Thirteen holotypes of the orthoclad genus Rheocricotopus from Sino-Indian Region: R. (Psilocricotopus) hidakadeeus Sasa & Suzuki, R. (P.) isigadeeus Sasa & Suzuki, R. (P.) kurocedeus Sasa, R. (P.) tokarakeleus Sasa & Suzuki, R. (P.) tobatervicesimus Kikuchi & Sasa, R. (Rheocricotopus) inaquereus Sasa, Kitami & Suzuki, R. (R.) inaxeyeus Sasa, Kitami & Suzuki, R. (R.) shoufukusecundus Sasa, R. (R.) tamahumeralis Sasa, R. (R.) tatequintus Sasa, R. (R.) tedorisecundus Sasa, R. (R.) togapeniculus Sasa & Okazawa and R. (R.) yakulemeus Sasa & Suzuki are re-examined and illustrated, Some additional descriptions, corrections and a key of these thirteen holotypes are given.
15ŕ-Hydroxytestosterone produced in vitro and in vivo in the sea lamprey, .I.Petromyzon marinus./I..
Czech Academy of Sciences Publication Activity Database
Bryan, M. B.; Scott, A. P.; Černý, Ivan; Yun, S. S.; Li, W.
2003-01-01
Roč. 132, - (2003), s. 418-426 ISSN 0016-6480 Institutional research plan: CEZ:AV0Z4055905 Keywords : steroid * androgen * endocrinology Subject RIV: CC - Organic Chemistry Impact factor: 1.736, year: 2003
A pheromone outweighs temperature in influencing migration of sea lamprey
Brant, Cory O.; Li, Ke; Johnson, Nicholas S.; Li, Weiming
2015-01-01
Organisms continuously acquire and process information from surrounding cues. While some cues complement one another in delivering more reliable information, others may provide conflicting information. How organisms extract and use reliable information from a multitude of cues is largely unknown. We examined movement decisions of sea lampreys (Petromyzon marinus L.) exposed to a conspecific and an environmental cue during pre-spawning migration. Specifically, we predicted that the mature male-released sex pheromone 3-keto petromyzonol sulfate (3kPZS) will outweigh the locomotor inhibiting effects of cold stream temperature (less than 15°C). Using large-scale stream bioassays, we found that 3kPZS elicits an increase (more than 40%) in upstream movement of pre-spawning lampreys when the water temperatures were below 15°C. Both warming temperatures and conspecific cues increase upstream movement when the water temperature rose above 15°C. These patterns define an interaction between abiotic and conspecific cues in modulating animal decision-making, providing an example of the hierarchy of contradictory information.
Effects of coded-wire-tagging on stream-dwelling Sea Lamprey larvae
Johnson, Nicholas; Swink, William D.; Dawson, Heather A.; Jones, Michael L.
2016-01-01
The effects of coded wire tagging Sea Lamprey Petromyzon marinus larvae from a known-aged stream-dwelling population were assessed. Tagged larvae were significantly shorter on average than untagged larvae from 3 to 18 months after tagging. However, 30 months after tagging, the length distribution of tagged and untagged larvae did not differ and tagged Sea Lampreys were in better condition (i.e., higher condition factor) and more likely to have undergone metamorphosis than the untagged population. The reason why tagged larvae were more likely to metamorphose is not clear, but the increased likelihood of metamorphosis could have been a compensatory response to the period of slower growth after tagging. Slower growth after tagging was consistent across larval size-classes, so handling and displacement from quality habitat during the early part of the growing season was likely the cause rather than the tag burden. The tag effects observed in this study, if caused by displacement and handling, may be minimized in future studies if tagging is conducted during autumn after growth has concluded for the year.
Restoration of oyster reefs in an estuarine lake: population dynamics and shell accretion
Casas, Sandra M.; La Peyre, Jerome F.; La Peyre, Megan K.
2015-01-01
Restoration activities inherently depend on understanding the spatial and temporal variation in basic demographic rates of the species of interest. For species that modify and maintain their own habitat such as the eastern oyster Crassostrea virginica, understanding demographic rates and their impacts on population and habitat success are crucial to ensuring restoration success. We measured oyster recruitment, density, size distribution, biomass, mortality and Perkinsus marinus infection intensity quarterly for 3 yr on shallow intertidal reefs created with shell cultch in March 2009. All reefs were located within Sister Lake, LA. Reefs were placed in pairs at 3 different locations within the lake; pairs were placed in low and medium energy sites within each location. Restored reefs placed within close proximity (biomass (>14.6 kg m-2) at the end of 3 yr. Shell accretion, on average, exceeded estimated rates required to keep pace with local subsidence and shell loss. Variation in recruitment, growth and survival drives local site-specific population success, which highlights the need to understand local water quality, hydrodynamics, and metapopulation dynamics when planning restoration.
Jones, Michael L.; Brenden, Travis O.; Irwin, Brian J.
2015-01-01
The St. Marys River (SMR) historically has been a major producer of sea lampreys (Petromyzon marinus) in the Laurentian Great Lakes. In the early 2000s, a decision analysis (DA) project was conducted to evaluate sea lamprey control policies for the SMR; this project suggested that an integrated policy of trapping, sterile male releases, and Bayluscide treatment was the most cost-effective policy. Further, it concluded that formal assessment of larval sea lamprey abundance and distribution in the SMR would be valuable for future evaluation of control strategies. We updated this earlier analysis, adding information from annual larval assessments conducted since 1999 and evaluating additional control policies. Bayluscide treatments continued to be critical for sea lamprey control, but high recruitment compensation minimized the effectiveness of trapping and sterile male release under current feasible ranges. Because Bayluscide control is costly, development of strategies to enhance trapping success remains a priority. This study illustrates benefits of an adaptive management cycle, wherein models inform decisions, are updated based on learning achieved from those decisions, and ultimately inform future decisions.
Directory of Open Access Journals (Sweden)
Bal, S.
2009-01-01
Full Text Available Bacillus species are ubiquitous and diverse both in the terrestrial and marine ecosystems. In this investigation, predominant Bacillus species from sea water of three different sites of Orissa Coast were isolated and identified. In total, 16 Bacillus species were identified using morpho-physiological and biochemical characterisation. These identified bacterial strains include B. fastidiosus (CMB1, B. alvei (CMB2, B. coagulans (CMB3, B. marinus (CMB5, B. mycoides (CMB8, B. coagulans (PMB1, B. circulans (PMB2, B. cereus (PMB3, B. subtilis (PMB4, B. alcalophilus (GMB1, B. licheniformics (GMB2, B. polymyxa (GMB3 and B. pumilus (GMB4. The isolates CMB4, CMB6 and CMB7 were identified only up to genus level. These isolates were further screened for their salt tolerance and growth under varied temperature and pH conditions. Ability of these strains to produce extracellular enzymes such as protease, amylase, lipase, gelatinase, casein hydrolase, lecithinase, chitinase and pectinase were also screened and found that most of the Bacillus spp. possess extracellular enzymes.
HPLC and ELISA analyses of larval bile acids from Pacific and western brook lampreys
Yun, S.-S.; Scott, A.P.; Bayer, J.M.; Seelye, J.G.; Close, D.A.; Li, W.
2003-01-01
Comparative studies were performed on two native lamprey species, Pacific lamprey (Lampetra tridentata) and western brook lamprey (Lampetra richardsoni) from the Pacific coast along with sea lamprey (Petromyzon marinus) from the Great Lakes, to investigate their bile acid production and release. HPLC and ELISA analyses of the gall bladders and liver extract revealed that the major bile acid compound from Pacific and western brook larval lampreys was petromyzonol sulfate (PZS), previously identified as a migratory pheromone in larval sea lamprey. An ELISA for PZS has been developed in a working range of 20pg-10ng per well. The tissue concentrations of PZS in gall bladder were 127.40, 145.86, and 276.96??g/g body mass in sea lamprey, Pacific lamprey, and western brook lamprey, respectively. Releasing rates for PZS in the three species were measured using ELISA to find that western brook and sea lamprey released PZS 20 times higher than Pacific lamprey did. Further studies are required to determine whether PZS is a chemical cue in Pacific and western brook lampreys. ?? 2003 Elsevier Inc. All rights reserved.
2015-01-01
Anselm Citron, one of CERN’s pioneers, an enthusiastic scholar and internationally renowned researcher, passed away on 8 December at the age of 91. Anselm Citron, front, looks at a quadrupole for the muon beam at the SC with, left to right, Bengt Hedin, Marinus van Gulik and Pierre Lapostolle. Born in Germany, Citron went to high school in the Netherlands, where he had been sent to escape the persecution of people with Jewish roots. After abitur and a short period at a technical high school, he took part in the last stages of the Second World War before returning to Freiburg in 1945. There, he studied physics under Wolfgang Gentner, and obtained his PhD. Citron then joined the Cavendish Laboratory, Cambridge, in 1952, to take part in research on accelerator physics. A year later, he came to the newly founded CERN as one of its first 12 staff physicists and contributed to the construction of the Proton Synchrotron, for which he was responsible for the high-frequency powe...
