Cloverleaf skull with generalised bone dysplasia
International Nuclear Information System (INIS)
Kozlowski, K.; Warren, P.S.; Fisher, C.C.; Royal Hospital for Women, Camperdown
1985-01-01
A case of cloverleaf skull with generalised bone dysplasia is reported. The authors believe that bone dysplasia associated with cloverleaf is neither identical with thanatophoric dysplasia nor achondroplasia. Until identity of thanatophoric dysplasia and cloverleaf skull with generalised bone dysplasia is proved the diseases should be looked upon as separate entities and the wording ''thanatophoric dysplasia with cloverleaf skull'' should be abolished. (orig.)
Cloverleaf skull with generalised bone dysplasia
Energy Technology Data Exchange (ETDEWEB)
Kozlowski, K.; Warren, P.S.; Fisher, C.C.
1985-09-01
A case of cloverleaf skull with generalised bone dysplasia is reported. The authors believe that bone dysplasia associated with cloverleaf is neither identical with thanatophoric dysplasia nor achondroplasia. Until identity of thanatophoric dysplasia and cloverleaf skull with generalised bone dysplasia is proved the diseases should be looked upon as separate entities and the wording ''thanatophoric dysplasia with cloverleaf skull'' should be abolished.
ESO & NOT photometric monitoring of the Cloverleaf quasar
Ostensen, R; Remy, M; Lindblad, PO; Refsdal, S; Stabell, R; Surdej, J; Barthel, PD; Emanuelsen, PI; Festin, L; Gosset, E; Hainaut, O; Hakala, P; Hjelm, M; Hjorth, J; Hutsemekers, D; Jablonski, M; Kaas, AA; Kristen, H; Larsson, S; Magain, P; Pettersson, B; Pospieszalska-Surdej, A; Smette, A; Teuber, J; Thomsen, B; Van Drom, E
1997-01-01
The Cloverleaf quasar, H1413+117, has been photometrically monitored at ESO (La Silla, Chile) and with the NOT (La Palma, Spain) during the period 1987-1994. All good quality CCD frames have been successfully analysed using two independent methods (i.e. an automatic image decomposition technique and
EMP protection technology interchange
International Nuclear Information System (INIS)
Martin, L.C.
1977-01-01
Investigation and assessment of the potential degrading and destructive effects associated with the nuclear electromagnetic (EMP) phenomena has created a large technological base. This base is indeed quite broad owing to the unique and system-pervasive character of the EMP. One of the aims of an emerging discipline, such as that associated with EMP, is to provide for adequate transfer and integration of the developing technology into the overall engineering community. The needs of the community and how EMP hardening and protection information can be transferred or exchanged are reviewed. Many of the current and generally available sources of information are listed, examples of interchange methods are provided, and problems of developing specifications, standards, and suitable guidelines for design and incorporation of protection are also discussed
International Nuclear Information System (INIS)
Scheffel, J.
1989-05-01
This is a non-linear MHD study of Extrap interchange stability. The closed-line stability criterion d(pgγ)/dψ ≥ 0 is used for fully 2-D numerical calculations of marginally stable equilibria. It is found that Extrap has a stabilzing effect on these modes. The reason for this is that q = Ιdl/B diverges towards the separatrix, which forms a boundary for the pinch. Consequently, in comparison with the 1-D Z-pinch, the Extrap octupole field allows steeper pressure profile in the boundary region. This stabilizing effect is shown to diminish in equilibria with an externally imposed axial magnetic field. It is also shown how the shape of the plasma cross-section depends on the relative direction of plasma current and external rod currents, when the current density j is finite on the boundary. Unfavourable curvature and higher values of j at the boundary are obtained in the case of parallel currents. Only when j vanishes at the separatrix, the cross-section can be truly square-shaped. The type of singularity of q at the separatrix is derived, as well as criteria for j to become singular
Tonni, Gabriele; Palmisano, Marcella; Ginocchi, Vladimiro; Ventura, Alessandro; Baldi, Maurizia; Baffico, Ave Maria
2014-11-01
Prenatal diagnosis of thanatophoric dysplasia (TD) type II presenting in the first trimester with increased nuchal translucency (NT) and cloverleaf skull (Kleeblattschaedel) have been scantly reported in the medical record. Abnormal choroid plexus has been seen in association with fetal anomalies. Here we described a case of increased NT associated with indented choroid plexuses, early onset hydrocephalus and cloverleaf skull in a fetus subsequently diagnosed at early second trimester to carry a de novo mutation encoding for TD type II. The findings of dysmorphic choroid plexus, early onset hydrocephalus and cloverleaf skull at first trimester scan may be early, useful ultrasound markers of TD type II. Molecular analysis to control for possible overlapping syndromes were performed and resulted negative. Postmortem X-ray and 3D-CT scan confirmed the cloverleaf skull, narrow thorax, straight femur with rhizomelic shortening of the limbs and the presence of a communicating hydrocephalus. © 2014 Japanese Teratology Society.
Information interchange system and apparatus
2013-01-01
To overcome the drawback of difficulties when interchanging a patient's health record among different health information management systems and yet keep the patient's privacy, this invention proposes a method comprising the steps of: extracting, from a certificate, a signature of a first service
Directory of Open Access Journals (Sweden)
Qian Feng
Full Text Available Upon viral infections, pattern recognition receptors (PRRs recognize pathogen-associated molecular patterns (PAMPs and stimulate an antiviral state associated with the production of type I interferons (IFNs and inflammatory markers. Type I IFNs play crucial roles in innate antiviral responses by inducing expression of interferon-stimulated genes and by activating components of the adaptive immune system. Although pegylated IFNs have been used to treat hepatitis B and C virus infections for decades, they exert substantial side effects that limit their use. Current efforts are directed toward the use of PRR agonists as an alternative approach to elicit host antiviral responses in a manner similar to that achieved in a natural infection. RIG-I is a cytosolic PRR that recognizes 5' triphosphate (5'ppp-containing RNA ligands. Due to its ubiquitous expression profile, induction of the RIG-I pathway provides a promising platform for the development of novel antiviral agents and vaccine adjuvants. In this study, we investigated whether structured RNA elements in the genome of coxsackievirus B3 (CVB3, a picornavirus that is recognized by MDA5 during infection, could activate RIG-I when supplied with 5'ppp. We show here that a 5'ppp-containing cloverleaf (CL RNA structure is a potent RIG-I inducer that elicits an extensive antiviral response that includes induction of classical interferon-stimulated genes, as well as type III IFNs and proinflammatory cytokines and chemokines. In addition, we show that prophylactic treatment with CVB3 CL provides protection against various viral infections including dengue virus, vesicular stomatitis virus and enterovirus 71, demonstrating the antiviral efficacy of this RNA ligand.
Interchange Recognition Method Based on CNN
Directory of Open Access Journals (Sweden)
HE Haiwei
2018-03-01
Full Text Available The identification and classification of interchange structures in OSM data can provide important information for the construction of multi-scale model, navigation and location services, congestion analysis, etc. The traditional method of interchange identification relies on the low-level characteristics of artificial design, and cannot distinguish the complex interchange structure with interference section effectively. In this paper, a new method based on convolutional neural network for identification of the interchange is proposed. The method combines vector data with raster image, and uses neural network to learn the fuzzy characteristics of the interchange, and classifies the complex interchange structure in OSM. Experiments show that this method has strong anti-interference, and has achieved good results in the classification of complex interchange shape, and there is room for further improvement with the expansion of the case base and the optimization of neural network model.
Kinetic features of interchange turbulence
International Nuclear Information System (INIS)
Sarazin, Y; Grandgirard, V; Fleurence, E; Garbet, X; Ghendrih, Ph; Bertrand, P; Depret, G
2005-01-01
Non-linear gyrokinetic simulations of the interchange instability are discussed. The semi-Lagrangian numerical scheme allows one to address two critical points achieved with simulations lasting several confinement times: an accurate statistical analysis of the fluctuations and the back reaction of the turbulence on equilibrium profiles. Zonal flows are found to quench a 2D + 1D interchange turbulence when one of the species has a vanishing response to zonal modes. Conversely, when streamers dominate, the equilibrium profiles are found to be stiff. In the non-linear regime and steady-state turbulence, the distribution function exhibits a significant departure from a Maxwellian distribution. This property is characterized by an expansion on generalized Laguerre functions with a slow decay of the series of moments. This justifies the use of gyrokinetic simulations since a standard fluid approach, based on a limited number of moments, would certainly require a complex closure so as to take into account the impact of these non-vanishing high order moments
Random Interchange of Magnetic Connectivity
Matthaeus, W. H.; Ruffolo, D. J.; Servidio, S.; Wan, M.; Rappazzo, A. F.
2015-12-01
Magnetic connectivity, the connection between two points along a magnetic field line, has a stochastic character associated with field lines random walking in space due to magnetic fluctuations, but connectivity can also change in time due to dynamical activity [1]. For fluctuations transverse to a strong mean field, this connectivity change be caused by stochastic interchange due to component reconnection. The process may be understood approximately by formulating a diffusion-like Fokker-Planck coefficient [2] that is asymptotically related to standard field line random walk. Quantitative estimates are provided, for transverse magnetic field models and anisotropic models such as reduced magnetohydrodynamics. In heliospheric applications, these estimates may be useful for understanding mixing between open and close field line regions near coronal hole boundaries, and large latitude excursions of connectivity associated with turbulence. [1] A. F. Rappazzo, W. H. Matthaeus, D. Ruffolo, S. Servidio & M. Velli, ApJL, 758, L14 (2012) [2] D. Ruffolo & W. Matthaeus, ApJ, 806, 233 (2015)
Bibliographic information interchange with data independence
International Nuclear Information System (INIS)
Macedo, L.F.P. de
1980-01-01
A technique for bibliographic information processing, at the standardized interchange format ISO 2709 or ANSI Z39.2, which allows to obtain programs with data independence is developed. A format definition language and manipulation commands which enable data storage and retrieval at the logical level are specified. With this technique it is possible to implement programs which can accept data from any information system, reducing, therefore, the requirements of a common bibliographic information interchange format. (Author) [pt
Feasibility of automated foundational ontology interchangeability
CSIR Research Space (South Africa)
Khan, ZC
2014-11-01
Full Text Available the Source Domain Ontology (sOd), with the domain knowledge com- ponent of the source ontology, the Source Foundational Ontology (sOf ) that is the foundational ontology component of the source ontology that is to be interchanged, and any equivalence... or subsumption mappings between enti- ties in sOd and sOf . – The Target Ontology (tO) which has been interchanged, which comprises the Target Domain Ontology (tOd), with the domain knowledge component of the target ontology, and the Target Foundational Ontology...
Focus on Nutrition. MCH Program Interchange.
National Center for Education in Maternal and Child Health, Washington, DC.
This issue of the "MCH Program Interchange" describes selected materials and publications in maternal and child health (MCH) nutrition services and programs. The materials were developed by or are available from federal agencies, state and local public health agencies, and voluntary and professional organizations. The information is intended to…
Bioboxes: standardised containers for interchangeable bioinformatics software.
Belmann, Peter; Dröge, Johannes; Bremges, Andreas; McHardy, Alice C; Sczyrba, Alexander; Barton, Michael D
2015-01-01
Software is now both central and essential to modern biology, yet lack of availability, difficult installations, and complex user interfaces make software hard to obtain and use. Containerisation, as exemplified by the Docker platform, has the potential to solve the problems associated with sharing software. We propose bioboxes: containers with standardised interfaces to make bioinformatics software interchangeable.
Hierarchical states in the compositional interchange format
Beohar, H.; Nadales Agut, D.E.; Beek, van D.A.; Cuijpers, P.J.L.; Aceto, L.; Sobocinski, P.
2010-01-01
CIF is a language designed for two purposes, namely as a specification language for hybrid systems and as an interchange format for allowing model transformations between other languages for hybrid systems. To facilitate the top-down development of a hybrid system and also to be able to express
Process mining for electronic data interchange
Engel, R.; Krathu, W.; Zapletal, M.; Pichler, C.; Aalst, van der W.M.P.; Werthner, H.; Huemer, C.; Setzer, T.
2011-01-01
Choreography modeling and service integration received a lot of attention in the last decade. However, most real-world implementations of inter-organizational systems are still realized by traditional Electronic Data Interchange (EDI) standards. In traditional EDI standards, the notion of process or
Design management of electronic data interchange systems
Heck, van H.W.G.M.
1993-01-01
This study deals with the management of the design process of Electronic Data Interchange (EDI) systems. Its objectives are (1) to investigate the design process of EDI systems from a practical and theoretical perspective; (2) to develop a model to describe factors relevant to EDI
Diverging diamond interchange performance evaluation (I-44 and Route 13)
2011-02-01
Performance evaluation was conducted on the first diverging diamond interchange (DDI) or double : crossover interchange (DCD) constructed in the United States. This evaluation assessed traffic operations, safety and : public perceptions t...
Financing mechanisms for capital improvements : interchanges, final report, March 2010.
2010-03-01
This report examines the use of alternative local financing mechanisms for interchange and interchange area infrastructure improvements. The financing mechanisms covered include transportation impact fees, tax increment financing, value capture finan...
Financing mechanisms for capital improvements : interchanges : final report.
2010-03-01
This report examines the use of alternative local financing mechanisms for interchange and interchange area infrastructure improvements. The financing mechanisms covered include transportation impact fees, tax increment financing, value capture finan...
Understanding SOL plasma turbulence by interchange motions
Czech Academy of Sciences Publication Activity Database
Horáček, Jan; Pitts, R. A.; Nielsen, A.H.; Garcia, O.E.
2007-01-01
Roč. 52, č. 16 (2007), s. 192-193 ISSN 0003-0503. [Annual meeting of the division of plasma physics/49th./. Orlando , 12.11.2007-16.11.2007] Grant - others:-(XE) European Training fellowships and Grants (Euratom), EDGETURB Institutional research plan: CEZ:AV0Z20430508 Keywords : tokamak * plasma * scrape-off layer * turbulence * interchange instability Subject RIV: BL - Plasma and Gas Discharge Physics http://meetings.aps.org/Meeting/DPP07/Event/70125
Study of two-dimensional interchange turbulence
International Nuclear Information System (INIS)
Sugama, Hideo; Wakatani, Masahiro.
1990-04-01
An eddy viscosity model describing enstrophy transfer in two-dimensional turbulence is presented. This model is similar to that of Canuto et al. and provides an equation for the energy spectral function F(k) as a function of the energy input rate to the system per unit wavenumber, γ s (k). In the enstrophy-transfer inertial range, F(k)∝ k -3 is predicted by the model. The eddy viscosity model is applied to the interchange turbulence of a plasma in shearless magnetic field. Numerical simulation of the two-dimensional interchange turbulence demonstrates that the energy spectrum in the high wavenumber region is well described by this model. The turbulent transport driven by the interchange turbulence is expressed in terms of the Nusselt number Nu, the Rayleigh number Ra and Prantl number Pr in the same manner as that of thermal convection problem. When we use the linear growth rate for γ s (k), our theoretical model predicts that Nu ∝ (Ra·Pr) 1/2 for a constant background pressure gradient and Nu ∝ (Ra·Pr) 1/3 for a self-consistent background pressure profile with the stress-free slip boundary conditions. The latter agrees with our numerical result showing Nu ∝ Ra 1/3 . (author)
Directory of Open Access Journals (Sweden)
Chih-Ping Chen
2013-09-01
Conclusion: A prenatal diagnosis of cloverleaf skull, short limbs, straight femurs, and occipital pseudoencephalocele should include a differential diagnosis of TD2. A molecular analysis of FGFR3 using uncultured amniocytes is useful for the rapid confirmation of TD2 at prenatal diagnosis.
INTERCHANGE RECONNECTION AND CORONAL HOLE DYNAMICS
International Nuclear Information System (INIS)
Edmondson, J. K.; Antiochos, S. K.; DeVore, C. R.; Lynch, B. J.; Zurbuchen, T. H.
2010-01-01
We investigate the effect of magnetic reconnection between open and closed fields, often referred to as 'interchange' reconnection, on the dynamics and topology of coronal hole boundaries. The most important and most prevalent three-dimensional topology of the interchange process is that of a small-scale bipolar magnetic field interacting with a large-scale background field. We determine the evolution of such a magnetic topology by numerical solution of the fully three-dimensional MHD equations in spherical coordinates. First, we calculate the evolution of a small-scale bipole that initially is completely inside an open field region and then is driven across a coronal hole boundary by photospheric motions. Next the reverse situation is calculated in which the bipole is initially inside the closed region and driven toward the coronal hole boundary. In both cases, we find that the stress imparted by the photospheric motions results in deformation of the separatrix surface between the closed field of the bipole and the background field, leading to rapid current sheet formation and to efficient reconnection. When the bipole is inside the open field region, the reconnection is of the interchange type in that it exchanges open and closed fields. We examine, in detail, the topology of the field as the bipole moves across the coronal hole boundary and find that the field remains well connected throughout this process. Our results, therefore, provide essential support for the quasi-steady models of the open field, because in these models the open and closed flux are assumed to remain topologically distinct as the photosphere evolves. Our results also support the uniqueness hypothesis for open field regions as postulated by Antiochos et al. On the other hand, the results argue against models in which open flux is assumed to diffusively penetrate deeply inside the closed field region under a helmet streamer. We discuss the implications of this work for coronal observations.
Interchange stability of noncircular reversed field pinches
International Nuclear Information System (INIS)
Skinner, D.A.; Prager, S.C.; Todd, A.M.M.
1987-08-01
Interchange (Mercier) stability of toroidal reversed-field-pinch plasmas with noncircular cross-section is evaluated numerically. Marginally stable pressure profiles and beta values are produced. Most shapes, such as indented or vertically elongated, reduce stability by making the net magnetic curvature of the poloidal-field-dominated plasmas yet worse than that of the circle. Horizontally elongated plasmas slightly enhance stability beyond that of the circle as a result of increased shear produced by toroidicity. Such shear enhancement by the toroidal shift of magnetic surfaces might be exploited for future, more comprehensive studies
Comprehensive Evaluation and Classification of Interchange Diagrammatic Guide Signs’ Complexity
Li, Yang; Zhao, Xiaohua; He, Qing; Huang, Lihua; Rong, Jian
2018-01-01
The effectiveness of interchange diagrammatic guide signs has significant meaning in traffic safety and driver’s understanding. This paper presented a comprehensive evaluation and classification of interchange diagrammatic guide signs’ complexity. The effectiveness of interchange diagrammatic guide signs relies on how well road users can understand those diagrams. This study tested 37 types of diagrams on the visual recognition complexity degree in three levels, general level, partial level, ...
Achieving robust interchangeability of test assets in ATE systems
Oblad, R P
1999-01-01
This paper identities the key issues that have made if so difficult to achieve asset interchangeability. Several of the historical attempts to solve the problem of asset interchangeability are described, along with an analysis of the reasons that they did not achieve the expected results. Specific topics that are covered are SCPI, VXIplug&play, IVI, ATLAS, and Measurement Subsystems. Principles associated with the ownership of interfaces will be outlined. Finally, a set of rules and principles will be discussed that must be applied to achieve robust asset interchangeability. Robust is defined as interchangeability that can be "guaranteed" without testing all TPSs against the modified test system. (9 refs).
Internet-based data interchange with XML
Fuerst, Karl; Schmidt, Thomas
2000-12-01
In this paper, a complete concept for Internet Electronic Data Interchange (EDI) - a well-known buzzword in the area of logistics and supply chain management to enable the automation of the interactions between companies and their partners - using XML (eXtensible Markup Language) will be proposed. This approach is based on Internet and XML, because the implementation of traditional EDI (e.g. EDIFACT, ANSI X.12) is mostly too costly for small and medium sized enterprises, which want to integrate their suppliers and customers in a supply chain. The paper will also present the results of the implementation of a prototype for such a system, which has been developed for an industrial partner to improve the current situation of parts delivery. The main functions of this system are an early warning system to detect problems during the parts delivery process as early as possible, and a transport following system to pursue the transportation.
Quark interchange model of baryon interactions
Energy Technology Data Exchange (ETDEWEB)
Maslow, J.N.
1983-01-01
The strong interactions at low energy are traditionally described by meson field theories treating hadrons as point-like particles. Here a mesonic quark interchange model (QIM) is presented which takes into account the finite size of the baryons and the internal quark structure of hadrons. The model incorporates the basic quark-gluon coupling of quantum chromodynamics (QCD) and the MIT bag model for color confinement. Because the quark-gluon coupling constant is large and it is assumed that confinement excludes overlap of hadronic quark bags except at high momenta, a non-perturbative method of nuclear interactions is presented. The QIM allows for exchange of quark quantum numbers at the bag boundary between colliding hadrons mediated at short distances by a gluon exchange between two quarks within the hadronic interior. This generates, via a Fierz transformation, an effective space-like t channel exchange of color singlet (q anti-q) states that can be identified with the low lying meson multiplets. Thus, a one boson exchange (OBE) model is obtained that allows for comparison with traditional phenomenological models of nuclear scattering. Inclusion of strange quarks enables calculation of YN scattering. The NN and YN coupling constants and the nucleon form factors show good agreement with experimental values as do the deuteron low energy data and the NN low energy phase shifts. Thus, the QIM provides a simple model of strong interactions that is chirally invariant, includes confinement and allows for an OBE form of hadronic interaction at low energies and momentum transfers.
Quark interchange model of baryon interactions
International Nuclear Information System (INIS)
Maslow, J.N.
1983-01-01
The strong interactions at low energy are traditionally described by meson field theories treating hadrons as point-like particles. Here a mesonic quark interchange model (QIM) is presented which takes into account the finite size of the baryons and the internal quark structure of hadrons. The model incorporates the basic quark-gluon coupling of quantum chromodynamics (QCD) and the MIT bag model for color confinement. Because the quark-gluon coupling constant is large and it is assumed that confinement excludes overlap of hadronic quark bags except at high momenta, a non-perturbative method of nuclear interactions is presented. The QIM allows for exchange of quark quantum numbers at the bag boundary between colliding hadrons mediated at short distances by a gluon exchange between two quarks within the hadronic interior. This generates, via a Fierz transformation, an effective space-like t channel exchange of color singlet (q anti-q) states that can be identified with the low lying meson multiplets. Thus, a one boson exchange (OBE) model is obtained that allows for comparison with traditional phenomenological models of nuclear scattering. Inclusion of strange quarks enables calculation of YN scattering. The NN and YN coupling constants and the nucleon form factors show good agreement with experimental values as do the deuteron low energy data and the NN low energy phase shifts. Thus, the QIM provides a simple model of strong interactions that is chirally invariant, includes confinement and allows for an OBE form of hadronic interaction at low energies and momentum transfers
Flute-interchange stability in a hot electron plasma
International Nuclear Information System (INIS)
Dominguez, R.R.
1980-01-01
Several topics in the kinetic stability theory of flute-interchange modes in a hot electron plasma are discussed. The stability analysis of the hot-electron, curvature-driven flute-interchange mode, previously performed in a slab geometry, is extended to a cylindrical plasma. The cold electron concentration necessary for stability differs substantially from previous criteria. The inclusion of a finite temperature background plasma in the stability analysis results in an ion curvature-driven flute-interchange mode which may be stabilized by either hot-electron diamagnetic effects, hot-electron plasma density, or finite (ion) Larmor radius effects
Brand and generic medications: Are they interchangeable
International Nuclear Information System (INIS)
Al-Jazairi, Abdulrazak S.; Blhareth, S.; Eqtefan, Iyad S.; Al-Suwayeh, Saleh A.
2008-01-01
Generic substitution has become a common practice since the late 1970s in the United States. At that time, many of these generics caused bioavailability problems, which fueled suspicions about their efficacy and safety and the Food and Drug Administration (FDA) standards for bioequivalence. In Saudi Arabia, the increasing number of local products raised several concerns with regard to switching from brands to generics. Our objective was to review and examine the basis of the controversy surrounding brand and generic interchangeability and to explore a practical approach in pursuing a switch. Articles indexed initially under terms such as generic medications, generic substitution, bioequivalence and bioinequivalence were identified. These terms were used to search the indexing service, MEDLINE (1966-2006). References from the extracted articles and additional data sources, including the Code of Federal Regulations and Regulatory Guidelines from the FDA Center for Drug Evaluation and research were also reviewed. Foe most drugs, bioequivalence testing generally should enable clinicians to routinely substitute generic for innovator products. However, for narrow therapeutic, critical dose drugs, or for highly variable drugs, safe switching between products can not be assured. These drugs need special precautions and blood level monitoring upon switching. FDA firmly believes that approved generic and brand drugs can be dispensed with the full expectation that the consumer will receive the same clinical benefit. Performing the switch process is an advisable practice to reduce health care costs in countries with strong post-marketing surveillance program, but caution is to be exercised when narrow therapeutic index drugs or highly variable drugs are prescribed. (author)
Collecting and Analyzing Stakeholder Feedback for Signing at Complex Interchanges
2014-10-01
The purpose of this project was to identify design constraints related to signing, markings, and geometry for complex interchanges, and then to identify useful topics for future research that will yield findings that can address those design issues. ...
Good Security Practices for Electronic Commerce, Including Electronic Data Interchange
National Research Council Canada - National Science Library
Saltman, Roy
1993-01-01
Electronic commerce (EC) is the use of documents in electronic form, rather than paper, for carrying out functions of business or government that require interchange of information, obligations, or monetary value between organizations...
Paying for payments: free payments and optimal interchange fees
Korsgaard, Søren
2014-01-01
Do consumers and merchants use the most efficient payment instruments? I examine how inter- change fees, which are fees paid from merchants' banks to consumers' banks when card transactions take place, influence the choice between cash and payment cards. I show that when consumers do not pay transaction fees to banks - a common feature in bank contracts - card use is declining in interchange fees, and surcharging does not neutralize interchange fees. According to my model, banks set interchan...
Towards harmonized data interchange in food consumption data
DEFF Research Database (Denmark)
Pakkala, H.; Christensen, Tue; Presser, K.
2014-01-01
Food consumption data are collected and used in several fields of science. The data are often combined from various sources and interchanged between different systems. There is, however, no harmonized and widely used data interchange format. In addition, food consumption data are often combined w...... interchange format for food consumption based on work and experiences related to food composition.The aim is that the data interchange format will provide a basis for wider harmonization in the future.......Food consumption data are collected and used in several fields of science. The data are often combined from various sources and interchanged between different systems. There is, however, no harmonized and widely used data interchange format. In addition, food consumption data are often combined...... with other data such as food composition data. In the field of food composition, successful harmonization has recently been achieved by the European Food Information Resource Network, which is now the basis of a standard draft by the European Committee for Standardization. We present an XML-based data...
Nuclear medicine image and data interchange through e-mail
Energy Technology Data Exchange (ETDEWEB)
Lyra, M; Skouroliakou, K; Perris, A; Georgossopoulos, C; Pappas, D [Radiology Department, Athens University, Athens (Greece); Stefanides, C [Pediatric Hospital, Aglaia Kyriakou, Athens (Greece)
1999-12-31
Prosperity of easy interchange in every day practice of Nuclear Medicine found its application through the INTERNET media. We use a simple and safe way to interchange images and diagnostic information between the scintigraphic acquisition and processing location and the clinical department in order to improve patient`s health care and young doctor`s education. images and patient reports are transferred and saved through dedicated software to a workstation that transforms y-camera scintigraphic images in a PC readable format. Diagnosis reports and scintigraphic images are incorporated to a database directory in hypertext form. Usual WWW connection gives the possibility of patients` examinations transfer by email attachments as well as interchange of relative comments towards both directions. Cost effective solution has been achieved using standard hard- and soft-ware. Furthermore, both educational files can be downloaded from our department ftp location, by a unique password. (authors) 7 refs., 3 figs.
Nuclear medicine image and data interchange through e-mail
International Nuclear Information System (INIS)
Lyra, M.; Skouroliakou, K.; Perris, A.; Georgossopoulos, C.; Pappas, D.; Stefanides, C.
1998-01-01
Prosperity of easy interchange in every day practice of Nuclear Medicine found its application through the INTERNET media. We use a simple and safe way to interchange images and diagnostic information between the scintigraphic acquisition and processing location and the clinical department in order to improve patient's health care and young doctor's education. images and patient reports are transferred and saved through dedicated software to a workstation that transforms y-camera scintigraphic images in a PC readable format. Diagnosis reports and scintigraphic images are incorporated to a database directory in hypertext form. Usual WWW connection gives the possibility of patients' examinations transfer by email attachments as well as interchange of relative comments towards both directions. Cost effective solution has been achieved using standard hard- and soft-ware. Furthermore, both educational files can be downloaded from our department ftp location, by a unique password. (authors)
Arctic warming will promote Atlantic-Pacific fish interchange
DEFF Research Database (Denmark)
Wisz, Mary; Broennimann, O.; Grønkjær, Peter
2015-01-01
the interchange of marine biota between the two seas. Here, we forecast the potential northward progression of 515 fish species following climate change, and report the rate of potential species interchange between the Atlantic and the Pacific via the Northwest Passage and the Northeast Passage. For this, we...... projected niche-based models under climate change scenarios and simulated the spread of species through the passages when climatic conditions became suitable. Results reveal a complex range of responses during this century, and accelerated interchange after 2050. By 2100 up to 41 species could enter......Throughout much of the Quaternary Period, inhospitable environmental conditions above the Arctic Circle have been a formidable barrier separating most marine organisms in the North Atlantic from those in the North Pacific. Rapid warming has begun to lift this barrier, potentially facilitating...
Induced interchange heterozygosity in Sesbania aegyptiaca (poir. ) pers
Energy Technology Data Exchange (ETDEWEB)
Zadoo, S.N.
1987-03-01
Three plants with reciprocal translocation of chromosomes were isolated from M/sub 1/ progeny of Sesbania aegyptiaca (Poir.) Pers., after treating the dry seeds with 10, 20, 30, 40 and 45 K rad doses of gamma rays. The cytological observation of these plants revealed that in each case a reciprocal interchange involving two non-homologous chromosomes has taken place. The plants have been studied for their meiotic behaviour, with particular reference to type and frequency of multiple associations, mode of orientation of interchange multiple at metaphase-I, disjunction at anaphase-I, and chiasma frequency. The consequences of these factors vis-a-vis the fertility has been discussed.
Interchange Instability and Transport in Matter-Antimatter Plasmas
Kendl, Alexander; Danler, Gregor; Wiesenberger, Matthias; Held, Markus
2017-06-01
Symmetric electron-positron plasmas in inhomogeneous magnetic fields are intrinsically subject to interchange instability and transport. Scaling relations for the propagation velocity of density perturbations relevant to transport in isothermal magnetically confined electron-positron plasmas are deduced, including damping effects when Debye lengths are large compared to Larmor radii. The relations are verified by nonlinear full-F gyrofluid computations. Results are analyzed with respect to planned magnetically confined electron-positron plasma experiments. The model is generalized to other matter-antimatter plasmas. Magnetized electron-positron-proton-antiproton plasmas are susceptible to interchange-driven local matter-antimatter separation, which can impede sustained laboratory magnetic confinement.
Interchange Instability and Transport in Matter-Antimatter Plasmas.
Kendl, Alexander; Danler, Gregor; Wiesenberger, Matthias; Held, Markus
2017-06-09
Symmetric electron-positron plasmas in inhomogeneous magnetic fields are intrinsically subject to interchange instability and transport. Scaling relations for the propagation velocity of density perturbations relevant to transport in isothermal magnetically confined electron-positron plasmas are deduced, including damping effects when Debye lengths are large compared to Larmor radii. The relations are verified by nonlinear full-F gyrofluid computations. Results are analyzed with respect to planned magnetically confined electron-positron plasma experiments. The model is generalized to other matter-antimatter plasmas. Magnetized electron-positron-proton-antiproton plasmas are susceptible to interchange-driven local matter-antimatter separation, which can impede sustained laboratory magnetic confinement.
Electronic Data Interchange (EDI) for Libraries and Publishers.
Santosuosso, Joe
1992-01-01
Defines electronic data interchange (EDI) as the exchange of data between computer systems without human intervention or interpretation. Standards are discussed; and the implementation of EDI in libraries and the serials publishing community in the areas of orders and acquisitions, claims, and invoice processing is described. (LRW)
CEN MetaLex: Facilitating Interchange in e-Government
Boer, A.; Winkels, R.
2011-01-01
MetaLex is a generic and extensible interchange framework for the XML encoding of the structure of, and metadata about, documents that function as a source of law. It aims to be jurisdiction and language-neutral, and is based on modern XML publishing concepts like a strict separation between text,
A Cloverleaf of Software Engineering
DEFF Research Database (Denmark)
Bjørner, Dines
2005-01-01
, however "lite". Third, despite 35 years of formal methods, the SE industry, maturity-wise still lags far behind that of other engineering disciplines. So we examine why. Finally, in several areas, in health care, in architecture, and others, we see that major undertakings are primarily spearheaded...... by senior academic staff. Professors of medicine daily perform specialized surgery and treatments at hospitals. Professors of architecture design new, daring buildings for industry, and professors of civil engineering head the engineering structural design of new, daring bridges. So we speculate what......We shall touch upon four issues of software engineering (SE): domain engineering, formal techniques, SE sociology, and academic software architects. First, before software can be designed one must understand its requirements; but before requirements can be formulated one must understand the domain...
Wen, Weijia; Wu, Jinbo; Kodzius, Rimantas
2011-01-01
A polymerase chain reaction (PCR) device for fast amplification and detection of DNA includes an interchangeable PCR chamber, a temperature control component, and an optical detection system. The DNA amplification is performed on an interchangeable
32 CFR 644.409 - Procedures for Interchange of National Forest Lands.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Procedures for Interchange of National Forest... Interests § 644.409 Procedures for Interchange of National Forest Lands. (a) General. The interchange of national forest lands is accomplished in three steps: first, agreement must be reached between the two...
Reload pattern optimization by application of multiple cyclic interchange algorithms
Energy Technology Data Exchange (ETDEWEB)
Geemert, R. van; Quist, A.J.; Hoogenboom, J.E. [Technische Univ. Delft (Netherlands)
1996-09-01
Reload pattern optimization procedures are proposed which are based on the multiple cyclic interchange approach, according to which the search for the reload pattern associated with the highest objective function value can be thought of as divided in multiple stages. The transition from the initial to the final stage is characterized by an increase in the degree of locality of the search procedure. The general idea is that, during the first stages, the `elite` cluster containing the group of best patterns must be located, after which the solution space is sampled in a more and more local sense to find the local optimum in this cluster. The transition(s) from global search behaviour to local search behaviour can be either prompt, by defining strictly separate search regimes, or gradual by introducing stochastic tests for the number of fuel bundles involved in a cyclic interchange. Equilibrium cycle optimization results are reported for a test PWR reactor core of modest size. (author)
Reload pattern optimization by application of multiple cyclic interchange algorithms
International Nuclear Information System (INIS)
Geemert, R. van; Quist, A.J.; Hoogenboom, J.E.
1996-01-01
Reload pattern optimization procedures are proposed which are based on the multiple cyclic interchange approach, according to which the search for the reload pattern associated with the highest objective function value can be thought of as divided in multiple stages. The transition from the initial to the final stage is characterized by an increase in the degree of locality of the search procedure. The general idea is that, during the first stages, the 'elite' cluster containing the group of best patterns must be located, after which the solution space is sampled in a more and more local sense to find the local optimum in this cluster. The transition(s) from global search behaviour to local search behaviour can be either prompt, by defining strictly separate search regimes, or gradual by introducing stochastic tests for the number of fuel bundles involved in a cyclic interchange. Equilibrium cycle optimization results are reported for a test PWR reactor core of modest size. (author)
XAFS Data Interchange: A single spectrum XAFS data file format
International Nuclear Information System (INIS)
Ravel, B.; Newville, M.
2016-01-01
We propose a standard data format for the interchange of XAFS data. The XAFS Data Interchange (XDI) standard is meant to encapsulate a single spectrum of XAFS along with relevant metadata. XDI is a text-based format with a simple syntax which clearly delineates metadata from the data table in a way that is easily interpreted both by a computer and by a human. The metadata header is inspired by the format of an electronic mail header, representing metadata names and values as an associative array. The data table is represented as columns of numbers. This format can be imported as is into most existing XAFS data analysis, spreadsheet, or data visualization programs. Along with a specification and a dictionary of metadata types, we provide an application-programming interface written in C and bindings for programming dynamic languages. (paper)
Nonlinear growth of the quasi-interchange instability
International Nuclear Information System (INIS)
Waelbroeck, F.L.
1988-07-01
In this paper nonlinear effects on the growth of a pressure-driven, interchange-like mode are investigated. This mode is thought to be responsible for the sawtooth crashes observed in JET and successfully accounts for most of their features. The analysis presented here differs from previous bifurcation calculations by the inclusion of toroidal coupling effects. Toroidal curvature, which is important for pressure-driven modes, destroys the helical symmetry which is typical of kink-like instabilities. 14 refs., 3 figs
Towards Building a Uniform Cloud Database Representation for Data Interchange
Directory of Open Access Journals (Sweden)
Andreica Alina
2016-12-01
Full Text Available The paper proposes design principles for data representation and simplification in order to design cloud services for data exchange between various information systems. We use equivalence algorithms and canonical representation in the cloud database. The solution we describe brings important advantages in organizational / entity communication and cooperation, with important societal benefits and can be provided within cloud architectures. The generic design principles we apply bring important advantages in the design of the interchange services.
Market structure and credit card pricing: what drives the interchange?
Zhu Wang
2008-01-01
This paper presents a model for the credit card industry, where oligopolistic card networks price their products in a complex marketplace with competing payment instruments, rational consumers/merchants, and competitive card issuers/acquirers. The analysis suggests that card networks demand higher interchange fees to maximize card issuers' profits as card payments become more efficient. At equilibrium, consumer rewards and card transaction volume also increase, while consumer surplus and merc...
XML-Based SHINE Knowledge Base Interchange Language
James, Mark; Mackey, Ryan; Tikidjian, Raffi
2008-01-01
The SHINE Knowledge Base Interchange Language software has been designed to more efficiently send new knowledge bases to spacecraft that have been embedded with the Spacecraft Health Inference Engine (SHINE) tool. The intention of the behavioral model is to capture most of the information generally associated with a spacecraft functional model, while specifically addressing the needs of execution within SHINE and Livingstone. As such, it has some constructs that are based on one or the other.
NN interaction from bag-model quark interchange
Energy Technology Data Exchange (ETDEWEB)
Bakker, B.L.G.; Bozoian, M.; Maslow, J.N.; Weber, H.J.
1982-03-01
A partial-wave helicity-state analysis of elastic nucleon-nucleon scattering is carried out in momentum space. Its basis is a one- and two-boson exchange amplitude from a bag-model quark interchange mechanism. The resulting phase shifts and bound-state parameters of the deuteron are compared with other meson theoretic potentials and data up to laboratory energies of approx.350 MeV.
Theory of semicollisional drift-interchange modes in cylindrical plasmas
International Nuclear Information System (INIS)
Hahm, T.S.; Chen, L.
1985-01-01
Resistive interchange instabilities in cylindrical plasmas are studied, including the effects of electron diamagnetic drift, perpendicular resistivity, and plasma compression. The analyses are pertinent to the semicollisional regime where the effective ion gyro-radius is larger than the resistive layer width. Both analytical and numerical results show that the modes can be completely stabilized by the perpendicular plasma transport. Ion sound effects, meanwhile, are found to be negligible in the semicollisional regime
Electronic data interchange in the Canadian natural gas industry
International Nuclear Information System (INIS)
Sheinfield, J.
1995-01-01
The concept of electronic data interchange (EDI) in the gas industry was discussed. EDI as a champion of costumer service and as a powerful management tool was defined, and the process of electronic information transfer was explained. EDI was then placed in the context of the business process, and its benefits in providing efficient service and product improvement were enumerated. North American Gas EDI standards, and industry initiatives were explored in detail
NN interaction from bag-model quark interchange
International Nuclear Information System (INIS)
Bakker, B.L.G.; Bozoian, M.; Maslow, J.N.; Weber, H.J.
1982-01-01
A partial-wave helicity-state analysis of elastic nucleon-nucleon scattering is carried out in momentum space. Its basis is a one- and two-boson exchange amplitude from a bag-model quark interchange mechanism. The resulting phase shifts and bound-state parameters of the deuteron are compared with other meson theoretic potentials and data up to laboratory energies of approx.350 MeV
Statistical analysis of anomalous transport in resistive interchange turbulence
International Nuclear Information System (INIS)
Sugama, Hideo; Wakatani, Masahiro.
1992-01-01
A new anomalous transport model for resistive interchange turbulence is derived from statistical analysis applying two-scale direct-interaction approximation to resistive magnetohydrodynamic equations with a gravity term. Our model is similar to the K-ε model for eddy viscosity of turbulent shear flows in that anomalous transport coefficients are expressed in terms of by the turbulent kinetic energy K and its dissipation rate ε while K and ε are determined by transport equations. This anomalous transport model can describe some nonlocal effects such as those from boundary conditions which cannot be treated by conventional models based on the transport coefficients represented by locally determined plasma parameters. (author)
Directory interchange format manual, version 3.0
1990-01-01
The Directory Interchange Format (DIF) is a data structure used to exchange directory level information about data sets among information systems. The format consists of a number of fields that describe the attributes of a directory entry and text blocks that contain a descriptive summary of and references for the directory entry. All fields and the summary are preceded by labels identifying their contents. All values are ASCII character strings. The structure is intended to be flexible, allowing for future changes in the contents of directory entries.
Guidelines for Provision and Interchange of Geothermal Data Assets
Energy Technology Data Exchange (ETDEWEB)
none,
2014-07-03
The US Department of Energy Office of Geothermal Technologies (OGT) is funding and overseeing the development of the National Geothermal Data System (NGDS), a distributed information system providing access to integrated data in support of, and generated in, all phases of geothermal development. NGDS is being built in an open paradigm and will employ state-of-the-art informatics approaches and capabilities to advance the state of geothermal knowledge in the US. This document presents guidelines related to provision and interchange of data assets in the context of the National Geothermal Data System. It identifies general specifications for NGDS catalog metadata and data content, and provides specific instructions for preparation and submission of data assets by OGT-funded projects.
Dynamics and fluctuation spectra of electrostatic resistive interchange turbulence
International Nuclear Information System (INIS)
Sydora, R.D.; Leboeuf, J.N.; An, Z.G.; Diamond, P.H.; Lee, G.S.; Hahm, T.S.