Relatively rapid loss of lampricide residues from fillet tissue of fish after routine treatment
Vue, C.; Bernardy, J.A.; Hubert, T.D.; Gingerich, W.H.; Stehly, G.R.
2002-01-01
The selective sea lamprey (Petromyzon marinus) larvicide 3-trifluoromethyl-4-nitrophenol (TFM) is currently used to control parasitic sea lampreys in tributaries to the Great Lakes basin. The concentration and persistence of TFM and its major metabolite, TFM glucuronide (TFM-glu), was determined in fillet tissue of fish after a typical stream application. Rainbow trout (Oncorhynchus mykiss) and channel catfish (Ictalurus punctatus) were exposed to a nominal concentration of 12.6 nmol/mL TFM for about 12 h during a sea lamprey control treatment of the Ford River in Michigan. Concentrations of TFM and TFM-glu were greatest in the fillet tissues during the exposure period, with greater residues in channel catfish (wet wt; mean, 6.95 nmol/g TFM; mean, 2.40 nmol/g TFM-glu) than in rainbow trout (wet wt; mean, 1.45 nmol/g TFM; mean, 0.93 nmol/g TFM-glu). After the exposure period, residues in both species decreased by 90-99% within 6-12 h and were less than the quantitation limit (<0.03 nmol/g) within 36 h.
Morshedian, Ala; Toomery, Matthew B.; Pollock, Gabriel E.; Frederiksen, Rikard; Enright, Jennifer; McCormick, Stephen; Cornwall, M. Carter; Fain, Gordon L.; Corbo, Joseph C.
2017-01-01
The spectral composition of ambient light varies across both space and time. Many species of jawed vertebrates adapt to this variation by tuning the sensitivity of their photoreceptors via the expression of CYP27C1, an enzyme that converts vitamin A1 into vitamin A2, thereby shifting the ratio of vitamin A1-based rhodopsin to red-shifted vitamin A2-based porphyropsin in the eye. Here, we show that the sea lamprey (Petromyzon marinus), a jawless vertebrate that diverged from jawed vertebrates during the Cambrian period (approx. 500 Ma), dynamically shifts its photoreceptor spectral sensitivity via vitamin A1-to-A2 chromophore exchange as it transitions between photically divergent aquatic habitats. We further show that this shift correlates with high-level expression of the lamprey orthologue of CYP27C1, specifically in the retinal pigment epithelium as in jawed vertebrates. Our results suggest that the CYP27C1-mediated vitamin A1-to-A2 switch is an evolutionarily ancient mechanism of sensory plasticity that appeared not long after the origin of vertebrates.
The sea lamprey meiotic map improves resolution of ancient vertebrate genome duplications.
Smith, Jeramiah J; Keinath, Melissa C
2015-08-01
It is generally accepted that many genes present in vertebrate genomes owe their origin to two whole-genome duplications that occurred deep in the ancestry of the vertebrate lineage. However, details regarding the timing and outcome of these duplications are not well resolved. We present high-density meiotic and comparative genomic maps for the sea lamprey (Petromyzon marinus), a representative of an ancient lineage that diverged from all other vertebrates ∼550 million years ago. Linkage analyses yielded a total of 95 linkage groups, similar to the estimated number of germline chromosomes (1n ∼ 99), spanning a total of 5570.25 cM. Comparative mapping data yield strong support for the hypothesis that a single whole-genome duplication occurred in the basal vertebrate lineage, but do not strongly support a hypothetical second event. Rather, these comparative maps reveal several evolutionarily independent segmental duplications occurring over the last 600+ million years of chordate evolution. This refined history of vertebrate genome duplication should permit more precise investigations of vertebrate evolution. © 2015 Smith and Keinath; Published by Cold Spring Harbor Laboratory Press.
Dunlop, Erin S.; McLaughlin, Robert L.; Adams, Jean V.; Jones, Michael L.; Birceanu, Oana; Christie, Mark R.; Criger, Lori A.; Hinderer, Julia L.M.; Hollingworth, Robert M.; Johnson, Nicholas; Lantz, Stephen R.; Li, Weiming; Miller, James R.; Morrison, Bruce J.; Mota-Sanchez, David; Muir, Andrew M.; Sepulveda, Maria S.; Steeves, Todd B.; Walter, Lisa; Westman, Erin; Wirgin, Isaac; Wilkie, Michael P.
2018-01-01
Rapid evolution of pest, pathogen and wildlife populations can have undesirable effects; for example, when insects evolve resistance to pesticides or fishes evolve smaller body size in response to harvest. A destructive invasive species in the Laurentian Great Lakes, the sea lamprey (Petromyzon marinus) has been controlled with the pesticide 3-trifluoromethyl-4-nitrophenol (TFM) since the 1950s. We evaluated the likelihood of sea lamprey evolving resistance to TFM by (1) reviewing sea lamprey life history and control; (2) identifying physiological and behavioural resistance strategies; (3) estimating the strength of selection from TFM; (4) assessing the timeline for evolution; and (5) analyzing historical toxicity data for evidence of resistance. The number of sea lamprey generations exposed to TFM was within the range observed for fish populations where rapid evolution has occurred. Mortality from TFM was estimated as 82-90%, suggesting significant selective pressure. However, 57 years of toxicity data revealed no increase in lethal concentrations of TFM. Vigilance and the development of alternative controls are required to prevent this aquatic invasive species from evolving strategies to evade control.
Magneto-aerotactic bacteria deliver drug-containing nanoliposomes to tumour hypoxic regions
Felfoul, Ouajdi; Mohammadi, Mahmood; Taherkhani, Samira; de Lanauze, Dominic; Zhong Xu, Yong; Loghin, Dumitru; Essa, Sherief; Jancik, Sylwia; Houle, Daniel; Lafleur, Michel; Gaboury, Louis; Tabrizian, Maryam; Kaou, Neila; Atkin, Michael; Vuong, Té; Batist, Gerald; Beauchemin, Nicole; Radzioch, Danuta; Martel, Sylvain
2016-11-01
Oxygen-depleted hypoxic regions in the tumour are generally resistant to therapies. Although nanocarriers have been used to deliver drugs, the targeting ratios have been very low. Here, we show that the magneto-aerotactic migration behaviour of magnetotactic bacteria, Magnetococcus marinus strain MC-1 (ref. 4), can be used to transport drug-loaded nanoliposomes into hypoxic regions of the tumour. In their natural environment, MC-1 cells, each containing a chain of magnetic iron-oxide nanocrystals, tend to swim along local magnetic field lines and towards low oxygen concentrations based on a two-state aerotactic sensing system. We show that when MC-1 cells bearing covalently bound drug-containing nanoliposomes were injected near the tumour in severe combined immunodeficient beige mice and magnetically guided, up to 55% of MC-1 cells penetrated into hypoxic regions of HCT116 colorectal xenografts. Approximately 70 drug-loaded nanoliposomes were attached to each MC-1 cell. Our results suggest that harnessing swarms of microorganisms exhibiting magneto-aerotactic behaviour can significantly improve the therapeutic index of various nanocarriers in tumour hypoxic regions.
Directory of Open Access Journals (Sweden)
Francisco Manoel de Souza Braga
2005-03-01
Full Text Available Os peixes foram amostrados quatro vezes em cada local, de julho de 2001 a abril de 2002: inverno (julho de 2001, primavera (outubro de 2001, verão (fevereiro de 2002 e outono (abril de 2002. Foram amostrados segmentos de cinco riachos no sistema do Ribeirão Grande (22o 47’ 08’’ S, 45o 28’ 17’’W. Coletas quantitativas foram feitas com um aparelho de pesca-elétrica ligado a um gerador com capacidade máxima de 1.500 V e 8,7 A de 600 Hz de corrente alternada. Alimentação, mudanças na gordura visceral e fator de condição foram comparados em duas espécies de characidiíneos, Characidium lauroi e C. Alipioi do sistema do Ribeirão Grande, sudeste do Brasil. Nas dietas das duas espécies ninfas de Ephemeroptera, foram registradas larvas de Diptera (Chironomidae, Simuliidae, ninfas de Plecoptera, larvas de Trichoptera (Hydroptilidae, Psychoyiidae, insetos terrestres (Coleoptera, Isoptera, Hemiptera [Heteroptera, Homoptera], larvas de Megaloptera (Corydalidae, Arachnida, Ostracoda e restos vegetais. A gordura visceral decresceu em fevereiro, coincidindo com o declínio do fator de condição em ambas as espécies. O aumento da atividade alimentar durante o verão proporciona o acúmulo de gordura. Durante as estações seguintes, esses peixes devem utilizar as reservas de gordura visceral para manutenção e reproduçãoFeeding, seasonal changes in visceral fat and condition factor were compared in two species of characidiin fishes, Characidium lauroi and C. alipioi from Ribeirão Grande system, southeastern Brazil. Five streams of Ribeirão Grande system were sampled (22o 47’ 08’’ S, 45o 28’ 17’’W. The samples were taken four times per site, from July, 2001 to April, 2002: winter (July 2001, spring (October 2001, summer (February 2002 and autumn (April 2002. Quantitative collections were made with an electro-fishing device powered by a generator with maximum capacity of 1,500 V and 8.7 A of 60 Hz alternating current
Assessment of disturbance at three spatial scales in two large tropical reservoirs
Directory of Open Access Journals (Sweden)
Letícia de Morais
2016-12-01
Full Text Available Large reservoirs are an increasingly common feature across tropical landscapes because of their importance for water supply, flood control and hydropower, but their ecological conditions are infrequently evaluated. Our objective was to assess the range of disturbances for two large tropical reservoirs and their influences on benthic macroinvertebrates. We tested three hypotheses: i a wide variation in the level of environmental disturbance can be observed among sites in the reservoirs; ii the two reservoirs would exhibit a different degree of disturbance level; and iii the magnitude of disturbance would influence the structure and composition of benthic assemblages. For each reservoir, we assessed land use (macroscale, physical habitat structure (mesoscale, and water quality (microscale. We sampled 40 sites in the littoral zones of both Três Marias and São Simão Reservoirs (Minas Gerais, Brazil. At the macroscale, we measured cover percentages of land use categories in buffer areas at each site, where each buffer was a circular arc of 250 m. At the mesoscale, we assessed the presence of human disturbances in the riparian and drawdown zones at the local (site scale. At the microscale, we assessed water quality at each macroinvertebrate sampling station using the Micro Disturbance Index (MDI. To evaluate anthropogenic disturbance of each site, we calculated an integrated disturbance index (IDI from a buffer disturbance index (BDI and a local disturbance index (LDI. For each site, we calculated richness and abundance of benthic macroinvertebrates, Chironomidae genera richness, abundance and percent Chironomidae individuals, abundance and percent EPT individuals, richness and percent EPT taxa, abundance and percent resistant individuals, and abundance and percent non-native individuals. We also evaluated the influence of disturbance on benthic macroinvertebrate assemblages at the entire-reservoir scale. The BDI, LDI and IDI had significantly
Hirabayashi, Kimio; Nagai, Yoshinari; Mushya, Tetsuya; Higashino, Makoto; Taniguchi, Yoshio
2017-06-01
A study on the attraction of adult Propsilocerus akamusi midges to different-colored light traps was carried out from October 21 to November 15, 2013. The 6 colored lights used in light-emitting diode (LED) lamps were white, green, red, blue, amber, and ultraviolet (UV). The UV lamp attracted the most P. akamusi, followed by green, white, blue, amber, and red. A white pulsed LED light attracted only half the number of midges as did a continuous-emission white LED light. The result indicated that manipulation of light color, considering that the red LED light and/or pulsed LED light are not as attractive as the other colors, may be appropriate for the development of an overall integrated strategy to control nuisance P. akamusi in the Lake Suwa area.
Paul, Nilotpol; Hazra, Niladri; Mazumdar, Abhijit
2014-05-23
Immature and adult stages of Monopelopia mongpuense sp. n. from phytotelmata of Cedrus deodara (Lamb.) in Darjeeling are described along with biological notes. Key to the adult males of all species of the genus Monopelopia Fittkau is also presented. This genus is recorded for the first from Indian subcontinent.
Giłka, Wojciech; Dobosz, Roland
2015-06-26
First specific records of chironomids of the tribe Tanytarsini from New Caledonia based on detailed descriptions of new species are presented. Cladotanytarsus (Cladotanytarsus) stylifer sp. nov. and its closest relatives, i.a. Cladotanytarsus (C.) isigacedeus (Sasa et Suzuki, 2000), comb. nov., known from males bearing extraordinarily elongate hypopygial anal points are diagnosed. Paratanytarsus mirificus sp. nov. is described as adult male with unique structure of its hypopygium and shortened antennae. Diagnostic description of Tanytarsus fuscithorax Skuse, 1889 is also complemented.
Energy Technology Data Exchange (ETDEWEB)
Michailova, P. [Institute of Zoology, Bulgarian Academy of Sciences, 1 Tzar Osvoboditel boul., Sofia 1000 (Bulgaria)]. E-mail: michailova@zoology.bas.bg; Petrova, N. [Institute of Zoology, Russian Academy of Sciences, St. Petersburg, 199034, Universit. nab. 1, Russia (Russian Federation); Ilkova, J. [Institute of Zoology, Bulgarian Academy of Sciences, 1 Tzar Osvoboditel boul., Sofia 1000 (Bulgaria); Bovero, S. [Department of Animal Biology, University of Turin, via Albertina 13, Turin (Italy); Brunetti, S. [Department of Animal Biology, University of Turin, via Albertina 13, Turin (Italy); White, K. [School of Biological Sciences, University of Manchester, Manchester M13 9PT (United Kingdom); Sella, G. [Department of Animal Biology, University of Turin, via Albertina 13, Turin (Italy)
2006-11-15
The genotoxic action of copper (Cu) on the polytene chromosomes of Chironomus riparius was investigated by analysing structural and functional chromosome aberrations of fourth instars larvae hatched from eggs subject to acute (48 h) exposure with three environmentally relevant concentrations of aqueous Cu (0.005, 0.01, 0.05 mg/l). A dose dependent relationship was observed between Cu concentration and frequency of chromosomal aberrations. A significantly higher frequency of functional alterations, specifically decondensed centromeres and telomeres, and reduction in activity of Balbiani rings, was observed in treated material compared to control. A comparison of breakpoints resulting from treatment with chromium and lead from earlier studies with those Cu-induced identified a series of chromosomal weak points particularly vulnerable to trace metals. We also show that the appearance of structural and functional chromosome aberrations are more sensitive indicators of acute Cu toxicity in chironomid larvae than changes in external morphology. - Acute exposure of Chironomus eggs to copper resulted in changes in chromosome structure and function.
Directory of Open Access Journals (Sweden)
Trond Andersen
Full Text Available The genus Troglocladius Andersen, Baranov et Hagenlund, gen. n. is erected based on T. hajdi Andersen, Baranov et Hagenlund, sp. n. collected at 980 m depth in the Lukina jama-Trojama cave system in Croatia. Morphological features such as pale color, strongly reduced eyes and very long legs make it a typical cave animal. Surprisingly, it has also retained large wings and appears to be capable of flight which would make T. hajdi the first flying troglobiont worldwide, disproving previous beliefs that bats are the only animals capable of flying in complete darkness. Morphologically the new species does not readily fit within any described genus, but shares characteristics with genera both in the tribes "Metriocnemini" and "Orthocladiini". Bayesian molecular phylogenetic analysis using the markers COI, 18S rDNAs, 28S rDNA, CADI, and CADIV groups it with the genera Tvetenia, Cardiocladius and Eukiefferiella in the tribe "Metriocnemini". Troglocladius hajdi may be parthenogenetic, as only females were collected. The discovery confirms the position of the Dinaric arch as a highly important hotspot of subterranean biodiversity.
Mazack, Jane E.; Kranzfelder, Petra; Anderson, Alyssa M.; Bouchard, William; Perry, James; Vondracek, Bruce C.; Ferrington, Leonard C.
2014-01-01
Diamesa mendotae Muttkowski, 1915 is a winter-active species common in groundwater-buffered streams of Minnesota and Wisconsin. This species is capable of surviving under snow cover for at least 28 days. Field collections of adult D. mendotae were used to determine survivorship under long-term exposure to controlled sub-freezing conditions. Specimens were placed into a controlled temperature chamber at −5 °C, batches removed at weekly intervals, and subsequently held at 6 °C to determine survivorship and longevity. Our results indicate that overall survivorship is negatively related to treatment duration of sub-freezing treatment, individuals can survive sub-freezing temperatures for at least 70 days, with total longevity of 92 days. Additionally, males had a significantly higher rate of survivorship than females within treatments. Total longevity increased with treatment time, suggesting adult D. mendotae may survive long periods of below-freezing temperatures under natural conditions before mating, which may convey population-level advantages.