1985-11-01
The saturation mechanism for density and potential fluctuation spectra which evolve from linearly unstable electrostatic resistive interchange modes, are investigated using particle simulations. Detailed comparisons of the nonlinear evolution, saturation levels and resultant spectra between two- and three-dimensional sheared magnetic field configurations are made. Significant differences appear. The single rational surface, quasilinear-dominated evolution, fluctuation spectrum is adequately described using a density convection model. For the multiple rational surface case, the potential fluctuations are adequately represented by a balance between the nonlinearly modified source (curvature drive) and linear sink (parallel resistive field line diffusion). An accurate description of the density spectrum requires a mode coupling theory based on the two-point density correlation evolution equation. 24 refs., 15 figs
The Harang reversal and the interchange stability of the magnetotail
Ohtani, Shinichi; Gkioulidou, Matina; Wang, Chih-Ping; Wolf, Richard A.
2016-04-01
The present study addresses steady convection in the plasma sheet in terms of the interchange stability with special attention to the Harang reversal. The closure of the tail current with a field-aligned current (FAC) results from the divergence/convergence of the pressure gradient current. If the magnetotail is in a steady state, the associated change of local plasma pressure p has to balance with its advective change. Accordingly, for adiabatic transport, the flux tube entropy parameter pVγ increases and decreases along the convection path in regions corresponding to downward and upward FACs, respectively. This requirement, along with the condition for the interchange stability imposes an important constraint on the direction of convection especially in the regions of downward FACs. It is deduced that for the dusk cell, the convection in the downward R2 current has to be directed azimuthally duskward, which follows the sunward, possibly dawnward deflected, convection in the region of the premidnight upward R1 current. This duskward turn of convection takes place in the vicinity of the R1-R2 demarcation, and it presumably corresponds to the Harang reversal. For the dawn cell the convection in the postmidnight downward R1 current has to deflect dawnward, and then it proceeds sunward in the upward R2 current. The continuity of the associated ionospheric currents consistently reproduces the assumed FAC distribution. The proposed interrelationships between the convection and FACs are also verified with a quasi-steady plasma sheet configuration and convection reproduced by a modified Rice Convection Model with force balance.
Simulation of the interchange instability in a magnetospheric substorm site
Directory of Open Access Journals (Sweden)
O. V. Mingalev
2006-07-01
Full Text Available We perform modeling of the interchange instability driven by longitudinal pressure asymmetry in the region of the pressure buildup that forms in the inner magnetosphere at the substorm growth phase. The simulation refers to the dawnward side of the Harang discontinuity and times after Bz IMF turning northward. The solution for the equilibrium state indicates tailward flows associated with vortices, which is in agreement with a previous finding of Ashour-Abdalla et al. (1999, 2002. We show that in the regions of equilibrium field-aligned currents (FACs, small initial perturbations in pVγ (p is the isotropic plasma pressure, V is the unit magnetic flux tube volume, γ=5/3 the adiabatic exponent, set up as ripples inclined to azimuth, grow in time. For the background FAC of ~10-6 A/m2, the linear growth rate of the instability is ~6 min. Starting from the 12th min of evolution, the perturbations exhibit nonlinear deformations, develop undulations and front steepening. An interesting peculiarity in the distribution of the associated small-scale FACs is that they become asymmetric with time. Specifically, the downward currents are more localised, reaching densities up to 15×10-6 A/m2 at the nonlinear stage. The upward FACs are more dispersed. When large enough, these currents are likely to produce the aurora. We also run our simulation for the initial perturbations of large transverse scales in order to demonstrate that the interchange instability can be responsible for pressure and cross-tail current spatial variations of great extent.
Transport intermodal interchanges: Socio-economic impacts at Lille European metropolis
Energy Technology Data Exchange (ETDEWEB)
Heddebaut, O.; Ciommo, F. di
2016-07-01
Within the framework of the “City-HUB” FP7 European research project 27 interchanges were studied in nine European countries. It investigated how transport interchanges work from the point of view of governance and the organization of facilities. On this basis a typology of interchanges has been defined for classifying the interchanges and selecting the key elements for improving the interchanges location, construction, and organization of an interchange. The paper focus on the implementation of the City-HUB interchange typology to the case study of Lille European Metropolis (MEL) where two contingent railways stations Lille Flandres and Lille Europe were analysed as a potential unique interchange. Indeed, the article is related to the creation of a joint interchanges able to attract more public transport users than private users such as it is now the case. These two main railways interchanges have different territorial and transport functions (i.e. one is oriented to regional traffic and the other one to national and international traffic). Urban planners and transport authorities would like to connect both stations creating a unique interchange. A key point of the Lille’s City-HUB analysis is related to the involvement of the stakeholders. Their involvement is at the origin of the interactions between City-HUB and its socio-economic and urban context. We demonstrate that combining transport and land use planning policies could boost commercial development, new business offices or housing. The urban City-Hub overcomes its role of transport infrastructure for being a “place”. (Author)
What Kind of International Interchange Is Beneficial? Experiences of Taiwanese Indigenes
Chen, Shan-Hua
2014-01-01
Because of globalization, international interchanges among indigenes in every country have become more frequent. Influenced by international multicultural trends, Taiwan's government not only supports indigenous populations to revive their traditional cultures, but also encourages the promotion of the international interchange activities among…
The Place of Community-Based Learning in Higher Education: A Case Study of Interchange
Hardwick, Louise
2013-01-01
This article focuses on one strand of community engagement: community-based learning for students. It considers in particular Interchange as a case study. Interchange is a registered charity based in, but independent of, a department in a Higher Education Institution. It brokers between undergraduate research/work projects and Voluntary Community…
Directory of Open Access Journals (Sweden)
Jessica S Wang
Full Text Available Therapeutic interchange of a same class medication for an outpatient medication is a widespread practice during hospitalization in response to limited hospital formularies. However, therapeutic interchange may increase risk of medication errors. The objective was to characterize the prevalence and safety of therapeutic interchange.Secondary analysis of a transitions of care study. We included patients over age 64 admitted to a tertiary care hospital between 2009-2010 with heart failure, pneumonia, or acute coronary syndrome who were taking a medication in any of six commonly-interchanged classes on admission: proton pump inhibitors (PPIs, histamine H2-receptor antagonists (H2 blockers, hydroxymethylglutaryl CoA reductase inhibitors (statins, angiotensin-converting enzyme (ACE inhibitors, angiotensin receptor blockers (ARBs, and inhaled corticosteroids (ICS. There was limited electronic medication reconciliation support available. Main measures were presence and accuracy of therapeutic interchange during hospitalization, and rate of medication reconciliation errors on discharge. We examined charts of 303 patients taking 555 medications at time of admission in the six medication classes of interest. A total of 244 (44.0% of medications were therapeutically interchanged to an approved formulary drug at admission, affecting 64% of the study patients. Among the therapeutically interchanged drugs, we identified 78 (32.0% suspected medication conversion errors. The discharge medication reconciliation error rate was 11.5% among the 244 therapeutically interchanged medications, compared with 4.2% among the 311 unchanged medications (relative risk [RR] 2.75, 95% confidence interval [CI] 1.45-5.19.Therapeutic interchange was prevalent among hospitalized patients in this study and elevates the risk for potential medication errors during and after hospitalization. Improved electronic systems for managing therapeutic interchange and medication reconciliation
An interchangeable scanning Hall probe/scanning SQUID microscope
International Nuclear Information System (INIS)
Tang, Chiu-Chun; Lin, Hui-Ting; Wu, Sing-Lin; Chen, Tse-Jun; Wang, M. J.; Ling, D. C.; Chi, C. C.; Chen, Jeng-Chung
2014-01-01
We have constructed a scanning probe microscope for magnetic imaging, which can function as a scanning Hall probe microscope (SHPM) and as a scanning SQUID microscope (SSM). The scanning scheme, applicable to SHPM and SSM, consists of a mechanical positioning (sub) micron-XY stage and a flexible direct contact to the sample without a feedback control system for the Z-axis. With the interchangeable capability of operating two distinct scanning modes, our microscope can incorporate the advantageous functionalities of the SHPM and SSM with large scan range up to millimeter, high spatial resolution (⩽4 μm), and high field sensitivity in a wide range of temperature (4.2 K-300 K) and magnetic field (10 −7 T-1 T). To demonstrate the capabilities of the system, we present magnetic images scanned with SHPM and SSM, including a RbFeB magnet and a nickel grid pattern at room temperature, surface magnetic domain structures of a La 2/3 Ca 1/3 MnO 3 thin film at 77 K, and superconducting vortices in a striped niobium film at 4.2 K
Planetary interchange of bioactive material: probability factors and implications.
Clark, B C
2001-01-01
It is now well-accepted that both lunar and martian materials are represented in the meteorite collections. Early suggestions that viable organisms might survive natural transport between planets have not yet been thoroughly examined. The concept of Planetary Interchange of Bioactive Material (PIBM) is potentially relevant to the conditions under which life originated. PIBM has been also invoked to infer that the potential danger to Earth from martian materials is non-existent, an inference with, however, many pitfalls. Numerous impediments to efficient transfer of viable organisms exist. In this work, the lethality of space radiation during long transients and the biasing of launched objects toward materials unlikely to host abundant organisms are examined and shown to reduce the likelihood of successful transfer by orders of magnitude. It is also shown that martian meteorites studied to date assuredly have been subjected to sterilizing levels of ionizing radiation in space. PIBM considerations apply to both the solar system locale(s) of the origin of life and to the applicability of planetary protection protocols to preserve the biospheres of planetary bodies, including our own.
Stabilization of numerical interchange in spectral-element magnetohydrodynamics
Sovinec, C. R.
2016-08-01
Auxiliary numerical projections of the divergence of flow velocity and vorticity parallel to magnetic field are developed and tested for the purpose of suppressing unphysical interchange instability in magnetohydrodynamic simulations. The numerical instability arises with equal-order C0 finite- and spectral-element expansions of the flow velocity, magnetic field, and pressure and is sensitive to behavior at the limit of resolution. The auxiliary projections are motivated by physical field-line bending, and coercive responses to the projections are added to the flow-velocity equation. Their incomplete expansions are limited to the highest-order orthogonal polynomial in at least one coordinate of the spectral elements. Cylindrical eigenmode computations show that the projections induce convergence from the stable side with first-order ideal-MHD equations during h-refinement and p-refinement. Hyperbolic and parabolic projections and responses are compared, together with different methods for avoiding magnetic divergence error. The projections are also shown to be effective in linear and nonlinear time-dependent computations with the NIMROD code Sovinec et al. [17], provided that the projections introduce numerical dissipation.
An interchangeable scanning Hall probe/scanning SQUID microscope
Energy Technology Data Exchange (ETDEWEB)
Tang, Chiu-Chun; Lin, Hui-Ting; Wu, Sing-Lin [Department of Physics, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Chen, Tse-Jun; Wang, M. J. [Institute of Astronomy and Astrophysics, Academia Sinica, Taipei 10617, Taiwan (China); Ling, D. C. [Department of Physics, Tamkang University, Tamsui Dist., New Taipei City 25137, Taiwan (China); Chi, C. C.; Chen, Jeng-Chung [Department of Physics, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Frontier Research Center on Fundamental and Applied Sciences of Matters, National Tsing Hua University, Hsinchu 30013, Taiwan (China)
2014-08-15
We have constructed a scanning probe microscope for magnetic imaging, which can function as a scanning Hall probe microscope (SHPM) and as a scanning SQUID microscope (SSM). The scanning scheme, applicable to SHPM and SSM, consists of a mechanical positioning (sub) micron-XY stage and a flexible direct contact to the sample without a feedback control system for the Z-axis. With the interchangeable capability of operating two distinct scanning modes, our microscope can incorporate the advantageous functionalities of the SHPM and SSM with large scan range up to millimeter, high spatial resolution (⩽4 μm), and high field sensitivity in a wide range of temperature (4.2 K-300 K) and magnetic field (10{sup −7} T-1 T). To demonstrate the capabilities of the system, we present magnetic images scanned with SHPM and SSM, including a RbFeB magnet and a nickel grid pattern at room temperature, surface magnetic domain structures of a La{sub 2/3}Ca{sub 1/3}MnO{sub 3} thin film at 77 K, and superconducting vortices in a striped niobium film at 4.2 K.
Space Solar Power Technical Interchange Meeting 2: SSP TIM 2
Sanders, Jim; Hawk, Clark W.
1998-01-01
The 2nd Space Solar Power Technical Interchange Meeting (SSP TIM 2) was conducted September 21st through 24th with the first part consisting of a Plenary session. The summary results of this Plenary session are contained in part one of this report. The attendees were then organized into Working Breakout Sessions and Integrated Product Team (IPT) Sessions for the purpose of conducting in-depth discussions in specific topic areas and developing a consensus as to appropriate study plans and actions to be taken. The Second part covers the Plenary Summary Session, which contains the summary results of the Working Breakout Sessions and IPT Sessions. The appendix contains the list of attendees. The ob'jective was to provide an update for the study teams and develop plans for subsequent study activities. This SSP TIM 2 was initiated and the results reported electronically over the Internet. The International Space Station (ISS) could provide the following opportunities for conducting research and technology (R&T) which are applicable to SSP: (1) Automation and Robotics, (2) Advanced Power Generation, (3) Advanced Power Management & Distribution (PMAD), (4) Communications Systems and Networks, (5) Energy Storage, (6) In Space Propulsion (ISP), (7) Structural Dynamics and Control, and Assembly and (8) Wireless Power Transmission.
Turbulent interchange in simulated rod bundle geometries for Genetron-12 flows
International Nuclear Information System (INIS)
Petrunik, K.
1973-01-01
Turbulent interchange data between subchannel arrays simulating an infinite triangular array in a rod bundle fuel cluster were obtained for two-phase Genetron-12 (dichlorodifluoromethane), single phase subcooled Genetron-12 and single phase water flows at gap spacings of 0.025, 0.052 and 0.100 inches. Single phase turbulent interchange rates were relatively independent of the pitch to diameter ratio for the larger two gaps studied but increased for the smallest gap spacing. Two-phase Genetron-12 interchange data were obtained under conditions of unequal qualities and mass fluxes and essentially zero radial pressure gradient along the interconnection region between subchannels. Vapour transport occurred primarily by a diffusional type mechanism and was qualitatively similar to single phase behaviour. For annular flow conditions liquid interchange occurred through a dual mechanism via the film flow and entrained droplets. Vapour interchange was significantly suppressed at the smallest gap spacing due to the presence of the liquid film. Liquid interchange under two-phase conditions increased with gap spacing from 0.025 to 0.052 inches and levelled off slightly at 0.100 inches. Data obtained with heat addition in one test channel indicated negligible effects on the vapour transfer rates but a slight reduction in the magnitude of liquid interchange. (O.T.)
2010-10-13
... on the Route 250 Bypass Interchange at McIntire Road Project in Virginia AGENCY: Federal Highway.... 139(l)(1). The actions relate to the Route 250 Bypass Interchange at McIntire Road project in the City... Virginia: Route 250 Bypass Interchange at McIntire Road. The project would involve construction of a grade...
Interchange Slip-Running Reconnection and Sweeping SEP-Beams
Masson, S.; Aulanier, G.; Pariat, E.; Klein, K.-L.
2011-01-01
We present a new model to explain how particles, accelerated at a reconnection site that is not magnetically connected to the Earth, could eventually propagate along the well-connected open flux tube. Our model is based on the results of a low-beta resistive magnetohydrodynamics simulation of a three-dimensional line-tied and initially current-free bipole, that is embedded in a non-uniform open potential field. The topology of this configuration is that of an asymmetric coronal null-point, with a closed fan surface and an open outer spine. When driven by slow photospheric shearing motions, field lines, initially fully anchored below the fan dome, reconnect at the null point, and jump to the open magnetic domain. This is the standard interchange mode as sketched and calculated in 2D. The key result in 3D is that, reconnected open field lines located in the vicinity of the outer spine, keep reconnecting continuously, across an open quasi-separatrix layer, as previously identified for non-open-null-point reconnection. The apparent slipping motion of these field lines leads to form an extended narrow magnetic flux tube at high altitude. Because of the slip-running reconnection, we conjecture that if energetic particles would be travelling through, or be accelerated inside, the diffusion region, they would be successively injected along continuously reconnecting field lines that are connected farther and farther from the spine. At the scale of the full Sun, owing to the super-radial expansion of field lines below 3 solar radius, such energetic particles could easily be injected in field lines slipping over significant distances, and could eventually reach the distant flux tube that is well-connected to the Earth.
Nonlinear simulation of electromagnetic current diffusive interchange mode turbulence
International Nuclear Information System (INIS)
Yagi, M.; Itoh, S.I.; Fukuyama, A.
1998-01-01
The anomalous transport in toroidal plasmas has been investigated extensively. It is pointed out that the nonlinear instability is important in driving the microturbulence[1], i.e., the self-sustained plasma turbulence. This concept is explained as follows; when the electron motion along the magnetic field line is resisted by the background turbulence, it gives rise to the effective resistivity and enhances the level of the turbulence. The nonlinear simulation of the electrostatic current diffusive interchange mode (CDIM) in the two dimensional sheared slab geometry has been performed as an example. The occurrence of the nonlinear instability and the self-sustainment of the plasma turbulence were confirmed by this simulation[2]. On the other hand, the electromagnetic turbulence is sustained in the high pressure limit. The possibility of the self-organization with more variety has been pointed out[3]. It is important to study the electromagnetic turbulence based on the nonlinear simulation. In this paper, the model equation for the electrostatic CDIM turbulence[2] is extended for both electrostatic and electromagnetic turbulence. (1) Not only E x B convective nonlinearity but also the electromagnetic nonlinearity which is related to the parallel flow are incorporated into the model equation. (2) The electron and ion pressure evolution equations are solved separately, making it possible to distinguish the electron and ion thermal diffusivities. The two dimensional nonlinear simulation of the electromagnetic CDIM is performed based on the extended fluid model. This paper is organized as follows. The model equation is explained in section II. The result of simulation is shown in section III. The conclusion and discussion are given in section IV. (author)
International Nuclear Information System (INIS)
Chen, I-H.; Meng Hsiao; Hsu, Y.-H.; Tsai, C.-H.
2003-01-01
The 3' untranslated region (UTR) of bamboo mosaic potexvirus (BaMV) RNA was identified to fold into a tertiary structure comprising a cloverleaf-like structure designated ABC domain followed by a major stem-loop D, which in turn is followed by a pseudoknot E and a poly(A) tail. The coat protein accumulation level of the mutant, BaMV40A/ΔABC, lacking ABC domain was just 15% that of wild-type when inoculated into protoplasts of Nicotiana benthamiana. This suggested that ABC domain might play an important role in BaMV RNA replication. To define the precise role of each of the three stem-loops of ABC domain in RNA replication, three mutants BaMV40B and C each lacking stem-loop A, B, and C, respectively, were created. Our results showed that accumulation of viral products of mutants BaMV40B and C were not as efficient as wild-type. On the contrary, level of accumulation of viral products of BaMVA was similar to that of wild-type in protoplasts and inoculated leaves. Interestingly, the accumulation of viral products was not as efficient as that of wild-type in systemic leaves, implying that stem-loop A is dispensable for replication, but signifies a role in systemic accumulation. Using UV cross-linking and competition experiments, it was demonstrated that the E. coli expressed helicase domain of BaMV ORF1 can preferentially interact with the ABC domain
Interchanges in popcorn (Zea mays L. involving the nucleolus organizer chromosome
Directory of Open Access Journals (Sweden)
Maria Suely Pagliarini
2006-01-01
Full Text Available The analysis of microsporogenesis in endogamous plants of popcorn (S5 to S7 showed several and distinctinterchanges which involve the nucleolus organizer (chromosome 6. The detection of cells with interchanges was facilitatedby the presence of two nucleoli of different sizes in contrast to normal ones with a single big nucleolus. Interchange points donot always seem to be at the same place. Whereas in several situations the interchange point clearly involved more than twochromosome pairs, a simple terminal translocation seemed to occur in others. During diplotene, a cross-shaped configurationconnected with the nucleoli was observed in some meiocytes. Some heteromorphic bivalents were found during diakinesis,after which meiosis progressed normally to the end and gave rise to apparently normal tetrads with one normal nucleolus ineach microspore. Tests of pollen viability in fixed pollen grains showed 100% stainability in normal and in affected plants.This is the first report on chromosome interchanges in popcorn.
Interchange instability with line-typing and finite Larmor radius effects
International Nuclear Information System (INIS)
Riordan, J.C.; Hartman, C.W.
1977-01-01
Finite Larmor radius and end effects are included in a treatment of the low-β interchange instability. Higher order modes are shown to be destabilized by incomplete line-tying through an external plasma
Naeimi, M.; Alimoradi, Z.; Razi, M.; Monajjem, S.
2014-01-01
The present article involves in evaluation and engineering judgment of various geometric configurations for highway interchanges by considering substantial parameters over the discretion process. The geometric, economical and architectural criteria as the fundamental indicators are divided into
2011-11-01
The intersection and mandatory movement lane control signs placed on intersection approaches are critical to : safe and efficient intersection operations. Ramp, frontage road, and cross-street approaches to interchanges : often widen at intersections...
Controls for the Electronic Data Interchange at the Defense Finance and Accounting Service Columbus
National Research Council Canada - National Science Library
2001-01-01
.... The Electronic Data Interchange sends and receives contract payment information from computer to computer in a standard format, thus allowing documents to be received, validated, accepted, and immediately processed...
Geothermal Energy and the Eastern US: Fifth technical information interchange meeting, Minutes
Energy Technology Data Exchange (ETDEWEB)
None
1980-12-01
The technical interchange meeting documented here is the fifth meeting where people interested in geothermal energy in the Eastern US have met to interchange technical information. These meetings are intended to assist all in the difficult task of balancing time and effort in doing their assigned jobs and keeping track of what others are doing in similar or related tasks. All of the aforementioned meetings have served their intended purpose and further regional and national meetings are sure to follow.
Geothermal Energy and the Eastern US: Technical Information Interchange Meeting, Minutes
Energy Technology Data Exchange (ETDEWEB)
None
1979-12-01
The technical interchange meeting documented here is the fourth meeting where people interested in geothermal energy in the Eastern US have met to interchange technical information. These meetings are intended to assist all in the difficult task of balancing time and effort in doing their assigned jobs and keeping track of what others are doing in similar or related tasks. All of the aforementioned meetings have served their intended purpose and further regional and national meetings are sure to follow.
Statistical Analysis of Interchange Injection Events from Over a Decade of Cassini Data
Azari, A.; Jia, X.; Liemohn, M. W.; Sergis, N.; Thomsen, M. F.; Mitchell, D. G.; Rymer, A. M.; Paranicas, C.; Provan, G.; Ye, S.; Cowley, S. W. H.; Hospodarsky, G. B.; Vandegriff, J. D.; Kurth, W. S.
2017-12-01
The Cassini spacecraft has routinely observed interchange injection events with multiple instruments since arriving at Saturn in 2004. Interchange injection events are thought to initiate from a Rayleigh-Taylor like plasma instability sourced from Saturn's rapid rotation (period 10.8 hours) and dense plasma population outgassing primarily from Enceladus, and are the primary source of mass transport in the inner/middle magnetosphere. This dense plasma must be transported outward, and to conserve magnetic flux, inward moving flux tubes of low density, energetic (> keV) plasma from the outer reaches of the Saturnian system also occur. These inward-bound flux tubes are referred to as interchange injections. We will present a statistical evaluation of the occurrence rates of interchange injections at Saturn demonstrating seasonal dependence of interchange over the entirety of the Cassini mission's equatorial orbits between 2005 and 2016. We identify interchange events from CHarge Energy Mass Spectrometer (CHEMS) H+ data using a trained and tested automated algorithm. Our event identification compares well with manual identification and previous surveys of injections by L-shell and local time (Chen and Hill, 2008, Lai et al., 2016, Kennelly et al., 2013). We find that peak rates of interchange events occur between 7 - 9 Saturn radii, in agreement with previous surveys. We also evaluate interchange by preferred local time sector and season, splitting our events into pre-equinox, equinox, and post - equinox time periods. We determine that over all seasons, nightside occurrence dominated as compared to dayside, but the preferred dayside sector shifts from pre-noon during equinox, to post-noon during post-equinox. We will further investigate seasonal dependence by presenting occurrence organized by the phase systems derived based on Saturn kilometric radiation (SKR) and magnetic field perturbations (PPO).
International Nuclear Information System (INIS)
Kumar, O.A.; Panda, R.C.; Rao, K.G.R.
1986-01-01
After gamma irradiation (30 Kr) of seeds of Capsicum annuum cultivar cerasiformis (2 n = 24) two plants were recorded each carrying two interchanges. The nucleolus organiser chromosome appeared not to be involved. The interchange heterozygotes were weak and meiosis was irregular. At least one multivalent association per PMC was recorded. At metaphase I the predominant orientation was adjacent. The probable reasons for anaphase I and other meiotic irregularities and the incidence of high pollen sterility are discussed. (author)
International Nuclear Information System (INIS)
Guzdar, P.N.; Drake, J.F.
1993-01-01
The generation of shear flow by resistive ballooning modes and resistive interchange modes is compared and contrasted using a 3-D fluid code. The resistive ballooning modes give rise to poloidally asymmetric transport and hence drive poloidal rotation due to the Reynold's Stress as well as the anomalous Stringer/Winsor mechanism. On the other hand the resistive interchange mode can drive shear flow only through the Reynold's Stress. The studies show that if the self-consistent sheared flow is suppressed, the resistive ballooning modes give rise to a larger anomalous transport than produced by the resistive interchange modes. Furthermore the shear flow generated by the resistive ballooning modes is larger than that driven by the resistive interchange modes due to the combined effect of the dual mechanisms stated earlier. As a consequence strong suppression of the fluctuations as well as reduction of the transport occurs for resistive ballooning modes. On the other hand, for the resistive interchange modes the level of fluctuation as well as the anomalous transport is not reduced by the self consistent shear flow generated by the Reynold's Stress. This latter result is in agreement with some earlier 3-D simulation of resistive interchange modes
International Nuclear Information System (INIS)
Gaebler, H.E.; Bahr, A.; Mieke, B.
1999-01-01
An isotope dilution technique using enriched stable isotopes is applied to determine the interchangeable heavy-metal fraction in soils. Metals in two soil samples are extracted at constant pH, with water, NH 4 NO 3 , and EDTA. A spike of enriched stable isotopes is added to the suspension of sample and eluant at the beginning of the extraction. The heavy-metal fraction which exchanges with the added spike during the extraction is called the interchangeable fraction. The extractable heavy-metal fractions are obtained from the heavy-metal concentrations in the eluates. Isotope ratios and concentrations are determined by HR-ICP-MS. The isotope dilution technique described enables both the extractable and the interchangeable heavy-metal fractions to be determined in the same experiment. The combination of both results gives additional information on elemental availability under different conditions that cannot be obtained by analyzing the extractable heavy-metal fractions alone. It is demonstrated that in some cases different eluants just shift the distribution of the interchangeable fraction of an element between the solid and liquid phases (e.g., Pb and Cd in a topsoil sample) while the amount of the interchangeable fraction itself remains constant. For other elements, as Ni, Zn, and Cr, the use of different eluants (different pH, complexing agents) sometimes enlarges the interchangeable fraction. (orig.)
Interchangeability of the Wii Balance Board for Bipedal Balance Assessment.
Bonnechère, Bruno; Jansen, Bart; Omelina, Lubos; Rooze, Marcel; Van Sint Jan, Serge
2015-08-27
Since 2010, an increasing interest in more portable and flexible hardware for balance and posture assessment led to previously published studies determining whether or not the Wii Balance Board could be used to assess balance and posture, both scientifically and clinically. However, no previous studies aimed at comparing results from different Wii Balance Boards for clinical balance evaluation exist. The objective of this crossover study is to assess the interchangeability of the Wii Balance Board. A total of 6 subjects participated in the study and their balance was assessed using 4 different Wii Balance Boards. Trials were recorded simultaneously with Wii Balance Boards and with a laboratory force plate. Nine relevant clinical parameters were derived from center of pressure displacement data obtained from Wii Balance Board and force plate systems. Intraclass correlation coefficients (ICC), F tests, and Friedman tests were computed to assess the agreement between trials and to compare the Wii Balance Board and force plate results. Excellent correlations were found between the Wii Balance Board and force plate (mean ρ =.83). With the exception of 2 parameters, strong to excellent agreements were found for the 7 remaining parameters (ICC=.96). No significant differences were found between trials recorded with different Wii Balance Boards. Our results indicate that for most of the parameters analyzed, balance and posture assessed with one Wii Balance Board were statistically similar to results obtained from another. Furthermore, the good correlation between the Wii Balance Board and force plate results shows that Wii Balance Boards can be reliably used for scientific assessment using most of the parameters analyzed in this study. These results also suggest that the Wii Balance Board could be used in multicenter studies and therefore, would allow for the creation of larger populations for clinical studies. Ethical Committee of the Erasme Hospital (CCB B406201215142
Influence of radio frequency waves on the interchange stability in HANBIT mirror plasmas
International Nuclear Information System (INIS)
Hogun Jhang; Kim, S.S.; Lee, S.G.; Park, B.H.; Bak, J.G.
2005-01-01
Experimental and theoretical studies are made of the influence of high frequency radio frequency (rf) waves upon interchange stability in HANBIT mirror plasmas. An emphasis is put on the interchange stability near the resonance region, ω 0 ∼Ω i , where ω 0 is the angular frequency of the applied rf wave and Ω i is the ion cyclotron frequency. Recent HANBIT experiments have shown the existence of the interchange-stable operation window in favor of ω 0 /Ω i ≤1 with its sensitivity on the applied rf power. A strong nonlinear interaction between the rf wave and the interchange mode has been observed with the generation of sideband waves. A theoretical analysis including both the ponderomotive force and the nonlinear sideband wave coupling has been developed and applied to the interpretation of the experiments, resulting in a good agreement. From the study, it is concluded that the nonlinear wave-wave coupling process is responsible for the rf stabilization of the interchange modes in HANBIT mirror plasmas operating near the resonance condition. (author)
The determination of parameters for thermal unit pricing and economic interchange
International Nuclear Information System (INIS)
Briggs, D.W.; Pickles, R.; McPhail, E.M.
1988-01-01
When an interchange of energy occurs between adjoining utilities which is not the subject of a predetermined fixed price agreement but is related to the immediate cost of generating and transmitting the power, the purchaser and seller need to know the cost of the power before agreeing to the interchange. A working party from three Maritime utilities was set up to reveiw areas of interchange energy pricing between them and in particular standardize the following aspects: test procedure for a unit heat rate over its load range; maintenance and operating costs; provision for contingency costs; start up costs of units; and a pricing formula considering the above items. The three utilities are Nova Scotia Power Corporation, Maritime Electric, and New Brunswick Power Commission. Details are presented of the three utility's methods of determining heat rate, operating factor, total fuel cost, transmission loss, operations and maintenance costs, gas turbine parameters, pricing formulae, and start up costs. 2 figs., 7 tabs
Theory of energetic trapped particle-induced resistive interchange-ballooning modes
International Nuclear Information System (INIS)
Biglari, H.; Chen, L.
1986-02-01
A theory describing the influence of energetic trapped particles on resistive interchange-ballooning modes in tokamaks is presented. It is shown that a population of hot particles trapped in the region of adverse curvature can resonantly interact with and destabilize the resistive interchange mode, which is stable in their absence because of favorable average curvature. The mode is different from the usual resistive interchange mode not only in its destabilization mechanism, but also in that it has a real component to its frequency comparable to the precessional drift frequency of the rapidly circulating energetic species. Corresponding growth rate and threshold conditions for this trapped-particle-driven instability are derived and finite banana width effects are shown to have a stabilizing effect on the mode. Finally, the ballooning/tearing dispersion relation is generalized to include hot particles, so that both the ideal and the resistive modes are derivable in the appropriate limits. 23 refs., 7 figs
Koch, Tobias; Schultze, Martin; Jeon, Minjeong; Nussbeck, Fridtjof W; Praetorius, Anna-Katharina; Eid, Michael
2016-01-01
Multirater (multimethod, multisource) studies are increasingly applied in psychology. Eid and colleagues (2008) proposed a multilevel confirmatory factor model for multitrait-multimethod (MTMM) data combining structurally different and multiple independent interchangeable methods (raters). In many studies, however, different interchangeable raters (e.g., peers, subordinates) are asked to rate different targets (students, supervisors), leading to violations of the independence assumption and to cross-classified data structures. In the present work, we extend the ML-CFA-MTMM model by Eid and colleagues (2008) to cross-classified multirater designs. The new C4 model (Cross-Classified CTC[M-1] Combination of Methods) accounts for nonindependent interchangeable raters and enables researchers to explicitly model the interaction between targets and raters as a latent variable. Using a real data application, it is shown how credibility intervals of model parameters and different variance components can be obtained using Bayesian estimation techniques.
ePrescribing: Reducing Costs through In-Class Therapeutic Interchange.
Stenner, Shane P; Chakravarthy, Rohini; Johnson, Kevin B; Miller, William L; Olson, Julie; Wickizer, Marleen; Johnson, Nate N; Ohmer, Rick; Uskavitch, David R; Bernard, Gordon R; Neal, Erin B; Lehmann, Christoph U
2016-12-14
Spending on pharmaceuticals in the US reached $373.9 billion in 2014. Therapeutic interchange offers potential medication cost savings by replacing a prescribed drug for an equally efficacious therapeutic alternative. Hard-stop therapeutic interchange recommendation alerts were developed for four medication classes (HMG-CoA reductase inhibitors, serotonin receptor agonists, intranasal steroid sprays, and proton-pump inhibitors) in an electronic prescription-writing tool for outpatient prescriptions. Using prescription data from January 2012 to June 2015, the Compliance Ratio (CR) was calculated by dividing the number of prescriptions with recommended therapeutic interchange medications by the number of prescriptions with non-recommended medications to measure effectiveness. To explore potential cost savings, prescription data and medication costs were analyzed for the 45,000 Vanderbilt Employee Health Plan members. For all medication classes, significant improvements were demonstrated - the CR improved (proton-pump inhibitors 2.8 to 5.32, nasal steroids 2.44 to 8.16, statins 2.06 to 5.51, and serotonin receptor agonists 0.8 to 1.52). Quarterly savings through the four therapeutic interchange interventions combined exceeded $200,000 with an estimated annual savings for the health plan of $800,000, or more than $17 per member. A therapeutic interchange clinical decision support tool at the point of prescribing resulted in increased compliance with recommendations for outpatient prescriptions while producing substantial cost savings to the Vanderbilt Employee Health Plan - $17.77 per member per year. Therapeutic interchange rules require rational targeting, appropriate governance, and vigilant content updates.
Schuth, G; Carr, G; Barnes, C; Carling, C; Bradley, P S
2016-01-01
Positional variation in match performance is well established in elite soccer but no information exists on players switching positions. This study investigated the influence of elite players interchanging from one position to another on physical and technical match performance. Data were collected from multiple English Premier League (EPL) seasons using a computerised tracking system. After adhering to stringent inclusion criteria, players were examined across several interchanges: central-defender to fullback (CD-FB, n = 11, 312 observations), central-midfielder to wide-midfielder (CM-WM, n = 7, 171 observations), wide-midfielder to central-midfielder (WM-CM, n = 7, 197 observations) and attacker to wide-midfielder (AT-WM, n = 4, 81 observations). Players interchanging from CD-FB covered markedly more high-intensity running and sprinting distance (effect size [ES]: -1.56 and -1.26), lost more possessions but made more final third entries (ES: -1.23 and -1.55). Interchanging from CM-WM and WM-CM resulted in trivial to moderate differences in both physical (ES: -0.14-0.59 and -0.21-0.39) and technical performances (ES: -0.48-0.64 and -0.36-0.54). Players interchanging from AT-WM demonstrated a moderate difference in high-intensity running without possession (ES: -0.98) and moderate-to-large differences in the number of clearances, tackles and possessions won (ES: -0.77, -1.16 and -1.41). The data demonstrate that the physical and technical demands vary greatly from one interchange to another but utility players seem able to adapt to these positional switches.
Pro EDI in BizTalk Server 2006 R2 electronic document interchange solutions
Beckner, Mark
2008-01-01
As business becomes more dependent on working with partners, suppliers, and other organizations in a streamlined way, Electronic Data Interchange (EDI) is one of the next big waves in connected systems. Microsoft BizTalk Server 2006 R2 offers an efficient, integrated way to deploy EDI solutions, and with the help of this book, readers will see how EDI can be used in their business and how best to get it set up with BizTalk. This book offers insights into the brand-new Biztalk 2006 R2--based EDI functionality, including the far greater flexibility in handling interchange. It gives advice coveri
Linear theory of drift-tearing and interchange modes in a screw pinch
International Nuclear Information System (INIS)
Copenhaver, C.
1978-04-01
A drift dispersion relation, as applied to a resistive incompressible plasma in a screw pinch, is derived. This dispersion relation incorporates both drift-tearing and drift-interchange modes and is valid throughout the collisional regime by including kinetic theory factors. The dispersion relation reduces to the drift-tearing dispersion relation in the zero pressure gradient limit, and to the classical resistive dispersion relation in the zero drift limit. The electron temperature gradient instability is still present. Now, however, the introduction of the interchange-drift instability increases the growth rate further above the tearing-drift case. (orig.) [de
78 FR 6845 - Notice of Final Federal Agency Actions on Proposed Interchange Project in Massachusetts
2013-01-31
..., Cambridge, MA 02142, Monday through Friday 8:00 a.m.-4:30 p.m., 617-494-2419, [email protected]dot.gov . For the Massachusetts Department of Transportation Highway Division (MassDOT): Ms. Mary Hynes, Project Manager... on Proposed Interchange Project in Massachusetts AGENCY: Federal Highway Administration (FHWA), DOT...
Electron density in reasonably real metallic surfaces, including interchange and correlation effects
International Nuclear Information System (INIS)
Moraga, L.A.; Martinez, G.
1981-01-01
By means of a new method, the electron density in a jellium surface is calculated taking in account interchange and correlation effects; reproducing, in this way, the Lang and Kohn results. The new method is self-consistent but not iterative and hence is possible extend it to the solution of the same problem in more reasonably real metallic surfaces. (L.C.) [pt
2010-10-05
... Price Competition and Innovation Act of 2009 (BPCI Act) that amends the Public Health Service Act (PHS... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2010-N-0477] Approval Pathway for Biosimilar and Interchangeable Biological Products; Public Hearing; Request for...
Lanska, Meredith; Olds, Justin M.; Westerman, Deanne L.
2014-01-01
On a recognition memory test, both perceptual and conceptual fluency can engender a sense of familiarity and elicit recognition memory illusions. To date, perceptual and conceptual fluency have been studied separately but are they interchangeable in terms of their influence on recognition judgments? Five experiments compared the effect of…
Interchange stability criteria for anisotropic central-cell plasmas in the tandem mirror GAMMA 10
International Nuclear Information System (INIS)
Hojo, Hitoshi; Inutake, Masaaki; Ichimura, Makoto; Katsumata, Ryota; Watanabe, Tsuguhiro.
1993-05-01
Flute interchange stability of anisotropic central-cell plasmas in the tandem mirror GAMMA 10 is studied numerically. The stability criteria on the beta value is obtained as a function of axial localization length of the pressure in both central and anchor cells. The temperature anisotropy of the plasma is also discussed. (author)
Factors That Influence Running Intensity in Interchange Players in Professional Rugby League.
Delaney, Jace A; Thornton, Heidi R; Duthie, Grant M; Dascombe, Ben J
2016-11-01
Rugby league coaches adopt replacement strategies for their interchange players to maximize running intensity; however, it is important to understand the factors that may influence match performance. To assess the independent factors affecting running intensity sustained by interchange players during professional rugby league. Global positioning system (GPS) data were collected from all interchanged players (starters and nonstarters) in a professional rugby league squad across 24 matches of a National Rugby League season. A multilevel mixed-model approach was employed to establish the effect of various technical (attacking and defensive involvements), temporal (bout duration, time in possession, etc), and situational (season phase, recovery cycle, etc) factors on the relative distance covered and average metabolic power (P met ) during competition. Significant effects were standardized using correlation coefficients, and the likelihood of the effect was described using magnitude-based inferences. Superior intermittent running ability resulted in very likely large increases in both relative distance and P met . As the length of a bout increased, both measures of running intensity exhibited a small decrease. There were at least likely small increases in running intensity for matches played after short recovery cycles and against strong opposition. During a bout, the number of collision-based involvements increased running intensity, whereas time in possession and ball time out of play decreased demands. These data demonstrate a complex interaction of individual- and match-based factors that require consideration when developing interchange strategies, and the manipulation of training loads during shorter recovery periods and against stronger opponents may be beneficial.
A transformation framework for the compositional interchange format for hybrid systems
Hendriks, D.; Schiffelers, R.R.H.; Hüfner, Martin; Sonntag, Christian
2012-01-01
The purpose of the Compositional Interchange Format for hybrid systems (CIF) is to establish inter-operability of a wide range of tools by means of model transformations - using the CIF as intermediate, the implementation of many bi-lateral translators between specific formalisms can be avoided.
A semantic-preserving transformation from the compositional interchange format to UPPAAL
Nadales Agut, D.E.; Reniers, M.A.; Schiffelers, R.R.H.; Jorgensen, K.E.; Beek, van D.A.; Bittanti, S.; Cenedese, A.; Zampieri, S.
2011-01-01
The Compositional Interchange Format (CIF), is a modeling formalism for hybrid systems, that aims to establishing interoperability of a wide range of tools by means of model transformations to and from CIF. UPPAAL is currently a very successful tool for the specification and analysis of timed
New concepts in the abstract format of the Compositional Interchange Format
D.A. van Beek; P.J. Collins (Pieter); D.E. Nadales Agut; J.E. Rooda (Jacobus); R.R.H. Schiffelers; A. Giua; M. Silva (Manuel); J. Zaytoon
2009-01-01
textabstractThe compositional interchange format for hybrid systems (CIF) supports inter-operability of a wide range of tools by means of model transformations to and from the CIF. Work on the CIF takes place in the FP7 Multiform project, and in several other European projects. The CIF consists of
Stevens, J.M.G.; Vervaecke, H.; Vries, Han de; Elsacker, L. van
2005-01-01
Biological market models explain variability in reciprocity and interchange between groups. In groups with a shallow dominance gradient, grooming will be mostly exchanged for itself (i.e. exchange will occur). In groups with steep dominance hierarchies, interchange is expected: individuals will
Energy Technology Data Exchange (ETDEWEB)
Lois Garcia, D.; Monzon de Caceres, A.; Hernandez del Olmo, S.
2016-07-01
Transport interchanges can be considered as a node, where people transfer from one mode to another, and as a place to stay, using facilities and services as well as waiting areas. Reducing disruption of transfer in multimodal trips is a key element for assuring seamless mobility in big cities. Based on previous research (Hernández & Monzón, 2016) this paper aims to explore the predictive capacity of attitudes towards several service factors on general satisfaction with transport interchange. Complementary, it was analyzing how personal and trip characteristics are related to evaluation of some variables, and examining the influence of waiting time on the perceived quality. To that end, a two steps methodology was conducted (personal and on-line interview) in a representative sample of 740 users (54% female, 55% work purpose trip). We performed path analysis to test the model showing a satisfactory statistical fit. The model developed show good performance for predicting general satisfaction at Moncloa Transport Interchange (Madrid, Spain). The outputs of the model indicate that Information and Safety and Security factors predicted 49% of general satisfaction. Furthermore, the results showed also a strong association between evaluation of Design and Environmental quality, factors that not affect directly general satisfaction but do so through Information and Safety & Security perception, acting the last as mediator variables. Nevertheless, spending time queuing inside the interchange show a negative influence on Information and Safety & Security, while age of participants affect negatively to Information, which mean that elder have some cognitive accessibility problems. Moreover, our data shows gender differences in safety perception, since women feel less safe (particularity the youngest) inside the interchange. The results indicate a number of priority measures to enhance. (Author)
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
For the engineer interchange project (coal mine technology field), field survey for collecting information was made on the level and trend of production technology through visits to some coal industry organizations by specialists in Russia which is one candidate for the engineer training project by sending and receiving. Although coal is positioned as an important energy resource in Russia, poor business performance and a decrease in production are reported because of privatization and cur off of subsidies during a transfer period to a market economy. In addition, severe environment surrounding the Russian coal industry such as a delay of facility renewal due to poor funds, overage facilities, and moral reduction of workers due to a rationing delay has a potential for further reduction of production. The research group thus surveyed the current state of the Russian coal industry such as actual production structures, actual coal mines, technical levels, and various problem points in Moscow and Baykal districts. (NEDO)
Lorne, Emmanuel; Diouf, Momar; de Wilde, Robert B P; Fischer, Marc-Olivier
2018-02-01
The Bland-Altman (BA) and percentage error (PE) methods have been previously described to assess the agreement between 2 methods of medical or laboratory measurements. This type of approach raises several problems: the BA methodology constitutes a subjective approach to interchangeability, whereas the PE approach does not take into account the distribution of values over a range. We describe a new methodology that defines an interchangeability rate between 2 methods of measurement and cutoff values that determine the range of interchangeable values. We used a simulated data and a previously published data set to demonstrate the concept of the method. The interchangeability rate of 5 different cardiac output (CO) pulse contour techniques (Wesseling method, LiDCO, PiCCO, Hemac method, and Modelflow) was calculated, in comparison with the reference pulmonary artery thermodilution CO using our new method. In our example, Modelflow with a good interchangeability rate of 93% and a cutoff value of 4.8 L min, was found to be interchangeable with the thermodilution method for >95% of measurements. Modelflow had a higher interchangeability rate compared to Hemac (93% vs 86%; P = .022) or other monitors (Wesseling cZ = 76%, LiDCO = 73%, and PiCCO = 62%; P < .0001). Simulated data and reanalysis of a data set comparing 5 CO monitors against thermodilution CO showed that, depending on the repeatability of the reference method, the interchangeability rate combined with a cutoff value could be used to define the range of values over which interchangeability remains acceptable.
Outcome of a ceftriaxone/cefotaxime interchange programme in a major teaching hospital.
Gutensohn, A; Bunz, D; Frighetto, L; Jewesson, P
1991-01-01
A two-stage intervention programme was performed to enable the effective substitution of ceftriaxone for cefotaxime in a teaching hospital with large numbers of transient prescribers. One hundred and sixteen patients with a variety of bacterial infections were randomized to an open, historical control comparative study to determine if ceftriaxone was an acceptable replacement for cefotaxime. For 6 months prior to the intervention, both cephalosporins were available on formulary. Following an initial informational stage, a therapeutic interchange programme was implemented to convert prescriptions for cefotaxime to ceftriaxone. Ceftriaxone and cefotaxime were equivalent in terms of microbiological and clinical efficacy and patient tolerance in 77 evaluable patients. No changes in prescriber service occurred after the changeover. Post-intervention treatment courses required a ceftriaxone/cefotaxime interchange in 28% of the cases. Ceftriaxone appeared to be a suitable and cost-effective alternative to cefotaxime in this hospital. The intervention programme successfully invoked the formulary change with minimal expense and prescriber opposition.
The influence of finite Larmor radius effects on the radial interchange motions of plasma filaments
DEFF Research Database (Denmark)
Madsen, Jens; Garcia, Odd E.; Larsen, Jeppe Stærk
2011-01-01
The influence of finite Larmor radius (FLR) effects on the perpendicular convection of isolated particle density filaments driven by interchange motions in magnetized plasmas is investigated using a two-moment gyrofluid model. By means of numerical simulations on a two-dimensional, bi-periodic do......The influence of finite Larmor radius (FLR) effects on the perpendicular convection of isolated particle density filaments driven by interchange motions in magnetized plasmas is investigated using a two-moment gyrofluid model. By means of numerical simulations on a two-dimensional, bi......-periodic domain perpendicular to the magnetic field, it is demonstrated that the radial velocities of the blob-like filaments are roughly described by the inertial scaling, which prescribes a velocity proportional to the square root of the summed electron and ion pressures times the square root of the blob width...
Jiang, Jin-Wu; Yang, Nuo; Wang, Bing-Shen; Rabczuk, Timon
2013-04-10
We perform molecular dynamics simulations to investigate the reduction of the thermal conductivity by kinks in silicon nanowires. The reduction percentage can be as high as 70% at room temperature. The temperature dependence of the reduction is also calculated. By calculating phonon polarization vectors, two mechanisms are found to be responsible for the reduced thermal conductivity: (1) the interchanging effect between the longitudinal and transverse phonon modes and (2) the pinching effect, that is, a new type of localization, for the twisting and transverse phonon modes in the kinked silicon nanowires. Our work demonstrates that the phonon interchanging and pinching effects, induced by kinking, are brand-new and effective ways in modulating heat transfer in nanowires, which enables the kinked silicon nanowires to be a promising candidate for thermoelectric materials.
Wen, Weijia
2011-03-03
A polymerase chain reaction (PCR) device for fast amplification and detection of DNA includes an interchangeable PCR chamber, a temperature control component, and an optical detection system. The DNA amplification is performed on an interchangeable chip with volumes as small as 1.25 µl, while the heating and cooling rate may be as fast as 12.7 °C/second ensuring that the total time needed of only 25 minutes to complete the 35 cycle PCR amplification. The PCR may be performed according to a two-temperature approach for denaturing and annealing (Td and Ta) of DNA with the PCR chip, with which the amplification of male-specific SRY gene marker by utilizing raw saliva may be achieved. The genetic identification may be in-situ detected after PCR by the optical detection system.
Interchange on the Civitavecchia Railway Line- Capranica Scalo - Capranica resort Orte Scalo
Directory of Open Access Journals (Sweden)
Elisa Pulvirenti
2014-12-01
Full Text Available The project is an interchange in the territory of Tuscia, in the small town of Capranica Scalo (VT, Italy. It is where two railway lines intersect, the Roma-Viterbo FR3 line and Civitavecchia-Orte line. The latter has been inserted within the TEN -T recognised as an important link for the European freight transport. It is currently subject to a restoration project. Based on the results from the analysis it has been designed a central space, the interchange, for an area larger than the single city centre. It will not only improve the integration between different modes of transport and enhance the traveling and waiting times, but it is proposed as a condenser of entertainment activities, representing also a showroom for the promotion of the territory and enhancement of its resources.
Nonlinear behavior of multiple-helicity resistive interchange modes near marginally stable states
International Nuclear Information System (INIS)
Sugama, Hideo; Nakajima, Noriyoshi; Wakatani, Masahiro.
1991-05-01
Nonlinear behavior of resistive interchange modes near marginally stable states is theoretically studied under the multiple-helicity condition. Reduced fluid equations in the sheared slab configuration are used in order to treat a local transport problem. With the use of the invariance property of local reduced fluid model equations under a transformation between the modes with different rational surfaces, weakly nonlinear theories for single-helicity modes by Hamaguchi and Nakajima are extended to the multiple-helicity case and applied to the resistive interchange modes. We derive the nonlinear amplitude equations of the multiple-helicity modes, from which the convective transport in the saturated state is obtained. It is shown how the convective transport is enhanced by nonlinear interaction between modes with different rational surfaces compared with the single-helicity case. We confirm that theoretical results are in good agreement with direct numerical simulations. (author)
Fast detection of genetic information by an optimized PCR in an interchangeable chip.
Wu, Jinbo
2012-02-01
In this paper, we report the construction of a polymerase chain reaction (PCR) device for fast amplification and detection of DNA. This device consists of an interchangeable PCR chamber, a temperature control component as well as an optical detection system. The DNA amplification happens on an interchangeable chip with the volumes as low as 1.25 μl, while the heating and cooling rate was as fast as 12.7°C/second ensuring that the total time needed of only 25 min to complete the 35 cycle PCR amplification. An optimized PCR with two-temperature approach for denaturing and annealing (Td and Ta) of DNA was also formulated with the PCR chip, with which the amplification of male-specific sex determining region Y (SRY) gene marker by utilizing raw saliva was successfully achieved and the genetic identification was in-situ detected right after PCR by the optical detection system.
Low-dimensional model of resistive interchange convection in magnetized plasma
International Nuclear Information System (INIS)
Bazdenkov, S.; Sato, Tetsuya
1997-09-01
Self-organization and generation of large shear flow component in turbulent resistive interchange convection in magnetized plasma is considered. The effect of plasma density-electrostatic potential coupling via the inertialess electron dynamics along the magnetic field is shown to play significant role in the onset of shear component. The results of large-scale numerical simulation and low-dimensional (reduced) model are presented and compared. (author)
Directory of Open Access Journals (Sweden)
Geng Wang
2015-12-01
Full Text Available AIM: To investigate the difference of macular thickness measurements between stratus optical coherence tomography (OCT and Cirrus OCT (Carl Zeiss Meditec, Dublin, CA, USA in the same myopic patient and to develop a conversion equation to interchange macular thickness obtained with these two OCT devices. METHODS: Eighty-nine healthy Chinese adults with spherical equivalent (SE ranging from -1.13 D to -9.63 D were recruited. The macular thickness was measured by Cirrus OCT and Stratus OCT. The correlation between macular thickness and axial length and the agreement between two OCT measurements were evaluated. A formula was generated to interchange macular thickness obtained with two OCT devices. RESULTS: Average macular thickness measured with Stratus OCT (r=-0.280, P=0.008 and Cirrus OCT (r=-0.224, P=0.034 were found to be negatively correlated with axial length. No statistically significant correlation was found between axial length and central subfield macular thickness (CMT measured with Stratus OCT (r=0.191, P=0.073 and Cirrus OCT (r=0.169, P=0.113. The mean CMT measured with Cirrus OCT was 53.63±7.94 μm thicker than with Stratus OCT. The formula CMTCirrus OCT=78.328+0.874×CMTStratus OCT was generated to interchange macular thickness obtained with two OCT devices. CONCLUSION: Macular thickness measured with Cirrus OCT were thicker than with Stratus OCT in myopic eyes. A formula can be used to interchange macular thickness measured with two OCT devices in myopic eyes. Studies with different OCT devices and larger samples are warranted to enable the comparison of macular values measured with different OCT devices.
Abler, M. C.; Mauel, M. E.; Saperstein, A.
2017-12-01
Plasmas confined by a strong dipole field exhibit interchange and entropy mode turbulence, which previous experiments have shown respond locally to active feedback [1]. On the Collisionless Terrella Experiment (CTX), this turbulence is characterized by low frequency, low order, quasi-coherent modes with complex spectral dynamics. We apply bicoherence analysis [2] to study nonlinear phase coupling in a variety of scenarios. First, we study the self-interaction of the naturally occurring interchange turbulence; this analysis is then expanded to include the effects of single or multiple driven modes in the frequency range of the background turbulent oscillations. Initial measurements of coupling coefficients are presented in both cases. Driven low frequency interchange modes are observed to generate multiple harmonics which persist throughout the plasma, becoming weaker as they propagate away from the actuator in the direction of the electron magnetic drift. Future work is also discussed, including application of wavelet bicoherence analysis and applications to planetary magnetospheres. [1] Roberts, Mauel, and Worstell, Phys Plasmas (2015). [2] Grierson, Worstell, and Mauel, Phys Plasmas (2009). Supported by NSF-DOE Partnership for Plasma Science Grants DOE-DE-FG02-00ER54585 and NSF-PHY-1201896.
Barlas, Stephen
2017-08-01
Pharmaceutical industry sectors are at odds as the Food and Drug Administration seeks to define "interchangeability" for biosimilars. The battle lines vary by topic, but biosimilar marketers, health plans, and drugstores are generally urging lower hurdles.
Lin, Ying Chih; Lu, Chin Lung; Chang, Hwan-You; Tang, Chuan Yi
2005-01-01
In the study of genome rearrangement, the block-interchanges have been proposed recently as a new kind of global rearrangement events affecting a genome by swapping two nonintersecting segments of any length. The so-called block-interchange distance problem, which is equivalent to the sorting-by-block-interchange problem, is to find a minimum series of block-interchanges for transforming one chromosome into another. In this paper, we study this problem by considering the circular chromosomes and propose a Omicron(deltan) time algorithm for solving it by making use of permutation groups in algebra, where n is the length of the circular chromosome and delta is the minimum number of block-interchanges required for the transformation, which can be calculated in Omicron(n) time in advance. Moreover, we obtain analogous results by extending our algorithm to linear chromosomes. Finally, we have implemented our algorithm and applied it to the circular genomic sequences of three human vibrio pathogens for predicting their evolutionary relationships. Consequently, our experimental results coincide with the previous ones obtained by others using a different comparative genomics approach, which implies that the block-interchange events seem to play a significant role in the evolution of vibrio species.
Botulinum toxin type A products are not interchangeable: a review of the evidence
Directory of Open Access Journals (Sweden)
Brin MF
2014-10-01
Full Text Available Mitchell F Brin,1,2 Charmaine James,3 John Maltman1 1Allergan, Inc., Irvine, CA, USA; 2Department of Neurology, University of California, Irvine, CA, USA; 3Allergan, Marlow, UKAbstract: Botulinum toxin type A (BoNTA products are injectable biologic medications derived from Clostridium botulinum bacteria. Several different BoNTA products are marketed in various countries, and they are not interchangeable. Differences between products include manufacturing processes, formulations, and the assay methods used to determine units of biological activity. These differences result in a specific set of interactions between each BoNTA product and the tissue injected. Consequently, the products show differences in their in vivo profiles, including preclinical dose response curves and clinical dosing, efficacy, duration, and safety/adverse events. Most, but not all, published studies document these differences, suggesting that individual BoNTA products act differently depending on experimental and clinical conditions, and these differences may not always be predictable. Differentiation through regulatory approvals provides a measure of confidence in safety and efficacy at the specified doses for each approved indication. Moreover, the products differ in the amount of study to which they have been subjected, as evidenced by the number of publications in the peer-reviewed literature and the quantity and quality of clinical studies. Given that BoNTAs are potent biological products that meet important clinical needs, it is critical to recognize that their dosing and product performance are not interchangeable and each product should be used according to manufacturer guidelines.Keywords: onabotulinumtoxinA, abobotulinumtoxinA, incobotulinumtoxinA, glabellar lines, non-interchangeability
Ionic interchanges and adsorbents of interest in nuclear and environmental processes
International Nuclear Information System (INIS)
Olguin G, M. T.
2010-01-01
The ionic interchanges and the adsorbents are of special interest inside the water treatment processes (industrial or human consumption), as well as for the radionuclides generation, due to their structural characteristics and to their capacity to remove an extensive range of polluting species. In the ININ have been developed researches on these materials, with the purpose of generating new knowledge that serves like base inside radionuclides separation processes or polluted water treatment. The results obtained until the present have been published in different scientific magazines. (Author)
Asymptotics of the spectral gap for the interchange process on large hypercubes
International Nuclear Information System (INIS)
Starr, Shannon; Conomos, Matthew P
2011-01-01
We consider the interchange process (IP) on the d-dimensional, discrete hypercube of side-length n. Specifically, we compare the spectral gap of the IP to the spectral gap of the random walk (RW) on the same graph. We prove that the two spectral gaps are asymptotically equivalent, in the limit n→∞. This result gives further supporting evidence for a conjecture of Aldous, that the spectral gap of the IP equals the spectral gap of the RW on all finite graphs. Our proof is based on an argument invented by Handjani and Jungreis, who proved Aldous's conjecture for all trees
Directory of Open Access Journals (Sweden)
Nelly Oktavia Adiwijaya
2015-03-01
Full Text Available Fertilizer distribution from distributor to agents, are required to be responsive in addressing the demand for fertilizers. Distributors are also required to be able to manage inventory in the warehouse, to avoid overstocking of fertilizer. Design and implementation of a fertilizer retail electronic commerce applications using electronic data interchange (EDI method is applied in this study. The system is built to help distributors to control the existence of the stock of fertilizer so no excess stock. In addition, the use of EDI can provide information quickly (real-time without having to go directly to the warehouse locations.
International Nuclear Information System (INIS)
Adler, V.; Sorensen, J.H.; Rogers, G.O.
1989-01-01
Because the goal of emergency preparedness for both chemical and nuclear hazards is to reduce human exposure to hazardous materials, this paper examines the interchange of lessons learned from emergency planning and accident experience in both industries. While the concerns are slightly different, sufficient similarity is found for each to draw implications from the others experience. Principally the chemical industry can learn from the dominant planning experience associated with nuclear power plants, while the nuclear industry can chiefly learn from the chemical industry's accident experience. 23 refs
ONeil, D. A.; Mankins, J. C.; Christensen, C. B.; Gresham, E. C.
2005-01-01
The Advanced Technology Lifecycle Analysis System (ATLAS), a spreadsheet analysis tool suite, applies parametric equations for sizing and lifecycle cost estimation. Performance, operation, and programmatic data used by the equations come from a Technology Tool Box (TTB) database. In this second TTB Technical Interchange Meeting (TIM), technologists, system model developers, and architecture analysts discussed methods for modeling technology decisions in spreadsheet models, identified specific technology parameters, and defined detailed development requirements. This Conference Publication captures the consensus of the discussions and provides narrative explanations of the tool suite, the database, and applications of ATLAS within NASA s changing environment.
ONeil, D. A.; Craig, D. A.; Christensen, C. B.; Gresham, E. C.
2005-01-01
The objective of this Technical Interchange Meeting was to increase the quantity and quality of technical, cost, and programmatic data used to model the impact of investing in different technologies. The focus of this meeting was the Technology Tool Box (TTB), a database of performance, operations, and programmatic parameters provided by technologists and used by systems engineers. The TTB is the data repository used by a system of models known as the Advanced Technology Lifecycle Analysis System (ATLAS). This report describes the result of the November meeting, and also provides background information on ATLAS and the TTB.
Two-dimensional convection and interchange motions in fluids and magnetized plasmas
DEFF Research Database (Denmark)
Garcia, O.E.; Bian, N.H.; Naulin, V.
2006-01-01
fluids, emphasizing its relation to interchange motions of non- uniformly magnetized plasmas. This is followed by a review of the theories for the onset of convection and quasi-linear saturation in driven-dissipative systems. Non-linear numerical simulations which result in stationary convective states...... behaviour of the fluctuation level which is associated with relaxation oscillations in the kinetic energy of the azimuthally mean flows. This leads to a state of large-scale intermittency manifested by exponential tails in the single-point probability distribution function of the dependent variables...
International Nuclear Information System (INIS)
Eichelberg, M.; Riesmeier, J.; Thiel, A.; Jensch, P.; Emmel, D.; Haderer, A.; Ricke, J.; Stohlmann, L.; Bernarding, J.
2002-01-01
The use of telemedicine is becoming indispensable for a continuous and economical delivery of a high quality of care. However, data protection requirements have to be considered. For the selection of solutions, vendor-independent components based on standards are a prerequisite for a seamless integration into the existing, often heterogeneous, IT infrastructure. The ''Internet protocol'' TCP/IP and the DICOM standard with it's new security extensions form the basis for an internationally standardized and accepted procedure for a secure interchange of radiological images beyond platform boundaries. (orig.) [de
A longitudinal multilevel CFA-MTMM model for interchangeable and structurally different methods
Koch, Tobias; Schultze, Martin; Eid, Michael; Geiser, Christian
2014-01-01
One of the key interests in the social sciences is the investigation of change and stability of a given attribute. Although numerous models have been proposed in the past for analyzing longitudinal data including multilevel and/or latent variable modeling approaches, only few modeling approaches have been developed for studying the construct validity in longitudinal multitrait-multimethod (MTMM) measurement designs. The aim of the present study was to extend the spectrum of current longitudinal modeling approaches for MTMM analysis. Specifically, a new longitudinal multilevel CFA-MTMM model for measurement designs with structurally different and interchangeable methods (called Latent-State-Combination-Of-Methods model, LS-COM) is presented. Interchangeable methods are methods that are randomly sampled from a set of equivalent methods (e.g., multiple student ratings for teaching quality), whereas structurally different methods are methods that cannot be easily replaced by one another (e.g., teacher, self-ratings, principle ratings). Results of a simulation study indicate that the parameters and standard errors in the LS-COM model are well recovered even in conditions with only five observations per estimated model parameter. The advantages and limitations of the LS-COM model relative to other longitudinal MTMM modeling approaches are discussed. PMID:24860515
Random Walk on a Perturbation of the Infinitely-Fast Mixing Interchange Process
Salvi, Michele; Simenhaus, François
2018-03-01
We consider a random walk in dimension d≥1 in a dynamic random environment evolving as an interchange process with rate γ >0 . We prove that, if we choose γ large enough, almost surely the empirical velocity of the walker X_t/t eventually lies in an arbitrary small ball around the annealed drift. This statement is thus a perturbation of the case γ =+∞ where the environment is refreshed between each step of the walker. We extend three-way part of the results of Huveneers and Simenhaus (Electron J Probab 20(105):42, 2015), where the environment was given by the 1-dimensional exclusion process: (i) We deal with any dimension d≥1 ; (ii) We treat the much more general interchange process, where each particle carries a transition vector chosen according to an arbitrary law μ ; (iii) We show that X_t/t is not only in the same direction of the annealed drift, but that it is also close to it.
Parasites of freshwater fishes and the Great American Biotic Interchange: a bridge too far?
Choudhury, A; García-Varela, M; Pérez-Ponce de León, G
2017-03-01
We examine the extent to which adult helminths of freshwater fishes have been part of the Great American Biotic Interchange (GABI), by integrating information in published studies and new data from Panama with fish biogeography and Earth history of Middle America. The review illustrates the following: (1) the helminth fauna south of the Trans-Mexican Volcanic Belt, and especially south of the Isthmus of Tehuantepec, shows strong Neotropical affinities; (2) host-parasite associations follow principles of the 'biogeographic core fauna' in which host-lineage specificity is pronounced; (3) phylogenetic analysis of the widespread freshwater trematode family Allocreadiidae reveals a complex history of host-shifting and co-diversification involving mainly cyprinodontiforms and characids; (4) allocreadiids, monogeneans and spiruridan nematodes of Middle American cyprinodontiforms may provide clues to the evolutionary history of their hosts; and (5) phylogenetic analyses of cryptogonimid trematodes may reveal whether or how cichlids interacted with marine or brackish-water environments during their colonization history. The review shows that 'interchange' is limited and asymmetrical, but simple narratives of northward isthmian dispersal will likely prove inadequate to explain the historical biogeography of many host-parasite associations in tropical Middle America, particularly those involving poeciliids. Finally, our study highlights the urgent need for targeted survey work across Middle America, focused sampling in river drainages of Colombia and Venezuela, and deeper strategic sampling in other parts of South America, in order to develop and test robust hypotheses about fish-parasite associations in Middle America.
Martín-Serrano, María José; Roman-Ortiz, Carmen; Villa-Sáez, M Luz; Labrador-Castellanos, M Purificación; Blanco-Carrasco, Rosario; Lozano-Ballesteros, Felicidad; Pedraza-Martín, Carmen; José-Herrero, M Teresa San; López-Ropero, Ana M; Tenías Burillo, José María
2014-01-01
To estimate in patients awaiting cataract surgery the concordance and interchangeability of axial eye length measurements performed with the aid of various biometric methods (optical or ultrasonic) by different operators (nurses) at different times during the period prior to surgery. We selected 182 consecutive eyes from 91 patients.Ocular axial length was measured with the aid of 2 methods (IOLMaster® and Ocuscan®) by 9 randomly allocated technicians at 2 different times during the waiting period. The concordance between measurements was evaluated by means of the intraclass correlation coefficient (ICC); the interchangeability of the results was assessed with Bland Altman plots and Passing and Bablok regression. The measurements were consistent between biometric methods (ICC 0.975, 95% confidence interval [CI] 0.968 to 0.980) and measurement dates (ICC 0.996, 95% CI 0.995 to 0.997). Interobserver agreement was more heterogeneous (ICC range 0.844 to 0.998). No systematic errors were observed among the various biometric methods and measurement dates. Because measurement of axial length in phakic patients may be technician-dependent, the technician's experience should be noted in the protocols of ophthalmology services.
Random Walk on a Perturbation of the Infinitely-Fast Mixing Interchange Process
Salvi, Michele; Simenhaus, François
2018-05-01
We consider a random walk in dimension d≥ 1 in a dynamic random environment evolving as an interchange process with rate γ >0. We prove that, if we choose γ large enough, almost surely the empirical velocity of the walker X_t/t eventually lies in an arbitrary small ball around the annealed drift. This statement is thus a perturbation of the case γ =+∞ where the environment is refreshed between each step of the walker. We extend three-way part of the results of Huveneers and Simenhaus (Electron J Probab 20(105):42, 2015), where the environment was given by the 1-dimensional exclusion process: (i) We deal with any dimension d≥1; (ii) We treat the much more general interchange process, where each particle carries a transition vector chosen according to an arbitrary law μ ; (iii) We show that X_t/t is not only in the same direction of the annealed drift, but that it is also close to it.
Collisionless interchange instability 1. Numerical simulations of intermediate-scale irregularities
International Nuclear Information System (INIS)
Zargham, S.; Seyler, C.E.
1987-01-01
Numerical simulations of the generalized Rayleigh-Taylor instability are presented. The model and simulations are applicable to bottomside and topside spread F, unstable barium cloud dynamics, and collisional interchange instability in general. The principal result is that the evolution of the effective electric field, and shocklike structures propagating perpendicular to E eff along the extrema of the quasiperiodic structures. The spectral properties of the nonlinear state are analyzed using one-dimensional power spectra calculated along spatial trajectories for selected angles to E eff . In this way a direct comparison to in situ probe data can be made. The inherent anisotropy of the nonlinear state is reflected in major qualitative differences between the spectra taken parallel to and perpendicular to E eff . The fundamental finding of the present work is that anisotropy in interchange dynamics is much greater than had been previously reported. This strong anisotropy can explain much of the spectral and spatial structural characteristics of both bottomside and topside spread F. In a companion paper a comparison of the simulation results to various in situ data sets is given
International Nuclear Information System (INIS)
Maslovsky, D.; Levitt, B.; Mauel, M. E.
2003-01-01
Interchange instabilities excited by energetic electrons trapped by a magnetic dipole nonlinearly saturate and exhibit complex, coherent spectral characteristics and frequency sweeping [H. P. Warren and M. E. Mauel, Phys. Plasmas 2, 4185 (1995)]. When monochromatic radio frequency (rf) fields are applied in the range of 100-1000 MHz, the saturation behavior of the interchange instability changes dramatically. For applied fields of sufficient intensity and pulse-length, coherent interchange fluctuations are suppressed and frequency sweeping is eliminated. When rf fields are switched off, coherent frequency sweeping reappears. Since low frequency interchange instabilities preserve the electron's first and second adiabatic invariants, these observations can be interpreted as resulting from nonlinear resonant wave-particle interactions described within a particle phase-space, (ψ,φ), comprised of the third adiabatic invariant and the azimuthal angle. Self-consistent numerical simulation is used to study (1) the nonlinear development of the instability, (2) the radial mode structure of the interchange instability, and (3) the suppression of frequency sweeping. When the applied rf heating is modeled as an 'rf collisionality', the simulation reproduces frequency sweeping suppression and suggests an explanation for the observations that is consistent with Berk and co-workers [H. L. Berk et al., Phys. Plasmas 6, 3102 (1999)
International Nuclear Information System (INIS)
Roberts, T. M.; Mauel, M. E.; Worstell, M. W.
2015-01-01
Turbulence in plasma confined by a magnetic dipole is dominated by interchange fluctuations with complex dynamics and short spatial coherence. We report the first use of local current-collection feedback to modify, amplify, and suppress these fluctuations. The spatial extent of turbulence regulation is limited to a correlation length near the collector. Changing the gain and phase of collection results in power either extracted from or injected into the turbulence. The measured plasma response shows some agreement with calculations of the linear response of global interchange-like MHD and entropy modes to current-collection feedback
International Nuclear Information System (INIS)
Bjarnason, Elias H.; Arnalds, Unnar B.; Olafsson, Sveinn
2006-01-01
We introduce a novel modular cell based scanning tunneling microscope with external piezoelectric actuators. A tip and a sample are contained in a closed interchangeable cell, consisting of a stiff top plate and a bottom part, fastened together by an elastic material. The bottom part, containing a scanning tip, is fastened to a base unit while the top plate, containing a sample, is capable of scanning motion by external piezoelectric actuators mounted in the same base unit. The actuators are pre-loaded by the deformation of the elastic material of the cell, giving an increased stability. This design is expected to simplify the scanning tunneling microscope (STM) operation in difficult environments greatly by enclosing only the tip and sample in a small cell-module, which is pluggable to a scanning mechanism and other supportive functionalities. A frequency characterization and an image scan showing atomic resolution of highly oriented graphite in air, at room temperature, is presented
The neutronic and fuel cycle performance of interchangeable 3500 MWth metal and oxide fueled LMRs
International Nuclear Information System (INIS)
Fujita, E.K.; Wade, D.C.
1990-01-01
This study summarizes the neutronic and fuel cycle analysis performed at Argonne National Laboratory for an oxide and a metal fueled 3500 MWth LMR. These reactor designs formed the basis for a joint US/European study of LMR ATWS events. The oxide and metal core designs were developed to meet reactor performance specifications that are constrained by requirements for core loading interchangeability and for a small burnup reactivity swing. Differences in the computed performance parameters of the oxide and metal cores, arising from basic differences in their neutronic characteristics, are identified and discussed. It is shown that metal and oxide cores designed to the same ground rules exhibit many similar performance characteristics; however, they differ substantially in reactivity coefficients, control strategies, and fuel cycle options. 12 refs., 2 figs., 12 tabs
Gateau, Jérôme; Rigneault, Hervé; Guillon, Marc
2017-01-27
Intensity maxima and zeros of speckle patterns obtained behind a diffuser are experimentally interchanged by applying a spiral phase delay of charge ±1 to the impinging coherent beam. This transform arises from the expectation that tightly focused beams, which have a planar wave front around the focus, are so changed into vortex beams and vice versa. The statistics of extrema locations and the intensity distribution of the so-generated "complementary" patterns are characterized by numerical simulations. It is demonstrated experimentally that the incoherent superposition of the three "complementary speckle patterns" yield a synthetic speckle grain size enlarged by a factor of sqrt[3]. A cyclic permutation of optical vortices and intensity maxima is unexpectedly observed and discussed.
An XXX male resulting from paternal X-Y interchange and maternal X-X nondisjunction.
Annerén, G; Andersson, M; Page, D C; Brown, L G; Berg, M; Läckgren, G; Gustavson, K H; de la Chapelle, A
1987-01-01
A 2-year-old boy was found to have a 47,XXX karyotype. Restriction-fragment-length-polymorphism analysis showed that, of his three X chromosomes, one is of paternal and two are of maternal origin. The results of Y-DNA hybridization were reminiscent of those in XX males in two respects. First, hybridization to Southern transfers revealed the presence in this XXX male of sequences derived from the Y-chromosomal short arm. Second, in situ hybridization showed that this Y DNA was located on the tip of the X-chromosomal short arm. We conclude that this XXX male resulted from the coincidence of X-X nondisjunction during maternal meiosis and aberrant X-Y interchange either during or prior to paternal meiosis. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 PMID:2889356
Interchange and Infernal Fishbone Modes in Plasmas with Tangentially Injected Beams
International Nuclear Information System (INIS)
Kolesnichenko; Ya.I.; Marchenko; V.S.; White; R.B.
2006-01-01
New energetic particle mode instabilities of fishbone type are predicted. The considered instabilities are driven by the circulating energetic ions. They can arise in plasmas of tokamaks and spherical tori with weak magnetic shear in the wide core region and strong shear at the periphery, provided that the central safety factor is close to the ratio m/n, where m and n are the poloidal mode number and toroidal mode number, respectively. The instability with m = n = 1 has interchange-like spatial structure, whereas the structure of instabilities with m/n > 1 is similar to that of the infernal MHD mode (except for the region in vicinity of the local Alfven resonance)
Anderson Localization from the Berry-Curvature Interchange in Quantum Anomalous Hall Systems
Han, Yulei; Qiao, Zhenhua
In this talk, we theoretically investigate the localization mechanism of the quantum anomalous Hall effect (QAHE) in the presence of spin-flip disorders. We show that the QAHE stays quantized at weak disorders, then enters a Berry-curvature mediated metallic phase at moderate disorders, and finally goes into the Anderson insulating phase at strong disorders. From the phase diagram, we find that at the charge neutrality point although the QAHE is most robust against disorders, the corresponding metallic phase is much easier to be localized into the Anderson insulating phase due to the interchange of Berry curvatures carried, respectively, by the conduction and valence bands. In the end, we provide a phenomenological picture related to the topological charges to better understand the underlying physical origin of the QAHE Anderson localization.
Interchange turbulence model for the edge plasma in SOLEDGE2D-EIRENE
Energy Technology Data Exchange (ETDEWEB)
Bufferand, H.; Marandet, Y. [Aix-Marseille Universite, CNRS, PIIM, Marseille (France); Ciraolo, G.; Ghendrih, P.; Bucalossi, J.; Fedorczak, N.; Gunn, J.; Tamain, P. [CEA, IRFM, Saint-Paul-Lez-Durance (France); Colin, C.; Galassi, D.; Leybros, R.; Serre, E. [Aix-Marseille Universite, CNRS, M2P2, Marseille (France)
2016-08-15
Cross-field transport in edge tokamak plasmas is known to be dominated by turbulent transport. A dedicated effort has been made to simulate this turbulent transport from first principle models but the numerical cost to run these simulations on the ITER scale remains prohibitive. Edge plasma transport study relies mostly nowadays on so-called transport codes where the turbulent transport is taken into account using effective ad-hoc diffusion coefficients. In this contribution, we propose to introduce a transport equation for the turbulence intensity in SOLEDGE2D-EIRENE to describe the interchange turbulence properties. Going beyond the empirical diffusive model, this system automatically generates profiles for the turbulent transport and hence reduces the number of degrees of freedom for edge plasma transport codes. We draw inspiration from the k-epsilon model widely used in the neutral fluid community. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Interchanges genesis Plan of Madrid = Génesis del plan de intercambiadores de Madrid
Directory of Open Access Journals (Sweden)
Javier Aldecoa Martínez-Conde
2018-04-01
Full Text Available The public transport, as we know it today, originates from the end of the 18 th and beginning of the 19th Centuries. Initially a privilege for the aristocratic and bourgeoisie classes, public transport saw a surge in development once communication between Madrid and others distant urban centers became a necessity that demanded a more economical and accessible transport system. The increase of these services, along with the diversification of the means of transportation, quickly caused congestion problems at transfer points. Throughout the last century, these same problems have been confronted with a variety of diverse strategies and solutions. All in all, the history of intermodality in Madrid tells the story of an evolution that has allowed the urban web to unite all of its branches extending from the main gates that are now being converted the interchanges in relation with the city. From its creation in 1985, the CRTM (transport authority of Madrid, considered the intermodality to be a main priority within the following different fields of action: infrastructure, ticketing and whole image and information. Within the interchanges is where the integration efforts of the different transport modes best become a reality. In essence, interchanges play the same role in today`s cities as the gates in the walls of a centuries-old medieval city. At this moment, interchanges are the gates to the cities of the 21st Century. Resumen El transporte público, tal como lo conocemos hoy, se origina a finales del siglo XVIII y principios del XIX. Inicialmente fue un privilegio para las clases aristocráticas y burguesas. El transporte público vio un aumento en el desarrollo una vez que la comunicación entre Madrid y otros centros urbanos distantes se convirtió en una necesidad que exigía un sistema de transporte más económico y accesible. El aumento de estos servicios, junto con la diversificación de los medios de transporte, causó rápidamente problemas
2012-12-14
... harass, harm, pursue, hunt, shoot, wound, kill, trap, capture, or collect, or to attempt to engage in any..., compact soil, and install road surfaces (paving). Install erosion control structures (such as silt fencing... additional highway ramps would be constructed in the other Interchange quadrants. The existing frontage road...
Yu, Shuzhi; Hao, Fanchang; Leong, Hon Wai
2016-02-01
We consider the problem of sorting signed permutations by reversals, transpositions, transreversals, and block-interchanges. The problem arises in the study of species evolution via large-scale genome rearrangement operations. Recently, Hao et al. gave a 2-approximation scheme called genome sorting by bridges (GSB) for solving this problem. Their result extended and unified the results of (i) He and Chen - a 2-approximation algorithm allowing reversals, transpositions, and block-interchanges (by also allowing transversals) and (ii) Hartman and Sharan - a 1.5-approximation algorithm allowing reversals, transpositions, and transversals (by also allowing block-interchanges). The GSB result is based on introduction of three bridge structures in the breakpoint graph, the L-bridge, T-bridge, and X-bridge that models goodreversal, transposition/transreversal, and block-interchange, respectively. However, the paper by Hao et al. focused on proving the 2-approximation GSB scheme and only mention a straightforward [Formula: see text] algorithm. In this paper, we give an [Formula: see text] algorithm for implementing the GSB scheme. The key idea behind our faster GSB algorithm is to represent cycles in the breakpoint graph by their canonical sequences, which greatly simplifies the search for these bridge structures. We also give some comparison results (running time and computed distances) against the original GSB implementation.
Trifirò, Gianluca; Marcianò, Ilaria; Ingrasciotta, Ylenia
2018-03-01
Since 2006, biosimilars have been available in several countries worldwide, thus allowing for potential savings in pharmaceutical expenditure. However, there have been numerous debates about the interchangeability of biosimilars and reference products based on concerns of immunogenicity by switching between biological products, which may cause lack of effect and toxicity. Areas covered: The authors provide the reader with an overview of the different positions of regulatory authorities on the interchangeability and automatic substitution of biosimilars and reference products. Presently, the FDA allows automatic substitution without prescriber intervention if the biosimilar is interchangeable with reference products, while the European Medicines Agency delegate to each single EU member state. Expert opinion: Different approaches in defining interchangeability and automatic substitution call for harmonization to increase confidence of healthcare professionals and patients about the clinical impact of switching. Networks of electronic healthcare records and administrative databases, potentially linkable to clinical charts and registries may rapidly assess frequency and benefit-risk profile of different switching patterns in routine care at different levels, thus integrating and strengthening pre-marketing evidence.
Venema, L.F.; Post, W.J.; Hendriks, H.G.D.; Huet, R.C.G.; de Wolf, J.T.W.; de Vries, A.J.
BACKGROUND: Bedside thromboelastography is increasingly used, but an assessment of the clinical interchangeability of the 2 major systems, TEG (R) (Hemoscope) and RoTEM (R) (Pentapharm), has not been performed. METHODS: We measured blood samples from 46 cardiac surgical patients after induction of
Evaluation of TEG(®) and RoTEM(®) inter-changeability in trauma patients.
Hagemo, Jostein S; Næss, Paal A; Johansson, Pär; Windeløv, Nis A; Cohen, Mitchell Jay; Røislien, Jo; Brohi, Karim; Heier, Hans Erik; Hestnes, Morten; Gaarder, Christine
2013-05-01
Massive haemorrhage is a leading cause of preventable deaths in trauma. Traumatic coagulopathy is frequently present early after trauma, and is associated with increased mortality. A number of recent trials suggest that viscoelastic haemostatic assays (VHA), such as thromboelastography and thromboelastometry, are useful tools in guiding transfusion. Treatment algorithms exist for the use of VHAs but are not validated in traumatic haemorrhage. In this study we examined the inter-changeability of two commonly used VHAs, TEG(®) and RoTEM(®). A total of 184 trauma patients over the age of 18, requiring full trauma team activation, were included at three different hospitals in three different countries (Copenhagen, Denmark, San Francisco, CA, USA and Oslo, Norway). Blood samples were drawn immediately upon arrival, and TEG(®) and RoTEM(®) analyzed simultaneously. Correlations were calculated using. Spearman's rank correlation coefficient. Agreement was evaluated by Bland-Altman plots and calculation of limits of agreement. The mean ISS in the total population was 17, and the mortality was 16.5%. Mean base excess was -2.8 (SD: 4.2). The correlation coefficient for corresponding values for the two devices was 0.24 for the R-time vs CT in all centres combined. For the K-time vs CFT the correlation was 0.48, for the α-angleTEG vs α-angleRoTEM 0.44, and for MA vs MCF 0.76. Limits of agreement exceeded the preset clinically acceptable deviation of 10% for all variables in all centres except for MA/MCF in one centre (Copenhagen). Generally, correlation coefficients were lower and agreement poorer in the one centre (Oslo) where measurements were performed bedside by clinicians. Inter-changeability between TEG(®) and RoTEM(®) is limited in the trauma setting. Agreement seems poorer when clinicians operate the devices. Development and validation of separate treatment algorithms for the two devices is required. Copyright © 2012 Elsevier Ltd. All rights reserved.