Niitsuma, Hiromi
2016-02-16
The male and female adults and pupa of Nilothauma niidaense n. sp. are described and illustrated on the basis of the material collected from a fontal stream in Fukushima Prefecture, Japan. N. sasai Adam & Sæther is treated as a junior synonym of N. hibaratertium Sasa, of which the male is redescribed. The Adam & Sæther key to Nilothauma males is revised.
Jacobsen, Richard E.
2008-01-01
A key has been developed for identifying the pupal exuviae of 132 taxa of chironomid midges collected in Everglades National Park, as well as 18 additional species from freshwater habitats adjacent to the Park. Descriptions and illustrations are based upon voucher specimens from extensive collections of chironomid pupal exuviae for faunal surveys and biomonitoring research conducted in ENP and surrounding freshwater areas from 1998 to 2007. The key includes taxonomic comments for confirming identifications, as well as brief summaries of the distribution and ecology of each species in southern Florida waters. Information is also provided on the morphology of chironomid pupal exuviae, recommended references for identifying pupal exuviae, techniques for making slides, and methods to confirm proper identification.
Andersen, Trond; Baranov, Viktor; Hagenlund, Linn Katrine; Ivković, Marija; Kvifte, Gunnar Mikalsen; Pavlek, Martina
2016-01-01
The genus Troglocladius Andersen, Baranov et Hagenlund, gen. n. is erected based on T. hajdi Andersen, Baranov et Hagenlund, sp. n. collected at 980 m depth in the Lukina jama-Trojama cave system in Croatia. Morphological features such as pale color, strongly reduced eyes and very long legs make it a typical cave animal. Surprisingly, it has also retained large wings and appears to be capable of flight which would make T. hajdi the first flying troglobiont worldwide, disproving previous beliefs that bats are the only animals capable of flying in complete darkness. Morphologically the new species does not readily fit within any described genus, but shares characteristics with genera both in the tribes "Metriocnemini" and "Orthocladiini". Bayesian molecular phylogenetic analysis using the markers COI, 18S rDNAs, 28S rDNA, CADI, and CADIV groups it with the genera Tvetenia, Cardiocladius and Eukiefferiella in the tribe "Metriocnemini". Troglocladius hajdi may be parthenogenetic, as only females were collected. The discovery confirms the position of the Dinaric arch as a highly important hotspot of subterranean biodiversity.
Tang, Hong-Qu; Cranston, Peter S; Zhao, Jian-Gang; Lok, Chan-Wa; Wong, Kai-Chin; Li, Zhi-Qiang
2014-12-09
Based on associated material collected from Macau and Guangxi, the pupae and larvae of Polypedilum (Pentapedilum) nodosum Johannsen and P. (Tripodura) masudai Tokunaga are described completely for the first time. Both species are newly recorded from China. Characters for distinguishing the immature stage of these species from other allied Polypedilum species are noted. The previously recorded Polypedilum (Pentapedilum) 'K1' of Cranston (1996) is shown to be P. nodosum. Information is provided on distribution and ecological tolerances.
International Nuclear Information System (INIS)
Michailova, P.; Petrova, N.; Ilkova, J.; Bovero, S.; Brunetti, S.; White, K.; Sella, G.
2006-01-01
The genotoxic action of copper (Cu) on the polytene chromosomes of Chironomus riparius was investigated by analysing structural and functional chromosome aberrations of fourth instars larvae hatched from eggs subject to acute (48 h) exposure with three environmentally relevant concentrations of aqueous Cu (0.005, 0.01, 0.05 mg/l). A dose dependent relationship was observed between Cu concentration and frequency of chromosomal aberrations. A significantly higher frequency of functional alterations, specifically decondensed centromeres and telomeres, and reduction in activity of Balbiani rings, was observed in treated material compared to control. A comparison of breakpoints resulting from treatment with chromium and lead from earlier studies with those Cu-induced identified a series of chromosomal weak points particularly vulnerable to trace metals. We also show that the appearance of structural and functional chromosome aberrations are more sensitive indicators of acute Cu toxicity in chironomid larvae than changes in external morphology. - Acute exposure of Chironomus eggs to copper resulted in changes in chromosome structure and function
Andersen, Trond; González, Orestes C Bello; Baars, Jan-Robert; Earle, William
2015-08-19
Polypedilum (Pentapedilum) tuburcinatum Andersen et Bello González sp. n. is described and figured as male, female, pupa and larva based on material collected in the Eastern Cape Province in South Africa, imported into quarantine in Ireland and reared in the laboratory. The species feeds on the aquatic weed Lagarosiphon major (Ridl.) Moss ex Wager and is regarded as a promising candidate agent for biological control of this invasive weed.
Directory of Open Access Journals (Sweden)
L. Marziali
2013-09-01
Full Text Available The response of 443 chironomid species to water temperature was analyzed, with the aim of defining their thermal optimum, tolerance limits and thermal habitat. The database included 4442 samples mainly from Italian river catchments collected from the 1950s up to date. Thermal preferences were calculated separately for larval and pupal specimens and for different habitats: high altitude and lowland lakes in the Alpine ecoregion; lowland lakes in the Mediterranean ecoregion; heavily modified water bodies; kryal, krenal, rhithral and potamal in running waters. Optimum response was calculated as mean water temperature, weighted by species abundances; tolerance as weighted standard deviation; skewness and kurtosis as 3rd and 4th moment statistics. The responses were fitted to normal uni- or plurimodal Gaussian models. Cold stenothermal species showed: i unimodal response, ii tolerance for a narrow temperature range, iii optima closed to their minimum temperature values, iv leptokurtic response. Thermophilous species showed: i optima at different temperature values, ii wider tolerance, iii optima near their maximum temperature values, iv platikurtic response, often fitting a plurimodal model. As expected, lower optima values and narrower tolerance were obtained for kryal and krenal, than for rhithral, potamal and lakes. Thermal response curves were produced for each species and were discussed according to species distribution (i.e. altitudinal range in running water and water depth in lakes, voltinism and phylogeny. Thermal optimum and tolerance limits and the definition of the thermal habitat of species can help predicting the impact of global warming on freshwater ecosystems.
Directory of Open Access Journals (Sweden)
Masaru Yamamoto
2015-07-01
Full Text Available Three new species: Ionthosmittia cuneipenne sp. nov., Orthocladius (Euorthocladius okinawanus sp. nov. and Parakiefferiella semiovata sp. nov., are described from Okinawa Island, Ryukyus, Japan. In addition to these species, twelve species are newly recorded from this island. Diagnostic characters of Tokyobrillia tamamegaseta (Kobayashi et Sasa are emended. Pentapedilum yakuabeum Sasa et Suzuki syn. nov. and Polypedilum yakucedeum Sasa et Suizuki syn. nov. are junior synonyms of Ainuyusurika tuberculatum (Tokunaga. Einfeldia kanazawai (Yamamoto is transferred to the genus Chironomus Meigen and its systematic position is discussed.
Directory of Open Access Journals (Sweden)
Julieta Massaferro
2009-06-01
Full Text Available Entre los indicadores biológicos lacustres más utilizados en las reconstrucciones ambientales, se encuentran el polen, los ostrácodos y las diatomeas, y entre los insectos, los coleópteros y los quironómidos. Este grupo ha cobrado gran importancia en los últimos tiempos, debido a los resultados prometedores que se han obtenido en reconstrucciones climáticas realizadas en América del Norte y Europa. En América del Sur, el uso de los quironómidos fósiles en estudios cuaternarios es relativamente limitado, principalmente por su escaso conocimiento taxonómico regional. La mayor parte de estos estudios fueron realizados en lagos glaciares patagónicos de Argentina y Chile. Las larvas de quironómidos constituyen una valiosa herramienta paleolimnológica, por ser un grupo de organismos altamente sensible a cambios ambientales, tanto naturales como artificiales. Además, es un grupo de insectos ampliamente distribuido y con una abundancia y diversidad relativamente altas. Sus cápsulas cefálicas se preservan en los sedimentos lacustres y poseen caracteres importantes que permiten identificar géneros y muchas veces especies. El estudio de los ensambles de quironómidos en sedimentos lacustres puede ser utilizado con distintos objetivos, por ejemplo, para estudios de eutrofización, ya que responden rápidamente a cambios en la concentración de nutrientes, materia orgánica y otros elementos, como metales pesados. No obstante, uno de los potenciales más importantes de este grupo de insectos es su sensibilidad a los cambios de temperatura, por este motivo, la aplicación más importante de su estudio en sedimentos se centra en las reconstrucciones climáticas. Esta contribución es una síntesis de los resultados de los trabajos publicados en la Patagonia argentina y chilena, sobre la base del uso de los quironómidos fósiles en reconstrucciones paleoambientales.Pollen, ostracods, diatoms and insects such as beetles and chironomids are the biological indicators from lake sediments more useful in environmental reconstructions. Chironomids have recently acquired great importance due to the promising results obtained regarding climatic reconstructions mainly in Europe and North America. In South America, the use of fossil chironomids in Quaternary studies is still limited and the reason for that is the little regional taxonomic knowledge. Most of these studies were developed in glacial lakes in Patagonia both in Argentina and Chile. The larvae of chironomids are an invaluable paleolimnological tool due to the sensitiveness of these insects to natural and non-natural environmental changes. In addition to that, this group of insects is widely distributed with a high abundance and diversity. Their head capsules can preserve in sediments holding characters which allow their generic and sometimes specific identification. The study of chironomid assemblages can be used with different goals, for instance, to study eutrofication due to their quick response to changes in organic matter, nutrients and heavy metals. However, one of the most significant potentials of this group is its sensitivity to temperature variations, which is why the most important implementation of their study in sediments is centered in climatic reconstructions. This article is a review of the studies developed in Argentinean and Chilean Patagonia, using fossil chironomids for paleoenvironmental reconstructions.