Regional consequences of a biotic interchange: insights from the Lessepsian invasion
Nawrot, Rafal; Albano, Paolo G.; Chattopadhyay, Devapriya; Zuschin, Martin
2016-04-01
The fossil record provides ample evidence of large-scale biotic interchanges and their pervasive effects on regional biotas, but mechanisms controlling such events are difficult to decipher in deep time. Massive invasion of Indo-Pacific species into the Mediterranean Sea triggered by the opening of the Suez Canal offers a unique opportunity to examine the ecological consequences of breaking down biogeographic barriers. We developed an extensive database of taxonomic composition, body size and ecological characteristics of the Red Sea and Mediterranean bivalve fauna in order to link biotic selectivity of the invasion process with its effects on the recipient biota. Shallow-water occurrence and presence outside the tropical zone in other regions are the strongest predictors of the successful transition through the Suez Canal. Subsequent establishment of alien species in the Mediterranean Sea correlates with early arrival and preference for hard substrates. Finally, large-bodied species and hard-bottom dwellers are over-represented among the invasive aliens that have reached the spread stage and impose a strong impact on native communities. Although body size is important only at the last invasion stage, alien species are significantly larger compared to native Mediterranean bivalves. This reflects biogeographic difference in the body-size distributions of the source and recipient species pools related to the recent geological history of the Mediterranean Sea. Contrary to the general expectations on the effects of temperature on average body size, continued warming of the Mediterranean Sea accelerates the entry of tropical aliens and thus indirectly leads to increase in the proportion of large-bodied species in local communities and the regional biota. Invasion-driven shifts in species composition are stronger in hard-substrate communities, which host a smaller pool of incumbent species and are more susceptible to the establishment of newcomers. Analogous differences
Energy Technology Data Exchange (ETDEWEB)
van Geemert, R.; Hoogenboom, J.E.; Gibcus, H.P.M. [Technische Univ. Delft (Netherlands). Interfacultair Reactor Inst.; Quist, A.J. [Delft University of Technology, Faculty of Applied Mathematics and Informatics Mekelweg 4, 2628 JB, Delft (Netherlands)
1998-12-01
Fuel shuffling optimization procedures are proposed for the Hoger Onderwijs Reactor (HOR) in Delft, The Netherlands, a 2MWth swimming-pool type research reactor. These procedures are based on the multiple cyclic interchange approach, according to which the search for the reload pattern associated with the highest objective function value can be thought of as divided in multiple stages. The transition from the initial to the final stage is characterized by an increase in the degree of locality of the search procedure. The general idea is that, during the first stages, the `elite` cluster containing the group of best patterns must be located, after which the solution space is sampled in a more and more local sense to find the local optimum in this cluster. The transition(s) from global search behaviour to local search behaviour can be either prompt, by defining strictly separate search regimes, or gradual by introducing stochastic acceptance tests. The possible objectives and the safety and operation constraints, as well as the optimization procedure, are discussed, followed by some optimization results for the HOR. (orig.) 4 refs.
International Nuclear Information System (INIS)
Geemert, R. van; Hoogenboom, J.E.; Gibcus, H.P.M.
1998-01-01
Fuel shuffling optimization procedures are proposed for the Hoger Onderwijs Reactor (HOR) in Delft, The Netherlands, a 2MWth swimming-pool type research reactor. These procedures are based on the multiple cyclic interchange approach, according to which the search for the reload pattern associated with the highest objective function value can be thought of as divided in multiple stages. The transition from the initial to the final stage is characterized by an increase in the degree of locality of the search procedure. The general idea is that, during the first stages, the 'elite' cluster containing the group of best patterns must be located, after which the solution space is sampled in a more and more local sense to find the local optimum in this cluster. The transition(s) from global search behaviour to local search behaviour can be either prompt, by defining strictly separate search regimes, or gradual by introducing stochastic acceptance tests. The possible objectives and the safety and operation constraints, as well as the optimization procedure, are discussed, followed by some optimization results for the HOR. (orig.)
DOD Electronic Commerce (EC)/Electronic Data Interchange (EDI) in contracting report
1993-12-01
Use of Electronic Commerce (EC)/Electronic Data Interchange (EDI) to support Department of Defense (DoD) procurement processes has been under consideration for some time. A 1988 Deputy Secretary of Defense memo calls for maximum use of EDI, based on 10 years of DoD EDI investigation and experiments. In 1990, Defense Management Review Decision 941 stated, 'The strategic goal of DoD's current efforts is to provide the department with the capability to initiate, conduct, and maintain its external business related transactions and internal logistics, contracting, and financial activities without requiring the use of hard copy media.' The EC in Contracting PAT membership reflected a broad cross section of Military Services and Defense Agencies working on a full-time basis for 60 days. The diversity of the EC in Contracting PAT ensured that the needs and concerns of all DoD components were addressed during the creation of the report. The resultant plan, therefore, represents a comprehensive approach for implementing EC throughout the DoD.
The interchangeability of radioisotope and X-ray based measurements of bone mineral density
International Nuclear Information System (INIS)
Adachi, J.D.; Webber, C.E.
1991-01-01
Lumbar spine and femoral neck bone mineral density (BMD) were measured with a Novo radioisotope based dual photon densitometer and with a Lunar X-ray densitometer in 94 subjects attending a Metabolic Bone Disease Clinic. There was a strong correlation between results obtained from each machine. The correlation coefficients for the spine and femoral neck were 0.97 and 0.88, respectively. Differences between results from each machine were normally distributed with a mean bias of 37.5% (spine) and 27.8% (femur), arising principally from differences in machine calibration. In each case the BMD was greater measured by X-ray absorptiometry. The range for the bias was approximately 25-50% for the spine and 10-45% for the femoral neck. The results from these two machines are not interchangeable. When subjects participating in long term studies using a radioisotope densitometer are transferred to an X-ray densitometer, an individual conversion factor must be measured at each site for each subject. (author)
Amazonian magnetostratigraphy: Dating the first pulse of the Great American Faunal Interchange
Campbell, Kenneth E., Jr.; Prothero, Donald R.; Romero-Pittman, Lidia; Hertel, Fritz; Rivera, Nadia
2010-04-01
The chronostratigraphy of the youngest Neogene deposits of the Amazon Basin, which comprise the Madre de Dios Formation in eastern Peru, remains unresolved. Although 40Ar/ 39Ar dates on two volcanic ashes from this formation in Peru provide critical baseline data points, stratigraphic correlations among scattered riverine outcrops in adjacent drainage basins remain problematic. To refine the chronostratigraphy of the Madre de Dios Formation, we report here the magnetostratigraphy of an outcrop on the Madre de Dios River in southeastern Peru. A total of 18 polarity zones was obtained in the ˜65-m-thick Cerro Colorado section, which we correlate to magnetozones Chrons C4Ar to C2An (9.5-3.0 Ma) based on the prior 40Ar/ 39Ar dates. These results confirm the late Miocene age of a gomphothere recovered from the Ipururo Formation, which underlies the late Miocene Ucayali Unconformity at the base of the Cerro Colorado outcrop. The results also support earlier interpretations of a late Miocene age for other fossils of North American mammals recovered from basal conglomeratic deposits of the Madre de Dios Formation immediately above the Ucayali Unconformity. These mammals include other gomphotheres, peccaries, and tapirs, and their presence in South America in the late Miocene is recognized as part of the first pulse of the Great American Faunal Interchange.
Ding, Yuzhe; Huang, Eric; Lam, Kit S; Pan, Tingrui
2013-05-21
Biopatterning has been increasingly used for well-defined cellular microenvironment, patterned surface topology, and guided biological cues; however, it meets challenges on biocompatibility, thermal and chemical sensitivity, as well as limited availability of reagents. In this paper, we aim at combining the desired features from non-contact inkjet printing and dot-matrix impact printing to establish a versatile multiplexed micropatterning platform, referred to as Microfluidic Impact Printer (MI-Printer), for emerging biomedical applications. Using this platform, we can achieve the distinct features of no cross-contamination, sub-microliter ink loading with a minimal dead volume, high-throughput printing, biocompatible non-contact processing, sequential patterning with self-alignment, wide adaptability for complex media (e.g., cell suspension or colloidal solutions), interchangeable/disposable cartridge design, and simple assembly and configuration, all highly desirable towards laboratory-based research and development. Specifically, the printing resolution of the MI-printer platform has been experimentally characterized and theoretically analysed. Optimal printing resolution of 80 μm has been repeatedly obtained. Furthermore, two useful functions of the MI-printer, multiplexed printing and combinatorial printing, have been experimentally demonstrated with less than 10 μm misalignment. Moreover, molecular and biological patterning, utilizing the multiplexed and combinatorial printing, has been implemented to illustrate the utility of this versatile printing technique for emerging biomedical applications.
Summary of Work for Joint Research Interchanges with DARWIN Integrated Product Team 1998
Hesselink, Lambertus
1999-01-01
The intent of Stanford University's SciVis group is to develop technologies that enabled comparative analysis and visualization techniques for simulated and experimental flow fields. These techniques would then be made available under the Joint Research Interchange for potential injection into the DARWIN Workspace Environment (DWE). In the past, we have focused on techniques that exploited feature based comparisons such as shock and vortex extractions. Our current research effort focuses on finding a quantitative comparison of general vector fields based on topological features. Since the method relies on topological information, grid matching and vector alignment is not needed in the comparison. This is often a problem with many data comparison techniques. In addition, since only topology based information is stored and compared for each field, there is a significant compression of information that enables large databases to be quickly searched. This report will briefly (1) describe current technologies in the area of comparison techniques, (2) will describe the theory of our new method and finally (3) summarize a few of the results.
Summary of Work for Joint Research Interchanges with DARWIN Integrated Product Team
Hesselink, Lambertus
1999-01-01
The intent of Stanford University's SciVis group is to develop technologies that enabled comparative analysis and visualization techniques for simulated and experimental flow fields. These techniques would then be made available un- der the Joint Research Interchange for potential injection into the DARWIN Workspace Environment (DWE). In the past, we have focused on techniques that exploited feature based comparisons such as shock and vortex extractions. Our current research effort focuses on finding a quantitative comparison of general vector fields based on topological features. Since the method relies on topological information, grid matching an@ vector alignment is not needed in the comparison. This is often a problem with many data comparison techniques. In addition, since only topology based information is stored and compared for each field, there is a significant compression of information that enables large databases to be quickly searched. This report will briefly (1) describe current technologies in the area of comparison techniques, (2) will describe the theory of our new method and finally (3) summarize a few of the results.
MAPA: Implementation of the Standard Interchange Format and use for analyzing lattices
Shasharina, Svetlana G.; Cary, John R.
1997-05-01
MAPA (Modular Accelerator Physics Analysis) is an object oriented application for accelerator design and analysis with a Motif based graphical user interface. MAPA has been ported to AIX, Linux, HPUX, Solaris, and IRIX. MAPA provides an intuitive environment for accelerator study and design. The user can bring up windows for fully nonlinear analysis of accelerator lattices in any number of dimensions. The current graphical analysis methods of Lifetime plots and Surfaces of Section have been used to analyze the improved lattice designs of Wan, Cary, and Shasharina (this conference). MAPA can now read and write Standard Interchange Format (MAD) accelerator description files and it has a general graphical user interface for adding, changing, and deleting elements. MAPA's consistency checks prevent deletion of used elements and prevent creation of recursive beam lines. Plans include development of a richer set of modeling tools and the ability to invoke existing modeling codes through the MAPA interface. MAPA will be demonstrated on a Pentium 150 laptop running Linux.
International Nuclear Information System (INIS)
Bakken, V.; Jacobsen, T.
The charge exchange cross sections observed for pN interactions at 19 GeV/c in terms of the quark-quark interchange concept are discussed. If one uu-pair and one dd-pair of sea-quarks are assigned to each initial nucleon in pn and pp inelastic reactions, and if these quarks are assumed to participate on equal footing with the valence quarks in a quark-quark interchange mechanism between the two initial nucleons, the ratios between some observed charge exchange cross sections are well reproduced. This indicates that in this model the sea-quarks contribute significantly to the particle production in low p(subT) hadronic processes. (Auth.)
International Nuclear Information System (INIS)
Du, X.D.; Toi, K.; Osakabe, M.
2014-10-01
A resistive interchange mode with bursting behavior and rapid frequency chirping in the range less than 10 kHz is observed for the first time in the magnetic hill region of net current-free, low beta LHD (Large Helical Device) plasmas during high power injection of perpendicular neutral beams. The mode resonates with the precession motion of helically trapped energetic beam ions, following the resonant condition. The radial mode structure is found to be very similar to that of usual pressure-driven interchange mode, of which radial displacement eigenfunction has an even function around the rational surface. This beam driven mode is excited when the beta value of helically trapped energetic ions exceed a certain threshold. The radial transport of helically trapped energetic ions induced by the mode transiently generates significant radial electric field near the plasma peripheral region. Thus generated radial electric field clearly suppresses micro turbulence and improves bulk plasma confinement, suggesting strong flow shear generation. (author)
Hung, Yen-Ni; Yang, Shu-Yu; Kuo, Chian-Jue; Lin, Shih-Ku
2018-03-01
The change in psychiatric diagnoses in clinical practice is not an unusual phenomenon. The interchange between the diagnoses of schizophrenic disorders and bipolar disorders is a major clinical issue because of the differences in treatment regimens and long-term prognoses. In this study, we used a nationwide population-based sample to compare the diagnostic consistency and interchange rate between schizophrenic disorders and bipolar disorders. In total, 25 711 and 11 261 patients newly diagnosed as having schizophrenic disorder and bipolar disorder, respectively, were retrospectively enrolled from the Psychiatric Inpatient Medical Claims database between 2001 and 2005. We followed these two cohorts for 7 years to determine whether their diagnoses were consistent throughout subsequent hospitalizations. The interchange between the two diagnoses was analyzed. In the schizophrenic disorder cohort, the overall diagnostic consistency rate was 87.3% and the rate of change to bipolar disorder was 3.0% during the 7-year follow-up. Additional analyses of subtypes revealed that the change rate from schizoaffective disorder to bipolar disorder was 12.0%. In the bipolar disorder cohort, the overall diagnostic consistency rate was 71.9% and the rate of change to schizophrenic disorder was 8.3%. Changes in the diagnosis of a major psychosis are not uncommon. The interchange between the diagnoses of schizophrenic disorders and bipolar disorders might be attributed to the evolution of clinical symptoms and the observation of preserved social functions that contradict the original diagnosis. While making a psychotic diagnosis, clinicians should be aware of the possibility of the change in diagnosis in the future. © 2017 The Authors. Psychiatry and Clinical Neurosciences © 2017 Japanese Society of Psychiatry and Neurology.
Qian, Yi-Feng; Dai, Jin-Hui; Liu, Rui; Chen, Min-Jie; Zhou, Xing-Tao; Chu, Ren-Yuan
2013-01-01
To investigate refractive and axial responses to the shift of focal plane resulting from the interchange of two monochromatic lights separately corresponding to the peak wavelengths of the cones absorption spectrum in retina, fifty 2-week-old pigmented guinea pigs were randomly assigned to five groups based on the mode of illumination: short-wavelength light (SL), middle-wavelength light (ML) and broad-band white light (BL) for 20 weeks, SL for 10 weeks followed by ML for 10 weeks (STM), as well as ML for 10 weeks followed by SL for 10 weeks (MTS). Biometric and refractive measurements were then performed every 2 weeks. After 10 weeks, SL and STM groups became more hyperopic and had less vitreous elongation than BL group. However, ML and MTS groups became more myopic and had more vitreous elongation. After interchange of the monochromatic light, the refractive error decreased rapidly by about 1.93D and the vitreous length increased by 0.14 mm in STM group from 10 to 12 weeks. After that, there were no significant intergroup differences between STM and BL groups. The interchange from ML to SL quickly increased the refractive error by about 1.53D and decreased the vitreous length by about 0.13 mm in MTS group after two weeks. At this time, there were also no significant intergroup differences between MTS and BL groups. The guinea pig eye can accurately detect the shift in focal plane caused by interchange of two monochromatic lights and rapidly generate refractive and axial responses. However, an excessive compensation was induced. Some properties of photoreceptors or retina may be changed by the monochromatic light to influence the following refractive development.
Directory of Open Access Journals (Sweden)
Yi-Feng Qian
Full Text Available To investigate refractive and axial responses to the shift of focal plane resulting from the interchange of two monochromatic lights separately corresponding to the peak wavelengths of the cones absorption spectrum in retina, fifty 2-week-old pigmented guinea pigs were randomly assigned to five groups based on the mode of illumination: short-wavelength light (SL, middle-wavelength light (ML and broad-band white light (BL for 20 weeks, SL for 10 weeks followed by ML for 10 weeks (STM, as well as ML for 10 weeks followed by SL for 10 weeks (MTS. Biometric and refractive measurements were then performed every 2 weeks. After 10 weeks, SL and STM groups became more hyperopic and had less vitreous elongation than BL group. However, ML and MTS groups became more myopic and had more vitreous elongation. After interchange of the monochromatic light, the refractive error decreased rapidly by about 1.93D and the vitreous length increased by 0.14 mm in STM group from 10 to 12 weeks. After that, there were no significant intergroup differences between STM and BL groups. The interchange from ML to SL quickly increased the refractive error by about 1.53D and decreased the vitreous length by about 0.13 mm in MTS group after two weeks. At this time, there were also no significant intergroup differences between MTS and BL groups. The guinea pig eye can accurately detect the shift in focal plane caused by interchange of two monochromatic lights and rapidly generate refractive and axial responses. However, an excessive compensation was induced. Some properties of photoreceptors or retina may be changed by the monochromatic light to influence the following refractive development.
Prescription Omega-3 Fatty Acid Products and Dietary Supplements Are Not Interchangeable.
Hilleman, Daniel; Smer, Aiman
2016-01-01
To provide an overview of prescription and dietary supplement omega-3 fatty acid (OM3-FA) products and considerations for clinical use. Narrative review. The PubMed database was searched for cardiovascular-related investigations focused on eicosapentaenoic acid (EPA) and/or docosahexaenoic acid (DHA) (limit: English-only articles). Additional regulatory information on prescription and dietary supplements was obtained from United States Food and Drug Administration online sources. Prescription QM3-FA products are supported by robust clinical development and safety monitoring programs, whereas dietary supplements are not required to demonstrate safety or efficacy prior to marketing. There are no over-the-counter OM3-FA products available in the United States. Investigations of OM3-FA dietary supplements show that quantities of EPA and DHA are highly variable within and between brands. Dietary supplements also may contain potentially harmful components, including oxidized OM3-FA, other lipids, cholesterol, and toxins. Prescription OM3-FA products may contain DHA and EPA or EPA alone. All prescription OM3-FA products have demonstrated statistically significant triglyceride reduction as monotherapy or in combination with statins in patients with hypertriglyceridemia. Differential effects between products containing EPA and DHA compared with a high-purity EPA product (icosapent ethyl) have clinical implications: Increases in low-density lipoprotein cholesterol associated with DHA have the potential to confound strategies for managing patients with dyslipidemia. Cardiovascular outcomes studies of prescription CM3-FA products are ongoing. OM3-FA dietary supplements should not be substituted for prescription products, and prescription OM3-FA products that contain DHA are not equivalent to or interchangeable with high-purity EPA (icosapent ethyl) and should not be substituted for it.
First North American fossil monkey and early Miocene tropical biotic interchange
Bloch, Jonathan I.; Woodruff, Emily D.; Wood, Aaron R.; Rincon, Aldo F.; Harrington, Arianna R.; Morgan, Gary S.; Foster, David A.; Montes, Camilo; Jaramillo, Carlos A.; Jud, Nathan A.; Jones, Douglas S.; MacFadden, Bruce J.
2016-05-01
New World monkeys (platyrrhines) are a diverse part of modern tropical ecosystems in North and South America, yet their early evolutionary history in the tropics is largely unknown. Molecular divergence estimates suggest that primates arrived in tropical Central America, the southern-most extent of the North American landmass, with several dispersals from South America starting with the emergence of the Isthmus of Panama 3-4 million years ago (Ma). The complete absence of primate fossils from Central America has, however, limited our understanding of their history in the New World. Here we present the first description of a fossil monkey recovered from the North American landmass, the oldest known crown platyrrhine, from a precisely dated 20.9-Ma layer in the Las Cascadas Formation in the Panama Canal Basin, Panama. This discovery suggests that family-level diversification of extant New World monkeys occurred in the tropics, with new divergence estimates for Cebidae between 22 and 25 Ma, and provides the oldest fossil evidence for mammalian interchange between South and North America. The timing is consistent with recent tectonic reconstructions of a relatively narrow Central American Seaway in the early Miocene epoch, coincident with over-water dispersals inferred for many other groups of animals and plants. Discovery of an early Miocene primate in Panama provides evidence for a circum-Caribbean tropical distribution of New World monkeys by this time, with ocean barriers not wholly restricting their northward movements, requiring a complex set of ecological factors to explain their absence in well-sampled similarly aged localities at higher latitudes of North America.
Directory of Open Access Journals (Sweden)
Cara L Fiore
2015-04-01
Full Text Available Compared to our understanding of the taxonomic composition of the symbiotic microbes in marine sponges, the functional diversity of these symbionts is largely unknown. Furthermore, the application of genomic, transcriptomic, and proteomic techniques to functional questions on sponge host-symbiont interactions is in its infancy. In this study, we generated a transcriptome for the host and a metatranscriptome of its microbial symbionts for the giant barrel sponge, Xestospongia muta, from the Caribbean. In combination with a gene-specific approach, our goals were to 1 characterize genetic evidence for nitrogen cycling in X. muta, an important limiting nutrient on coral reefs 2 identify which prokaryotic symbiont lineages are metabolically active and, 3 characterize the metabolic potential of the prokaryotic community. Xestospongia muta expresses genes from multiple nitrogen transformation pathways that when combined with the abundance of this sponge, and previous data on dissolved inorganic nitrogen fluxes, shows that this sponge is an important contributor to nitrogen cycling on coral reefs. Additionally, we observed significant differences in gene expression of the archaeal amoA gene, which is involved in ammonia oxidation, between coral reef locations consistent with differences in the fluxes of dissolved inorganic nitrogen previously reported. In regards to symbiont metabolic potential, the genes in the biosynthetic pathways of several amino acids were present in the prokaryotic metatranscriptome dataset but in the host-derived transcripts only the catabolic reactions for these amino acids were present. A similar pattern was observed for the B vitamins (riboflavin, biotin, thiamin, cobalamin. These results expand our understanding of biogeochemical cycling in sponges, and the metabolic interchange highlighted here advances the field of symbiont physiology by elucidating specific metabolic pathways where there is high potential for host
Lapin Data Interchange Among Database, Analysis and Display Programs Using XML-Based Text Files
2005-01-01
The purpose of grant NCC3-966 was to investigate and evaluate the interchange of application-specific data among multiple programs each carrying out part of the analysis and design task. This has been carried out previously by creating a custom program to read data produced by one application and then write that data to a file whose format is specific to the second application that needs all or part of that data. In this investigation, data of interest is described using the XML markup language that allows the data to be stored in a text-string. Software to transform output data of a task into an XML-string and software to read an XML string and extract all or a portion of the data needed for another application is used to link two independent applications together as part of an overall design effort. This approach was initially used with a standard analysis program, Lapin, along with standard applications a standard spreadsheet program, a relational database program, and a conventional dialog and display program to demonstrate the successful sharing of data among independent programs. Most of the effort beyond that demonstration has been concentrated on the inclusion of more complex display programs. Specifically, a custom-written windowing program organized around dialogs to control the interactions have been combined with an independent CAD program (Open Cascade) that supports sophisticated display of CAD elements such as lines, spline curves, and surfaces and turbine-blade data produced by an independent blade design program (UD0300).
Directory of Open Access Journals (Sweden)
Guanghua Han
2017-06-01
Full Text Available This paper studies the risks in demand information sharing applications by electronic soft-orders using electronic data interchange (EDI systems in e-commerce and aims to suggest a sustainable regulation mechanism with a trust-embedded contract. In a supply chain with one retailer and one supplier, the retailer solicits private forecasted demand and places soft-orders via EDI to the supplier. To ensure abundant supply, the retailer has an incentive to inflate her soft-orders, which potentially harms the credible information sharing and sustainability of business cooperation. Normally, the degree to which the supplier relies on the retailer’s order information is specified by trust, which is evaluated according to the retailer’s reputation and supplier’s intuition in this study. Based on standard game theory, we find that both the retailer’s order and the quantity of supplier prepared materials are independent of the retailer’s forecast. Therefore, EDI based information sharing in e-commerce without a regulation mechanism leads to inefficient demand information sharing. Since both the supplier and retailer are proved to faces huge of potential profit losses due to the failure of information sharing, the commerce by EDI based information sharing is full of risk and unsustainable. Therefore, a regulation mechanism that leaded by the retailer is proposed to establish ‘win-win’ sustainable cooperation. Numerical experiments highlight the value of trust, the impact of reputation and intuition in decisions, and the effectiveness of the regulation mechanism by a cost-sharing contract.
Linear studies of resistive interchange modes in a cylindrical reversed field pinch
International Nuclear Information System (INIS)
Mirin, A.A.; O'Neill, N.J.; Killeen, J.; Bonugli, R.J.; Ellis, M.J.
1986-01-01
Resistive interchange modes in a cylindrical reversed field pinch are studied using a one-dimensional, linear, compressible initial value code. Separate equations for the electron and ion temperature perturbations are solved. Hall terms and the thermal force vector are included in Ohm's law. Anisotropic thermal conductivity and viscosity are included in the code model. Calculations are carried out for various values of poloidal and toroidal mode number, Lundquist number, Suydam parameter, Hall parameter, thermal conductivity, viscosity, etc., with respect to uniform density equilibria known to be stable to tearing modes. It is shown that in the cold ion limit sufficiently large Hall terms cause all modes that are tested to become stable. However for T/sub i/ = T/sub e/ and ignoring the effects of viscosity and thermal conductivity, there is a critical value of the ratio of Alfven to ion cyclotron frequency above which the ''even'' mode not only dominates the ''odd'' mode but is likely to have a growth rate significantly larger than that of the odd mode in the absence of Hall terms. Inclusion of a classical tensor thermal conductivity, while having little effect on the odd mode in the absence of Hall terms, does stabilize the even mode for sufficiently large Hall parameter. Inclusion of a classical tensor viscosity reduces the growth rate of (but does not necessarily stabilize) the odd mode. Inclusion of Hall and thermal force terms, tensor thermal conductivity and tensor viscosity causes all modes that are tested to stabilize. Results are compared to other contemporary studies
1993-12-01
Finite Difference Methods (FDM) and Finite Element Methods (FEM) studies are reported studying the soil nail wall construction at the Swift Delta I-5 Interchange bridge reconstruction in North Portland, Oregon. Five layers of soil nails were installe...
Howell, Joe; Sanders, Clark W.
2000-01-01
The University of Alabama in Huntsville's (UAH) Propulsion Research Center hosted the Space Solar Power Exploratory Research & Technology (SERT) Technical Interchange Meeting TIM) 2 in Huntsville, Alabama December 7-10. 1999 with 126 people in attendance. The SERT program includes both competitively procured activities. which are being implemented through a portfolio of focused R&D investments--with the maximum leveraging of existing resources inside and outside NASA. and guided by these system studies. Axel Roth. Director of the Flight Projects Directorate NASA MSFC, welcomed the SERT TIM 2 participants and challenged them to develop the necessary technologies and demonstrations that will lead to Space Solar Power (SSP) International implementation. Joe Howell, NASA MSFC, reiterated the SERT TIM 2 objectives: 1) Refining and modeling systems approaches for the utilization of SSP concepts and technologies, ranging, from the near-term e.g. for space science, exploration and commercial space applications to the far-term (e. g. SSP for terrestrial markets), including systems concepts, technology, infrastructure (i.g., transportation), and economics. 2) Conducting technology research, development and demonstration activities to produce "proof- of-concept" validation of critical SSP elements for both the nearer and farther-term applications. 3) Initiating partnerships Nationality and Internationally that could be expanded, as appropriate, to pursue later SSP technology and applications (e.g., space science. colonization, etc.). Day one began with the NASA Centers presenting their SERT activities summary since SERT TIM 1 and wound up with a presentation by Masahiro Mori, NASDA titled "NASDA In-house Study for SSP". Demonstration for the Near-Term. Day two began with the SERT Systems Studies and Analysis reports resulting from NRA 8-23 followed by presentations of SERT Technology Demonstrations reports resulting from NRA 8-23. Day two closed with John Mankins presentation
Kwok, Hin; Chan, Koon Wing; Chan, Kwok Hung; Chiang, Alan Kwok Shing
2015-01-01
Our study aimed at investigating the distribution, persistence and interchange of viral strains among peripheral blood mononuclear cells (PBMC), plasma and saliva of primary Epstein-Barr virus (EBV) infection subjects. Twelve infectious mononucleosis (IM) patients and eight asymptomatic individuals (AS) with primary EBV infection were followed longitudinally at several time points for one year from the time of diagnosis, when blood and saliva samples were collected and separated into PBMC, plasma and saliva, representing circulating B cell, plasma and epithelial cell compartments, respectively. To survey the viral strains, genotyping assays for the natural polymorphisms in two latent EBV genes, EBNA2 and LMP1, were performed and consisted of real-time PCR on EBNA2 to distinguish type 1 and 2 viruses, fluorescent-based 30-bp typing assay on LMP1 to distinguish deletion and wild type LMP1, and fluorescent-based heteroduplex tracking assays on both EBNA2 and LMP1 to distinguish defined polymorphic variants. No discernible differences were observed between IM patients and AS. Multiple viral strains were acquired early at the start of infection. Stable persistence of dominant EBV strains in the same tissue compartment was observed throughout the longitudinal samples. LMP1-defined strains, China 1, China 2 and Mediterranean+, were the most common strains observed. EBNA2-defined groups 1 and 3e predominated the PBMC and saliva compartments. Concordance of EBNA2 and LMP1 strains between PBMC and saliva suggested ready interchange of viruses between circulating B cell and epithelial cell pools, whilst discordance of viral strains observed between plasma and PBMC/saliva indicated presence of viral pools in other undetermined tissue compartments. Taken together, the results indicated that the distribution, persistence and interchange of viral strains among the tissue compartments are more complex than those proposed by the current model of EBV life cycle.
International Nuclear Information System (INIS)
Uchida, Y.; Sakurai, T.
1977-01-01
In this paper it is proposed that the basic behaviors of newly-emerged magnetic regions (NEMR) as seen in EUV and soft X-rays from space are interpreted by the interchange instability of the magnetic field of NEMR in the global situation surrounding it. It is shown that the situation with the NEMR is unstable against the interchange instability, and a continual relaxation to the lower energy state, or a continual invasion of the magnetic flux of the NEMR to the ambient region in the form of fine bundles or thin sheets, will take place in a short time scale of tau 1 approximately L/Vsub(A) following the change in the boundary condition at the photosphere. The second and the final relaxation is shown to be the enhanced Joule dissipation in a time scale of hours to several days occurring in the thin current sheets on the interface of this intermingled structure which is distributed in a large volume. This hypothesis may provide an explanation for the heating of NEMR to an X-ray emitting temperature, which is otherwise rather difficult to explain. The observed fast reconnection without appreciable flares (except for some smaller brightenings) is another aspect which can be explained in the present hypothesis. Namely, since the situation with the NEMR is unstable for the interchange from the beginning, the stressed configuration is relaxed before storing appreciable energy in the form of magnetic stress and therefore without a drastic release of a large amount of stored stress energy in the form of a flare. (Auth.)
International Nuclear Information System (INIS)
El-Hawary, M.E.; El-Hawary, F.; Mbamalu, G.A.N.
1991-01-01
A questionnaire was mailed to ten Canadian utilities to determine the methods the utilities use in determining the incremental cost of delivering energy at any time. The questionnaire was divided into three parts: generation, transmission and general. The generation section dealt with heat rates, fuel, operation and maintenance, startup and shutdown, and method of prioritizing and economic evaluation of interchange transactions. Transmission dealt with inclusion of transmission system incremental maintenance costs, and transmission losses determination. The general section dealt with incremental costs aspects, and various other economic considerations. A summary is presented of responses to the questionnaire
International Nuclear Information System (INIS)
Budtov, A.A.; Klinov, A.P.; Krestianinov, A.S.
2004-01-01
A series of compact linear electron accelerators for 1.9, 2.5 and 4.0 MeV equipped with a local radiation shielding has been designed and constructed in the NPK LUTS, the D.V.Efremov Institute (NIIEFA). The accelerators are intended for mobile facilities used for customs inspection of large-scale containers. Results of optimizing calculations of irradiator parameters and electron dynamics, verified under accelerators testing, are presented in the report. The main design approaches allowing the construction of unified accelerators with interchangeable accelerating structures for energies in the range of 1.9...4.0 MeV are also given
Inoue, H; Hirobe, M
1987-05-29
The interchange reaction of disulfides was caused by the copper(II)/ascorbic acid/O2 system. The incubation of two symmetric disulfides, L-cystinyl-bis-L-phenylalanine (PP) and L-cystinyl-bis-L-tyrosine (TT), with L-ascorbic acid and CuSO4 in potassium phosphate buffer (pH 7.2, 50 mM) resulted in the formation of an asymmetric disulfide, L-cystinyl-L-phenylalanine-L-tyrosine (PT), and the final ratio of PP:PT:TT was 1:2:1. As the reaction was inhibited by catalase and DMSO only at the initial time, hydroxyl radical generated by the copper(II)/ascorbic acid/O2 system seemed to be responsible for the initiation of the reaction. Oxytocin and insulin were denatured by this system, and catalase and DMSO similarly inhibited these denaturations. As the composition of amino acids was unchanged after the reaction, hydroxyl radical was thought to cause the cleavage and/or interchange reaction of disulfides to denature the peptides.
Directory of Open Access Journals (Sweden)
Andrea Angélica Bernal Figueroa
2014-05-01
Full Text Available One of the limitations on acid sulphated soils (SSA is related to the inhibition in the absorption of interchangeable bases generated mainly by excesses of aluminum oxide of change; this affects its productivity and limits the availability of nutrients for plants. This research evaluated in greenhouse, the effect of fodder beet (Beta vulgaris L., forage turnip (Brassica rapa L. and fodder radish (Raphanus sativus L. on the interchangeable bases of an SSA, contrasted with a not sulfated ground, in order to identify species for management and rehabilitation of these soils in Paipa (Boyacá. An experimental design was implemented with 6 treatments and 3 repetitions in which the basis measurement was made in the ground before and after the species plating and the measured leaf area and plants height when their vegetative period ended. Several significative statistic differences were found (P<0.01 in the basis concentration, as well as in the variables in the leaf area and height of the plant. The results indicated that the growth of the turnip (B. rapa and horseradish (R. sativus fodder, along with the complementary use of calcareous amendments as a corrective, led to an increase in the concentrations of Ca, Mg, K, and Na in the SSA, and presented a better growth and resistance to them. Similarly, the planting of fodder beet (B. vulgaris generated positive effects in the soil; however, the height and leaf area of this species were affected in the SSA, which limits their productivity.
Carne, Charlotte; Wiper, Sue; Semple, Stuart
2011-11-01
Evidence from a range of primate species indicates that grooming can be exchanged either for itself or for other rank-related "commodities," such as agonistic support, feeding tolerance, or reduced aggression. Patterns of exchange behavior have been found to vary considerably between species, and understanding the causes of this variation is central to the study of the evolution of primate social systems. It is, therefore, essential that exchange behavior is examined in a wide range of species and settings. This article is the first to explore the reciprocation and interchange of grooming in the Barbary macaque (Macaca sylvanus). We collected focal data on semi-free-ranging adult female Barbary macaques at Trentham Monkey Forest, England, and analyzed dyadic data using Generalized Linear Mixed Models. We found evidence for the reciprocal exchange of grooming and for the interchange of grooming for agonistic support and tolerance while feeding. There was no evidence that grooming was traded for a reduction in aggression; indeed, we found a positive relationship between aggression given and grooming received. This may reflect the "extortion" of grooming from subordinates by dominant animals. These results will facilitate comparative analyses of exchange behavior by adding to the current database a new species, characterized by a different social style from those macaque species previously investigated. © 2011 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Dassisti, M.; Carnimeo, L.
2013-01-01
European energy policy pursues the objective of a sustainable, competitive and reliable supply of energy. In 2007, the European Commission adopted a proper energy policy for Europe supported by several documents and included an action plan to meet the major energy challenges Europe has to face. A farsighted diversified yearly mix of energies was suggested to countries, aiming at increasing security of supply and efficiency, but a wide and systemic view of energy interchanges between states was missing. In this paper, a Small-World methodology of analysis of Interchange Energy-Networks (IENs) is presented, with the aim of providing a useful tool for planning sustainable energy policies. A proof case is presented to validate the methodology by considering the European IEN behaviour in the period of economical crisis. This network is approached as a Small World Net from a modelling point of view, by supposing that connections between States are characterised by a probability value depending on economic/political relations between countries. - Highlights: • Different view of the imports and exports of electric energy flows between European for potential use in ruling exchanges. • Panel data from 1996 to 2010 as part of a network of exchanges was considered from Eurostat official database. • The European import/export energy flows modelled as a network with Small World phenomena, interpreting the evolution over the years. • Interesting systemic tool for ruling and governing energy flows between countries
Effect of fast electrons on the stability of resistive interchange modes in the TJ-II stellarator
Energy Technology Data Exchange (ETDEWEB)
García, L. [Universidad Carlos III de Madrid, Avda. de la Universidad 30, 28911 Leganés, Madrid (Spain); Ochando, M. A.; Hidalgo, C.; Milligen, B. Ph. van [CIEMAT - Laboratorio Nacional de Fusión, Avda. Complutense 40, 28040 Madrid (Spain); Carreras, B. A. [BACV Solutions, 110 Mohawk Road, Oak Ridge, Tennessee 37830 (United States); Carralero, D. [Max-Planck-Institute for Plasma Physics, Boltzmannstr. 2, Garching (Germany)
2016-06-15
In this paper, we report on electromagnetic phenomena in low-β plasmas at the TJ-II stellarator, controlled by external heating. To understand the observations qualitatively, we introduce a simple modification of the standard resistive MHD equations, to include the potential impact of fast electrons on instabilities. The dominant instabilities of the modeling regime are resistive interchange modes, and calculations are performed in a configuration with similar characteristics as the TJ-II stellarator. The main effect of the trapping of fast electrons by magnetic islands induced by MHD instabilities is to increase the magnetic component of the fluctuations, changing the character of the instability to tearing-like and modifying the frequency of the modes. These effects seem to be consistent with some of the experimental observations.
International Nuclear Information System (INIS)
Minami, R.; Cho, T.; Kohagura, J.
2002-01-01
Observations of internal core plasma structural behaviour during the magnetohydrodynamic (MHD) destabilization of the central cell plasmas are carried out by the use of our developed semiconductor x-ray detector arrays installed in both central cell and anchor regions of the GAMMA 10 tandem mirror. In the present paper, it is found from the developed x-ray diagnostics that the bulk plasmas rotate without a change in its shape and structure with an ExB velocity during the destabilization. The onset of the off-axis rotation is identified to be closely related to a scaling of the MHD stability boundary (i.e. the anchor beta requirements for stabilizing central cell hot ion plasmas). These data confirm pressure driven interchange instability in tandem mirror plasmas, and reveal the rigid rotational bulk plasma structure as the first demonstrated interior plasma property during the destabilization. (author)
Farfán-Heredia, Berenice; Casas, Alejandro; Moreno-Calles, Ana I; García-Frapolli, Eduardo; Castilleja, Aída
2018-01-15
Interactions between societies and nature are regulated by complex systems of beliefs, symbolism, customs, and worldviews (kosmos), ecological knowledge (corpus), and management strategies and practices (praxis), which are constructed as product of experiences and communication of people throughout time. These aspects influence social relations, life strategies, and cultural identity, and all of them in turn influence and are influenced by local and regional patterns of interchange. In this study, we analyze the interchange of wild and weedy plants and mushrooms in traditional markets of the Phurépecha region of Mexico. Particularly, the social relations constructed around the interchange of these products; how knowledge, cultural values, and ecological factors influence and are influenced by interchange; and how all these factors influence the type and intensity of biotic resources management. We studied three main traditional markets of the Phurépecha region of Michoacán, Mexico, through 140 visits to markets and 60 semi-structured interviews to sellers of wild and weedy plants and mushrooms. In nearly 2 years, we carried out 80 visits and 30 interviews in the "Barter Market", 20 visits and 15 interviews in the "Phurépecha Tiánguis", and 40 visits and 15 interviews to the "Municipal Market". We documented information about the spaces of interchange that form the markets, the types of interchange occurring there, the cultural and economic values of the resources studied, the environmental units that are sources of such resources, the activities associated to resources harvesting and, particularly, the management techniques practiced to ensure or increase their availability. We analyzed the relations between the amounts of products interchanged, considered as pressures on the resources; the perception of their abundance or scarcity, considered as the magnitude of risk in relation to the pressures referred to; and the management types as response to pressures
Crutchley, Jody
2015-01-01
This article explores the experiences of teachers who participated in the League of the Empire's "Interchange of Home and Dominion Teachers" scheme through a tripartite approach to "British World" space. First, it identifies the mechanisms through which exchanges were established. It analyses the patterns of teacher mobility…
Zaid, Abdel Naser; Mousa, Ayman; Ghazal, Nadia; Bustami, Rana
2015-01-01
Montelukast is a leukotriene receptor antagonist. The release of leukotrienes causes narrowing and constricting in the respiratory airways. Blocking the action of these leukotrienes, montelukast can be used for the prophylaxis and treatment of chronic asthma. The aim of this study was to evaluate the interchangeability and comparative effectiveness between a generic and a brand montelukast 10 mg immediate release tablets (Broncast(®) and Singulair(®), respectively) after a single oral dose among Arab Mediterranean volunteers. An open-label, randomized two-period crossover bioequivalence design was conducted in 31 healthy male volunteers with a 1 week washout between each study period and under fasting conditions. The plasma drug concentration was assessed by using a previously validated LC MS/MS method. The ratio between the generic and brand of geometric least squares means was reported for both generic and brand products. Moreover, an in vitro dissolution study was conducted on generic and brand tablets using three different pH media, and similarity and non-similarity factors (f2 and f1) were calculated. The used bioanalytical method was found to be linear within the range 6.098-365.855 ng/mL. The correlation coefficient was close to 0.999 during the course of the study validation. Statistical comparison of the main pharmacokinetic parameters showed the inexistence of any significant difference between generic and the brand. The point estimates (ratios of geometric means) were 111.939, 111.711, and 112.169 % for AUC0-24, AUC0-∞, and Cmax, respectively. The 90 % confidence intervals (CIs) were within the pre-defined limits of 80.00-125.00 % as specified by the FDA and EMA for bioequivalence studies. F2 and f1 were higher than 50 and lower than 15, respectively in all selected pH media. Broncast(®) immediate release film coated tablets (10 mg/tablet) are bioequivalent to Singulair(®) immediate release film coated tablets (10 mg/tablet), with a
Mitchell, D. G.; Krimigis, S. M.; Krupp, N.; Paranicas, C.; Roussos, E.; Kollmann, P.
2017-12-01
We present observations from the final orbits of the Cassini Mission at Saturn by the Magnetospheric Imaging Instrument (MIMI). Crossing inside the D-Ring at the equator and just above Saturn's atmosphere, these orbits covered regions never visited previously in the mission. Highlights include the confirmation of an inner radiation belt analogous to the inner radiation belt at Earth by the Low Energy Magnetospheric Measurement System (LEMMS), with surprising twists—Saturn's D-ring material appears to be a source for these particles. Details will be presented in another session. The Grand Finale orbits also afforded a close-up view of the auroral ion acceleration regions by the Ion and Neutral Camera (INCA). Ionospheric ions at the base of auroral field lines are accelerated perpendicular to the magnetic field to 10's and 100's of keV, and charge exchange with exospheric neutrals to be emitted as energetic neutral atoms and images by INCA. We show that this acceleration region lies at about 0.1 Rs. Another feature seen previously in the mission but imaged with greater resolution is a flow channel associated with interchange motion in the middle magnetosphere. We show this feature to extend over several Saturn radii in the radial direction, and over about 2 Saturn radii azimuthally. Additional data have been received since the writing of this abstract and before Cassini's plunge into the atmosphere on September 15, so additional features may be presented.
Carrillo, Juan D.; Forasiepi, Analía; Jaramillo, Carlos; Sánchez-Villagra, Marcelo R.
2015-01-01
The vast mammal diversity of the Neotropics is the result of a long evolutionary history. During most of the Cenozoic, South America was an island continent with an endemic mammalian fauna. This isolation ceased during the late Neogene after the formation of the Isthmus of Panama, resulting in an event known as the Great American Biotic Interchange (GABI). In this study, we investigate biogeographic patterns in South America, just before or when the first immigrants are recorded and we review the temporal and geographical distribution of fossil mammals during the GABI. We performed a dissimilarity analysis which grouped the faunal assemblages according to their age and their geographic distribution. Our data support the differentiation between tropical and temperate assemblages in South America during the middle and late Miocene. The GABI begins during the late Miocene (~10–7 Ma) and the putative oldest migrations are recorded in the temperate region, where the number of GABI participants rapidly increases after ~5 Ma and this trend continues during the Pleistocene. A sampling bias toward higher latitudes and younger records challenges the study of the temporal and geographic patterns of the GABI. PMID:25601879
Lawton, Zachary E; Traub, Angelica; Fatigante, William L; Mancias, Jose; O'Leary, Adam E; Hall, Seth E; Wieland, Jamie R; Oberacher, Herbert; Gizzi, Michael C; Mulligan, Christopher C
2017-06-01
Forensic evidentiary backlogs are indicative of the growing need for cost-effective, high-throughput instrumental methods. One such emerging technology that shows high promise in meeting this demand while also allowing on-site forensic investigation is portable mass spectrometric (MS) instrumentation, particularly that which enables the coupling to ambient ionization techniques. While the benefits of rapid, on-site screening of contraband can be anticipated, the inherent legal implications of field-collected data necessitates that the analytical performance of technology employed be commensurate with accepted techniques. To this end, comprehensive analytical validation studies are required before broad incorporation by forensic practitioners can be considered, and are the focus of this work. Pertinent performance characteristics such as throughput, selectivity, accuracy/precision, method robustness, and ruggedness have been investigated. Reliability in the form of false positive/negative response rates is also assessed, examining the effect of variables such as user training and experience level. To provide flexibility toward broad chemical evidence analysis, a suite of rapidly-interchangeable ion sources has been developed and characterized through the analysis of common illicit chemicals and emerging threats like substituted phenethylamines. Graphical Abstract ᅟ.
Chao, Yu-Ying; Chen, Yen-Ling; Lin, Hong-Yi; Huang, Yeou-Lih
2018-06-20
Thermal desorption electrospray ionization/mass spectrometry (TD-ESI-MS) employing a quickly interchangeable ionization source is a relatively new ambient ionization mass spectrometric technique that has had, to date, only a limited number of applications related to food safety control. With reallocation of resources, this direct-analysis technique has had wider use in food analysis when operated in dual-working mode (pretreatment-free qualitative screening and conventional quantitative confirmation) after switching to an ambient ionization source from a traditional atmospheric pressure ionization source. Herein, we describe the benefits and challenges associated with the use of a TD-ESI source to detect adulterants in processed vegetables (PVs), as a proof-of-concept for the detection of basic colorants. While TD-ESI can offer direct qualitative screening analyses for PVs with detection capabilities lower than those provided with liquid chromatography/UV detection within 30 s, the use of TD-ESI for semi-quantification is applicable only for homogeneous food matrices. Copyright © 2018 Elsevier B.V. All rights reserved.
Chao, Yu-Ying; Chen, Yen-Ling; Chen, Wei-Chu; Chen, Bai-Hsiun; Huang, Yeou-Lih
2018-06-30
Ambient mass spectrometry using an interchangeable thermal desorption/electrospray ionization source (TD-ESI) is a relatively new technique that has had only a limited number of applications to date. Nevertheless, this direct-analysis technique has potential for wider use in analytical chemistry (e.g., in the rapid direct detection of contaminants, residues, and adulterants on and in food) when operated in dual-working mode (pretreatment-free qualitative screening and conventional quantitative confirmation) after switching to a TD-ESI source from a conventional ESI source. Herein, we describe the benefits and challenges associated with the use of a TD-ESI source to detect adulterants on traditional Chinese pastries (TCPs), as a proof-of-concept for the detection of illegal colorants. While TD-ESI can offer direct (i.e., without any sample preparation) qualitative screening analyses for TCPs with adequate sensitivity within 30 s, the use of TD-ESI for semi-quantification is applicable only for homogeneous matrices (e.g., tang yuan). Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Ernest Bhero
2015-11-01
Full Text Available Background: Improved operational efficiency is important to role players in cross-border logistics and trade corridors. Cargo owners and cargo forwarders have been particularly concerned about long delays in the processing and clearing of cargo at border posts. Field studies suggest that these delays are due to a combination of factors, such as a lack of optimum system configurations and non-optimised human-dependent operations, which make the operations prone to corruption and other malpractices. Objectives: This article presents possible strategies for improving some of the operations in this sector. The research hinges on two key questions: (1 what is the impact of information interchange between stakeholders on the cargo transit time and (2 how will cargo transit time be impacted upon by automatic identification of cargo and the status of cargo seals on arriving vehicles at the border? Method: The use of information communication systems enabled by automatic identification systems (incorporating radio-frequency identification technology is suggested. Results: Results obtained by the described simulation model indicate that improvements of up to 82% with regard to transit time are possible using these techniques. Conclusion: The findings therefore demonstrate how operations at border posts can be improved through the use of appropriate technology and configuration of the operations.
Lawton, Zachary E.; Traub, Angelica; Fatigante, William L.; Mancias, Jose; O'Leary, Adam E.; Hall, Seth E.; Wieland, Jamie R.; Oberacher, Herbert; Gizzi, Michael C.; Mulligan, Christopher C.
2017-06-01
Forensic evidentiary backlogs are indicative of the growing need for cost-effective, high-throughput instrumental methods. One such emerging technology that shows high promise in meeting this demand while also allowing on-site forensic investigation is portable mass spectrometric (MS) instrumentation, particularly that which enables the coupling to ambient ionization techniques. While the benefits of rapid, on-site screening of contraband can be anticipated, the inherent legal implications of field-collected data necessitates that the analytical performance of technology employed be commensurate with accepted techniques. To this end, comprehensive analytical validation studies are required before broad incorporation by forensic practitioners can be considered, and are the focus of this work. Pertinent performance characteristics such as throughput, selectivity, accuracy/precision, method robustness, and ruggedness have been investigated. Reliability in the form of false positive/negative response rates is also assessed, examining the effect of variables such as user training and experience level. To provide flexibility toward broad chemical evidence analysis, a suite of rapidly-interchangeable ion sources has been developed and characterized through the analysis of common illicit chemicals and emerging threats like substituted phenethylamines. [Figure not available: see fulltext.
Harley, Jamie A; Lovell, Ric J; Barnes, Christopher A; Portas, Matthew D; Weston, Matthew
2011-08-01
In elite-level soccer, player motion characteristics are commonly generated from match play and training situations using semiautomated video analysis systems and global positioning system (GPS) technology, respectively. Before such data are used collectively to quantify global player load, it is necessary to understand both the level of agreement and direction of bias between the systems so that specific interventions can be made based on the reported results. The aim of this report was to compare data derived from both systems for physical match performances. Six elite-level soccer players were analyzed during a competitive match using semiautomated video analysis (ProZone® [PZ]) and GPS (MinimaxX) simultaneously. Total distances (TDs), high speed running (HSR), very high speed running (VHSR), sprinting distance (SPR), and high-intensity running distance (HIR; >4.0 m·s(-1)) were reported in 15-minute match periods. The GPS reported higher values than PZ did for TD (GPS: 1,755.4 ± 245.4 m; PZ: 1,631.3 ± 239.5 m; p < 0.05); PZ reported higher values for SPR and HIR than GPS did (SPR: PZ, 34.1 ± 24.0 m; GPS: 20.3 ± 15.8 m; HIR: PZ, 368.1 ± 129.8 m; GPS: 317.0 ± 92.5 m; p < 0.05). Caution should be exercised when using match-load (PZ) and training-load (GPS) data interchangeably.
International Nuclear Information System (INIS)
Atiemo, S.M.; Ofosu, F.G.; Aboh, I.J.K.; Yeboah, P.O.
2010-01-01
Street dust samples were collected from Tema Motor way (near Ashiaman overhead) and Tetteh Quarshie interchange in Accra. The samples were segregated into two groups of grain sizes between 100 um - 250 um and the other being less than 100 um. Energy dispersive X-ray florescence technique was used to determine their elemental compositions. In all twenty (20) elements were identified: K, Ca, Ti, V, Cr, Mn, Fe, Ni, Cu, Zn, Ga, Ge, As, Se, Br, Rb, Sr, Y, Zr and Pb. The results show significant concentrations levels of K, Ca, Ti, Pb, Zn, Cu, Mn, Fe, Rb, Sr, Y, Zr and Cr in all the samples. Enrichment factors determined for the elements show high enrichment of V, Zn, Cu, Zr, Cr, Br and Pb from the sample sites. There was no indication of significant anthropogenic contribution of manganese (Mn) which gave average enrichment factor values of 0.60 and 0.78 in the road dust at the Tema motor way and Tetteh Quarshie Interchange respectively. Risk assessment of selected heavy metal contaminants from both sites indicate that Pb gave Hazard Index (HI) values of 0.56 and 0.62 which falls below the safe level of one (1). It was also observed that ingestion which gave HI values of 2.1 and 2.3 was the highest risk of exposure pathway. Tetteh Quarshie Interchange gave the highest cumulative risk of exposure. (author)
Ohfuji, Satoko; Ito, Kazuya; Ishibashi, Motoki; Shindo, Shizuo; Takasaki, Yoshio; Yokoyama, Takashi; Yokoyama, Takato; Yamashita, Yuji; Shibao, Keigo; Nakano, Takashi; Tsuru, Tomomi; Irie, Shin; Hirota, Yoshio
2017-06-01
In Japan, the routine immunization program with oral polio vaccine (OPV) has been suspended since September 2012, when a program with 4 doses of inactivated monovalent polio vaccine (IPV) or quadrivalent vaccine against diphtheria, pertussis, and tetanus with IPV (DTaP-IPV) was introduced. The aim of this study was to examine the interchangeability among these 3 types of polio vaccines.We conducted a prospective cohort study at 5 pediatric clinics in Japan. A total of 153 infants were assigned to 1 of the 4 groups by considering the vaccination history of OPV and trivalent vaccine against DTaP. Eleven infants with a history of OPV received 3 doses of DTaP-IPV; 49 infants with a history of OPV and DTaP received 3 doses of IPV; 50 polio vaccine-naïve infants received 2 doses of IPV followed by 2 doses of DTaP-IPV; and 43 polio vaccine-naive infants received 2 doses of DTaP-IPV followed by IPV. The immunogenicity after polio vaccination was evaluated among these 4 groups.After 2 doses of polio vaccination, more than 80% of the infants exhibited a neutralization antibody titer ≥1:8 for all Sabin strains and wild strains in all groups. After the third dose, the seroprotection proportion (i.e., a neutralization antibody titer ≥1:8) reached about 100%. After the fourth dose, a neutralization antibody titer exceeded the required protective levels (i.e., a neutralization antibody titer ≥1:8) considerably in all groups.Four doses of polio vaccines induced a sufficient level of immunity in Japanese infants, irrespective of vaccine combinations or order.
Sensui, Takayuki
2012-10-01
Although digitalization has tripled consumer-class camera market scale, extreme reductions in prices of fixed-lens cameras has reduced profitability. As a result, a number of manufacturers have entered the market of the System DSC i.e. digital still camera with interchangeable lens, where large profit margins are possible, and many high ratio zoom lenses with image stabilization functions have been released. Quiet actuators are another indispensable component. Design with which there is little degradation in performance due to all types of errors is preferred for good balance in terms of size, lens performance, and the rate of quality to sub-standard products. Decentering, such as that caused by tilting, sensitivity of moving groups is especially important. In addition, image stabilization mechanisms actively shift lens groups. Development of high ratio zoom lenses with vibration reduction mechanism is confronted by the challenge of reduced performance due to decentering, making control over decentering sensitivity between lens groups everything. While there are a number of ways to align lenses (axial alignment), shock resistance and ability to stand up to environmental conditions must also be considered. Naturally, it is very difficult, if not impossible, to make lenses smaller and achieve a low decentering sensitivity at the same time. 4-group zoom construction is beneficial in making lenses smaller, but decentering sensitivity is greater. 5-group zoom configuration makes smaller lenses more difficult, but it enables lower decentering sensitivities. At Nikon, the most advantageous construction is selected for each lens based on specifications. The AF-S DX NIKKOR 18-200mm f/3.5-5.6G ED VR II and AF-S NIKKOR 28-300mm f/3.5-5.6G ED VR are excellent examples of this.
Zehnder, Pascal; Roth, Beat; Burkhard, Fiona C; Kessler, Thomas M
2008-09-01
We determined and compared urethral pressure measurements using air charged and microtip catheters in a prospective, single-blind, randomized trial. A consecutive series of 64 women referred for urodynamic investigation underwent sequential urethral pressure measurements using an air charged and a microtip catheter in randomized order. Patients were blinded to the type and sequence of catheter used. Agreement between the 2 catheter systems was assessed using the Bland and Altman 95% limits of agreement method. Intraclass correlation coefficients of air charged and microtip catheters for maximum urethral closure pressure at rest were 0.97 and 0.93, and for functional profile length they were 0.9 and 0.78, respectively. Pearson's correlation coefficients and Lin's concordance coefficients of air charged and microtip catheters were r = 0.82 and rho = 0.79 for maximum urethral closure pressure at rest, and r = 0.73 and rho = 0.7 for functional profile length, respectively. When applying the Bland and Altman method, air charged catheters gave higher readings than microtip catheters for maximum urethral closure pressure at rest (mean difference 7.5 cm H(2)O) and functional profile length (mean difference 1.8 mm). There were wide 95% limits of agreement for differences in maximum urethral closure pressure at rest (-24.1 to 39 cm H(2)O) and functional profile length (-7.7 to 11.3 mm). For urethral pressure measurement the air charged catheter is at least as reliable as the microtip catheter and it generally gives higher readings. However, air charged and microtip catheters cannot be used interchangeably for clinical purposes because of insufficient agreement. Hence, clinicians should be aware that air charged and microtip catheters may yield completely different results, and these differences should be acknowledged during clinical decision making.
SUGOI: automated ontology interchangeability
CSIR Research Space (South Africa)
Khan, ZC
2015-04-01
Full Text Available A foundational ontology can solve interoperability issues among the domain ontologies aligned to it. However, several foundational ontologies have been developed, hence such interoperability issues exist among domain ontologies. The novel SUGOI tool...
Wiley, R A
1977-01-01
User's guide for the implementation of level one of the proposed American National Standard Specifications for an information interchange data descriptive file on control data 6000/7000 series computers
Bennett, Sophia Elizabeth
2017-01-01
Mr Huidong LI Deputy Chairman and Secretary-General, Rev. Committee of Chinese Nationalist Party Vice President, Sun Yat-Sen Culture Interchange Association of China Member, Committee for Internal and Judicial Affairs of the National People's Congress of China
Ladhani, Shamez N; Andrews, Nick J; Waight, Pauline; Hallis, Bassam; Matheson, Mary; England, Anna; Findlow, Helen; Bai, Xilian; Borrow, Ray; Burbidge, Polly; Pearce, Emma; Goldblatt, David; Miller, Elizabeth
2015-01-29
An open, non-randomised study was undertaken in England during 2011-12 to evaluate vaccine antibody responses in infants after completion of the routine primary infant immunisation schedule, which included two doses of meningococcal group C (MenC) conjugate (MCC) vaccine at 3 and 4 months. Any of the three licensed MCC vaccines could be used for either dose, depending on local availability. Healthy term infants registered at participating general practices (GPs) in Hertfordshire and Gloucestershire, UK, were recruited prospectively to provide a single blood sample four weeks after primary immunisation, which was administered by the GP surgery. Vaccination history was obtained at blood sampling. MenC serum bactericidal antibody (SBA) and IgG antibodies against Haemophilus influenzae b (Hib), pertussis toxin (PT), diphtheria toxoid (DT), tetanus toxoid (TT) and thirteen pneumococcal serotypes were analysed according to MCC vaccines received. MenC SBA responses differed significantly (Pvaccine schedule as follows: MenC SBA geometric mean titres (GMTs) were significantly lower in infants receiving a diphtheria cross-reacting material-conjugated MCC (MCC-CRM) vaccine followed by TT-conjugated MCC (MCC-TT) vaccine (82.0; 95% CI, 39-173; n=14) compared to those receiving two MCC-CRM (418; 95% CI, 325-537; n=82), two MCC-TT (277; 95% CI, 223-344; n=79) or MCC-TT followed by MCC-CRM (553; 95% CI, 322-949; n=18). The same group also had the lowest Hib geometric mean concentrations (0.60 μg/mL, 0.27-1.34) compared to 1.85 μg/mL (1.23-2.78), 2.86 μg/mL (2.02-4.05) and 4.26 μg/mL (1.94-9.36), respectively. Our results indicate that MCC vaccines with different carrier proteins are not interchangeable. When several MCC vaccines are available, children requiring more than one dose should receive MCC vaccines with the same carrier protein or, alternatively, receive MCC-TT first wherever possible. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Balk JM
2015-08-01
.05. No significant differences in the hematological profile were observed (P>0.05. Conclusion: The standard twice-daily RBV regimen is interchangeable with the once-daily regimen. The once-daily regimen will improve compliance and opens the opportunity to combine RBV with other drugs dosed once a day, in a single pill. Keywords: hepatitis C, dose regimen, ribavirin, pegylated interferon
Directory of Open Access Journals (Sweden)
Thomas W Kelley
2010-12-01
Full Text Available Abstract Background Nematodes represent the most abundant benthic metazoa in one of the largest habitats on earth, the deep sea. Characterizing major patterns of biodiversity within this dominant group is a critical step towards understanding evolutionary patterns across this vast ecosystem. The present study has aimed to place deep-sea nematode species into a phylogenetic framework, investigate relationships between shallow water and deep-sea taxa, and elucidate phylogeographic patterns amongst the deep-sea fauna. Results Molecular data (18 S and 28 S rRNA confirms a high diversity amongst deep-sea Enoplids. There is no evidence for endemic deep-sea lineages in Maximum Likelihood or Bayesian phylogenies, and Enoplids do not cluster according to depth or geographic location. Tree topologies suggest frequent interchanges between deep-sea and shallow water habitats, as well as a mixture of early radiations and more recently derived lineages amongst deep-sea taxa. This study also provides convincing evidence of cosmopolitan marine species, recovering a subset of Oncholaimid nematodes with identical gene sequences (18 S, 28 S and cox1 at trans-Atlantic sample sites. Conclusions The complex clade structures recovered within the Enoplida support a high global species richness for marine nematodes, with phylogeographic patterns suggesting the existence of closely related, globally distributed species complexes in the deep sea. True cosmopolitan species may additionally exist within this group, potentially driven by specific life history traits of Enoplids. Although this investigation aimed to intensively sample nematodes from the order Enoplida, specimens were only identified down to genus (at best and our sampling regime focused on an infinitesimal small fraction of the deep-sea floor. Future nematode studies should incorporate an extended sample set covering a wide depth range (shelf, bathyal, and abyssal sites, utilize additional genetic loci (e
Energy Technology Data Exchange (ETDEWEB)
Olguin G, M. T., E-mail: teresa.olguin@inin.gob.m [ININ, Departamento de Quimica, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)
2010-07-01
The ionic interchanges and the adsorbents are of special interest inside the water treatment processes (industrial or human consumption), as well as for the radionuclides generation, due to their structural characteristics and to their capacity to remove an extensive range of polluting species. In the ININ have been developed researches on these materials, with the purpose of generating new knowledge that serves like base inside radionuclides separation processes or polluted water treatment. The results obtained until the present have been published in different scientific magazines. (Author)
Directory of Open Access Journals (Sweden)
Annika eKrause
2015-11-01
Full Text Available This study assessed the interchangeability between heart rate (HR and heart rate variability (HRV measures derived from a series of interbeat intervals (IBIs recorded via electrocardiogram (ECG and intra-arterial blood pressure (BP in various behavioral contexts. Five minutes of simultaneously recorded IBIs from ECG and BP signals in 11 female domestic pigs during resting, feeding and active behavior were analyzed. Comparisons were made for measures of HR, SDNN (the standard deviation of IBIs and RMSSD (the root mean of the squared distances of subsequent IBIs derived from ECG and BP signals for each behavior category using statistical procedures with different explanatory power (linear regression, intraclass correlation coefficient (ICC, Bland and Altman plots and analysis of variance (ANOVA. Linear regression showed a strong relationship for HR during all behaviors and for HRV during resting. Excellent ICCs (lower 95% CI > 0.75 and narrow limits of agreement (LoA in all behavior categories were found for HR. ICCs for HRV reached the critical lower 95% CI value of 0.75 only during resting. Using Bland and Altman plots, HRV agreement was unacceptable for all of the behavior categories. ANOVA showed significant differences between the methods in terms of HRV. BP systematically overestimated HRV compared with ECG. Our findings reveal that HR data recorded via BP agree well those recorded using ECG independently of the activity of the subject, whereas ECG and BP cannot be used interchangeably in the context of HRV in free-moving domestic pigs.
Li, Erqiang
2010-09-01
A PET/PTFE-based piezoelectric squeeze mode drop-on-demand inkjet printhead with interchangeable nozzles is designed and fabricated. The printhead chamber is comprised of PET (polyethylene terephthalate) tubing or PTFE (polytetrafluoroethylene, or Teflon) tubing, which of a much softer material, than the conventionally used glass tubing. Applying the same electrical voltage, PET/PTFE-based printhead will generate a larger volume change in the material to be dispensed. The novel printhead fabricated herein has successfully dispensed liquids with viscosities up to 100 cps, as compared to 20 cps for the commercial printheads. Furthermore, PTFE-based printhead provides excellent anti-corrosive property when strongly corrosive inks are involved. The interchangeable nozzle design enables the same printhead to be fitted with nozzles of different orifice size, thus a clogged nozzle can be easily removed for cleaning or replacement. The characteristics of this novel printhead are also studied by dispensing glycerin-water solutions. © 2010 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
A. S. Khorloohiyn
2017-01-01
Full Text Available One of key elements of an engineering component quality management system of process of provision of sports and improving services in gyms is the subsystem of diagnostics of physical client state. The aim of the study was to increase in efficiency of functioning of a quality management system of process of provision of sports and improving services in gyms due to development of techniques of incorrect estimation of the initial client state.The task of formation of a complex of indices of the initial status by criterion of necessary informtiveness is formulated. The principle of the functional interchangeability as a methodological basis for its decision is reasonable. The hierarchical structure of an integral assessment of the initial client state of gym is offered. On its basis the hierarchical model of rating of informtiveness of a complex of the single (measured indices, the providing objectivity of an integral assessment of the initial status is developed. The correctness of model is provided at the expense of a formulation of a complex of assumptions and original technology of application of different methods of expert estimation.The result of simulation of informtiveness of an integral assessment of the initial client state for a specific type of service and the purposes of physical enhancement includes: 1 library of sets of single indices, for each of which the technique and a monitoring aid, and also an informtiveness assessment in points, 2 the rules of support of the functional interchangeability of alternative complexes of indices by criterion of sufficiency of informtiveness of a complex based on additive models and the accepted restrictions is defined.The concept of a technique of formation of a complex of the measured and (or evaluated indices of the initial client state for the specific type of sports and improving service adapted under material opportunities of gym on the one hand, and responding to criterion of necessary
International Nuclear Information System (INIS)
Mason, J.M.; Setlow, P.
1987-01-01
Spores of Bacillus subtilis strains which carry deletion mutations in one gene (sspA) or two genes (sspA and sspB) which code for major alpha/beta-type small, acid-soluble spore proteins (SASP) are known to be much more sensitive to heat and UV radiation than wild-type spores. This heat- and UV-sensitive phenotype was cured completely or in part by introduction into these mutant strains of one or more copies of the sspA or sspB genes themselves; multiple copies of the B. subtilis sspD gene, which codes for a minor alpha/beta-type SASP; or multiple copies of the SASP-C gene, which codes for a major alpha/beta-type SASP of Bacillus megaterium. These findings suggest that alpha/beta-type SASP play interchangeable roles in the heat and UV radiation resistance of bacterial spores
DEFF Research Database (Denmark)
Pedersen, Rune Johan Skullerud; Mikkelsen, Benny; Jørgensen, Bo Foged
1998-01-01
interchanging can be used to create a robust and nonblocking OXC. However, for an OXC with n fiber inlets each carrying m wavelengths the OXC requires n×m internal wavelengths, which constrains the size of the cross-connect. In this paper we therefore propose and demonstrate an architecture that uses a reduced......Optical transport layers need rearrangeable wavelength-division multiplexing optical cross-connects (OXCs) to increase the capacity and flexibility of the network. It has previously been shown that a cross-connect based on all-optical wavelength converters for routing as well as wavelength slot...... set of internal wavelengths without sacrificing cross-connecting capabilities. By inserting a partly equipped OXC with the new architecture in a 10-Gbit/s re-circulating loop setup we demonstrate the possibility of cascading up to ten OXCs. Furthermore, we investigate the regenerating effect...
DEFF Research Database (Denmark)
Madsen, Ole Rintek
2011-01-01
DAS28 is a widely used composite score for the assessment of disease activity in patients with rheumatoid arthritis (RA) and is often used as a treatment decision tool in the daily clinic. Different versions of DAS28 are available. DAS28-CRP(3) is calculated based on three variables: swollen...... and tender joint counts and CRP. DAS28-CRP(4) also includes patient global assessment. Thresholds for low and high disease activity are the same for the two scores. Based on the Bland-Altman method, the interchangeability between DAS28-CRP with three and four variables was examined in 319 RA patients...... selected for initiating biological treatment. Data were extracted from the Danish registry for biological treatment in rheumatology (DANBIO). Multiple regression analysis was used to assess the predictability of the DAS28 scores by several measures of disease activity. The overall mean DAS28-CRP was 4...
Energy Technology Data Exchange (ETDEWEB)
Hassam, Adil [Univ. of Maryland, College Park, MD (United States)
2015-09-21
We studied the feasibility of resonantly driving GAMs in tokamaks. A numerical simulation was carried out and showed the essential features and limitations. It was shown further that GAMs can damp by phase-mixing, from temperature gradients, or nonlinear detuning, thus broadening the resonance. Experimental implications of this were quantified. Theoretical support was provided for the Maryland Centrifugal Experiment, funded in a separate grant by DOE. Plasma diamagnetism from supersonic rotation was established. A theoretical model was built to match the data. Additional support to the experiment in terms of numerical simulation of the interchange turbulence was provided. Spectra from residual turbulence on account of velocity shear suppression were obtained and compared favorably to experiment. A new drift wave, driven solely by the thermal force, was identified.
Directory of Open Access Journals (Sweden)
Becciolini A
2017-06-01
Full Text Available Andrea Becciolini,1 Maria Gabriella Raimondo,2 Chiara Crotti,2 Elena Agape,2 Martina Biggioggero,2 Ennio Giulio Favalli1 1Department of Rheumatology, 2Department of Clinical Sciences and Health Community, University of Milan, Division of Rheumatology, Gaetano Pini Institute, Milan, Italy Abstract: The introduction of biological agents drastically changed the treatment paradigm of inflammatory arthritides, ameliorating the natural history of the diseases but concomitantly increasing the drug costs due to the manufacturing process. On this concern, biosimilar drugs may represent a valid option for reducing this elevated cost and increasing the availability of these highly effective treatments. Recently, CT-P13, the first biosimilar of infliximab, has been approved with the same indications established for the reference product (RP, and its daily use is progressively increasing. However, the experience with biosimilar drugs in the field of rheumatology is still limited, raising potential doubts and concerns on their correct management in real-life settings. Comparability analysis between CT-P13 and its RP was evaluated in equivalence randomized controlled trials (RCTs – PLANETRA and PLANETAS – performed on patients with rheumatoid arthritis and axial spondylitis, respectively. CT-P13 and RP showed similar profile in terms of quality, biological activity, safety, immunogenicity, and efficacy. However, the interchangeability between infliximab RP and its biosimilar still represents the most challenging issue because of a lack of a long-lasting experience. To date, reassuring preliminary data on this topic were reported in open-label extensions of PLANETRA and PLANETAS RCTs and in ongoing real-life observational studies. These findings, taken all together, significantly affect the landscape of biosimilar regulatory pathways and strongly support CT-P13 introduction as a great opportunity for expanding the accessibility to these very effective and
Directory of Open Access Journals (Sweden)
Joaquim Anacleto
2008-01-01
Full Text Available It is argued that the invariants associated to the First Law of Thermodynamics and to the concept of identical processes lead to a clear definition of heat and work. The conditions for heat and work to be invariant under a system-surroundings interchange are also investigated. Finally, examples are presented to illustrate the above conditions.
Energy Technology Data Exchange (ETDEWEB)
Zheng, Ruisheng; Chen, Yao; Wang, Bing [Shandong Provincial Key Laboratory of Optical Astronomy and Solar-Terrestrial Environment, and Institute of Space Sciences, Shandong University, Weihai 264209 (China); Li, Gang [Department of Physics and CSPAR, University of Alabama in Huntsville, Huntsville, AL 35899 (United States); Xiang, Yongyuan, E-mail: ruishengzheng@sdu.edu.cn [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650216 (China)
2017-05-01
The cold-dense plasma is occasionally detected in the solar wind with in situ data, but the source of the cold-dense plasma remains illusive. Interchange reconnections (IRs) between closed fields and nearby open fields are known to contribute to the formation of solar winds. We present a confined filament eruption associated with a puff-like coronal mass ejection (CME) on 2014 December 24. The filament underwent successive activations and finally erupted, due to continuous magnetic flux cancelations and emergences. The confined erupting filament showed a clear untwist motion, and most of the filament material fell back. During the eruption, some tiny blobs escaped from the confined filament body, along newly formed open field lines rooted around the south end of the filament, and some bright plasma flowed from the north end of the filament to remote sites at nearby open fields. The newly formed open field lines shifted southward with multiple branches. The puff-like CME also showed multiple bright fronts and a clear southward shift. All the results indicate an intermittent IR existed between closed fields of the confined erupting filament and nearby open fields, which released a portion of filament material (blobs) to form the puff-like CME. We suggest that the IR provides a possible source of cold-dense plasma in the solar wind.
Directory of Open Access Journals (Sweden)
M Khosravi
2012-05-01
Full Text Available The majority of existing tractors in Iran are not equipped with any tools to measure and display slip and ground speed. This is mainly due to the lack of national standards for measuring tools and instruments of tractors. In current research, an interchangeable system for two wheel drive tractors has been designed. Furthermore, it has been assessed after construction. To measure actual and theoretical ground speed, four rotary encoders for sensing the rotation of front and rear wheels have been utilized. Slip and ground speed were measured by means of software which has been developed in an ATmega16PU microprocessor. The measured slip and speed are digitally displayed on tractor dashboard. To evaluate the performance of the system, the measured values of ground speed and slip were compared with their calculated values obtained from conventional method. The Micro-controller has been programmed in such a way that the effect of front wheel sliding on slip is eliminated. In all evaluation conditions (in field and on asphalt, the maximum difference between system measurements for slip and speed and calculated slip and speed via conventional method was 2.4% and 0.2 km h-1, respectively. With slight alteration this system can be fitted on any kind of exiting two wheel drive tractors in the country.
Directory of Open Access Journals (Sweden)
Hassan Soleimani
2013-09-01
Full Text Available Materials evaluation is a critically significant feature of a coherent curriculum to achieve the objectives of pedagogy. To this end, two EFL textbooks commonly taught in language institutes in Iran, namely Interchange series and American English File, were selected for evaluation, seeking teachers’ viewpoints on the effectiveness of the two textbooks. Thirty EFL teachers who had used these two textbooks in their teaching experience participated in the study. A modified version of Litz’s (2005 teacher textbook evaluation form was used to collect data. Analysis of the collected data showed that the teachers were satisfied with the two materials. Moreover, it was found that the difference between the two textbooks was not significant in four features including practical considerations, layout and design, activities, and skills but this difference was significant in two features including language type as well as subject and content. The authors of the two textbooks, the administrators of language institutes, curriculum and material developers, and also students interested in learning EFL can benefit from the findings of this study.
Directory of Open Access Journals (Sweden)
Patrick W. Fedick
2018-03-01
Full Text Available Portable mass spectrometers (MS are becoming more prevalent due to improved instrumentation, commercialization, and the robustness of new ionization methodologies. To increase utility towards diverse field-based applications, there is an inherent need for rugged ionization source platforms that are simple, yet robust towards analytical scenarios that may arise. Ambient ionization methodologies have evolved to target specific real-world problems and fulfill requirements of the analysis at hand. Ambient ionization techniques continue to advance towards higher performance, with specific sources showing variable proficiency depending on application area. To realize the full potential and applicability of ambient ionization methods, a selection of sources may be more prudent, showing a need for a low-cost, flexible ionization source platform. This manuscript describes a centralized system that was developed for portable MS systems that incorporates modular, rapidly-interchangeable ionization sources comprised of low-cost, commercially-available parts. Herein, design considerations are reported for a suite of ambient ionization sources that can be crafted with minimal machining or customization. Representative spectral data is included to demonstrate applicability towards field processing of forensic evidence. While this platform is demonstrated on portable instrumentation, retrofitting to lab-scale MS systems is anticipated.
Ogawa, K.; Isobe, M.; Kawase, H.; Nishitani, T.; Seki, R.; Osakabe, M.; LHD Experiment Group
2018-04-01
The effect of the helically-trapped energetic-ion-driven resistive interchange modes (EICs) on energetic ion confinement is studied in the Large Helical Device deuterium plasmas. Neutron diagnostics such as the neutron flux monitor and the vertical neutron camera (VNC) are used in order to measure neutrons mainly created by beam-plasma reactions. The line-integrated neutron profiles are obtained by VNC in magnetohydrodynamic-quiet plasma with various neutral beam (NB) injection patterns. The profiles are consistent with that expected by the beam ion density calculated using orbit-following simulations. Significant decreases of the total neutron emission rate (S n) and the neutron counting rate of the VNC (C n) in central cords are observed to be synchronized with EIC bursts with perpendicular-NB injection. The drop rates of both S n and C n increase with EIC amplitude and reach around 50%. The line-integrated neutron profiles before and after EIC burst show that in the central cords, C n decrease due to EIC burst whereas there is almost no change in the other cords. The experimental results suggests that the effect of EIC on helically-trapped beam ion is substantial, however the effect of passing beam ion is not significant.
International Nuclear Information System (INIS)
Zheng, Ruisheng; Chen, Yao; Wang, Bing; Li, Gang; Xiang, Yongyuan
2017-01-01
The cold-dense plasma is occasionally detected in the solar wind with in situ data, but the source of the cold-dense plasma remains illusive. Interchange reconnections (IRs) between closed fields and nearby open fields are known to contribute to the formation of solar winds. We present a confined filament eruption associated with a puff-like coronal mass ejection (CME) on 2014 December 24. The filament underwent successive activations and finally erupted, due to continuous magnetic flux cancelations and emergences. The confined erupting filament showed a clear untwist motion, and most of the filament material fell back. During the eruption, some tiny blobs escaped from the confined filament body, along newly formed open field lines rooted around the south end of the filament, and some bright plasma flowed from the north end of the filament to remote sites at nearby open fields. The newly formed open field lines shifted southward with multiple branches. The puff-like CME also showed multiple bright fronts and a clear southward shift. All the results indicate an intermittent IR existed between closed fields of the confined erupting filament and nearby open fields, which released a portion of filament material (blobs) to form the puff-like CME. We suggest that the IR provides a possible source of cold-dense plasma in the solar wind.
Becciolini, Andrea; Raimondo, Maria Gabriella; Crotti, Chiara; Agape, Elena; Biggioggero, Martina; Favalli, Ennio Giulio
2017-01-01
The introduction of biological agents drastically changed the treatment paradigm of inflammatory arthritides, ameliorating the natural history of the diseases but concomitantly increasing the drug costs due to the manufacturing process. On this concern, biosimilar drugs may represent a valid option for reducing this elevated cost and increasing the availability of these highly effective treatments. Recently, CT-P13, the first biosimilar of infliximab, has been approved with the same indications established for the reference product (RP), and its daily use is progressively increasing. However, the experience with biosimilar drugs in the field of rheumatology is still limited, raising potential doubts and concerns on their correct management in real-life settings. Comparability analysis between CT-P13 and its RP was evaluated in equivalence randomized controlled trials (RCTs) - PLANETRA and PLANETAS - performed on patients with rheumatoid arthritis and axial spondylitis, respectively. CT-P13 and RP showed similar profile in terms of quality, biological activity, safety, immunogenicity, and efficacy. However, the interchangeability between infliximab RP and its biosimilar still represents the most challenging issue because of a lack of a long-lasting experience. To date, reassuring preliminary data on this topic were reported in open-label extensions of PLANETRA and PLANETAS RCTs and in ongoing real-life observational studies. These findings, taken all together, significantly affect the landscape of biosimilar regulatory pathways and strongly support CT-P13 introduction as a great opportunity for expanding the accessibility to these very effective and high-cost therapies.
Directory of Open Access Journals (Sweden)
Carmen Salgado Santamaría
2009-10-01
Full Text Available El desarrollo de los podcasting, como sistema añadido de la ciberradio, impulsa a las redes de participación e intercambios comunicativos de interés social, que exhiben numerosas ventajas frente a las prácticas radiofónicas conocidas. La difusión que la radio pública realiza de los podcasts, la colocan en el actual proceso de convergencia tecnológica, y la sitúan en una sociedad de la información y del conocimiento, capaz de ofrecer diferentes servicios al alcance de todos los ciudadanos. Sólo la introducción de nuevos contenidos y servicios que aporten valor añadido a los existentes y satisfagan las necesidades de sus usuarios, procurarán la rentabilidad de este sistema. The development of podcasting as an additional system of cyberradio stimulates the appearance of networks of participation and communicative interchanges of social interest, and has numerous advantages over conventional radio practices. The spreading of podcasts through public radio situates it within the process of technological convergence and in an Information and Knowledge society which is able to offer different services within reach of all citizens. Only the introduction of new contents and services that contribute added value to the existing ones and satisfy the needs of users will make this system profitable.
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
This project aims at improvement of coal mining technology and productivity in Indonesia by Japanese production control technology and business management technology for underground coal mining, through interchange of coal engineers between Japan and Indonesia. This project is composed of the short- term and long-term dispatch project of engineers to Indonesia, and the training project of Indonesian engineers in Japan. In fiscal 1998, the short-term dispatch was made for the training in Indonesia on underground coal mine development (development planning, pit mouth selection, main gallery design, mining system selection, transport planning, ventilation planning, under-river mining, mine water proofing, drainage). The long-term dispatch was made for contact and negotiation with concerned Indonesian organizations, support of the training project, and collection of information on the trend of Indonesian economy and energy, and the present and trend of the coal industry for conducting smooth and effective engineer interchange. (NEDO)
Huser, Vojtech; Sastry, Chandan; Breymaier, Matthew; Idriss, Asma; Cimino, James J
2015-10-01
Efficient communication of a clinical study protocol and case report forms during all stages of a human clinical study is important for many stakeholders. An electronic and structured study representation format that can be used throughout the whole study life-span can improve such communication and potentially lower total study costs. The most relevant standard for representing clinical study data, applicable to unregulated as well as regulated studies, is the Operational Data Model (ODM) in development since 1999 by the Clinical Data Interchange Standards Consortium (CDISC). ODM's initial objective was exchange of case report forms data but it is increasingly utilized in other contexts. An ODM extension called Study Design Model, introduced in 2011, provides additional protocol representation elements. Using a case study approach, we evaluated ODM's ability to capture all necessary protocol elements during a complete clinical study lifecycle in the Intramural Research Program of the National Institutes of Health. ODM offers the advantage of a single format for institutions that deal with hundreds or thousands of concurrent clinical studies and maintain a data warehouse for these studies. For each study stage, we present a list of gaps in the ODM standard and identify necessary vendor or institutional extensions that can compensate for such gaps. The current version of ODM (1.3.2) has only partial support for study protocol and study registration data mainly because it is outside the original development goal. ODM provides comprehensive support for representation of case report forms (in both the design stage and with patient level data). Inclusion of requirements of observational, non-regulated or investigator-initiated studies (outside Food and Drug Administration (FDA) regulation) can further improve future revisions of the standard. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Jiaheng Wang
2017-05-01
Full Text Available Core/shell-structured CeO2/Fe3O4 and Fe3O4/CeO2 nanocapsules are prepared by interchange assembly of diluted magnetic semiconductor CeO2 and ferromagnetic ferrite Fe3O4 as the core and the shell, and vice versa, using a facile two-step polar solvothermal method in order to utilize the room-temperature ferromagnetism and abundant O-vacancies in CeO2, the large natural resonance in Fe3O4, and the O-vacancy-enhanced interfacial polarization between CeO2 and Fe3O4 for new generation microwave absorbers. Comparing to Fe3O4/CeO2 nanocapsules, the CeO2/Fe3O4 nanocapsules show an improved real permittivity of 3–10% and an enhanced dielectric resonance of 1.5 times at 15.3 GHz due to the increased O-vacancy concentration in the CeO2 cores of larger grains as well as the O-vacancy-induced enhancement in interfacial polarization between the CeO2 cores and the Fe3O4 shells, respectively. Both nanocapsules exhibit relatively high permeability in the low-frequency S and C microwave bands as a result of the bi-magnetic core/shell combination of CeO2 and Fe3O4. The CeO2/Fe3O4 nanocapsules effectively enhance permittivity and permeability in the high-frequency Ku band with interfacial polarization and natural resonance at ∼15 GHz, thereby improving absorption with a large reflection loss of -28.9 dB at 15.3 GHz. Experimental and theoretical comparisons with CeO2 and Fe3O4 nanoparticles are also made.