Roberts, Brent W.; Didier, Wes; Satbir, Rai; Johnson, Nicholas S.; Libants, Scot V.; Sang-Seon, Yun; Close, David
2013-01-01
In higher vertebrates, in response to stress, the hypothalamus produces corticotropin-releasing hormone (CRH), which stimulates cells in the anterior pituitary to produce adrenocorticotropic hormone (ACTH), which in turn stimulates production of either cortisol (F) or corticosterone (B) by the adrenal tissues. In lampreys, however, neither of these steroids is present. Instead, it has been proposed that the stress steroid is actually 17,21-dihydroxypregn-4-ene-3,20-dione (11-deoxycortisol; S). However, there have been no studies yet to determine its mechanism of regulation or site of production. Here we demonstrate that (1) intraperitoneal injections of lamprey-CRH increase plasma S in a dose dependent manner, (2) intraperitoneal injections of four lamprey-specific ACTH peptides at 100 lg/kg, did not induce changes in plasma S concentrations in either males or females; (3) two lamprey-specific gonadotropin-releasing hormones (GnRH I and III) and arginine-vasotocin (AVT), all at single doses, stimulated S production as well as, or to an even greater extent than CRH; (4) sea lamprey mesonephric kidneys, in vitro, converted tritiated 17a-hydroxyprogesterone (17a-P) into a steroid that had the same chromatographic properties (on HPLC and TLC) as S; (5) kidney tissues released significantly more immunoassayable S into the incubation medium than gill, liver or gonad tissues. One interpretation of these results is that the corticosteroid production of the sea lamprey, one of the oldest extant vertebrates, is regulated through multiple pathways rather than the classical HPI-axis. However, the responsiveness of this steroid to the GnRH peptides means that a reproductive rather than a stress role for this steroid cannot yet be ruled out.
International Nuclear Information System (INIS)
Ciereszko, Andrzej; Wolfe, Tobie D.; Dabrowski, Konrad
2005-01-01
In this study we sought to demonstrate that Comet assay can be applied to sea lamprey sperm DNA fragmentation and used to describe the relationship between sperm DNA damage and sperm fertilizing ability. We show that the assay can be used reliably and accurately, and unlike in the case of mammals, there is no need for additional steps related to improvement of efficacy of lysis and DNA decondensation. This agrees with the presence of histone proteins in lamprey sperm. An increase in DNA fragmentation was noted during short-term storage of milt on ice (0-4 days). We demonstrated genotoxic effects of UV radiation and oxidative stress (exposure to hydrogen peroxide) and found that oxidative damage to sperm DNA was likely repaired after fertilization in the embryo. Repairing capacity of the oocyte toward sperm DNA lesions caused by UV was restricted. Toxic effect of p,p-bis-(1-aziridinyl)-N-methylphosphinothioic acid (p,p-bis(1-aziridinyl)-N-methylphosphinothioic amide), a sea lamprey chemosterilant, could not be linked to DNA fragmentation in the in vitro tests. Its genotoxicity in vivo may possibly be associated with other mechanisms of DNA degradation (oxidation or DNA-protein and DNA-DNA cross-linking). In conclusion, this study demonstrates that Comet assay can be successfully applied to monitor effects of environmental disturbances and imposed injuries in sea lamprey spermatozoa and possibly other species of ancient fish with acrosomal sperm
Energy Technology Data Exchange (ETDEWEB)
Ciereszko, Andrzej [School of Natural Resources, Ohio State University, 210 Kottman Hall, 2021 Coffey Rd., Columbus, OH 434210 (United States); Semen Biology Group, Institute of Animal Reproduction and Food Research, Polish Academy of Sciences, 10-747 Olsztyn (Poland); Wolfe, Tobie D. [School of Natural Resources, Ohio State University, 210 Kottman Hall, 2021 Coffey Rd., Columbus, OH 434210 (United States); Dabrowski, Konrad [School of Natural Resources, Ohio State University, 210 Kottman Hall, 2021 Coffey Rd., Columbus, OH 434210 (United States)]. E-mail: dabrowski.1@osu.edu
2005-06-15
In this study we sought to demonstrate that Comet assay can be applied to sea lamprey sperm DNA fragmentation and used to describe the relationship between sperm DNA damage and sperm fertilizing ability. We show that the assay can be used reliably and accurately, and unlike in the case of mammals, there is no need for additional steps related to improvement of efficacy of lysis and DNA decondensation. This agrees with the presence of histone proteins in lamprey sperm. An increase in DNA fragmentation was noted during short-term storage of milt on ice (0-4 days). We demonstrated genotoxic effects of UV radiation and oxidative stress (exposure to hydrogen peroxide) and found that oxidative damage to sperm DNA was likely repaired after fertilization in the embryo. Repairing capacity of the oocyte toward sperm DNA lesions caused by UV was restricted. Toxic effect of p,p-bis-(1-aziridinyl)-N-methylphosphinothioic acid (p,p-bis(1-aziridinyl)-N-methylphosphinothioic amide), a sea lamprey chemosterilant, could not be linked to DNA fragmentation in the in vitro tests. Its genotoxicity in vivo may possibly be associated with other mechanisms of DNA degradation (oxidation or DNA-protein and DNA-DNA cross-linking). In conclusion, this study demonstrates that Comet assay can be successfully applied to monitor effects of environmental disturbances and imposed injuries in sea lamprey spermatozoa and possibly other species of ancient fish with acrosomal sperm.
Mwedzi, Tongayi; Bere, Taurai; Mangadze, Tinotenda
2016-06-01
The study evaluated the response of macroinvertebrate assemblages to changes in water quality in different land-use settings in Manyame catchment, Zimbabwe. Four land-use categories were identified: forested commercial farming, communal farming, Great Dyke mining (GDM) and urban areas. Macroinvertebrate community structure and physicochemical variables data were collected in two seasons from 41 sites following standard methods. Although not environmentally threatening, urban and GDM areas were characterised by higher conductivity, total dissolved solids, salinity, magnesium and hardness. Chlorides, total phosphates, total nitrogen, calcium, potassium and sodium were significantly highest in urban sites whilst dissolved oxygen (DO) was significantly higher in the forested commercial faming and GDM sites. Macroinvertebrate communities followed the observed changes in water quality. Macroinvertebrates in urban sites indicated severe pollution (e.g. Chironomidae) whilst those in forested commercial farming sites and GDM sites indicated relatively clean water (e.g. Notonemouridae). Forested watersheds together with good farm management practices are important in mitigating impacts of urbanisation and agriculture. Strategies that reduce oxygen-depleting substances must be devised to protect the health of Zimbabwean streams. The study affirms the wider applicability of the South African Scoring System in different land uses.
Biology and chemistry of three Pennsylvania lakes: responses to acid precipitation
Energy Technology Data Exchange (ETDEWEB)
Bradt, P.T.; Dudley, J.L.; Berg, M.B.; Barrasso, D.S.