Michael, C. A.; Tanaka, K.; Akiyama, T.; Ozaki, T.; Osakabe, M.; Sakakibara, S.; Yamaguchi, H.; Murakami, S.; Yokoyama, M.; Shoji, M.; Vyacheslavov, L. N.; LHD Experimental Group
2018-04-01
In the Large helical device, a change of energetic particle mode is observed as He concentration is varied in ion-ITB type experiments, having constant electron density and input heating power but with a clear increase of central ion temperature in He rich discharges. This activity consists of bursty, but damped energetic interchange modes (EICs, Du et al 2015 Phys. Rev. Lett. 114 155003), whose occurrence rate is dramatically lower in the He-rich discharges. Mechanisms are discussed for the changes in drive and damping of the modes with He concentration. These EIC bursts consist of marked changes in the radial electric field, which is derived from the phase velocity of turbulence measured with the 2D phase contrast imaging (PCI) system. Similar bursts are detected in edge fast ion diagnostics. Ion thermal transport by gyro-Bohm scaling is recognised as a contribution to the change in ion temperature, though fast ion losses by these EIC modes may also contribute to the ion temperature dependence on He concentration, most particularly controlling the height of an ‘edge-pedestal’ in the Ti profile. The steady-state level of fast ions is shown to be larger in helium rich discharges on the basis of a compact neutral particle analyser (CNPA), and the fast-ion component of the diamagnetic stored energy. These events also have an influence on turbulence and transport. The large velocity shear induced produced during these events transiently improves confinement and suppresses turbulence, and has a larger net effect when bursts are more frequent in hydrogen discharges. This exactly offsets the increased gyro-Bohm related turbulence drive in hydrogen which results in the same time-averaged turbulence level in hydrogen as in helium.
Dexter, Franklin; Epstein, Richard H; Ledolter, Johannes; Wanderer, Jonathan P
2018-05-16
Recent studies have made longitudinal assessments of case counts using State (e.g., United States) and Provincial (e.g., Canada) databases. Such databases rarely include either operating room (OR) or anesthesia times and, even when duration data are available, there are major statistical limitations to their use. We evaluated how to forecast short-term changes in OR caseload and workload (hours) and how to decide whether changes are outliers (e.g., significant, abrupt decline in anesthetics). Observational cohort study. Large teaching hospital. 35 years of annual anesthesia caseload data. Annual data were used without regard to where or when in the year each case was performed, thereby matching public use files. Changes in caseload or hours among four-week periods were examined within individual year-long periods using 159 consecutive four-week periods from the same hospital. Series of 12 four-week periods of the hours of cases performed on workdays lacked trend or correlation among periods for 49 of 50 series and followed normal distributions for 50 of 50 series. These criteria also were satisfied for 50 of 50 series based on counts of cases. The Pearson r = 0.999 between hours of anesthetics and cases. For purposes of time series analysis of total workload at a hospital within 1-year, hours of cases and counts of cases are interchangeable. Simple control chart methods of detecting sudden changes in workload or caseload, based simply on the sample mean and standard deviation from the preceding year, are appropriate. Copyright © 2018 Elsevier Inc. All rights reserved.
Prater, T. J.; Bean, Q. A.; Werkheiser, N. J.; Johnston, M. M.; Ordonez, E. A.; Ledbetter, F. E.; Risdon, D. L.; Stockman, T. J.; Sandridge, S. K. R.; Nelson, G. M.
2016-01-01
NASA Marshall Space Flight Center (MSFC) and the Agency as a whole are currently engaged in a number of in-space manufacturing (ISM) activities that have the potential to reduce launch costs, enhance crew safety, and provide the capabilities needed to undertake long-duration spaceflight. The recent 3D Printing in Zero-G experiment conducted on board the International Space Station (ISS) demonstrated that parts of acrylonitrile butadiene styrene (ABS) plastic can be manufactured in microgravity using fused deposition modeling (FDM). This project represents the beginning of the development of a capability that is critical to future NASA missions. Current and future ISM activities will require the development of baseline material properties to facilitate design, analysis, and certification of materials manufactured using in-space techniques. The purpose of this technical interchange meeting (TIM) was to bring together MSFC practitioners and experts in materials characterization and development of baseline material properties for emerging technologies to advise the ISM team as we progress toward the development of material design values, standards, and acceptance criteria for materials manufactured in space. The overall objective of the TIM was to leverage MSFC's shared experiences and collective knowledge in advanced manufacturing and materials development to construct a path forward for the establishment of baseline material properties, standards development, and certification activities related to ISM. Participants were asked to help identify research and development activities that will (1) accelerate acceptance and adoption of ISM techniques among the aerospace design community; (2) benefit future NASA programs, commercial technology developments, and national needs; and (3) provide opportunities and avenues for further collaboration.
Feng, Qian; Langereis, Martijn A; Olagnier, David; Chiang, Cindy; van de Winkel, Roel; van Essen, Peter; Zoll, Jan; Hiscott, John; van Kuppeveld, Frank J M
2014-01-01
Upon viral infections, pattern recognition receptors (PRRs) recognize pathogen-associated molecular patterns (PAMPs) and stimulate an antiviral state associated with the production of type I interferons (IFNs) and inflammatory markers. Type I IFNs play crucial roles in innate antiviral responses by
Hilleman, D E; Reyes, A P; Wurdeman, R L; Faulkner, M
2001-08-01
Recent hypertension trials have demonstrated the importance of achieving goal blood pressures to reduce the risk of target organ damage. In patients with moderate to severe hypertension, the use of high-dose monotherapy and/or combinations of drugs are necessary to achieve these goals. Fixed-dose combination products may be useful in these patients by reducing the number of daily doses required to control blood pressure. The objective of the present study was to evaluate the efficacy and safety of a therapeutic interchange between high-dose calcium channel blocker therapy and a fixed-dose combination of amlodipine/ benazepril (Lotrel; Novartis Pharmaceuticals, USA) in patients with moderate to severe hypertension. A total of 75 patients were switched from amlodipine (n = 25), felodipine (n = 25), and nifedipine-GITS (n = 25) to amlodipine/benazepril. Twenty-eight of the 75 patients (37%) were taking either a beta-blocker or a diuretic in addition to the high-dose calcium channel blocker prior to the switch. Blood pressure control, side effects and the cost of the therapeutic interchange were evaluated in the year following the therapeutic interchange. Sixty-six of the 75 (88%) patients were successfully switched with maintenance of blood pressure control and without the development of new dose-limiting side effects. Reasons for treatment failure after the therapeutic interchange included loss of blood pressure control in five patients and the development of new dose-limiting side effects in four patients. These side effects included cough in three patients and rash in one patient. After accounting for differences in drug acquisition cost and costs related to the switch (clinic and emergency room and laboratory tests), a cost savings of $16030 for all 75 patients was realised in the first year. The per patient-per year cost savings was $214. Our data indicate that a therapeutic interchange from selected high-dose calcium channel blockers to a fixed-dose combination
Vitor Bento
2008-01-01
The main problem with the economics of card payments is that cash is used as its yardstick and cash payments, being the most socially inefficient means of payment, are made available at a price significantly below cost (often free of charge).
Interchangeable grabs for mobile cranes
Energy Technology Data Exchange (ETDEWEB)
Arnold, A
1985-02-07
Not only the large variety of material to be handled, but also the enormous amounts of material to be loaded and unloaded have been a constant source of danger for the operators of mobile or portal cranes with cable pull, or of fork lifters. Bad accident statistics and materials handling problems have thus been the reason leading to the purchase of mobile cranes with stable load handling and, in the following, to the development of various graps suitable for the different types of material to be handled. Rigid graps with hydraulic drive and designed for mechanical replacement have been developed and tested. The following equipment has so far been tested and developed to maturity: Rapid replacement automatism, tipping and magnetic slewing mechanism, safety equipment for magnetic operation, vacuum lifter and stacker fork.
Graeser, Karin; Zemtsovski, Mikhail; Kofoed, Klaus F; Winther-Jensen, Matilde; Nilsson, Jens C; Kjaergaard, Jesper; Møller-Sørensen, Hasse
2018-01-09
thermodilution was only 0.3 L/min (confidence interval, 0.04-0.58), there were wide limits of agreement (-1.8 to 2.5 L/min) with a percentage error of 55%. Measurements of cross-sectional area by 3D TEE had low bias of -0.27 cm (confidence interval, -0.45 to -0.08) and a percentage error of 18% compared to cardiac CT angiography. Despite low bias, the wide limits of agreement of Doppler-derived CO by 3D TEE compared to CO by thermodilution will limit clinical application and can therefore not be considered interchangeable with CO obtained by thermodilution. The lack of agreement is not explained by lack of agreement of the 3D technique.
Energy Technology Data Exchange (ETDEWEB)
Thompson, Undiné-Celeste, E-mail: undine_t@hotmail.com; Marsan, Jean-François, E-mail: jfmarsan@hotmail.com; Fournier-Peyresblanques, Bastien, E-mail: bastien.fp@gmail.com; Forgues, Chantal, E-mail: chantal_forgues@hotmail.com; Ogaa, Anita, E-mail: aogaa1@gmail.com; Jaeger, Jochen A.G., E-mail: jochen.jaeger@concordia.ca
2013-09-15
concrete projects “on the ground”. CAPPP can be used as a tool for comparative analysis in decision-making situations at various scales. CAPPP is a fairly straight-forward method that can be used by policy makers, EIA experts, and members of the general public alike. Highlights: ► We investigated the level of harmonization between SEA, plans, policies and programmes and EIA projects. ► We created a new methodology: the goal compliance analysis (GCA). ► We tested it on an ongoing project, the Turcot Interchange in Montreal, Canada. ► The method is straight-forward and can be used by policy makers, EIA experts, and members of the general public alike.
International Nuclear Information System (INIS)
Thompson, Undiné-Celeste; Marsan, Jean-François; Fournier-Peyresblanques, Bastien; Forgues, Chantal; Ogaa, Anita; Jaeger, Jochen A.G.
2013-01-01
concrete projects “on the ground”. CAPPP can be used as a tool for comparative analysis in decision-making situations at various scales. CAPPP is a fairly straight-forward method that can be used by policy makers, EIA experts, and members of the general public alike. Highlights: ► We investigated the level of harmonization between SEA, plans, policies and programmes and EIA projects. ► We created a new methodology: the goal compliance analysis (GCA). ► We tested it on an ongoing project, the Turcot Interchange in Montreal, Canada. ► The method is straight-forward and can be used by policy makers, EIA experts, and members of the general public alike
Energy Technology Data Exchange (ETDEWEB)
Badiei, Hamid R.; Lai, Bryant; Karanassios, Vassili
2012-11-15
An electrothermal, near-torch vaporization (NTV) sample introduction for micro- or nano-volume samples is described. Samples were pipetted onto coiled-filament assemblies that were purposely developed to be removable and interchangeable and were dried and vaporized into a small-volume vaporization chamber that clips onto any ICP torch with a ball joint. Interchangeable assemblies were also constructed to be small-size (e.g., less than 3 cm long with max diameter of 0.65 cm) and light-weight (1.4 g) so that they can be portable. Interchangeable assemblies with volume-capacities in three ranges (i.e., < 1 {mu}L, 1-10 {mu}L and 10-100 {mu}L) were fabricated and used. The horizontally-operated NTV sample introduction was interfaced to an axially-viewed ICP-AES (inductively coupled plasma-atomic emission spectrometry) system and NTV was optimized using ICP-AES and 8 elements (Pb, Cd, Zn, V, Ba, Mg, Be and Ca). Precision was 1.0-2.3% (peak height) and 1.1-2.4% (peak area). Detection limits (obtained using 5 {mu}L volumes) expressed in absolute-amounts ranged between 4 pg for Pb to 0.3 fg ({approx} 5 million atoms) for Ca. Detection limits expressed in concentration units (obtained using 100 {mu}L volumes of diluted, single-element standard solutions) were: 50 pg/mL for Pb; 10 pg/mL for Cd; 9 pg/mL for Zn; 1 pg/mL for V; 0.9 pg/mL for Ba; 0.5 pg/mL for Mg; 50 fg/mL for Be; and 3 fg/mL for Ca. Analytical capability and utility was demonstrated using the determination of Pb in pg/mL levels of diluted natural water Certified Reference Material (CRM) and the determination of Zn in 80 nL volumes of the liquid extracted from an individual vesicle. It is shown that portable and interchangeable assemblies with dried sample residues on them can be transported without analyte loss (for the concentrations tested), thus opening up the possibility for 'taking part of the lab to the sample' applications, such as testing for Cu concentration-compliance with the lead
Directory of Open Access Journals (Sweden)
Karine Araújo Ferreira
2005-12-01
Full Text Available Este artigo analisa impactos na logística pela troca eletrônica de informações entre empresas (com uso de EDI - Electronic Data Interchange e Internet, destacando a diferença destes impactos em empresas das indústrias alimentícia e automobilística. As empresas são pressionadas por parceiros para adoção destas tecnologias: a montadora é a responsável na cadeia automobilística e o grande varejo é o disseminador na cadeia alimentícia. O EDI pressupõe relações contratuais entre as empresas. As processadoras de alimentos observaram redução de erros e no tempo dos ciclos de pedido, assim como melhoria na visibilidade dos estoques e no planejamento de transporte para distribuição de seus produtos. Já nas empresas da indústria automobilística, os impactos são mais significativos no tempo e custo de processamento de pedido, com redução nos níveis e custo de estoque e de transporte para suprimento. Os resultados são de pesquisa de natureza qualitativa - estudos de casos.This paper analyzes the impacts of electronic information exchange (EDI - Electronic Data Interchange and Internet toward companies' logistics performance, emphasizing the difference of these impacts within food and automobile industries. Companies are being impelled by their partners to adopt these information technologies, whether: vehicle assemblers are responsible for the automobile chain; and great retailers work as disseminators through the food chain. EDI's implementation requires contractual relations among companies. Therefore, food processing industries aim to reduce both errors and cycle-time orders; as well as to improve inventory visibility and transport planning in the distribution of its products. However, in the automobile companies segment, the impacts are more significant in time and order processing costs, with the reduction of inventory and transport level's costs for supplying. The presented results are of qualitative research nature
Energy Technology Data Exchange (ETDEWEB)
Kato, H.; Murata, M.; Yamagishi, E.; Nakamura, M. [Ebara Corp., Tokyo (Japan); Nagaki, K.; Obikane, Y.; Omura, S.; Urata, I.; Tadaumi, H. [Nippon Telegraph and Telephone Corp., Tokyo (Japan)
1998-04-20
A basic concept of IN{sup 2}AVICS centers on its function for initiating a CALS-like business with an arbitrary client within an extremely short time. A portable document format was adopted as a basic document and drawing interchange format for IN{sup 2}AVICS. This format was selected as text and graphics can be displayed on the Internet having a quality identical to the original, regardless of the software used to create such media. IN{sup 2}AVICS also features a search engine with a thesaurus function by which stored text and graphic data can be made available. Users can make full use of various business-based functions featured in IN{sup 2}AVICS as soon as system setup is completed, including search, view, upload and download of text and graphics through an Internet browser. IN{sup 2}AVICS is capable of running various business systems, such as an electronic catalogue system, knowledge database system, and facility management system. It is expected that the present system developed jointly by Ebara Corporation and NTT can be widely accepted in the manufacturing industry. 2 refs., 4 figs.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-09-01
This is a detailed report on a 2-week tour made in May, 1997, as part of the `9th regular interchange with energy-related organizations in Europe,` during which tour visits were paid to energy agencies and institutes of Germany, the Netherlands, Sweden, Denmark, and France, and on-site investigations were conducted. The text describes, taking reference to a rich stock of data it carries, the nature, politics and economy, demand for energy, policy toward new energy, for each of the host countries. In the European countries, with the exception of France, efforts are being exerted to introduce new energy and to enhance its application, renewable energy in particular, in place of atomic power. The expectation they entertain toward new energy is far extensive than that of Japan which retains atomic power generation. Although wind power generation enjoys the overwhelming popularity over others, yet, in Germany and Sweden, it will be difficult for this technology to take the place of atomic power generation completely. As for photovoltaic power generation, not so much is expected from this technology as in Japan because of their climate and weather. 67 figs., 10 tabs.
Bando, T.; Ohdachi, S.; Suzuki, Y.; Sakamoto, R.; Narushima, Y.; Takemura, Y.; Watanabe, K. Y.; Sakakibara, S.; Du, X. D.; Motojima, G.; Tanaka, K.; Morisaki, T.; LHD Experiment Group
2018-01-01
Two types of oscillation phenomena are found just after hydrogen ice pellet injections in the Large Helical Device (LHD). Oscillation phenomena appear when the deposition profile of a hydrogen ice pellet is localized around the rotational transform ι = 1 rational surface. At first, damping oscillations (type-I) appear only in the soft X-ray (SX) emission. They are followed by the second type of oscillations (type-II) where the magnetic fluctuations and density fluctuations synchronized to the SX fluctuations are observed. Both oscillations have poloidal/toroidal mode number, m/n = 1/1. Since the type-II oscillations appear when the local pressure is large and/or the local magnetic Reynold's number is small, it is reasonable that type-II oscillations are caused by the resistive interchange modes. Because both types of oscillations appear simultaneously at slightly different locations and with slightly different frequencies, it is certain that type-I oscillations are different from type-II oscillations, which we believe is the MHD instability. It is possible that type-I oscillations are caused by the asymmetric concentration of the impurities. The type-I oscillations are similar to the impurity snake phenomena observed in tokamaks though type-I oscillations survive only several tens of milliseconds in LHD.
Energy Technology Data Exchange (ETDEWEB)
Eichelberg, M.; Riesmeier, J. [OFFIS e.V., Bereich IuK-Systeme im Gesundheitswesen, Oldenburg (Germany); Thiel, A.; Jensch, P. [Fachbereich Informatik, Carl-von-Ossietzky-Univ., Oldenburg (Germany); Emmel, D.; Haderer, A.; Ricke, J.; Stohlmann, L. [Klinik fuer Strahlenheilkunde, Charite-Campus-Virchow-Klinikum der Humboldt-Univ. zu Berlin (Germany); Bernarding, J. [Medizinische Informatik, Universitaetsklinikum Benjamin Franklin (UKBF), Freie Univ. Berlin (Germany)
2002-02-01
The use of telemedicine is becoming indispensable for a continuous and economical delivery of a high quality of care. However, data protection requirements have to be considered. For the selection of solutions, vendor-independent components based on standards are a prerequisite for a seamless integration into the existing, often heterogeneous, IT infrastructure. The ''Internet protocol'' TCP/IP and the DICOM standard with it's new security extensions form the basis for an internationally standardized and accepted procedure for a secure interchange of radiological images beyond platform boundaries. (orig.) [German] Um auch in Zukunft eine kostenguenstige und qualitativ hochwertige Patientenversorgung gewaehrleisten zu koennen, ist der Einsatz von Telemedizin unabdingbar. Dabei sind jedoch immer die Belange des Datenschutzes zu beruecksichtigen. Bei der Auswahl der Loesungen sind herstelleruebergreifende und auf Standards basierende Komponenten Voraussetzung fuer eine nahtlose Integration in die bestehende, oft heterogene EDV-Infrastruktur. Das ''Internetprotokoll'' TCP/IP und der DICOM-Standard mit seinen neuen Sicherheitserweiterungen bilden die Grundlage fuer ein weltweit standardisiertes und akzeptiertes Verfahren zum sicheren Austausch radiologischer Bilddaten ueber Plattformgrenzen hinweg. (orig.)
EXTREMELY STRONG CARBON-MONOXIDE EMISSION FROM THE CLOVERLEAF QUASAR AT A REDSHIFT OF 2.5
BARVAINIS, R; TACCONI, L; ANTONUCCI, R; ALLOIN, D; COLEMAN, P
1994-01-01
GALAXIES at high redshift are very faint and difficult to study at optical and near-infrared wavelengths, but detection of far-infrared emission(1) and molecular gas(2,3) in a galaxy at redshift z approximate to 2.3 has suggested that their early evolution may be investigated by these means instead.
The Interchangeability of Viscoelastographic Instruments and Reagents
2014-01-01
clinical and research settings, and now is the time to perform the vital harmonization and standardization of these viscoelastic assays. AUTHORSHIP M.A...boelastography (ROTEM) parameters are influenced by age, gender , and oral contraception. Perfusion. 2011;26(4):334Y340. 13. Jansen JO, Luke D, Davies E, Spencer
science, technology and environment: interchange workshops
African Journals Online (AJOL)
of stimulating discourse on pressing issues in science, technology ... the context of Lesotho in collaboration with the selected teachers (the research team),. 2. Explore how ... appropriate teaching methodologies for EE in multi- cultural science ...
Interchange. Program Improvement Products Identified through Networking.
Ohio State Univ., Columbus. National Center for Research in Vocational Education.
This catalog lists exemplary field-based program improvement products identified by the Dissemination and Utilization Products and Services Program (D&U) at the National Center for Research in Vocational Education. It is designed to increase awareness of these products among vocational educators and to provide information about them that…
Radial interchange motions of plasma filaments
DEFF Research Database (Denmark)
Garcia, O.E.; Bian, N.H.; Fundamenski, W.
2006-01-01
on a biperiodic domain perpendicular to the magnetic field. It is demonstrated that a blob-like plasma structure develops dipolar vorticity and electrostatic potential fields, resulting in rapid radial acceleration and formation of a steep front and a trailing wake. While the dynamical evolution strongly depends...
Chromatid interchanges at intrachromosomal telomeric DNA sequences
International Nuclear Information System (INIS)
Fernandez, J.L.; Vazquez-Gundin, F.; Bilbao, A.; Gosalvez, J.; Goyanes, V.
1997-01-01
Chinese hamster Don cells were exposed to X-rays, mitomycin C and teniposide (VM-26) to induce chromatid exchanges (quadriradials and triradials). After fluorescence in situ hybridization (FISH) of telomere sequences it was found that interstitial telomere-like DNA sequence arrays presented around five times more breakage-rearrangements than the genome overall. This high recombinogenic capacity was independent of the clastogen, suggesting that this susceptibility is not related to the initial mechanisms of DNA damage. (author)
AXAF FITS standard for ray trace interchange
Hsieh, Paul F.
1993-07-01
A standard data format for the archival and transport of x-ray events generated by ray trace models is described. Upon review and acceptance by the Advanced X-ray Astrophysics Facility (AXAF) Software Systems Working Group (SSWG), this standard shall become the official AXAF data format for ray trace events. The Flexible Image Transport System (FITS) is well suited for the purposes of the standard and was selected to be the basis of the standard. FITS is both flexible and efficient and is also widely used within the astronomical community for storage and transfer of data. In addition, software to read and write FITS format files are widely available. In selecting quantities to be included within the ray trace standard, the AXAF Mission Support team, Science Instruments team, and the other contractor teams were surveyed. From the results of this survey, the following requirements were established: (1) for the scientific needs, each photon should have associated with it: position, direction, energy, and statistical weight; the standard must also accommodate path length (relative phase), and polarization. (2) a unique photon identifier is necessary for bookkeeping purposes; (3) a log of individuals, organizations, and software packages that have modified the data must be maintained in order to create an audit trail; (4) a mechanism for extensions to the basic kernel should be provided; and (5) the ray trace standard should integrate with future AXAF data product standards.
Program 6 Technical Interchange Meeting Proceedings
1992-10-01
Buteau PRC (703)556-1355 Gary R. Dolson PRC (703) 5561859 David J. Gray Sterling (315)336-0500 Noreen S. Heyda Harris (407)984-6384 Jay Jesse GTE (719)570...Reed Sterling John Sautter Sterling (315)336-0500 Kevin Sculley PRC (402)291-5533 Stefan Shrier MRJ (703)934-9249 Peter Soliz Orion (505)262-2260...4730 Howard A. Melching GTE (719)570-8898 Noreen S. Heyda Harris (407)984-6384 Jonathan H. Reed Harris (407)984-6008 Stefan Shrier MRJ (703) 934-9249
6. Electronic Data Interchange and XML
Indian Academy of Sciences (India)
Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 3 · Current Issue Volume 23 | Issue 3. March 2018. Home · Volumes & Issues · Categories · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
Directory of Open Access Journals (Sweden)
Carolina Graterol Benavides
2011-06-01
Full Text Available Las organizaciones usan las tecnologías de información y comunicación (TIC´s para facilitar la gestión y control de sus procesos internos, fijando como directriz principal la alineación con las estrategias empresariales establecidas. Partiendo de esta premisa, se fija como objetivo general del presente artículo: presentar los resultados de la aplicación de la norma COBIT (Control Objectives for Information and Related Technology en el proceso de monitoreo de las transferencias electrónicas de datos contables, financieros y administrativos de la Unidad de Contraloría y Administración de la Región Occidente en una industria de lácteos venezolana. La organización considera que dicho proceso es crítico, lo cual se justifica gracias al valor de la información transferida en la elaboración de informes de gestión. Se trata de un proyecto factible, el cual involucra la aplicación de conocimiento, a través del uso de un modelo o marco de trabajo relacionado con la administración de recursos informáticos. // ABSTRACT: The information and communication technology (ICT‘s are used by the organizations in order to facilitate the administration and control of their internal processes. The principal guideline is to achieve the linkage between business strategies and ICTs strategies. Taking this premise as our starting-point, the general objective of this article is to present the results of the application of the COBIT framework (Control Objectives for Information and Related Technology in the monitoring process of the financial, countable and administrative data electronic interchange of the "Lácteos Los Andes" Western Region Controllership and Administration Unit. The mentioned process is critical for the organization on account of the value of the information transferred for the preparation of management reports. This study is a feasible project, which takes into account the knowledge application through a framework related to ICTs
Directory of Open Access Journals (Sweden)
Miguel Tregnaghi
2004-01-01
Full Text Available OBJECTIVE: To compare two pediatric recombinant hepatitis B vaccines-the Engerix-B reference vaccine and the Euvax-B vaccine-in terms of immunogenicity and reactogenicity, and also to investigate their interchangeability, that is, whether a three-dose hepatitis B vaccination schedule begun with a first dose of Engerix-B could be completed with two doses of Euvax-B. METHODS: This study was conducted in the city of Córdoba, Argentina, from March 1999 through February 2000. Three groups of Argentine newborns (100 per group were vaccinated at 0, 1, and 6 months of age with hepatitis B vaccine: group A, three doses of Euvax-B; group B, three doses of Engerix-B; and group C, one dose of Engerix-B followed by two doses of Euvax-B. Reactogenicity was evaluated based on parental reporting of any solicited local or systemic event occurring during the 7-day period following vaccination. Whether Euvax-B and Engerix-B were clinically identical was assessed in terms of the seroprotection rates (antibodies to hepatitis B surface antigen (anti-HBsAg >10 milli-international units per mL (mIU/mL 2 months after the third vaccination. RESULTS: Reactogenicity was low in all three groups. Five months after the second dose (that is, immediately prior to the third vaccination, seroprotection rates were 95.9%, 94.7%, and 90.2% for groups A, B, and C, respectively. Two months after the third dose all subjects were seroprotected, with geometric mean concentrations of anti-HBsAg of 2 468.1, 1 714.8, and 2 075.3 mIU/mL for groups A, B, and C, respectively. CONCLUSIONS: Both of the recombinant hepatitis B vaccines that we studied were well tolerated and highly immunogenic. Euvax-B was clinically identical (not inferior to the Engerix-B reference vaccine, and either vaccine could be used to achieve the World Health Organization goal of immunizing all infants against hepatitis B. Further, Euvax-B can be safely used in infants given an initial dose of either Euvax-B or Engerix
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
Activities were conducted for (1) proposing that some items in software comply with a standard format to be commonly used by plural personal computer programs in the field of the key technology of color image management and for (2) placing before ISO (International Organization for Standardization) a standardization proposal and a standard format proposal involving characters and character baselines in the field of research and development of standard data for diversification of international information interchange. Under Item (1), submission of a proposal was adjourned because the standard of color expression in Asian countries was insufficient and involved many problems requiring careful attention. The problems were whether the color names were suitable for the users, that the color names other than those specified by JIS (Japanese Industrial Standard) Z8102 were equivocal and needed proper notations, and whether color names to use with displays or the like were to be defined independently from JIS. Under Item (2), the problem of metric information standardization surfaced because it was supposed that mixing JIS fonts with other countries' fonts would give rise to problems. As for the character size, it is 10 points, more or less, in all the countries and therefore it does not make difficult the exchange of information under the Web environments. The results will be reported and explained to the departments concerned and to the Asian countries. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
Activities were conducted for (1) proposing that some items in software comply with a standard format to be commonly used by plural personal computer programs in the field of the key technology of color image management and for (2) placing before ISO (International Organization for Standardization) a standardization proposal and a standard format proposal involving characters and character baselines in the field of research and development of standard data for diversification of international information interchange. Under Item (1), submission of a proposal was adjourned because the standard of color expression in Asian countries was insufficient and involved many problems requiring careful attention. The problems were whether the color names were suitable for the users, that the color names other than those specified by JIS (Japanese Industrial Standard) Z8102 were equivocal and needed proper notations, and whether color names to use with displays or the like were to be defined independently from JIS. Under Item (2), the problem of metric information standardization surfaced because it was supposed that mixing JIS fonts with other countries' fonts would give rise to problems. As for the character size, it is 10 points, more or less, in all the countries and therefore it does not make difficult the exchange of information under the Web environments. The results will be reported and explained to the departments concerned and to the Asian countries. (NEDO)
Directory of Open Access Journals (Sweden)
Norma Valéria Dantas de Oliveira Souza
2007-06-01
és del análisis de contenido se ha verificado que existió intercambio de conocimiento cuando se realizaron grupos de orientación para clientes en el préoperatorio en las orientaciones individuales para el auto cuidado en su casa y a través del material de instrucción fornecido a los clientes. Además, se ha verificado que la actividad de extensión es una importante estrategia que facilita la enseñanza-aprendizajeQualitative, descriptive study, such as case study, that has the object of interchanging theory-practical knowledge established among the extension project practicant students called "Guiding the client in surgical situation in order to distinguish the care" and nursing practicants that act in surgical nurseries scenes at Pedro Ernesto University Hospital (Rio de Janeiro - Brazil. Objective: To identify and analyse the situation and ways of teaching-learning in which it is possible to establish theory-practical knowledge interchange among practicants and interns and to discuss the importance of extension project as an strategy to acquire theory-practical knowledge. It has been applied a semi-structured interview to 15 interns and after content analysis, it has been verified that there was knowledge interchange when groups of orientation to pre-operatory clients has been made, at individual orientation for home self care and through instrument material given to the clients. Besides, it has been verified that extension activities are an important strategy that facilitates the teaching-learning process.
The SOL width and the MHD interchange instability in tokamaks
Energy Technology Data Exchange (ETDEWEB)
Kerner, W [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking; Pogutse, O [Kurchatov institute, Moscow (Russian Federation)
1994-07-01
Instabilities in the SOL plasma can strongly influence the SOL plasma behaviour and in particular the SOL width. The SOL stability analysis shows that there exists a critical ratio of the thermal energy and the magnetic energy. If the SOL beta is greater than this critical value, the magnetic field cannot prevent the plasma displacement and a strong MHD instability in the SOL occurs. In the opposite case only slower resistive instabilities can develop. A theoretical investigation of the SOL plasma stability is presented for JET single-null and double-null divertor configurations. The dependence of the stability threshold on the SOL beta and on the sheath resistance is established. Applying a simple mixing length argument gives the scaling of the SOL width. 5 refs., 2 figs.
Electronic Networking as an Avenue of Enhanced Professional Interchange.
Ratcliff, James L.
Electronic networking is communication between two or more people that involves one or more telecommunications media. There is electronic networking software available for most computers, including IBM, Apple, and Radio Shack personal computers. Depending upon the sophistication of the hardware and software used, individuals and groups can…
Dissipative processes in interchange driven scrape-off layer turbulence
DEFF Research Database (Denmark)
Fundamenski, W.; Garcia, Odd Erik; Naulin, Volker
2007-01-01
First principles expressions are given for the parameters governing collisional diffusion and parallel losses of mass, momentum and energy in tokamak scrape-off layer (SOL) plasmas. These dissipative, or damping, coefficients are based on neoclassical perpendicular transport (Pfirsch-Schluter dif......First principles expressions are given for the parameters governing collisional diffusion and parallel losses of mass, momentum and energy in tokamak scrape-off layer (SOL) plasmas. These dissipative, or damping, coefficients are based on neoclassical perpendicular transport (Pfirsch......-Schluter diffusion) and classical parallel transport (sub-sonic advection and Spitzer-Harm diffusion). When numerical values derived from these expressions are used to compute damping coefficients for the edge-SOL electrostatic (ESEL) turbulence code, simulations correctly reproduce the radial profiles of particle...... density, n, and electron temperature, T-e, as well as statistical distributions and temporal correlations of particle density and flux density measured in Ohmic and L-mode plasmas on the TCV tokamak. Similarly, preliminary calculations agree reasonably well with radial profiles of T-e measured in Ohmic...
Dataflow Interchange Format and a Framework for Processing Dataflow Graphs
National Research Council Canada - National Science Library
Keceli, Fuat
2004-01-01
..., and recognizing useful subclasses of dataflow models. This thesis also develops the framework for a Java-based software repository that provides dataflow analysis and optimization algorithms for DIF representations. The featured framework is accompanied by toolboxes for hierarchical design support and visualization of graphs.
Dataflow Interchange Format and a Framework for Processing Dataflow Graphs
National Research Council Canada - National Science Library
Keceli, Fuat
2004-01-01
Digital Signal Processing (DSP) applications are often designed with tools based on dataflow graphs and the increasing number of such tools shows the need for a common intermediate graph representation for exchanging dataflow information...
Plastocyanin/cytochrome c6 interchange in Scenedesmus vacuolatus.
Miramar, M Dolores; Inda, Luis A; Saraiva, Lígia M; Peleato, M Luisa
2003-12-01
Plastocyanin and cytochrome c6 from the green alga Scenedesmus vacuolatus were immunoquantified in cells grown under different concentrations of copper and iron. Plastocyanin expression was constitutive, its synthesis was not significantly affected by iron availability, and increases with copper availability. On the contrary, cytochrome c6 synthesis is repressed by copper, and only residual amounts of the protein were detected at 0.1 micromol/L copper. Under copper deficiency, cytochrome c6 is slightly dependent on iron. In natural environments, plastocyanin seems to be the predominant electron donor to P700.
Interchangeable Positions in Interaction Sequences in Science Classrooms
Directory of Open Access Journals (Sweden)
Carol Rees
2017-03-01
Full Text Available Triadic dialogue, the Initiation, Response, Evaluation sequence typical of teacher /student interactions in classrooms, has long been identified as a barrier to students’ access to learning, including science learning. A large body of research on the subject has over the years led to projects and policies aimed at increasing opportunities for students to learn through interactive dialogue in classrooms. However, the triadic dialogue pattern continues to dominate, even when teachers intend changing this. Prior quantitative research on the subject has focused on identifying independent variables such as style of teacher questioning that have an impact, while qualitative researchers have worked to interpret the use of dialogue within the whole context of work in the classroom. A recent paper offers an alternative way to view the triadic dialogue pattern and its origin; the triadic dialogue pattern is an irreducible social phenomenon that arises in a particular situation regardless of the identity of the players who inhabit the roles in the turn-taking sequence (Roth & Gardner, 2012. According to this perspective, alternative patterns of dialogue would exist which are alternative irreducible social phenomena that arise in association with different situations. The aim of this paper is to examine as precisely as possible, the characteristics of dialogue patterns in a seventh-eighth grade classroom during science inquiry, and the precise situations from which these dialogue patterns emerge, regardless of the staffing (teacher or students in the turn-taking sequence. Three different patterns were identified each predominating in a particular situation. This fine-grained analysis could offer valuable insights into ways to support teachers working to alter the kinds of dialogue patterns that arise in their classrooms.
75 FR 81721 - Debit Card Interchange Fees and Routing
2010-12-28
... cards not marketed or labeled as a gift card or certificate. EFTA Section 920 provides, however, that... cardholder initiates a purchase by providing his or her card or card information to a merchant. In the case... purchases at retailers in the early 1980s. It was not until the mid-1990s, however, that PIN debit became a...
76 FR 43393 - Debit Card Interchange Fees and Routing
2011-07-20
... programs and certain reloadable, general-use prepaid cards not marketed or labeled as a gift card or gift... evolved to support payments made by consumers for the purchase of goods or services at merchants... of the purchase transaction. Debit cards are generally issued by depository institutions to their...
77 FR 46258 - Debit Card Interchange Fees and Routing
2012-08-03
... transactions may be reduced; (4) the fraud-prevention and data-security costs expended by each party involved... costs such as fraud-prevention research and development costs, data-security costs, fraud-related... own fraud-prevention tools. For example, many large Internet merchants implement extra security...
Turbulent interchange in triangular array bare rod bundles
International Nuclear Information System (INIS)
Kelly, J.M.; Todreas, N.
1977-07-01
Bulk mixing coefficients were measured for single plane water flow in a simulated rod bundle with a pitch to diameter ratio of 1.10. A tracer technique employing Rhodamine B as the tracer and measuring fluorescence was used. Isokinetic sampling was achieved by using a pressure balance method. The results were corrected for both entrance effects and diversion crossflows. The results showed a change in Reynolds number behavior as the laminar sublayer began to ''choke'' the turbulent mixing. This, and a review of other mixing experiments, suggested that secondary flows do not compensate for laminarization and that turbulent mixing decreases as the pitch to diameter ratio decreases for values of P/D less than 1.05 in a manner similar to that predicted by Ramm et al. Concentration profiles were measured through the clearance gap and the values of the gradient were used to calculate the gap averaged circumferential eddy diffusivity for mass. A discussion of the eddy diffusivity concept and its applicability to turbulent mixing is presented
Interchangeability of the Wii Balance Board for Bipedal Balance Assessment
Bonnech?re, Bruno; Jansen, Bart; Omelina, Lubos; Rooze, Marcel; Van Sint Jan, Serge
2015-01-01
Background Since 2010, an increasing interest in more portable and flexible hardware for balance and posture assessment led to previously published studies determining whether or not the Wii Balance Board could be used to assess balance and posture, both scientifically and clinically. However, no previous studies aimed at comparing results from different Wii Balance Boards for clinical balance evaluation exist. Objective The objective of this crossover study is to assess the interchangeabilit...
A compositional interchange format for hybrid systems : design and implementation
Nadales Agut, D.E.
2012-01-01
The design of large industrial controlled systems is a difficult task, which calls for a modelbased design approach. For this, different formalisms exist. Each of these formalisms addresses a specific set of problems, and has its own set of features. Moreover, several formalisms and tools are used
76 FR 43477 - Debit Card Interchange Fees and Routing
2011-07-20
... transactions may be reduced; (4) the fraud-prevention and data-security costs expended by each party involved... parties involved in those transactions; and the fraud-prevention and data-security activities and costs..., many large online merchants implement extra security measures to verify the legitimacy of a purchase...
Pre-School Educational Provision in Rural Areas. Interchange 69.
Copus, Andrew; Petrie, Scott; Shucksmith, Janet; Shucksmith, Mark; Still, Margaret; Watt, Joyce
The Scottish Executive Education Department has pledged to achieve universal provision of preschool education for 3- and 4-year-olds, whose parents want it, by 2002. The particular factors affecting delivery of preschool education in rural areas were examined through telephone interviews with local education authorities and voluntary preschool…
Interchanging parameters and integrals in dynamical systems: the mapping case
Energy Technology Data Exchange (ETDEWEB)
Roberts, John A.G. [Department of Mathematics, La Trobe University, Bundoora, VIC (Australia) and School of Mathematics, University of New South Wales, Sydney, NSW (Australia)]. E-mail: jagr@maths.unsw.edu.au; Apostolos, Iatrou; Quispel, G.R.W. [Department of Mathematics, La Trobe University, Bundoora, VIC (Australia)]. E-mails: A.Iatrou@latrobe.edu.au; R.Quispel@latrobe.edu.au
2002-03-08
We consider dynamical systems with discrete time (maps) that possess one or more integrals depending upon parameters. We show that integrals can be used to replace parameters in the original map so as to construct a different map with different integrals. We also highlight a process of reparametrization that can be used to increase the number of parameters in the original map prior to using integrals to replace them. Properties of the original map and the new map are compared. The theory is motivated by, and illustrated with, examples of a three-dimensional trace map and some four-dimensional maps previously shown to be integrable. (author)
Interchangeable end effector tools utilized on the PFMA
Cody, Joe; Carroll, John; Crow, George; Gierow, Paul; Littles, Jay; Maness, Michael; Morrison, Jim
1992-02-01
An instrumented task board, used for measuring forces applied by the Protoflight Manipulator Arm (PFMA) to the task board, was fabricated and delivered to Marshall Space Flight Center. SRS Technologies phased out the existing IBM compatible data acquisition system, used with a instrumented task board, and integrated the force measuring electronic hardware in with the Macintosh II data acquisition system. The purpose of this change was to acquire all data with the same time tag, allowing easier and more accurate data reduction in addition to real-time graphics. A three-dimensional optical position sensing system for determining the location of the PFMA's end effect or in reference to the center of the instrumented task board was also designed and delivered under. An improved task board was fabricated which included an improved instrumented beam design. The modified design of the task board improved the force/torque measurement system by increasing the sensitivity, reliability, load range and ease of maintenance. A calibration panel for the optical position system was also designed and fabricated. The calibration method developed for the position sensors enhanced the performance of the sensors as well as simplified the installation and calibration procedures required. The modifications made under this effort expanded the capabilities of the task board system. The system developed determines the arm's position relative to the task board and measures the signals to the joints resulting from the operator's control signals in addition to the task board forces. The software and hardware required to calculate and record the position of the PFMA during the performance of tasks with the instrumented task board were defined, designed and delivered to MSFC. PFMA joint input signals can be measured from a breakout box to evaluate the sensitivity or response of the arm operation to control commands. The data processing system provides the capability for post processing of time-history graphics and plots of the PFMA positions, the operator's actions, and the PFMA servo reactions in addition to realtime force and position sensor data presentation.
Cultural Interchangeability? Culture-Specific Items in Translation
Directory of Open Access Journals (Sweden)
Ajtony Zsuzsanna
2016-12-01
Full Text Available This paper summarizes the results of the translation work carried out within an international project aiming to develop the language skills of staff working in hotel and catering services. As the topics touched upon in the English source texts are related to several European cultures, these cultural differences bring about several challenges related to the translation of realia, or culture-specific items (CSIs. In the first part of the paper, a series of translation strategies for rendering source-language CSIs into the target language are enlisted, while the second part presents the main strategies employed in the prepared translations.
GuideLine Interchange Format (GLIP): Extensions and Practical Applications
2000-09-01
Others have also studied and used GLIF as well6-9 . We chose this formalism because it can be easily (and exactly) represented in a flowchart , a...benefit from guidelines in different formats (algorithms, flowcharts , written text). Guidelines in diagrammatic form such as algorithms are useful for...as long as a task is performed, the GL suggests the next steps. This can be a suitable modality for beginners . On the contrary, it can be "silent
2013-07-01
..., which consists of replacing the northbound and southbound bridge girders and lowering the pavement..., Dockets Management Facility, Room W12-140, 1200 New Jersey Avenue SE., Washington, DC 20590, or fax... Jones, Office of Freight Management and Operations, Office of Operations, (202) 366-2976, Mr. Bill Winne...
Directory of Open Access Journals (Sweden)
Vlasov Denis Nikolaevich
2013-06-01
Full Text Available The article deals with the planning concept of transport interchange hubs providing trans-regional bus transportation. According to the ever growing passenger traffic and the number of spatial planning documents, trans-regional bus route networks develop very rapidly in Russia. The findings of the poll of passengers demonstrate their high loyalty to trans-regional bus transportation networks due to their convenient arrangement and little time expenditures (compared to other means of transport. However, little attention is driven by specialized domestic sources to the planning concepts of transport interchange hubs having bus terminals within their structure; the regulatory documentation is missing. One of feasible ways to resolve the issue is to study the international practice of design and construction of transport interchange hubs having bus terminals as the key points providing trans-regional bus transportation.In this article, the transport interchange hub of Matsumoto, Japan, serves as the sample. The author considers its composition and functional site division. The author also performs a detailed analysis of the main elements of the hub, including the design of its pedestrian routes ensuring its functional and spatial unity. Moreover, the author considers the planning structure of a bus terminal and arrangement of retail trade facilities and service areas inside it.Изучены вопросы планировочной организации транспортно-пересадочных узлов (ТПУ, обеспечивающих межрегиональные поездки на автобусах. На примере ТПУ японского города Мацумото рассмотрен состав ТПУ, зонирование территории ТПУ, подробно проанализированы все элементы ТПУ, включая структуру пешеходных связей, обес
Fast detection of genetic information by an optimized PCR in an interchangeable chip.
Wu, Jinbo; Kodzius, Rimantas; Qin, Jianhua; Wen, Weijia; Xiao, Kang
2012-01-01
amplification. An optimized PCR with two-temperature approach for denaturing and annealing (Td and Ta) of DNA was also formulated with the PCR chip, with which the amplification of male-specific sex determining region Y (SRY) gene marker by utilizing raw saliva
International Nuclear Information System (INIS)
1980-01-01
This opening and closing device is of the type which employs a casing inside the duct along the fluid path. It is provided with an opening through which the fluid flows and a joint with a closing clapper controlled from the outside enabling the fluid flow to be regulated. It is characterized by the fact that the casing is provided with a lateral opening with respect to the fluid flow direction, the size of this opening being sufficiently large to allow the assembly with its closing clapper to be introduced and withdrawn [fr
Functional interchangeability of late domains, late domain cofactors and ubiquitin in viral budding.
Directory of Open Access Journals (Sweden)
Maria Zhadina
2010-10-01
Full Text Available The membrane scission event that separates nascent enveloped virions from host cell membranes often requires the ESCRT pathway, which can be engaged through the action of peptide motifs, termed late (L- domains, in viral proteins. Viral PTAP and YPDL-like L-domains bind directly to the ESCRT-I and ALIX components of the ESCRT pathway, while PPxY motifs bind Nedd4-like, HECT-domain containing, ubiquitin ligases (e.g. WWP1. It has been unclear precisely how ubiquitin ligase recruitment ultimately leads to particle release. Here, using a lysine-free viral Gag protein derived from the prototypic foamy virus (PFV, where attachment of ubiquitin to Gag can be controlled, we show that several different HECT domains can replace the WWP1 HECT domain in chimeric ubiquitin ligases and drive budding. Moreover, artificial recruitment of isolated HECT domains to Gag is sufficient to stimulate budding. Conversely, the HECT domain becomes dispensable if the other domains of WWP1 are directly fused to an ESCRT-1 protein. In each case where budding is driven by a HECT domain, its catalytic activity is essential, but Gag ubiquitination is dispensable, suggesting that ubiquitin ligation to trans-acting proteins drives budding. Paradoxically, however, we also demonstrate that direct fusion of a ubiquitin moiety to the C-terminus of PFV Gag can also promote budding, suggesting that ubiquitination of Gag can substitute for ubiquitination of trans-acting proteins. Depletion of Tsg101 and ALIX inhibits budding that is dependent on ubiquitin that is fused to Gag, or ligated to trans-acting proteins through the action of a PPxY motif. These studies underscore the flexibility in the ways that the ESCRT pathway can be engaged, and suggest a model in which the identity of the protein to which ubiquitin is attached is not critical for subsequent recruitment of ubiquitin-binding components of the ESCRT pathway and viral budding to proceed.
An XML-based interchange format for genotype-phenotype data.
Whirl-Carrillo, M; Woon, M; Thorn, C F; Klein, T E; Altman, R B
2008-02-01
Recent advances in high-throughput genotyping and phenotyping have accelerated the creation of pharmacogenomic data. Consequently, the community requires standard formats to exchange large amounts of diverse information. To facilitate the transfer of pharmacogenomics data between databases and analysis packages, we have created a standard XML (eXtensible Markup Language) schema that describes both genotype and phenotype data as well as associated metadata. The schema accommodates information regarding genes, drugs, diseases, experimental methods, genomic/RNA/protein sequences, subjects, subject groups, and literature. The Pharmacogenetics and Pharmacogenomics Knowledge Base (PharmGKB; www.pharmgkb.org) has used this XML schema for more than 5 years to accept and process submissions containing more than 1,814,139 SNPs on 20,797 subjects using 8,975 assays. Although developed in the context of pharmacogenomics, the schema is of general utility for exchange of genotype and phenotype data. We have written syntactic and semantic validators to check documents using this format. The schema and code for validation is available to the community at http://www.pharmgkb.org/schema/index.html (last accessed: 8 October 2007). (c) 2007 Wiley-Liss, Inc.
Sam Kurokawa; Seiji Manabe
2002-01-01
This paper examines determinants of EDI adoption and integration in the US and Japanese automobile suppliers. The paper constructs several hypotheses based on the transaction-cost and resource- dependence approaches, and tests these hypotheses by using data from the automobile suppliers. Our study shows: (1) the resource-dependence approach seemed more effective in explaining EDI adoption, while the transaction-cost approach seemed more effective in explaining EDI integration; (2) the transac...
2010-03-01
181 a. Information Grammar Theory ( Chomsky ) ..........................181 b. Events...document. a. Information Grammar Theory ( Chomsky ) Both grammars and events are learned for each XML document by means of a supporting schema or by...processing the XML document. The learning process is similar to Chomsky grammars, a hierarchical-based formal grammar for defining a language
Controls for the Electronic Data Interchange at the Defense Finance and Accounting Service Columbus
National Research Council Canada - National Science Library
2001-01-01
On May 21, 1997, the Under Secretary of Defense (Comptroller) directed the move to a paper-free contracting process which would modernize the acquisition processes of contract writing, administration, finance, and auditing...
2010-01-01
Based on the results from this research, MoDOT can confidently state that the diverging diamond was the right transportation solution for the Interstate 44 and Route 13 intersection. The overall results show: Most Springfield area residents were ...
Czech Academy of Sciences Publication Activity Database
La Sorte, F. A.; McKinney, M. L.; Pyšek, Petr
2007-01-01
Roč. 13, č. 4 (2007), s. 913-921 ISSN 1354-1013 Grant - others:DAISIE(XE) SSPI-CT-2003-511202 Institutional research plan: CEZ:AV0Z60050516 Source of funding: R - rámcový projekt EK Keywords : urban floras * homogenization * Europe and USA Subject RIV: EF - Botanics Impact factor: 4.786, year: 2007
A MODULAR PHOTOSYNTHETIC MICROBIAL FUEL CELL WITH INTERCHANGEABLE ALGAE SOLAR COMPARTMENTS
Fleury, Daniel
2017-01-01
This project trial provides a novel small-scale solar harnessing technology which increases environmental effectiveness while maintaining optimal energy efficiency. Although modern solar panels are purposed in producing clean energy, the materials and byproducts of solar cell manufacturing are not eco-friendly. Thus, considering an organic, renewable and energy efficient solar cell model is necessary. Investigations explored multiple highly-photosynthetic algal species which were later integr...
Directory of Open Access Journals (Sweden)
Lara Emanuele da Luz
2017-11-01
Full Text Available The present article intends, on the one hand, to study the genealogy of the term biopolitics, passing through the term bíos. To support this reflection, the first part of the book by Roberto Esposito, Bíos, will be used. The term biopolitics undergoes a mutation since its first use in 1905. On the other hand, based on the data presented in the first part of the chapter, an analysis of the consecration of the term made by Michel Foucault will be made. In the course of the article, besides Foucault and Esposito, a connection will be made to the Arendtian work
2013-11-27
... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35777] New Orleans & Gulf... Company New Orleans & Gulf Coast Railway Company, Inc. (NOGC), a Class III rail carrier, has filed a... to a third-party railroad, BNSF Railway Company and the New Orleans Public Belt are located in very...
Dual dynamics of constituent interchange in soft and hard hadronic processes
International Nuclear Information System (INIS)
Akkelin, S.V.; Kobylinskii, N.A.; Martynov, E.S.; Shelest, V.P.
1987-01-01
The possibility of combining the dual theory of soft hadronic processes with the rules of dimensional counting for hard processes is investigated. It is shown that this is achieved in the framework of a dual analytic model with certain conditions on the form and parameters of the Regge trajectories
The Role of Efficient XML Interchange (EXI) in Navy Wide-Area Network (WAN) Optimization
2015-03-01
classified documents by Edward Snowden created a catalyst for more Internet companies and users to implement data encryption (Curran, 2014). Adoption of...Digital & Analog Communication Systems (8th ed.). Upper Saddle River, NJ: Pearson Education. Curran, J. (2014). Snowden leaks said to spur
2003-07-01
into other game genres such as Real-Time Strategy (RTS) games and Massively Multiplayer Online Role- Playing Games ( MMORPG ). Unfortunately these game...games with a number of game companies, most notably Quicksilver, developers of Masters of Orion Ill, and UbiSoft, developer of the upcoming Matrix MMORPG ...in a recent DMSO funded effort to identify analysis applications of MMORPGs headed by Dr. David Johnson at IDA. This effort has suggested that the
Pero Vaz de Caminha: an-interchange program for quality control between Brazil and Portugal.
Utagawa, Maria Lúcia; di Loreto, Celso; de Freitas, Cristina; Milanezi, Fernanda; Longatto Filho, Adhemar; Pereira, Sónia Maria Miranda; Maeda, Marina Yoshiê Sakamoto; Schmitt, Fernando C
2006-01-01
To start an interexchange program for quality control in cervical cytology and discuss conceptual criteria for diagnosis. Slides were selected in the archives of the 2 institutes and included cases with unsatisfactory, negative and positive results. Sets of slides were changed between the partners every 3 months. At the end of each year a senior cytopathologist was invited to discuss the major discrepancies found in the study. A total of 1,041 cases were analyzed. Full concordance was obtained in 74.4% (774) of cases and discrepancies in 25.6% (267 cases). Full agreement was achieved in 276 (39%) of 707 cases categorized as negative. In 421 negative cases from laboratory A, this concordance represents 65.5% and 96.5% for laboratory B, which submitted 286 negative cases. The main discordance was the high number of atypical squamous cells of undetermined significance cases: 3.1% for A and 128 (33.2%) for B. Samples with discrepancies related to the quality of the material was another controversial issue: of 16 cases from laboratory A, 6 (37.5%) unsatisfactory cases were the same and 10 (62.5%) different. Laboratory B presented 20 unsatisfactory cases, and 14 (70.0%) had other diagnoses. Low grade squamous intraepithelial lesion and high grade squamous intraepithelial lesion concordance ranged from 75% to 80%, and invasive carcinoma has 4 discordances (28.5%), 3 previously screened as high grade squamous intraepithelial lesion and 1 as atypical squamous cells of undetermined significance. The kappa value obtained was 0.65, indicating substantial agreement. Our results indicated that atypical squamous cells of undetermined significance diagnoses are the crucial point of controversies and concern the quality of routine diagnosis in cytopathology.
Dillon, Patrick A; Kempton, Thomas; Ryan, Samuel; Hocking, Joel; Coutts, Aaron J
2018-03-01
To examine the effects of match-related and individual player characteristics on activity profile and technical performance during rotations in professional Australian football. Longitudinal observational study. Global positioning system data and player rating scores were collected from 33 professional Australian football players during 15 Australian football League matches. Player rating scores were time aligned with their relative total and high-speed running (HSR) distance (>20kmh -1 ) for each on ground rotation. Individual players' maximal aerobic running speed (MAS) was determined from a two-kilometre trial. A multilevel linear mixed model was used to examine the influence of rotations on physical activity profiles and skill execution during match play. Rotation duration and accumulated distance resulted in a trivial-to-moderate reduction in relative total and HSR distances as well as relative rating points. The number of disposals in a rotation had a small positive effect on relative total and HSR distances and a large positive effect on relative rating points. MAS was associated with a moderate-to-large increase in relative total distance, but had a large negative effect on relative rating points. Previous rotation time, stoppages and the number of rotations in the quarter had a trivial-to-small negative effect on relative total and HSR distances. A greater speed (mmin -1 ) was associated with a trivial increase in rating points during a rotation, while there was a trivial decrease in relative total distance as rating points increased. The complex relationship between factors that influence activity profile and technical performance during rotations in Australian football needs to be considered when interpreting match performance. Copyright © 2017 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.
Birn, Anne-Emanuelle; Hochman, Gilberto
2008-01-01
This article discusses the development of historical studies of international health since the 1980s, showing that the field has gained considerable density and complexity. The authors touch on various current research trends in the history of international health, including reconsideration of so-called centre-periphery and imperial-colonial relations. They emphasize the important, if often forgotten, role of Latin America in the history of international health and bring attention to the relevance of Canada to the international health field, especially in the last 30 years. The article concludes by introducing the articles that make up this special issue of CBMH, pointing out their most significant findings and cross-cutting themes.
Creatinine Clearance and Estimated Glomerular Filtration Rate – When are they Interchangeable
Šimetić, Lucija; Zibar, Lada; Drmić, Sandra; Begić, Ivana; Šerić, Vatroslav
2015-01-01
Study goal was to examine which of glomerular rate equations is most suitable for prediction of creatinine clearance. Using a retrospective review of data from 500 hospital patients we calculated glomerular filtration rate according to Cockcroft-Gault equation (C-G), Modification of Diet in Renal Disease Study equation (MDRD) and Chronic Kidney Disease Epidemiology Collaboration equation (CKD-EPI). We determined if results of these equations were compatible with creatinine clearance, and does...
Socrates and st. John the apostle: The interchangeable similarity of their portraits
Directory of Open Access Journals (Sweden)
Prolović Jadranka
2011-01-01
Full Text Available This article discusses depictions of the evangelist and apostle John and the similarity of his portrait to that of Socrates as known from antique monuments. Although not directly connected, certain parallels can also be found in their vitas.
Konold, Timothy; Cornell, Dewey
2015-09-01
Informant-based systems of assessment are common platforms for measuring a variety of educational and psychological constructs where the use of multiple informants is considered best practice. In many instances, structurally different informant types (e.g., students and teachers) are solicited on the basis of their unique roles with the target of measurement. The use of multiple informants provides an opportunity to evaluate the degree to which the obtained ratings are influenced by the trait of focus and extraneous sources that can be attributed to the rater. Data from a multilevel multitrait-multimethod design in which students (N = 35,565) and teachers (N = 9,112), from 340 middle schools, responded to items measuring 3 dimensions of school climate were evaluated through a multilevel correlated trait-correlated method latent variable model. Results indicated that ratings of school climate obtained by students and teachers demonstrated high levels of convergent validity, and that school-level ratings obtained by students and teachers were equitable in the assessment of teasing and bullying. Student ratings of support and structure yielded somewhat stronger evidence of convergent validity than ratings obtained by teachers as revealed by their respective trait factor loadings. This was explained in part by the higher levels of common method effects that were observed for teachers. (c) 2015 APA, all rights reserved.
The Defense Commissary Agency: A Business Case for Electronic Data Interchange
1993-09-01
4,818 51 33 Armour Foodd Co. Omaha, NE 2,603 21.3 1,913 114 34 Tree Top Inc. Chicago, IL 2.596 21.7 1,247 161 35 Reckitt & Colman, Inc. Lehigh Valley...Grocery Dallas, TX 1,388 46.2 1,002 195 127 Bisek And Co. Virginia Beach, VA 1,387 46.4 446 315 128 Benckiser Consultants Charlotte, NC 1,381 46.6
Aspects of nitrogen and carbon interchange in the Azolla-Anabaena symbiosis
International Nuclear Information System (INIS)
Peters, G.A.; Kaplan, D.; Meeks, J.C.; Buzby, K.M.; Marsh, B.H.; Corbin, J.L.
1985-01-01
The free-floating aquatic pteridophytes in the genus Azolla contain an N 2 -fixing cyanobacterium, Anabaena azollae, as a symbiont. Six extant species usually are recognized. In each species the symbiotic Anabaena can provide the total N requirement of the association via N 2 fixation and the Azolla sporophytes are capable of prolific vegetative reproduction in the absence of a combined N source. While vegetative reproduction and growth is more common, sexual reproduction occurs and presumably provides a means for survival during unfavorable environmental conditions. Azolla is heterosporous, producing both megasporocarps and microsporocarps on the same plant. Species demarcation is based primarily upon the morphology of these structures. Anabaena filaments are partitioned into both types of sporocarps during their development. The endophyte within the megasporocarp provides an inoculum for the developing sporophyte, maintaining the symbiosis. This report is restricted to studies conducted with the vegetatively propagated Azolla caroliniana - Anabaena azollae symbiosis grown on medium without combined N. It focuses on recent approaches to further elucidate aspects of host-endophyte interaction and incorporates analyses of soluble amino acids and ammonium, assays of ammonia assimilating enzymes, the use of [ 13 N]N 2 and the analysis of soluble sugars as well as 14 CO 2 -pulse chase studies. For orientation purposes the results are preceded by a description of the symbiosis. 39 references, 3 figures, 3 tables
Directory of Open Access Journals (Sweden)
Melahat Yıldırım
2016-12-01
CONCLUSION: Thiol- disulphide balance has shifted to the oxidative side in pregnant women with GDM. So blood glucose regulation is extremely crucial for reducing the oxidative stress which may lead to damages to vital organs of a mother or possibly to development of a fetus in women with GDM.
International Nuclear Information System (INIS)
Waszink, R.P.; Hwang, J.Y.; Efferding, L.E.
1974-06-01
This is a preliminry thermal/hydraulic report reflecting work under Subtask 6.2 of Ref. 1.1. This report is an extension of the previous thermal/hydraulic design report. Parts of this report have been transmitted to GE. The detailed design basis, listed by source, is given. Additional details are discussed
Influence of prilocaine in the interchange of 131I between aqueous humour and blood
International Nuclear Information System (INIS)
Arbex, S.T.; Neder, A.C.; Mattos Filho, T.R. de; Ramos, A.O.; Nascimento Filho, V.F. do
1981-01-01
The experiment had two groups: Group I - (six dogs) - 131 I was injected into the aqueous humour and the radioactivity was measured in the blood at 1,2,4,8,16,32,64 and 128 minutes after the administration. Group II - (eight animals) - 131 I was injected intravenously and the radioactivity was measured in the aqueous humour at 5 and 10 minutes after the administration. Each group was subdivided in two sub-groups, one of them besides the 131 I received 5 mg/Kg of prilocaine. 131 I in the iodite form was always injected in 0.1 ml volumes, corresponding to 312.5 μCi. The radioactivity was measured and the results were as follows: a) Group I - the prilocaine markedly decreased the radioactivity in the blood, suggesting a smaller passage of 131 I from the aqueous humour to the blood. b) Group II - the prilocaine increased the radioactivity in the aqueous humour, suggesting an accumulation of iodite in that compartment. (Author) [pt
78 FR 57822 - Lease and Interchange of Vehicles; Motor Carriers of Passengers
2013-09-20
... available to Google Android users and Apple iPhone and iPad users from the respective App Stores, or by... placard, sign, or other permanent or removable device on the right (curb) side of the passenger-carrying...
DEFF Research Database (Denmark)
Møller-Sørensen, H; Graeser, K; Hansen, K L
2014-01-01
was placed in the following successive positions: supine, head-down tilt, head-up tilt, supine, supine with phenylephrine administration, pace heart rate 80 beats per minute (bpm), pace heart rate 110 bpm. TEE CO and PAC CO were measured simultaneously. The agreement was analysed by Bland-Altman plots...
Evaluation of TEG(®) and RoTEM(®) inter-changeability in trauma patients
DEFF Research Database (Denmark)
Hagemo, Jostein S; Næss, Paal A; Johansson, Pär
2013-01-01
BACKGROUND: Massive haemorrhage is a leading cause of preventable deaths in trauma. Traumatic coagulopathy is frequently present early after trauma, and is associated with increased mortality. A number of recent trials suggest that viscoelastic haemostatic assays (VHA), such as thromboelastograph...
Directory of Open Access Journals (Sweden)
Chengkai Dai
2005-04-01
Full Text Available Chronic platelet-derived growth factor (PDGF signaling in glial progenitors leads to the formation of oligodendrogliomas in mice, whereas chronic combined Ras and Akt signaling leads to astrocytomas. Different histologies of these tumors imply that the pathways activated by these two oncogenic stimulations are different, and that the apparent lineage of the tumor cells may result from specific signaling activity. Therefore, we have investigated the signaling effects of PDGF in culture and in gliomas in vivo. In culture, PDGF transiently activates ERK1/2 and Akt, and subsequently elevates p21 and PCNA expression similar to chronic PDGF autocrine signaling in cultured astrocytes and PDGF-induced oligodendrogliomas in vivo. Culture experiments show that autocrine PDGF stimulation, and combined active Ras and Akt generate signaling patterns that are in some ways mutually exclusive. Furthermore, forced Akt activity in the context of chronic PDGF stimulation results in cells with an astrocytic differentiation pattern both in culture and in vivo. These data imply that these two interconvertible signaling motifs are distinct in mice and lead to gliomas resembling the two major glioma histologies found in humans. The ability of signaling activity to convert tumor cells from one lineage to another presents a mechanism for the development of tumors apparently comprised of cells from multiple lineages.
Imagery interchange in John Patrick Shanley’s Doubt, a parable
Directory of Open Access Journals (Sweden)
Sandra Sirangelo Maggio
2013-06-01
Full Text Available John Patrick Shanley’s play Doubt - a Parable (2004 revisits the world he knew as a child, which is the Bronx of the 1960’s. The story centers upon a Catholic Irish-Italian school community, and the plot relates to a doubt - that grows into belief, and ends up as certainty - on the part of Sister Aloysius, the principal of the school, who is persuaded that Father Flynn, the vicar, has been harassing the only Black student in the school. The play is an open-ended construct, allowing each reader/spectator to build their own interpretation of the facts implied. Shanley is more than the author of the play. He has also worked as the producer of the play on the stage and he turned the story into a movie screenplay, Doubt, and has worked as a director to the movie. In this paper we examine the strategies used by Shanley to keep the possibility of interpretation open as he translates his own work into different media, on the page and on the screen.
Electronic Data Interchange: from its Birth to its New Role in Logistics Information Systems
Janssens, Gerrit K.
2011-01-01
The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model...
Is There Evidence to Support Brand to Generic Interchange of the Mycophenolic Acid Products?
Phillips, Karen; Reddy, Prabashni; Gabardi, Steven
2017-02-01
The uptake of generic immunosuppressants lags comparatively to other drug classes, despite that the Food and Drug Administration (FDA) uses identical bioequivalence standards for all drugs. Transplant societies acknowledge the cost savings associated with generic immunosuppressants and support their use following heart, lung, kidney, or bone marrow transplantation. Seven studies of the pharmacokinetics or clinical efficacy of generic mycophenolate mofetil compared to the innovator product are published; all studies and products were ex-United States. Three studies did not demonstrate any pharmacokinetic differences between generic and innovator products in healthy subjects, achieving FDA bioequivalence requirements. Two studies in renal allograft recipients demonstrated no difference in area under the curves between generic and innovator products, and in one, the maximum concentration (Cmax) fell outside the FDA regulatory range. Two studies revealed no difference in acute organ rejection or graft function in renal allograft recipients. Patient surveys indicate that cost is a barrier to immunosuppressant adherence. Generics present a viable method to reduce costs to payers, patients, and health care systems. Adherence to immunosuppressants is crucial to prevent graft failure. An affordable regimen potentially confers greater adherence. Concerns regarding the presumed inferiority of generic immunosuppressants should be assuaged by regulatory requirements for bioequivalency testing, transplant society position statements, and pharmacokinetic and clinical studies.
Temperature dynamics and velocity scaling laws for interchange driven, warm ion plasma filaments
DEFF Research Database (Denmark)
Olsen, Jeppe Miki Busk; Madsen, Jens; Nielsen, Anders Henry
2016-01-01
The influence of electron and ion temperature dynamics on the radial convection of isolated structures in magnetically confined plasmas is investigated by means of numerical simulations. It is demonstrated that the maximum radial velocity of these plasma blobs roughly follows the inertial velocity...
International Cancer of the Head and Neck, Genetics and Environment (InterCHANGE) Study
2013-10-29
Evaluate the Association Between Certain Environmental Exposures (e.g. Cigarette Smoking, Alcohol Drinking, Betel Nut Chewing…) and Head and Neck Cancers; Assess the Effect of Genetic Factors, Including Both SNP and Copy Number Variation (CNV) Through Analysis of Both Main Effect and Gene-gene Interaction
Ely, Craig R.; Sladen, William J. L.; Wilson, Heather M.; Savage, Susan E.; Sowl, Kristine M.; Henry, Bill; Schwitters, Mike; Snowden, James
2014-01-01
North American Tundra Swans Cygnus c. columbianus are composed of two wellrecognised populations: an Eastern Population (EP) that breeds across northern Canada and north of the Brooks Range in Alaska, which migrates to the eastern seaboard of the United States, and a Western Population (WP) that breeds in coastal regions of Alaska south of the Brooks Range and migrates to western North America. We present results of a recent major ringing effort from across the breeding range in Alaska to provide a better definition of the geographic extent of the migratory divide in Alaska. We also reassess the staging and winter distributions of these populations based on locations of birds tracked using satellite transmitters, and recent recoveries and sightings of neck-collared birds. Summer sympatry of EP and WP Tundra Swans is very limited, and largely confined to a small area in northwest Alaska. Autumn migration pathways of EP and WP Tundra swans abut in southwest Saskatchewan, a region where migrating WP birds turn west, and EP birds deviate abruptly eastward. Overall, from 1989 to 2013 inclusive, 2.6% of recoveries or resightings reported to the USGS Bird Banding Laboratory were of birds that moved from the domain of the population in which they were initially captured to within the range of the other population; a proportion roughly comparable to the results of Limpert et al. (1991) for years before 1990. Of the 70 cross-boundary movements reported since 1989, 39% were of birds marked on breeding areas and 61% were of birds marked on wintering areas. Dispersing swans (i.e. those that made crossboundary movements) did not differ with respect to age or sex from those that did not move between populations. The Brooks Range in northern Alaska effectively separates the two populations within Alaska, but climate-induced changes in tundra breeding habitats and losses of wetlands on staging areas may alter the distribution for both of these populations.
The Long Term Effects of Electronic Commerce and Data Interchange on Firms
Directory of Open Access Journals (Sweden)
François Bergeron
1998-11-01
Full Text Available This research aims to identify the determinants of electronic commerce effectiveness, as well as the variation over time of their effect. A two-phased study was undertaken for this purpose, using EDI as a specific form of electronic commerce. Sixty-five organisations were surveyed twice over a three-year period. In Phase 1, determining factors were found to be the level of organisational support, the rigour of the implementation process, the presence of control procedures, and the level of internal integration, external integration and imposition of EDI. Imposition also has a negative effect on the organisational context of EDI. In Phase 2, the implementation process, internal integration and imposition lost their importance, whereas the effect of imposition on the organisational context became positive. In the future, we expect the security and external integration to be the most important success factors of electronic commerce.
Application of auctions as a pricing mechanism for the interchange of electric power
International Nuclear Information System (INIS)
Post, D.L.; Coppinger, S.S.; Sheble, G.B.
1995-01-01
The expected move to a market-based electric power industry will significantly change electric utility operations. These changes will fundamentally alter the pricing of electric power. How this pricing will be accomplished is a key issue. Traditionally, embedded cost based methods have been used. Recently, spot-pricing has received attention as a possible approach in a market-based electric power environment. Another market-based approach is the use of auctions. This paper will present the application of a sequential sealed-bid and sealed-offer auction to the pricing of electric power by using linear programming
Ashraf, H.; Hoop, B.J. de; Shaker, S.B.; Dirksen, A.; Bach, K.S.; Hansen, H.; Prokop, M.; Pedersen, J.H.
2010-01-01
OBJECTIVE: We examined the reproducibility of lung nodule volumetry software that offers three different volumetry algorithms. METHODS: In a lung cancer screening trial, 188 baseline nodules >5 mm were identified. Including follow-ups, these nodules formed a study-set of 545 nodules. Nodules were
Energy Technology Data Exchange (ETDEWEB)
Ashraf, H.; Bach, K.S.; Hansen, H. [Copenhagen University, Department of Radiology, Gentofte Hospital, Hellerup (Denmark); Hoop, B. de [University Medical Centre Utrecht, Department of Radiology, Utrecht (Netherlands); Shaker, S.B.; Dirksen, A. [Copenhagen University, Department of Respiratory Medicine, Gentofte Hospital, Hellerup (Denmark); Prokop, M. [University Medical Centre Utrecht, Department of Radiology, Utrecht (Netherlands); Radboud University Nijmegen, Department of Radiology, Nijmegen (Netherlands); Pedersen, J.H. [Copenhagen University, Department of Cardiothoracic Surgery RT, Rigshospitalet, Copenhagen (Denmark)
2010-08-15
We examined the reproducibility of lung nodule volumetry software that offers three different volumetry algorithms. In a lung cancer screening trial, 188 baseline nodules >5 mm were identified. Including follow-ups, these nodules formed a study-set of 545 nodules. Nodules were independently double read by two readers using commercially available volumetry software. The software offers readers three different analysing algorithms. We compared the inter-observer variability of nodule volumetry when the readers used the same and different algorithms. Both readers were able to correctly segment and measure 72% of nodules. In 80% of these cases, the readers chose the same algorithm. When readers used the same algorithm, exactly the same volume was measured in 50% of readings and a difference of >25% was observed in 4%. When the readers used different algorithms, 83% of measurements showed a difference of >25%. Modern volumetric software failed to correctly segment a high number of screen detected nodules. While choosing a different algorithm can yield better segmentation of a lung nodule, reproducibility of volumetric measurements deteriorates substantially when different algorithms were used. It is crucial even in the same software package to choose identical parameters for follow-up. (orig.)
DEFF Research Database (Denmark)
Ashraf, Haseem; de Hoop, B; Shaker, S B
2010-01-01
We examined the reproducibility of lung nodule volumetry software that offers three different volumetry algorithms.......We examined the reproducibility of lung nodule volumetry software that offers three different volumetry algorithms....
International Nuclear Information System (INIS)
Ashraf, H.; Bach, K.S.; Hansen, H.; Hoop, B. de; Shaker, S.B.; Dirksen, A.; Prokop, M.; Pedersen, J.H.
2010-01-01
We examined the reproducibility of lung nodule volumetry software that offers three different volumetry algorithms. In a lung cancer screening trial, 188 baseline nodules >5 mm were identified. Including follow-ups, these nodules formed a study-set of 545 nodules. Nodules were independently double read by two readers using commercially available volumetry software. The software offers readers three different analysing algorithms. We compared the inter-observer variability of nodule volumetry when the readers used the same and different algorithms. Both readers were able to correctly segment and measure 72% of nodules. In 80% of these cases, the readers chose the same algorithm. When readers used the same algorithm, exactly the same volume was measured in 50% of readings and a difference of >25% was observed in 4%. When the readers used different algorithms, 83% of measurements showed a difference of >25%. Modern volumetric software failed to correctly segment a high number of screen detected nodules. While choosing a different algorithm can yield better segmentation of a lung nodule, reproducibility of volumetric measurements deteriorates substantially when different algorithms were used. It is crucial even in the same software package to choose identical parameters for follow-up. (orig.)
Fidishun, Dolores
2002-01-01
Explains symbolic interactionism as a theory for analyzing research based on a qualitative interpretive process that can help librarians to understand the way in which the library staff and users view services, training, policy, and other issues. The theory focuses on the symbolic meaning of objects, such as books, and events as they are…
Teruya, Daisuke; Masukawa, Shigeo; Iida, Shoji
We propose a novel inverter that can be operated either as a Current Source Inverter (CSI) or as a Voltage Source Inverter (VSI) by changing only the control signals. It is proper to apply it to the interconnecting system with renewal energy, such as photovoltaic cells or wind generation systems, to a grid. This inverter is usually operated as the CSI connected to the grid. Even if the energy source has a lower voltage than the grid, the energy can be supplied to the grid through the proposed inverter. The power factor can be briefly maintained at almost unity. When power supply from the grid is interrupted, the proposed circuit should be operated as the VSI in the stand-alone operation mode. In this way, the circuit can maintain a constant output voltage to the loads. In this paper, the proposed circuit configuration and the control schemes for both the CSI and the VSI are described. Further, the circuit characteristics for both are discussed experimentally.
The interchangeability of learning rate and gain in backpropagation neural networks
Thimm, G.; Moerland, P.; Fiesler, E.
1996-01-01
The backpropagation algorithm is widely used for training multilayer neural networks. In this publication the gain of its activation function(s) is investigated. In specific, it is proven that changing the gain of the activation function is equivalent to changing the learning rate and the weights.
International Nuclear Information System (INIS)
Arons, J.; Lea, S.M.
1976-01-01
We describe the results of a linearized hydromagnetic stability analysis of the magnetopause of an accreting neutron star. The magnetosphere is assumed to be slowly rotating, and the plasma just outside of the magnetopause is assumed to be weakly magnetized. The plasma layer is assumed to be bounded above by a shock wave, and to be thin compared with the radius of the magnetosphere. Under these circumstances, the growing modes are shown to be localized in the direction parallel to the zero-order magnetic field. The structure of the modes is still similar to the flute mode, however. The growth rate at each magnetic latitude is lambda given by γ 2 =g/sub n/kα/sub eff/(lambda) tanh [kz/sub s/(lambda)] where g/sub n/ is the magnitude of the gravitational acceleration normal to the surface, kapprox. =vertical-barmvertical-bar/R (lambda)cos lambda, vertical-barmvertical-bar is the azimuthal mode number, R (lambda) is the radius of the magnetosphere, z/sub s/ is the height of the shock above the magnetopause, and α/sub eff/(lambda) <1 is the effective Atwood number which embodies the stabilizing effects of favorable curvature and magnetic tension. We calculate α/sub eff/(lambda), and also discuss the stabilizing effects of viscosity and of aligned flow parallel to the magnetopause
Modeling and simulation using the compositional interchange format for hybrid systems
Sonntag, C.L.W.; Schiffelers, R.R.H.; Beek, van D.A.; Rooda, J.E.; Engell, S.; Troch, I.; Breitenecker, F.
2009-01-01
One of the major challenges towards a broad industrial acceptance of hybrid systems techniques and tools is the large number of distinct modeling formalisms and the resulting manual effort for the tool-based solution of many complex design or analysis tasks. A promising approach to achieve
Alternating-Script Priming in Japanese: Are Katakana and Hiragana Characters Interchangeable?
Perea, Manuel; Nakayama, Mariko; Lupker, Stephen J.
2017-01-01
Models of written word recognition in languages using the Roman alphabet assume that a word's visual form is quickly mapped onto abstract units. This proposal is consistent with the finding that masked priming effects are of similar magnitude from lowercase, uppercase, and alternating-case primes (e.g., beard-BEARD, BEARD-BEARD, and BeArD-BEARD).…
Comparison of collision operators for drift and MHD-interchange modes in unsheared slab geometry
International Nuclear Information System (INIS)
Rewoldt, G.; Tang, W.M.; Hastie, R.J.
1986-02-01
The general procedure for the kinetic analysis of low-frequency electrostatic and electromagnetic modes in toroidal geometry is now well known. In the collisionless limit, the relevant dynamics (e.g., trapped particles, resonances, etc.) can be treated appropriately. However, with the introduction of collisional effects, it is customary, for tractability, to employ model collision operators which do not rigorously satisfy all conservation properties of more exact collision operators. Insight into the essential required features of such operators can be gained by studying models with increasing levels of completeness for a simpler, unsheared slab geometry. The results presented here for this simpler geometry can provide guidance in choosing model collision operators for toroidal-geometry kinetic calculations. 6 refs., 3 figs
78 FR 54589 - Information Required in Notices and Petitions Containing Interchange Commitments
2013-09-05
... ACQUISITION, CONTROL, MERGER, CONSOLIDATION PROJECT, TRACKAGE RIGHTS, AND LEASE PROCEDURES 0 6. The authority... INFORMATION: The Board modifies its existing rules regarding notices and petitions for acquisition exemption... that the filer provide an estimate of the difference in the sale or lease price of the transaction with...
Morin, Jeremy Edward
In 1844 Charles Goodyear obtained U.S. Patent #3,633 for his "Gum Elastic Composition". In a published circular, which describes his patent for the sulfur vulcanization of gum elastic composition, he stated: "No degree of heat, without blaze, can melt it (rubber)... It resists the most powerful chemical reagents. Aquafortis (nitric acid), sulphuric acid, essential and common oils, turpentine and other solvents... ..." Goodyear's sulfur vulcanization of rubber fueled much of the industrial revolution and made transportation possible, as it exists today. In doing so, Goodyear created one of the most difficult materials to recycle. Rubber will not melt, dissolve, or lend itself to the usual methods of chemical decomposition. Ironically, Goodyear recognized this problem and in 1853 he patented the process of adding ground rubber to virgin material, now currently known as regrind blending. Today, scrap tires represent one of the most serious sources of pollution in the world. Studies estimate that there are roughly 2 billion scrap tires in U.S. landfills and more are being added at a rate of over 273 million tires per year. Current methods of recycling waste tires are crude, ineffective, and use rubber powder as a low cost filler instead of a new rubber. The groundwork for a very simple and effective method of producing high-quality rubber goods using 100% scrap rubber was discovered in 1944 by A. V. Tobolsky et al. This application, however, was not recognized until recently in our laboratory. The process as studied to date represents a method of creating quality, high-value added rubber goods with nothing other than heat and pressure. High pressure is required to obtain a void-free compaction of the rubber particles by forcing all of the free surfaces into intimate contact. High temperature then activates the chemical rearrangement, scission, and reformation of the chemical bonds thus providing new bridges between the once fractured interfaces. This occurs both within and between particles. The technique of high-pressure high-temperature sintering has worked on all types of thermoset materials. Typical mechanical properties for sintered SBR powder rubber are as follows: 1.3 MPa 100% Modulus, 12.0 MPa Tensile Strength and 300% Elongation at Break. The goal of this research is two-fold. First, to gain an understanding of the variables that control the process of high-pressure high-temperature sintering. Second, to study the factors governing the mechanism of fusion with the hope of controlling and exploiting this process so that tires can be recycled to produce high quality and high-value added products.
Lifescience Database Archive (English)
Full Text Available Type 2 consists of cloverleaf skull, extreme proptosis, finger and toe abnormalities, elbow ankylosis or sy...o type 2 but without a cloverleaf skull. Mutations of the FGFR1 gene or FGFR2 gene can cause Pfeiffer syndro
Energy Technology Data Exchange (ETDEWEB)
Togo, Y [Japan Highway Public Corp., Tokyo (Japan)
1993-03-15
The Joshin'etsu motorway is a 204km expressway. Various technological studies have been made for the remediation work for the 69.5km section which is opened to traffic this spring, because not only a series of tunnels, bridges, long cut and fill soil particular to mountain roads are included but also the section has many landslide areas. The length of the Higureyama tunnel is 2,314m. Although strong andesite is prevailing as the nature of the soil, the central area of the tunnel is consisted of brittle mudstone and self-crushing andesite with faults because the tunnel runs through the lower portion of a landslide zone. The mudstone is a squeezing ground, and buckling of H supporting, breakage of lock bolts, and damage of sprayed concrete occurred in many places. 2 years and 10 months are required for the construction of the tunnel. The average monthly drilling is only 10m/month which is an unprecedented case in tunnel excavation. Even limited to large-scale landslides, 13 occurrences are experienced. 10 figs., 1 tab.
2011-07-29
.... 2000(d) et seq.]; American Indian Religious Freedom Act [42 U.S.C. 1996]; Farmland Protection Policy.... 13007 Indian Sacred Sites, E.O. 13287 Preserve America; E.O. 13175 Consultation and Coordination with...
Directory of Open Access Journals (Sweden)
Yongchul Choe
2012-09-01
Full Text Available English synopsis of: Zhang Bowei 张伯伟, Yuwai Hanji yanjiu lunji 域外汉籍研究论集 [A Collection of Research Essays on Foreign Writings in Chinese]. Beijing: Beijing Daxue Chubanshe, 2011.