1986-09-01
The biology and chemistry of three northeastern Pennsylvania lakes was studied from summer 1981 through summer 1983 to evaluate lakes with different sensitivities to acidification. At the acidified lake there were fewer phytoplankton and zooplankton species than at the moderately sensitive lakes. The most numerous plankton species in all three lakes are reportedly acid tolerant. Among the benthic macro-invertebrates (BMI) there were more acid tolerant Chironomidae at the acidified lake, but more acid intolerant Ephemeroptera and Mollusca and a higher wet weight at the least sensitive lake. There were no differences among the lakes' BMI mean total numbers or mean number of taxa. The fish community at the acidified lake was dominated by stunted Lepomis gibbosus, but L. machrochirous were most abundant in the other lakes. Principal component analysis suggested a shift in all three lakes over the sampling period toward combined lower pH, alkalinity, specific conductance, Ca and Mg and higher Al and Mn. Such chemical changes have been associated with acidification. The rate and extent of acidification appeared to be controlled by geological and hydrological characteristics of the drainage basins. 38 refs.
Energy Technology Data Exchange (ETDEWEB)
Richardson, J.S.; Kiffney, P.M.
2000-03-01
Metal contamination is one of the most widespread impacts on surface waters. Experimental flumes receiving water and aquatic invertebrates from an undisturbed, forested stream were used to determine the impact of metals in a low-conductivity stream. The experimental flumes were exposed to a gradient of doses maintaining a constant ratio of metals (1995: Cu, Zn, Mn, and Pb; 1996: Cu and Zn) for 6 d. Benthos and emigration were sampled from each of the 16 troughs. The overall densities of benthos declined, but not significantly, as the dose of metals increased. On the basis of the slopes of the concentration-response curve, Baetis, Ameletus, and Paraleptophlebia were the most sensitive taxa present. Other taxa (e.g., Nemouridae and Oligochaeta) were mildly affected by high metal concentrations. Chironomidae showed no significant decrease in densities with increasing dose. Chironomids made up >80% of the benthos and is the primary reason for no significant dose effect on overall densities. No treatment effect was observed on either algal standing crop or bacterial respiration rates. The invertebrate genera most affected by exposure to metals in this study were also absent or rare in nearby urban streams with high metal concentrations.
RESEARCH ON THE ENVIRONMENTAL QUALITY IN BRATIA RIVER
Directory of Open Access Journals (Sweden)
Alina - Mihaela Truţă
2017-12-01
Full Text Available The main purpose of the study was to determine the quality of Bratia River. The present paper was based on the bibliographic material as well as the field research carried out during 2016-2017. The research objectives were the following: identification of qualitative and quantitative structure of phytobenthic biocenoses in the established monitoring points; determination of the phytoplankton algae families in the monitoring stations; identification of the structure of benthic biocenoses in the monitoring points; establishing saprobity indices for each species identified and incorporation of the monitoring sections into the appropriate saprobity class; determining the quality of Bratia River according to the Water Framework Directive 2000/60/EU. We have identified 54 species in the phytobenthonic samples, grouped in three phyla: Cyanobacteria, Bacillariophyta and Chlorophyta. We have also identified 47 species in the structure of benthic zoocenosis belonging to 25 families from 8 genera. The main benthic invertebrate groups in the Bratia River were: Ephemeroptera, Plecoptera, Chironomidae, Trichoptera, and Gammaridae. Oboarele Mari and Gămăceşti recorded a high quality ecological status, while Berevoiesti station had a good ecological status.
Effect of habitat improvement on Atlantic salmon in the regulated river Suldalslaagen
Energy Technology Data Exchange (ETDEWEB)
Raastad, J.E.; Lillehammer, A.; Lillehammer, L. (Oslo Univ. (Norway). Zoological Museum); Kaasa, H. (Statkraft, Hoevik (Norway)); Eie, J.A. (Norwegian Water Resources and Energy Administration, Oslo (Norway))
1993-05-01
The River Suldaalslagen, which holds a population of large Atlantic salmon, has been regulated twice for hydropower production. The first regulation occurred in 1968 and the second in 1980. Present problems include the reduced density of benthic fauna, the reduced growth rate of young salmon, the low survival of 0[sup +] fish and the increased time required for smoltification. A programme of habitat restoration includes building a rearing channel system where water flow and the substrate can be controlled. The salmon fry are stocked in the rearing channel and in an adjacent tributary stream. The effects on macrobenthos of introduced dead organic material were also studied. Improvement of physical habitat increased the density of benthic animals, and the survival of 1[sup +] salmon was about 30%. Experiments that included adding 115 g wheat/m[sup 2] resulted in a threefold increase in benthic fauna compared with a control area. The largest increase in numbers was Chironomidae in August-September, when benthic Crustacea also showed a significant increase. An increase in macrobenthos is expected to increase the growth and survival of young salmon fry. (Author)
Directory of Open Access Journals (Sweden)
Fernando G. Spaccesi
2012-01-01
Full Text Available The structure and composition of benthic communities on hard substrates covered by the nonindigenous bivalve Limnoperna fortunei Dunker, the golden mussel, were quantified in the middle zone of the Río de la Plata Estuary (Argentina from April 2001 through March 2002. A total of 26 taxa were recorded. L. fortunei and Nematoda were the central and dominant groups, with a prodigious abundance of over 80%. The prevalence of L. fortunei, rather than the environmental variables, regulated the dynamics of the associated invertebrate fauna. The golden mussel alters both the structure and function of benthic native communities on hard substrates, allows a higher surface available for colonization and refuge, and provides food source to deposit-feeding organisms in the form of organic or residual material. The mussel also increases the abundance and diversity of taxa on hard substrata - such as Oligochaeta, Hirudinea, Tardigrada, Chironomidae, Copepoda, Tanaidacea, and Hydrachnidia. Similarities and nonparametric multidimensional-scaling analyses indicated that the benthic composition had a seasonal variation. L. fortunei has an environmental impact, an ability to invade new freshwater ambiences worldwide and ecological characteristic comparable to those of Dreissena polymorpha Pallas (the zebra mussel of North America and Europe.
Influence of acidification and aluminium on the density and biomass of lotic benthic invertebrates
Energy Technology Data Exchange (ETDEWEB)
Allard, M.; Moreau, G.
1986-10-01
Experiments were carried out in plasticized wooden channels fed by a small creek in the Reserve des Laurentides, 80 km north of Quebec city. Channels were naturally colonized by invertebrates for 65 d before treatment. Treated channels were acidified in August with dilute H/sub 2/SO/sub 4/ only, or with acid plus a solution of Al sulfate (final concentration of 0.19 mg L/sup -1/). The control channel received creek water only (pH 6.3 to 6.9). The addition of Al had no effect on invertebrate density and biomass. After 73 d of acidification, invertebrate densities were only one third the number found in the control channel. Invertebrate biomass was not different within channels, although biomass was generally higher in the two acidified channels. Difference in densities between acidified and non-acidified channels was attributed to lack of colonization and not to an increase in drift. Microtendipes, a large and resistant larva of Chironomidae constituted a large fraction of the biomass, largely outweighing numerous very small larvae. Effects on the density were attributed to the direct effect of low pH and not to indirect action through food limitations. 22 refs.
Energy Technology Data Exchange (ETDEWEB)
Bradt, P.T.; Dudley, J.L.; Berg, M.B.; Barrasso, D.S.
1986-01-01
The biology and chemistry of three northeastern Pennsylvania lakes was studied from summer 1981 through summer 1983 to evaluate lakes with different sensitivities to acidification. At the acidifies lake (total alkalinity par. delta 0.0 ..mu..eq L/sup -1/) there were fewer phytoplankton and zooplankton species than at the moderately sensitive lakes. The most numerous plankton species in all three lakes are reportedly acid tolerant. Among the benthic macro- invertebrates (BMI) there were more acid tolerant Chironomidae at the acidified lake, but more acid intolerant Ephemeroptera and Mollusca and a higher wet weight at the least sensitive lake. There were no differences among the lakes' BMI mean total numbers or mean number of taxa. The fish community at the acidified lake was dominated by stunted Lepomis gibbosus, but L. machrochirous were most abundant in the other lakes. Principal component analysis suggested a shift in all three lakes over the sampling period toward combined lower pH, alkalinity, specific conductance, Ca, and Mg and higher Al and Mn. Such chemical changes have been associated with acidification. The rate and extent of acidification appeared to be controlled by geological and hydrological characteristics of the drainage basins.
Directory of Open Access Journals (Sweden)
Cristina da Silva Gonçalves
Full Text Available Most Rivulidae fishes are popularly known as annual fishes which live in ephemeral environments such as pools, that obligatorily dry out seasonally causing the death of adult individuals. They have unique biological characteristics such as small body size, early sexual maturation, continuous reproduction, an elaborated courtship behavior, and a great reproductive capacity among fishes. The rivulids are widely distributed in North, Central and South America. In this study, the diet and reproductive biology of Cynopoecilus melanotaenia was analyzed. A total of 263 specimens were collected and the analysis of 233 gastrointestinal contents revealed an invertivorous diet composed mainly of small crustaceans (Cladocera, Amphipoda, and Ostracoda and immature insects (Chaoboridae, Culicidae, Syrphidae, but mainly Chironomidae larvae. Lepidophagy on male's diet was also registered. Fecundity was estimated by analyzing 59 pairs of mature ovaries and ranged from 2 to 157 oocytes (mean, 19 ± 26[SD]. The species has fractional spawning, a strategy to increase the chance of survival to prolonged depletions. This study is the first to investigate the reproductive biology of C. melanotaenia. The results confirmed the opportunistic character of the rivulid C. melanotaenia and provided unreported reproductive information that may aid conservation of the species.
Directory of Open Access Journals (Sweden)
Francisco Guerrero-Bolaño
2003-07-01
Full Text Available On July 2002, a study of some physicochemical parameters and their relationship with the benthonic macroinvertebrates community structure on four coriotypes: stone, trash, silt and macrophytes, was carried out in Pozo Azul (Gaira River basin, Magdalena, Colombia. The physicochemical parameters were determined, to a considerable extent, by the geographic characteristics of the system. The water was found to be oxygen saturated, and intermediate compounds of the organic matter stabilization, such as nitrites and ammonium, there were found 588 individuals distributed in 11 orders and 38 families. The most representative orders were Trichoptera, Coleoptera, Diptera and Ephemeroptera. The most representative families were Baetidae, Simullidae, Perlidae, Chironomidae, and Hydropsychidae, in this rank of abundance. The BMWP index for the relationship between the community structure and the water quality (adapted by Universidad del Valle, Cali, Colombia was calculated. According to this index the water quality was optimum. Also, given the general characteristics of the site studied, the water mass quality was classified as good and oligosaprobit, based on the saprobit ecology. It is possible that this state was reached due to stabilization after a small perturbation induced by coffee cultivation in the zone.
Effects of logging on macroinvertebrates in streams with and without buffer strips
Energy Technology Data Exchange (ETDEWEB)
Newbold, J D; Erman, D C; Roby, K B
1980-01-01
The impact of logging with and without buffer strip protection on stream macroinvertebrates was examined through comparisons of community structure in commercially logged and control watersheds throughout northern California. A nonparametric test of community dissimilarities within matched blocks of two control and one or two treated stations showed significant (P < 0.05) logging effects on unprotected streams when Euclidean distance and mutual information were used as dissimilarity indices, but not when chord distance was used. Shannon diversity in unprotected streams was lower (P < 0.01) than in control (unlogged) streams; densities of total macroinvertebrate fauna and of Chironomidae, Baetis, and Nemoura were higher in unprotected streams than in controls (P <0.05). Streams with narrow buffer strips (<30 m) showed significant effects by the Euclidean distance test, but diversity varied widely and was not significantly different from that in either unprotected or control streams than in controls (P < 0.05). Macroinvertebrate communities in streams with wide buffers (greater than or equal to 30m) could not be distinguished from those of controls by either Euclidean distance or diversity; however, diversity in wide-buffered streams was significantly greater than in streams without buffer strips, indicating effective protection from logging effects.
Structure of the macrozoobenthos as an indicator of different types of pollution in running waters
Directory of Open Access Journals (Sweden)
Simić Vladica M.
2002-01-01
Full Text Available Hydrobiological research on streams with different dominant forms of pollution (anthropogenic eutrophication, organic pollution, toxic pollution, trans-saprobic pollution in the central part of the Balkan Peninsula (territory of Serbia and Montenegro indicates that these different forms of pollution can be detected on the basis of structure of the macrozoobenthos community and individual indicator taxa. It is established from the obtained results that the greatest community diversity occurs in the case of anthropogenic eutrophication or weak organic pollution as a dominant process, where phytophilous and/or detritophagic forms (Cloeon, Polypedilum, Asellus, Stylaria, Erpobdella, Gammarus are dominant in the community. In the cases of very strong organic pollution, the macrozoobenthos community is characterized by mass development of certain taxa of the group Oligochaeta (Tubificidae and Chironomidae larvae {Chironomus gr. thummi. Depending on the strength and contribution of organic, toxic, and/or transsaprobic components, toxic pollution and mixed pollution arc characterized by a more or less heterogeneous and nonspecific population. However, a common feature is the presence of a small number of taxa with populations of a relatively low density, or the occurrence of individual specimens belonging to different groups of animals.
International Nuclear Information System (INIS)
Guerrero Bolano, Francisco; Manjares Hernandez, Ana; Nunez Padilla, Norbelis
2003-01-01
On July 2002, a study of some physicochemical parameters and their relationship with the benthonic macro invertebrates community structure on four coriotypes: stone, trash, silt and macrophytes, was carried out in Pozo Azul (Gaira River Basin, Magdalena, Colombia). The physicochemical parameters were determined, to a considerable extent, by the geographic characteristics of the system. The water was found to be oxygen saturated, and intermediate compounds of the organic matter stabilization, such as nitrites and ammonium, there were found 588 individuals distributed in 11 orders and 38 families. The most representative orders were trichoptera, coleoptera, diptera and ephemeroptera. The most representative families were baetidae, simullidae, perlidae, chironomidae, and hydropsychidae, in this rank of abundance. The BMWP index for the relationship between the community structure and the water quality (adapted by Universidad del Valle, Cali, Colombia) was calculated. According to this index the water quality was optimum. Also, given the general characteristics of the site studied, the water mass quality was classified as good and oligosaprobit, based on the saprobit ecology. It is possible that this state was reached due to stabilization after a small perturbation induced by coffee cultivation in the zone
Biodiversity of benthic macroinvertebrates in Air Terjun Asahan, Asahan, Melaka, Malaysia
Nurhafizah-Azwa, S.; Ahmad A., K.
2016-11-01
A study on benthic macroinvertebrate diversity was conducted at Air Terjun Asahan, Asahan, Melaka. Five stations were selected with distance intervals of approximately 500 metres. Three replicates of benthic macroinvertebrate and water samples were taken. Results classified Air Terjun Asahan in class II, which indicated good water quality based on WQI recommended by the Department of Environment. A total of 1 phylum, 2 classes, 6 order, 30 families, and 2183 individuals were successfully sampled and recorded. The analysis showed that the average value of Shannon Diversity Index, H' (2.19), Pielou Evenness Index, J' (0.30), and Margaleff Richness Index, DMG (3.77) described that Air Terjun Asahan was in moderate condition and the distribution of macroinvertebrates was uniform between stations. Correlation test showed that the WQI had a strong relationship with the diversity indices involved. BMWP, and FBI showed that Air Terjun Asahan was in good water quality. CCA test was conducted to show environmental factors towards benthic macroinvertebrate distribution. The presence of Leptophlebiidae, Baetidae, Heptageniidae and Chironomidae with high abundance of the families showed the potential as biological indicators of a clean ecosystem.
May, Thomas W.; Walther, Michael J.; Saiki, Michael K.; Brumbaugh, William G.
2009-01-01
This report presents the results for two sampling periods (October 2008 and January 2009) during a 4-year monitoring program to characterize selenium concentrations in selected irrigation drains flowing into the Salton Sea, California. Total selenium, selenium species (dissolved selenite, selenate, organoselenium), and total suspended solids were determined in water samples. Total selenium also was determined in water column particulates and in sediment, detritus, and biota that included algae, plankton, midge larvae (family, Chironomidae), and two fish species (western mosquitofish, Gambusia affinis, and sailfin molly, Poecilia latipinna). In addition, sediments were analyzed for percent total organic carbon and particle size. Mean total selenium concentrations in water for both sampling periods ranged from 1.00 to 33.6 micrograms per liter, predominately as selenate, which is typical of waters where selenium is leached out of selenium-containing marine shales and associated soils under alkaline and oxidizing conditions. Total selenium concentrations (micrograms per gram dry weight) ranged as follows: algae, 1.52 to 8.26; plankton, 0.79 to 3.66; midges, 2.68 to 50.6; fish, 3.09 to 30.4; detritus, 1.78 to 58.0; and sediment, 0.42 to 10.0.
May, Thomas W.; Walther, Michael J.; Saiki, Michael K.; Brumbaugh, William G.
2009-01-01
This report presents the results for two sampling periods (April 2008 and July 2008) during a 4-year monitoring program to characterize selenium concentrations in selected irrigation drains flowing into the Salton Sea, California. Total selenium, selenium species (dissolved selenite, selenate, organoselenium), and total suspended solids were determined in water samples and total selenium was determined in water column particulates and in sediment, detritus, and biota that included algae, plankton, midge larvae (family, Chironomidae), and two fish species - western mosquitofish (Gambusia affinis) and sailfin molly (Poecilia latipinna). In addition, sediments were analyzed for percent total organic carbon and particle size. Mean total selenium concentrations in water for both sampling periods ranged from 1.93 to 44.2 micrograms per liter, predominately as selenate, which is typical of waters where selenium is leached out of selenium-containing marine shales and associated soils under alkaline and oxidizing conditions. Total selenium concentrations (micrograms per gram dry weight) ranged as follows: algae, 0.75 to 3.39; plankton, 0.88 to 4.03; midges, 2.52 to 44.3; fish, 3.37 to 18.9; detritus, 1.11 to 13.6; sediment, 0.11 to 8.93.
May, Thomas W.; Walther, Michael J.; Saiki, Michael K.; Brumbaugh, William G.
2008-01-01
This report presents the results for two sampling periods (October 2007 and January 2008) during a 4-year monitoring program to characterize selenium concentrations in selected irrigation drains flowing into the Salton Sea, California. Total selenium, selenium species (selenite, selenate, organoselenium), and total suspended solids were determined in water samples, and total selenium was determined in sediment, detritus, and biota that included algae, plankton, midge larvae (family, Chironomidae), and two fish species?western mosquitofish (Gambusia affinis) and sailfin molly (Poecilia latipinna). In addition, sediments were analyzed for percent total organic carbon and particle size. Mean total selenium concentrations in water for both sampling periods ranged from 0.97 to 64.5 micrograms per liter, predominately as selenate, which is typical of waters where selenium is leached out of selenium-containing marine shales and associated soils under alkaline and oxidizing conditions. Total selenium concentrations (micrograms per gram dry weight) ranged as follows: algae, 0.95 to 5.99; plankton, 0.15 to 19.3; midges, 1.39 to 15.4; fish, 3.71 to 25.1; detritus, 0.85 to 21.7; sediment, 0.32 to 7.28.
Lake Ontario: Food web dynamics in a changing ecosystem (1970-2000)
Mills, E.L.; Casselman, J.M.; Dermott, R.; Fitzsimons, J.D.; Gal, G.; Holeck, K. T.; Hoyle, J.A.; Johannsson, O.E.; Lantry, B.F.; Makarewicz, J.C.; Millard, E.S.; Munawar, I.F.; Munawar, M.; O'Gorman, R.; Owens, R.W.; Rudstam, L. G.; Schaner, T.; Stewart, T.J.
2003-01-01
We examined stressors that have led to profound ecological changes in the Lake Ontario ecosystem and its fish community since 1970. The most notable changes have been reductions in phosphorus loading, invasion by Dreissena spp., fisheries management through stocking of exotic salmonids and control of sea lamprey (Petromyzon marinus), and fish harvest by anglers and double-crested cormorants (Phalacrocorax auritus). The response to these stressors has led to (i) declines in both algal photosynthesis and epilimnetic zooplankton production, (ii) decreases in alewife (Alosa pseudoharengus) abundance, (iii) declines in native Diporeia and lake whitefish (Coregonus clupeaformis), (iv) behavioral shifts in alewife spatial distribution benefitting native lake trout (Salvelinus namaycush), threespine stickleback (Gasterosteus aculeatus), and emerald shiner (Notropis atherinoides) populations, (v) dramatic increases in water clarity, (vi) predation impacts by cormorants on select fish species, and (vii) lake trout recruitment bottlenecks associated with alewife-induced thiamine deficiency. We expect stressor responses associated with anthropogenic forces like exotic species invasions and global climate warming to continue to impact the Lake Ontario ecosystem in the future and recommend continuous long-term ecological studies to enhance scientific understanding and management of this important resource.
Templeton, Thomas J.; Pain, Arnab
2015-01-01
The recent completion of high-coverage draft genome sequences for several alveolate protozoans – namely, the chromerids, Chromera velia and Vitrella brassicaformis ; the perkinsid Perkinsus marinus ; the apicomplexan, Gregarina niphandrodes , as well as high coverage transcriptome sequence information for several colpodellids, allows for new genome-scale comparisons across a rich landscape of apicomplexans and other alveolates. Genome annotations can now be used to help interpret fine ultrastructure and cell biology, and guide new studies to describe a variety of alveolate life strategies, such as symbiosis or free living, predation, and obligate intracellular parasitism, as well to provide foundations to dissect the evolutionary transitions between these niches. This review focuses on the attempt to identify extracellular proteins which might mediate the physical interface of cell–cell interactions within the above life strategies, aided by annotation of the repertoires of predicted surface and secreted proteins encoded within alveolate genomes. In particular, we discuss what descriptions of the predicted extracellular proteomes reveal regarding a hypothetical last common ancestor of a pre-apicomplexan alveolate – guided by ultrastructure, life strategies and phylogenetic relationships – in an attempt to understand the evolution of obligate parasitism in apicomplexans.
Templeton, Thomas J.
2015-11-20
The recent completion of high-coverage draft genome sequences for several alveolate protozoans – namely, the chromerids, Chromera velia and Vitrella brassicaformis ; the perkinsid Perkinsus marinus ; the apicomplexan, Gregarina niphandrodes , as well as high coverage transcriptome sequence information for several colpodellids, allows for new genome-scale comparisons across a rich landscape of apicomplexans and other alveolates. Genome annotations can now be used to help interpret fine ultrastructure and cell biology, and guide new studies to describe a variety of alveolate life strategies, such as symbiosis or free living, predation, and obligate intracellular parasitism, as well to provide foundations to dissect the evolutionary transitions between these niches. This review focuses on the attempt to identify extracellular proteins which might mediate the physical interface of cell–cell interactions within the above life strategies, aided by annotation of the repertoires of predicted surface and secreted proteins encoded within alveolate genomes. In particular, we discuss what descriptions of the predicted extracellular proteomes reveal regarding a hypothetical last common ancestor of a pre-apicomplexan alveolate – guided by ultrastructure, life strategies and phylogenetic relationships – in an attempt to understand the evolution of obligate parasitism in apicomplexans.
Impacts of aquatic nonindigenous invasive species on the Lake Erie ecosystem
Austen, Madeline J.W.; Ciborowski, Jan J.H.; Corkum, Lynda D.; Johnson, Tim B.; MacIsaac, Hugh J.; Metcalfe-Smith, Janice L.; Schloesser, Donald W.; George, Sandra E.
2002-01-01
Lake Erie is particularly vulnerable to the introduction and establishment of aquatic nonindigenous invasive species (NIS) populations. A minimum of 144 aquatic NIS have been recorded in the Lake Erie basin including several species [e.g., Eurasian watermilfoil (Myriophyllum spicatum); zebra mussel (Dreissena polymorpha); quagga mussel (Dreissena bugensis); an amphipod (Echinogammarus ischnus); round goby (Neogobius melanostomus); and sea lamprey (Petromyzon marinus)] that have had discernible impacts on the lake's ecology. NIS pose threats to the Lake Erie ecosystem for a variety of reasons including their ability to proliferate quickly, compete with native species, and transfer contaminants (e.g., PCBs) and disease through the food web. Six of the 14 beneficial use impairments listed in Annex 2 of the Great Lakes Water Quality Agreement are impaired in Lake Erie, in part as a result of the introduction of NIS. The Lake Erie Lakewide Management Plan (LaMP) has adopted an ecosystem approach to restore beneficial use impairments in the lake. Furthermore, a research consortium, known as the Lake Erie Millennium Network, is working alongside the LaMP, to address research problems regarding NIS, the loss of habitat, and the role of contaminants in the Lake Erie ecosystem.
Influence of on-board irradiation on the shelflife of redfish. Pt. 2
International Nuclear Information System (INIS)
Karnop, G.; Antonacopoulos, N.; Muenzer, R.
1978-01-01
Bacteriological and chemical investigations on extending the shelflife of fresh iced unpacked redfish (Sebastes marinus) be 100 krad irradiation were carried out during two voyages of RV 'Anton Dohrn'. Bacteriological criteria indicated no shelflife extension on one voyage and an extension by 5 - 7 days on the other voyage. Chemical indices indicated an extension of 4 - 6 and more then 10 days, respectively. Delayed irradiation after 7 days storage in ice influenced only the chemical values (4 - 6 days shelflife extension), while reirradiation on the 6th day affected both the bacteriological (some days extension) and the chemical values (more than 10 days extension). The greatest effect was obtained with whole fish irradiated and stored in plastic bags, which - due to the dominance of biologically largely inactive Moraxella sp. - on the 28th day showed nearly the initial chemical values. Together with the previously published sensoric findings (13) these results indicate no or only a slight prolongation of shelflife of unpacked iced redfish due to irradiation at once or on the 7th day or both at once and on the 7th day. (orig.) [de