2015-03-01
1977 Algorithm LZMA Lempel-Ziv Markov-chain Algorithm MB Megabyte NCW Network-Centric Warfare NoSQL Not only Structured Query Language NOW Network...Language ( NoSQL ) database (MongoDB Documentation Project, 2014). Its stated design goals are to be lightweight or compact, quickly traversed by
Venit, Tomáš; Dzijak, Rastislav; Kalendová, Alžběta; Kahle, Michal; Rohožková, Jana; Schmidt, Volker; Rülicke, Thomas; Rathkolb, Birgit; Hans, Wolfgang; Bohla, Alexander; Eickelberg, Oliver; Stoeger, Tobias; Wolf, Eckhard; Yildirim, Ali Önder; Gailus-Durner, Valérie; Fuchs, Helmut; de Angelis, Martin Hrabě; Hozák, Pavel
2013-01-01
Nuclear myosin I (NM1) is a nuclear isoform of the well-known "cytoplasmic" Myosin 1c protein (Myo1c). Located on the 11(th) chromosome in mice, NM1 results from an alternative start of transcription of the Myo1c gene adding an extra 16 amino acids at the N-terminus. Previous studies revealed its roles in RNA Polymerase I and RNA Polymerase II transcription, chromatin remodeling, and chromosomal movements. Its nuclear localization signal is localized in the middle of the molecule and therefore directs both Myosin 1c isoforms to the nucleus. In order to trace specific functions of the NM1 isoform, we generated mice lacking the NM1 start codon without affecting the cytoplasmic Myo1c protein. Mutant mice were analyzed in a comprehensive phenotypic screen in cooperation with the German Mouse Clinic. Strikingly, no obvious phenotype related to previously described functions has been observed. However, we found minor changes in bone mineral density and the number and size of red blood cells in knock-out mice, which are most probably not related to previously described functions of NM1 in the nucleus. In Myo1c/NM1 depleted U2OS cells, the level of Pol I transcription was restored by overexpression of shRNA-resistant mouse Myo1c. Moreover, we found Myo1c interacting with Pol II. The ratio between Myo1c and NM1 proteins were similar in the nucleus and deletion of NM1 did not cause any compensatory overexpression of Myo1c protein. We observed that Myo1c can replace NM1 in its nuclear functions. Amount of both proteins is nearly equal and NM1 knock-out does not cause any compensatory overexpression of Myo1c. We therefore suggest that both isoforms can substitute each other in nuclear processes.
Martin, R. Glenn
The subjectivistic problem for knowledge and communication associated with philosopher Immanuel Kant is that everything we know may in fact be determined by the structure of our own minds and not by the actual nature of external reality. Ernst Cassirer's contribution to the solution of this problem is the notion of "symbols" produced by…
Directory of Open Access Journals (Sweden)
Sargsyan Samvel Volodyaevich
2014-09-01
Full Text Available Fire-resistance testing laboratory for building products and constructions is a production room with a substantial excess heat (over 23 W/m . Significant sources of heat inside the aforementioned laboratory are firing furnace, designed to simulate high temperature effects on structures and products of various types in case of fire development. The excess heat production in the laboratory during the tests is due to firing furnaces. The laboratory room is considered as an object consisting of two control volumes (CV, in each of which there may be air intake and air removal, pollutant absorption or emission. In modeling air exchange conditions the following processes are being considered: the processes connected with air movement in the laboratory room: the jet stream in a confined space, distribution of air parameters, air motion and impurity diffusion in the ventilated room. General upward ventilation seems to be the most rational due to impossibility of using local exhaust ventilation. It is connected with the peculiarities of technological processes in the laboratory. Air jets spouted through large-perforated surface mounted at the height of 2 m from the floor level, "flood" the lower control volume, entrained by natural convective currents from heat sources upward and removed from the upper area. In order to take advantage of the proposed method of the required air exchange calculation, you must enter additional conditions, taking into account the provision of sanitary-hygienic characteristics of the current at the entrance of the service (work area. Exhaust air containing pollutants (combustion products, is expelled into the atmosphere by vertical jet discharge. Dividing ventilated rooms into two control volumes allows describing the research process in a ventilated room more accurately and finding the air exchange in the lab room during the tests on a more reasonable basis, allowing to provide safe working conditions for the staff without the use of PPE.
Directory of Open Access Journals (Sweden)
Humberto Merritt Tapia
2010-05-01
Full Text Available Trade relations between Latin America and the Republic of Korea started in the early sixties, but only after the beginning of the new century have become more dynamic, especially for the Asian nation. Behind the Korean export boom is the governmental thrust to science and technology, which has resulted in the production of goods with higher added value. The pattern of trade specialization followed by South Korea has allowed it to become one of the leading exporting nations of high technology goods in the world. On the other hand, Latin American nations have also enjoyed a remarkable growth in exports in the last decade, although their exporting profile contrast with that of Korea because their exports tend to be mainly primary products with low added value and some semi-finished goods . The pattern of specialization in Latin America is explained by its provision of vast natural resources, giving it a comparative advantage in world commodity markets. Unfortunately these advantages have not translated into sustained industrial developments throughout the region. In this context, the purpose of this paper is to illustrate the trade trends between South Korea and Latin America in the last ten years in an attempt to understand the reasons behind the asymmetries in trade flows that have been set in this period. The underlying assumption is that the commercial relationship between both parties depends on the pattern of specialization emerged in recent times and responds to the institutional policies implemented by both South Korea and by Latin American nations. The case of Mexico is highlighted because it is getting historic deficits with the Asian nation.
Hill, Bruce W.
2015-01-01
Approved for public release; distribution is unlimited Current and emerging Navy information concepts, including network-centric warfare and Navy Tactical Cloud, presume high network throughput and interoperability. The Extensible Markup Language (XML) addresses the latter requirement, but its verbosity is problematic for afloat networks. JavaScript Object Notation (JSON) is an alternative to XML common in web applications and some non-relational databases. Compact, binary encodings exist ...
DEFF Research Database (Denmark)
Holst, Birgitte; Mokrosinski, Jacek; Lang, Manja
2007-01-01
The carboxyamidated wFwLL peptide was used as a core ligand to probe the structural basis for agonism versus inverse agonism in the constitutively active ghrelin receptor. In the ligand, an efficacy switch could be built at the N terminus, as exemplified by AwFwLL, which functioned as a high...
Wu, Z.; Gao, K.; Wang, Z. L.; Shao, Q. G.; Hu, R. F.; Wei, C. X.; Zan, G. B.; Wali, F.; Luo, R. H.; Zhu, P. P.; Tian, Y. C.
2017-06-01
In X-ray grating-based phase contrast imaging, information retrieval is necessary for quantitative research, especially for phase tomography. However, numerous and repetitive processes have to be performed for tomographic reconstruction. In this paper, we report a novel information retrieval method, which enables retrieving phase and absorption information by means of a linear combination of two mutually conjugate images. Thanks to the distributive law of the multiplication as well as the commutative law and associative law of the addition, the information retrieval can be performed after tomographic reconstruction, thus simplifying the information retrieval procedure dramatically. The theoretical model of this method is established in both parallel beam geometry for Talbot interferometer and fan beam geometry for Talbot-Lau interferometer. Numerical experiments are also performed to confirm the feasibility and validity of the proposed method. In addition, we discuss its possibility in cone beam geometry and its advantages compared with other methods. Moreover, this method can also be employed in other differential phase contrast imaging methods, such as diffraction enhanced imaging, non-interferometric imaging, and edge illumination.
International Nuclear Information System (INIS)
Tawn, E Janet; Whitehouse, Caroline A
2005-01-01
Suggestions that exposure to intakes of alpha-emitting radionuclides such as plutonium could result in a specific profile of chromosome damage distinguishable from that of low LET irradiation have led to the re-analysis of the different types of chromosome aberrations in peripheral blood lymphocytes determined by G-banding in a group of 20 plutonium workers from the British Nuclear Fuels plc facility at Sellafield, UK. Comparisons were made with a group of workers with negligible plutonium intakes but similar external gamma doses and with an unexposed control group. Examination of simple translocation frequencies in the three groups indicated a significant difference (P = 0.033), with the higher frequency in the plutonium workers indicating that exposure from plutonium was contributing to the aberration yield. Slightly raised frequencies of both intra-chromosomal and complex aberrations were observed in the plutonium workers in comparison with the comparable external exposure group and the control group but the difference did not reach significance at the P = 0.05 level and there was no variation in the relative frequencies of the different aberration types between the three groups. There was, therefore, no firm indication from this study that either intra-chromosomal or complex aberrations could be used as a specific marker of high LET exposure in workers with historical intakes of plutonium
Skarin, Hanna; Segerman, Bo
2014-01-01
Clostridium botulinum (group III), Clostridium novyi and Clostridium haemolyticum are well-known pathogens causing animal botulism, gas gangrene/black disease, and bacillary hemoglobinuria, respectively. A close genetic relationship exists between the species, which has resulted in the collective term C. novyi sensu lato. The pathogenic traits in these species, e.g., the botulinum neurotoxin and the novyi alpha toxin, are mainly linked to a large plasmidome consisting of plasmids and circular prophages. The plasmidome of C. novyi sensu lato has so far been poorly characterized. In this study we explored the genomic relationship of a wide range of strains of C. novyi sensu lato with a special focus on the dynamics of the plasmidome. Twenty-four genomes were sequenced from strains selected to represent as much as possible the genetic diversity in C. novyi sensu lato. Sixty-one plasmids were identified in these genomes and 28 of them were completed. The genomic comparisons revealed four separate lineages, which did not strictly correlate with the species designations. The plasmids were categorized into 13 different plasmid groups on the basis of their similarity and conservation of plasmid replication or partitioning genes. The plasmid groups, lineages and species were to a large extent entwined because plasmids and toxin genes had moved across the lineage boundaries. This dynamic process appears to be primarily driven by phages. We here present a comprehensive characterization of the complex species group C. novyi sensu lato, explaining the intermixed genetic properties. This study also provides examples how the reorganization of the botulinum toxin and the novyi alpha toxin genes within the plasmidome has affected the pathogenesis of the strains.
Directory of Open Access Journals (Sweden)
Hanna Skarin
Full Text Available Clostridium botulinum (group III, Clostridium novyi and Clostridium haemolyticum are well-known pathogens causing animal botulism, gas gangrene/black disease, and bacillary hemoglobinuria, respectively. A close genetic relationship exists between the species, which has resulted in the collective term C. novyi sensu lato. The pathogenic traits in these species, e.g., the botulinum neurotoxin and the novyi alpha toxin, are mainly linked to a large plasmidome consisting of plasmids and circular prophages. The plasmidome of C. novyi sensu lato has so far been poorly characterized. In this study we explored the genomic relationship of a wide range of strains of C. novyi sensu lato with a special focus on the dynamics of the plasmidome. Twenty-four genomes were sequenced from strains selected to represent as much as possible the genetic diversity in C. novyi sensu lato. Sixty-one plasmids were identified in these genomes and 28 of them were completed. The genomic comparisons revealed four separate lineages, which did not strictly correlate with the species designations. The plasmids were categorized into 13 different plasmid groups on the basis of their similarity and conservation of plasmid replication or partitioning genes. The plasmid groups, lineages and species were to a large extent entwined because plasmids and toxin genes had moved across the lineage boundaries. This dynamic process appears to be primarily driven by phages. We here present a comprehensive characterization of the complex species group C. novyi sensu lato, explaining the intermixed genetic properties. This study also provides examples how the reorganization of the botulinum toxin and the novyi alpha toxin genes within the plasmidome has affected the pathogenesis of the strains.
2007-11-28
Identification/Solution Process • Senior leader engagement • Joint AFRL/Product center process • Multi-directorate AFRL engagement • PEO/ TEO approval...SPO Primes participation Strategy Driven Process Industry days PEO/ TEO Meeting Jan - May Prioritized Tech Solutions Existing SBIRs SBIR Topics...Electronic parts & components, Frontier now supports the Global Hawk Joint Stars, B-1B, KC -135, C-17, F-15E, & DoD’s Defense Support Program (DSP
Czech Academy of Sciences Publication Activity Database
Venit, Tomáš; Dzijak, Rastislav; Kalendová, Alžběta; Kahle, Michal; Rohožková, Jana; Schmidt, V.; Rülicke, T.; Rathkolb, B.; Hans, W.; Bohla, A.; Eickelberg, O.; Stoeger, T.; Wolf, E.; Yildirim, A.Ö.; Gailus-Durner, V.; Fuchs, H.; de Angelis, M.H.; Hozák, Pavel
2013-01-01
Roč. 8, č. 4 (2013), e61406 E-ISSN 1932-6203 R&D Projects: GA ČR GAP305/11/2232; GA TA ČR TE01020022; GA MŠk LH12143; GA ČR(CZ) GD204/09/H084 Institutional research plan: CEZ:AV0Z50520514 Institutional support: RVO:68378050 Keywords : nuclear myosin * myosin isoforms * cell nucleus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.534, year: 2013
The export systems of type 1 and F1C fimbriae are interchangeable but work in parental pairs
DEFF Research Database (Denmark)
Klemm, P; Jørgensen, BJ; Kreft, B
1995-01-01
, specialized two-component assembly systems. The organization of the fim and foc gene clusters encoding these fimbriae, as well as the structure of the organelles, is very similar; however, the actual sequence homology of the structural elements is not remarkable (34 to 60%). Both gene clusters encode...
Directory of Open Access Journals (Sweden)
Bassam A. Sweileh
2010-05-01
Full Text Available This work presents a new synthetic approach to aromatic and aliphatic polycarbonates by melt polycondensation of bisphenol A diacetates with alkylene- and arylenediphenyl dicarbonates. The diphenyl dicarbonates were prepared from phenyl chloroformate and the corresponding dihydroxy compounds. The process involved a precondensation step under a slow stream of dry argon with the elimination of phenyl acetate, followed by melt polycondensation at high temperature and under vacuum. The potential of this reaction is demonstrated by the successful synthesis of a series of aromatic-aromatic and aromatic-aliphatic polycarbonates having inherent viscosities from 0.19 to 0.43 dL/g. Thus low to intermediate molecular mass polymers were obtained. The 13C-NMR spectra of the carbon of the carbonate group showed that the formed polycarbonates contain partial random sequence distribution of monomer residues in their chains. The polycarbonates were characterized by inherent viscosity, FTIR, 1H-NMR and 13C-NMR spectroscopy. The glass transition temperatures, measured by DSC, of the polycarbonates were in the range 13–108 ºC. The thermogravimetric curves of showed that these polymers have good thermal stability up to 250 ºC. The present approach may open the door for novel polycarbonates containing other organic functional groups.
Energy Technology Data Exchange (ETDEWEB)
Lu, Jun; Wu, Ruiying; Adkins, Joshua N.; Joachimiak, Andrzej; Glover, Mark
2014-09-16
In the F-family of conjugative plasmids, TraJ is an essential transcriptional activator of the tra operon that encodes most of the proteins required for conjugation. Here we report for the first time the X-ray crystal structures of the TraJ N-terminal regions from the prototypic F plasmid (TraJF11-130) and from the Salmonella virulence plasmid pSLT (TraJpSLT 1-128). Both proteins form similar homodimeric Per-ARNT-Sim (PAS) fold structures. Mutational analysis reveals that the observed dimeric interface is critical for TraJF transcriptional activation, indicating that dimerization of TraJ is required for its in vivo function. An artificial ligand (oxidized dithiothreitol) occupies a cavity in the TraJF dimer interface, while a smaller cavity in corresponding region of the TraJpSLT structure lacks a ligand. Gas chromatography/mass spectrometry-electron ionization analysis of dithiothreitol-free TraJF suggests indole may be the natural TraJ ligand; however, disruption of the indole biosynthetic pathway does not affect TraJF function. Heterologous PAS domains from pSLT and R100 TraJ can functionally replace the TraJF PAS domain, suggesting that TraJ allelic specificity is mediated by the region C-terminal to the PAS domain.
2010-07-02
... to the U.S. Department of Transportation, Dockets Management Facility, Room W12-140, 1200 New Jersey... limit, resulting in large queue lengths creating back-ups which would add significant time to their...
1980-07-31
r wc z > IK z ul z w U- L.. 0cLL LLz ILlO W: LJ1- V. LLJ (D or40 0 LA% - a P.-1 . ~ W.- WO W LLJ ~ 2c I- -gV"C LL WL LL- 0i Wix I I Cý Lai caL ) - u...that shadowing effects on our irradiance measurements were negligible (except at high noon). The barge provided a platform where rapid, efficient and
Levin, P; Wei, W; Miao, R; Ye, F; Xie, L; Baser, O; Gill, J
2015-03-01
To evaluate real-world clinical outcomes for switching basal insulin analogues [insulin glargine (GLA) and insulin detemir (DET)] among US patients with type 2 diabetes mellitus (T2DM). Using the GE Centricity Electronic Medical Records database, this retrospective study examined two cohorts: cohort 1, comprising patients previously on GLA and then either switching to DET (DET-S) or continuing with GLA (GLA-C); and cohort 2, comprising patients previously on DET and then either switching to GLA (GLA-S) or continuing with DET (DET-C). Within each cohort, treatment groups were propensity-score-matched on baseline characteristics. At 1-year follow-up, insulin treatment patterns, glycated haemoglobin (HbA1c) levels, hypoglycaemic events, weight and body mass index (BMI) were evaluated. The analysis included 13 942 patients: cohort 1: n = 10 657 (DET-S, n = 1797 matched to GLA-C, n = 8860) and cohort 2: n = 3285 (GLA-S, n = 858 matched to DET-C, n = 2427). Baseline characteristics were similar between the treatment groups in each cohort. At 1-year follow-up, in cohort 1, patients in the DET-S subgroup were significantly less persistent with treatment, more likely to use a rapid-acting insulin analogue, had higher HbA1c values, lower HbA1c reductions and lower proportions of patients achieving HbA1c Diabetes, Obesity and Metabolism published by John Wiley & Sons Ltd.
Li, Erqiang; Xu, Qian; Sun, Jie; Fuh, Jerry; Wong, Yokesan; Thoroddsen, Sigurdur T
2010-01-01
, or Teflon) tubing, which of a much softer material, than the conventionally used glass tubing. Applying the same electrical voltage, PET/PTFE-based printhead will generate a larger volume change in the material to be dispensed. The novel printhead fabricated
Frow, Emma; Calvert, Jane
2013-01-01
Synthetic biology represents a recent attempt to bring engineering principles and practices to working with biology. In practice, the nature of the relationship between engineering and biology in synthetic biology is a subject of ongoing debate. The disciplines of biology and engineering are typically seen to involve differentways of knowing and doing, and to embody different assumptions and objectives. Tensions between these approaches are playing out as the field of synthetic biology is bei...
Escudero, X
1996-01-01
Coronary branch occlusion complicating percutaneous coronary angioplasty has been recognized in certain bifurcation lesions. The utilization of double angioplasty systems simultaneously has been called "kissing" because the image of contact between balloons, and has been utilized as an alternative to protect the jeopardized branch or prevent snowplow lesion of the principal artery. The technological advance with the use of wide lumen catheters and low profile dilation balloons make the application of this technique possible in those type of lesions using a single guiding catheter. The present paper describes one case treated with this technique using conventional angioplasty systems in a complex bifurcating lesion of the circumflex artery. Some technical considerations about the procedure are made.
2004-09-01
Required> </Equipment> <Equipment code="L44680"> <Description>LAUNCHER GRENADE SMOKE: SCREENING RP M250 </Description> <Required...EquipmentPiecesOnHand> </UnitEquipment> <UnitEquipment> <EquipmentDescription>LAUNCHER GRENADE SMOKE: SCREENING RP M250 </EquipmentDescription
de Vargas-Sansalvador, I M Pérez; Fay, C; Phelan, T; Fernández-Ramos, M D; Capitán-Vallvey, L F; Diamond, D; Benito-Lopez, F
2011-08-12
A new system for CO(2) measurement (0-100%) based on a paired emitter-detector diode arrangement as a colorimetric detection system is described. Two different configurations were tested: configuration 1 (an opposite side configuration) where a secondary inner-filter effect accounts for CO(2) sensitivity. This configuration involves the absorption of the phosphorescence emitted from a CO(2)-insensitive luminophore by an acid-base indicator and configuration 2 wherein the membrane containing the luminophore is removed, simplifying the sensing membrane that now only contains the acid-base indicator. In addition, two different instrumental configurations have been studied, using a paired emitter-detector diode system, consisting of two LEDs wherein one is used as the light source (emitter) and the other is used in reverse bias mode as the light detector. The first configuration uses a green LED as emitter and a red LED as detector, whereas in the second case two identical red LEDs are used as emitter and detector. The system was characterised in terms of sensitivity, dynamic response, reproducibility, stability and temperature influence. We found that configuration 2 presented a better CO(2) response in terms of sensitivity. Copyright © 2011 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Davi Rumel
2006-10-01
Full Text Available A construção racional do arsenal terapêutico, considerando a necessidade do paciente, a segurança e a disponibilidade do medicamento, e o melhor custo-benefício pressupõem embasamento na tríade: segurança, eficácia e qualidade. Mas na prática diária, a efetividade do medicamento é o que mais influencia a decisão do prescritor, que considera critérios que aumentem a adesão ao tratamento, tais como toxicidade relativa, conveniência de administração, custo e experiência de emprego. A entrada no mercado de novas moléculas para mesmos fins terapêuticos, acompanhada de grande publicidade, interfere no processo decisório do prescritor, assim como práticas de bonificações da indústria para venda nos balcões das farmácias repercutem na decisão de compra do paciente. O confronto entre a conhecida variabilidade biológica dos seres humanos e a não similaridade absoluta entre medicamentos da mesma classe terapêutica ou mesmo medicamentos genéricos, tem impacto na lista individualizada de medicamentos, que deve englobar os conceitos de droga de primeira escolha e segunda escolha. O desconhecimento desta discussão por parte dos prescritores é determinante do uso irracional de medicamentos, um problema de saúde publica. Assim, o objetivo do trabalho foi apresentar aos prescritores de medicamentos informações que possam auxiliar na construção mais racional do arsenal terapêutico utilizado para seus pacientes, com base em experiência na regulação de medicamentos da Agência Nacional de Vigilância Sanitária.The rational construction of an essential drug list, considering the patient's need, drug safety, availability and the best cost-benefit ratio, is based on drug safety, efficacy and quality. However, in daily practice, the prescriber's decision is mostly influenced by drug effectiveness, following criteria that increase adherence to the treatment, such as relative drug toxicity, convenience, cost and prescriber's experience. In addition, frequent launching of new molecules for the same therapeutic indication, together with wide publicity targeting prescribers, interferes with the decision-making process. Similarly, the bonuses offered by the industry for over-the-counter drug sales interfere with the consumer's choice. The confrontation between known human biological variability and the knowledge that there is no absolute similarity between drugs of the same therapeutic class, or even generic drugs, has an impact on the prescriber's drug list, which should include the concept of first and second choice drugs. Prescribers' unfamiliarity with these subjects is a determinant factor for irrational drug use: a public health issue. The objective of this study was to introduce to drug prescribers information that can help them building up a rational drug list for their patients, based on the National Health Surveillance Agency (Anvisa experience of drug regulation.
García-Yee, J. S.; Torres-Jardón, R.; Barrera-Huertas, H.; Castro, T.; Peralta, O.; García, M.; Gutiérrez, W.; Robles, M.; Torres-Jaramillo, J. A.; Ortínez-Álvarez, A.; Ruiz-Suárez, L. G.
2018-03-01
The role of the Tenango del Aire mountain pass, located southeast of the Mexico City Metropolitan Area (MCMA), in venting the city's air pollution has already been studied from a meteorological standpoint. To better understand the transport of gaseous air pollutants through the Tenango del Aire Pass (TAP), and its influence on the air quality of the MCMA, three mobile air quality monitoring units were deployed during a 31-day field campaign between February and March of 2011. Surface O3, NOx, and meteorological variables were continuously measured at the three sites. Vertical profiles of O3 and meteorological variables were also obtained at one of the sites using a tethered balloon. Days were classified as being under low pressure synoptic systems (LPS, 13 days), high pressure synoptic systems (HPS, 13 days), or as transition days (TR). The Mexican ozone standards at the Pass were not exceeded during LPS days, but were exceeded on almost all HPS days. A detailed analysis was performed using data from two typical days, one representative of LPS and the other of HPS. In both cases, morning vertical profiles of O3 showed a strong thermal inversion layer and near-surface O3 titration due to fresh NOx. In the LPS early morning, a single O3 layer of close to 45 ppb was observed from 150 to 700 magl. In the HPS early morning, 50 ppb was observed from 150 to 400 magl followed by a 400-m-thick layer with up to 80 ppb. These layers were the source of the morning increase of O3, with a simultaneous sharp decrease of NOx and CO as the mixing layer started to rise. During the LPS day, a southerly wind dominated throughout most of the daytime, with surface O3 lower than 60 ppb. The same was observed for the well-mixed midday and afternoon vertical profiles. Under HPS, northerly winds transported photochemically active air masses from the MCMA all morning, as observed by a smoother increase of Ox and O3, reaching 110 ppb of O3. Just after midday, the wind shifted back, carrying high-O3 (100-110 ppb) aged air masses until sunset. In addition, the midday and afternoon vertical profiles showed well-mixed high-O3 (100-110 ppb) mixing ratios. Analysis of Ox-NOx correlations was performed for these peri-urban and MCMA sites. A parallel analysis for the nearest urban air quality monitoring station in the MCMA was also done. A comparison allowed us to distinguish between photochemically active (VOC sensitive) or aged parcels (NOx sensitive) arriving at the TAP. Separating the correlations into time groups associated with wind direction changes allowed us to better distinguish between local, MCMA, or regional influence. The results are relevant to air quality management in the Mexico City megalopolis.
de Vries, Harmen; Mokhov, Anatoli V.; Levinsky, Howard B.
2017-01-01
The addition of hydrogen derived from renewable power to the natural gas network is being promoted as a viable means of storing excess wind and solar energy. However, the changes in combustion properties of the natural gas upon hydrogen addition can impact the performance of the end-use equipment
1993-02-01
Segment: BX General Shipment Information Level: A Sequence: 30 Usage: M Max Use: 1 Loop: Purpose: To transmit identification numbers and other basic ...official code as- signed to a city or point (for ratemaking purposes) within a city. 930210 10.7.25 DEPARTM•B•T OF DOOM4N GOVERMET SILL OF LAD#M wDI...development group as the official code as- signed to a city or point (for ratemaking purposes) within a city. 930210 10.7.27 DEPARTMENT OF DG:dEI GOVWERJT
2012-11-01
In response to local concerns, the Iowa Department of Transportation (DOT) requested a road safety audit (RSA) for the IA Highway 28 : corridor through the City of Norwalk in Warren County, Iowa, from the south corporate limits of Norwalk through the...
2013-08-22
... southbound bridge girders and lowering the pavement section from south of Morris Street to north of Fletcher... immediately. FOR FURTHER INFORMATION CONTACT: Ms. Crystal Jones, Office of Freight Management and Operations..., which consists of replacing the northbound and southbound bridge girders and lowering the pavement...
Sharma, Nidhi; O'Donnell, Brian J.; Flanegan, James B.
2005-01-01
The 5′ cloverleaf in poliovirus RNA has a direct role in regulating the stability, translation, and replication of viral RNA. In this study, we investigated the role of stem a in the 5′ cloverleaf in regulating the stability and replication of poliovirus RNA in HeLa S10 translation-replication reactions. Our results showed that disrupting the duplex structure of stem a destabilized viral RNA and inhibited efficient negative-strand synthesis. Surprisingly, the duplex structure of stem a was no...
Jap-A-Joe, Simone M. E. A. A.; Oostra, Roelof-Jan; Maas, Mario; Stoker, Jaap; van der Horst, Chantal M. A. M.
2003-01-01
A hitherto unknown combination of congenital anomalies was found in an anatomical specimen of a female neonate. External examination and additional CT and MRI studies showed thanatophoric dysplasia type II with cloverleaf skull and concomitant parietal meningoencephalocele and hypoplasia of the
Characterization of a magnetic trap by polarization dependent Zeeman spectroscopy
DEFF Research Database (Denmark)
Nielsen, Carsten Vandel; Lyngsøe, Jens Kristian; Thorseth, Anders
2008-01-01
This paper demonstrates a detailed experimental study of our cloverleaf magnetic trap for sodium atoms. By using polarization dependent Zeeman spectroscopy of our atomic beam, passing the magnetic trap region, we have determined important trap parameters such as gradients, their curvatures...
Energy Technology Data Exchange (ETDEWEB)
Montes, M. A.; Medialdea, J. M.; Garcia Mediavilla, B.; Moron, M. J.; Arnaiz, M. C.; Garcia Martinez de Simon, I.; Lopez, C. M.; Escot, E.; Lebrato, J. [Universidad de Sevilla. Sevilla (Spain)
1999-11-01
Among the different treatment systems assessed for the purification of the wastewaters poured from Aznalcollar quarry the last April 25, 1998, physical and chemical adsorption proved highly efficient for the removal of refractory heavy metals. In laboratory experiments, 99% of dissolved Mn and Zn was removed when wastewater passed through a packedbed column filled with a cationic exchange clay. In the same way, activated-carbon adsorption removed more than 80% of dissolved Zn and 11-16% of Mn. Results confirm the feasibility of these processes and contribute knowledge on their operational characteristics so that in any other similar situation we can consider all treatment possibilities. 8 refs.
A Bridge Deflection Monitoring System Based on CCD
Directory of Open Access Journals (Sweden)
Baohua Shan
2016-01-01
Full Text Available For long-term monitoring of the midspan deflection of Songjiazhuang cloverleaf junction on 309 national roads in Zibo city, this paper proposes Zhang’s calibration-based DIC deflection monitoring method. CCD cameras are used to track the change of targets’ position, Zhang’s calibration algorithm is introduced to acquire the intrinsic and extrinsic parameters of CCD cameras, and the DIC method is combined with Zhang’s calibration algorithm to measure bridge deflection. The comparative test between Zhang’s calibration and scale calibration is conducted in lab, and experimental results indicate that the proposed method has higher precision. According to the deflection monitoring scheme, the deflection monitoring software for Songjiazhuang cloverleaf junction is developed by MATLAB, and a 4-channel CCD deflection monitoring system for Songjiazhuang cloverleaf junction is integrated in this paper. This deflection monitoring system includes functions such as image preview, simultaneous collection, camera calibration, deflection display, and data storage. In situ deflection curves show a consistent trend; this suggests that the proposed method is reliable and is suitable for the long-term monitoring of bridge deflection.
AMS San Diego Testbed - Calibration Data
Department of Transportation — The data in this repository were collected from the San Diego, California testbed, namely, I-15 from the interchange with SR-78 in the north to the interchange with...
78 FR 62352 - Proposed Agency Information Collection Activities; Comment Request
2013-10-18
... or summary information concerning the costs incurred, and interchange transaction fees charged or... basis) aggregate or summary information concerning the costs incurred, and interchange transaction fees... costs and fixed costs, and to instruct respondents to exclude transactions monitoring from the...
A Compression Algorithm for Field Programmable Gate Arrays in the Space Environment
2011-12-01
Decimation in Frequency DIT Decimation in Time DSP Digital Signal Processing DTFT Discrete Time Fourier Transform EDIF Electronic Data Interchange...standard electronic data interchange format ( EDIF ), compilation directly to bitstream for direct implementation on an FPGA, and hardware cosimulation
Highway Safety Manual applied in Missouri - freeway/software : research summary.
2016-03-01
AASHTOs Highway Safety Manual (HSM) : includes models for freeway segments, speedchange : lanes (transitional area between mainline : and ramps), ramps, and interchange terminals. : These predictive models for freeway : interchanges need to be cal...
2012-01-10
... interim final rule with comment period. For further information about electronic data interchange (EDI... the accounts payable/receivable system and electronic data interchange (EDI) systems, and the business...
48 CFR 47.403-1 - Availability and unavailability of U.S.-flag air carrier service.
2010-10-01
... farthest interchange point on a usually traveled route. (2) When an origin or interchange point is not... interchange point on a usually traveled route to connect with U.S.-flag air carrier service. (3) When a U.S... travel by a foreign-flag air carrier. (e) For travel between two points outside the United States, the...
V. Martín Moreno; J. Benito Gómez Gandoy; M. de Oya Otero; Agustín Gómez de la Cámara; M.ª J. Antoranz González
2003-01-01
Objetivo: La masa grasa, la masa libre de grasa y la relación entre ambas, el índice adiposo-muscular, son parámetros útiles para valorar clínicamente al paciente. El objetivo de este estudio es medir el grado de acuerdo entre los índices adiposo-musculares corporales (IAMC) obtenidos mediante los pliegues cutáneos con la ecuación de Siri para cuatro pliegues (IAMC Siri) y para el pliegue del tríceps (IAMCtríceps); por bioimpedanciometría (IAMC Omron); y mediante las áreas adiposa y muscular ...
Ferkinhoff, Carl; Brisbin, Drew; Nikola, Thomas; Parshley, Stephen C.; Stacey, Gordon J.; Phillips, Thomas G.; Falgarone, Edith; Benford, Dominic J.; Staguhn, Johannes G.; Tucker, Carol E.
2011-01-01
We report the first detections of the [N II] 122 micron line from a high-redshift galaxy. The line was strongly (>6(sigma)) detected from SMMJ02399-0136, and H1413 + 117 (the Cloverleaf QSO) using the Redshift (zeta) and Early Universe Spectrometer on the Caltech Submillimeter Observatory. The lines from both sources are quite bright with line to far-infrared (FIR) continuum luminosity ratios that are approx.7.0 x 10(exp -4) (Cloverleaf) and 2.1 x 10(exo -3) (SMMJ02399). With ratios 2-10 times larger than the average value for nearby galaxies, neither source exhibits the line to continuum deficits seen in nearby sources. The line strengths also indicate large ionized gas fractions, approx.8%-17% of the molecUlar gas mass. The [O III]/[N II] line ratio is very sensitive to the effective temperature of ionizing stars and the ionization parameter for emission arising in the narrow-line region (NLR) of an active galactic nucleus (AGN). Using Our previous detection of the [O III] 88 micron line, the [O III]/[N II]line ratio for SMMJ02399-0136 indicates that the dominant source of the line emission is either stellar H II regions ionized by O9.5 stars, or the NLR of the AGN with ionization parameter log(U) = -3.3 to -4.0. A composite system, where 30%-50% of the FIR lines arise in the NLR also matches the data. The Cloverleaf is best modeled by a superposition of approx.200 M82-like starbursts accounting for all of the FIR emission and 43% of the [N II]line. The remainder may come from the NLR. This war!< demonstrates the utility of the [N II] and [O III] lines in constraining properties of the ionized medium.
Ferkinhoff, Carl; Brisbin, Drew; Nikola, Thomas; Parshley, Stephen C.; Stacey, Gordon J.; Phillips, Thomas G.; Falgarone, Edith; Benford, Dominic J.; Staguhn, Johannes G.; Tucker, Carol E.
2011-01-01
We report the first detections of the [NIl] 122 {\\mu} m line from a high redshift galaxy. The line was strongly (> 6{\\sigma}) detected from SMMJ02399-0136, and HI413+ 117 (the Cloverleaf QSO) using the Redshift(z) and Early Universe Spectrometer (ZEUS) on the CSO. The lines from both sources are quite bright with line-to-FIR continuum luminosity ratios that are approx.7.0x10(exp -4) (Cloverleaf) and 2.1x10(exp -3) (SMMJ02399). With ratios 2-10 times larger than the average value for nearby galaxies, neither source exhibits the line-to-continuum deficits seen in nearby sources. The line strengths also indicate large ionized gas fractions, approx.8 to 17% of the molecular gas mass. The [OIII]/[NII] line ratio is very sensitive to the effective temperature of ionizing stars and the ionization parameter for emission arising in the narrow-line region (NLR) of an AGN. Using our previous detection of the [01II] 88 {\\mu}m line, the [OIII]/ [NIl] line ratio for SMMJ02399-0136 indicates the dominant source of the line emission is either stellar HII regions ionized by 09.5 stars, or the NLR of the AGN with ionization parameter 10g(U) = -3.3 to -4.0. A composite system, where 30 to 50% of the FIR lines arise in the NLR also matches the data. The Cloverleaf is best modeled by a superposition of approx.200 M82like starbursts accounting for all of the FIR emission and 43% of the [NIl] line. The remainder may come from the NLR. This work demonstrates the utility of the [NIl] and [OIII] lines in constraining properties of the ionized medium.
Chandra Looks Over a Cosmic Four-Leaf Clover
2004-07-01
A careful analysis of observations by NASA's Chandra X-ray Observatory of a rare quadruple quasar has uncovered evidence that possibly a single star in a foreground galaxy magnified X-rays coming from the quasar. This discovery gives astronomers a new and extremely precise probe of the gas flow around the supermassive black hole that powers the quasar. "If our interpretation is correct, then we are seeing details around this black hole that are 50,000 times smaller than either the Hubble Space Telescope or Chandra could see under ordinary circumstances," said George Chartas of Penn State University in University Park, and lead author of a recent article on the Cloverleaf quasar in The Astrophysical Journal. The Cloverleaf quasar is a single object about 11 billion light years from Earth that appears as four images produced by a process known as gravitational lensing. If one or more galaxies lie along the line of sight to a more distant quasar, the gravitational field of the intervening galaxies can bend and magnify the light from the quasar and produce multiple images of it. The four images of the Cloverleaf quasar have been produced by one or more intervening galaxies. Cloverleaf Quasar Chandra X-ray Image of the Cloverleaf quasar One of the images (A), in the Cloverleaf is brighter than the others in both optical and X-ray light. Chartas and his colleagues found the relative brightness of this image was greater in X-ray than in optical light. The X-rays from iron atoms were also enhanced relative to X-rays at lower energies. Since the amount of brightening due to gravitational lensing does not vary with the wavelength, this means that an additional object has magnified the X-rays. The increased magnification of the X-ray light can be explained by gravitational microlensing, an effect which has been used to search for compact stars and planets in our galaxy. Microlensing occurs when a star or a multiple star system passes in front of light from a background object
Mitochondrial genome of the African lion Panthera leo leo.
Ma, Yue-ping; Wang, Shuo
2015-01-01
In this study, the complete mitochondrial genome sequence of the African lion P. leo leo was reported. The total length of the mitogenome was 17,054 bp. It contained the typical mitochondrial structure, including 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes and 1 control region; 21 of the tRNA genes folded into typical cloverleaf secondary structure except for tRNASe. The overall composition of the mitogenome was A (32.0%), G (14.5%), C (26.5%) and T (27.0%). The new sequence will provide molecular genetic information for conservation genetics study of this important large carnivore.
Feutry, Pierre; Pillans, Richard D; Kyne, Peter M; Chen, Xiao
2016-01-01
In this manuscript we describe the first complete mitochondrial sequence for the Near Threatened Graceful Shark Carcharhinus amblyrhynchoides. It is 16,705 bp in length, consists of two rRNA genes, 22 tRNA genes, 13 protein-coding genes and one control region with the typical gene arrangement pattern and translate orientation in vertebrates. The overall base composition is 31.4% A, 25.1% C, 13.2% G and 30.3% T. The shortest tRNA-Ser2 cannot fold into a clover-leaf secondary structure due to the lack of the dihydrouridine arm.
Chen, Xiao; Yu, Junqi; Zhang, Saile; Ding, Wenyong; Xiang, Dan
2014-12-01
The tiger shark Galeocerdo cuvier is the only member of the genus Galeocerdo. The complete mitochondrial genome of G. cuvier is presented for the first time in this study. The gene composition and arrangement in the mitogenome of G. cuvier is identical to most animal mitogenome. There are 22 bp short noncoding sequences and 44 bp overlaps in the mitogenome. The overall base composition is 31.8% A, 23.9% C, 13.0% G and 31.3% T. The dihydrouridine arm of tRNA-Ser2 was replaced by a simple loop and the other tRNAs could be folded into the typical cloverleaf structure.
DEFF Research Database (Denmark)
Korsgaard, Søren
depends only on the relative costs of producing cash and card payments and can be used by regulators to assess privately set interchange fees. When calibrated to cost data, the model implies an optimal fee that is low and may even be negative. The findings are consistent with empirical evidence of high......Do consumers and merchants use the most efficient payment instruments? I examine how interchange fees, which are fees paid from merchants' banks to consumers' banks when card transactions take place, influence the choice between cash and payment cards. I show that when consumers do not pay...... transaction fees to banks - a common feature in bank contracts - card use is declining in interchange fees, and surcharging does not neutralize interchange fees. According to my model, banks set interchange fees at too high a level, resulting in too few card payments. I derive an optimal interchange fee which...
ORF Alignment: NC_003228 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ide ... interchange protein [Bacteroides fragilis YCH46] ... Length = 140 ... Query: 401 NNQPKTGNRFID...FSAPDLNGNMVQLSEQIRGKVALIDLWASWCGPCRTTSKQLIPIYEKY 460 ... NNQPKTGNRFIDF...SAPDLNGNMVQLSEQIRGKVALIDLWASWCGPCRTTSKQLIPIYEKY Sbjct: 1 ... NNQPKTGNRFIDFSAPDLNGNMVQLSEQIRGKVALIDLWASWCGPCRTT
ORF Alignment: NC_006347 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ide ... interchange protein [Bacteroides fragilis YCH46] ... Length = 140 ... Query: 401 NNQPKTGNRFID...FSAPDLNGNMVQLSEQIRGKVALIDLWASWCGPCRTTSKQLIPIYEKY 460 ... NNQPKTGNRFIDF...SAPDLNGNMVQLSEQIRGKVALIDLWASWCGPCRTTSKQLIPIYEKY Sbjct: 1 ... NNQPKTGNRFIDFSAPDLNGNMVQLSEQIRGKVALIDLWASWCGPCRTT
Genetics Home Reference: microphthalmia
... microphthalmia should be distinguished from another condition called anophthalmia, in which no eyeball forms at all. However, the terms anophthalmia and severe microphthalmia are often used interchangeably. Microphthalmia ...
Genetics Home Reference: coloboma
... microphthalmia should be distinguished from another condition called anophthalmia, in which no eyeball forms at all. However, the terms anophthalmia and severe microphthalmia are often used interchangeably. Microphthalmia ...
Curvature-driven instabilities in a hot-electron plasma: radial analysis
International Nuclear Information System (INIS)
Berk, H.L.; Van Dam, J.W.; Rosenbluth, M.N.; Spong, D.A.
1981-12-01
The theory of unfavorable curvature-driven instabilities is developed for a plasma interacting with a hot electron ring whose drift frequencies are larger than the growth rates predicted from conventional magnetohydrodynamic theory. A z-pinch model is used to emphasize the radial structure of the problem. Stability criteria are obtained for the five possible modes of instability: the conventional hot electron interchange, a high-frequency hot electron interchange (at frequencies larger than the ion cyclotron frequency), a compressional instability, a background pressure-driven interchange, and an interacting pressure-driven interchange
National Positioning, Navigation, and Timing Architecture
National Research Council Canada - National Science Library
Huested, Patrick; Popejoy, Paul D
2008-01-01
.... The strategy is supported by vectors, or enterprise architecture elements, for using multiple PNT-related phenomenologies and interchangeable PNT solutions, PNT and Communications synergy, and co...
2011-07-08
... information. Electronic Data interchange (EDI) enables providers and payers to process financial and... hardware and software to exchange EDI data. Each trading partner, including providers, separately provides...
75 FR 76426 - Privacy Act of 1974; System of Records
2010-12-08
... name, middle initial); unique identifiers including Electronic Data Interchange Person Identifier (EDI... (EDI PI), other unique identifier (not Social Security Number), Federal Agency Smart Credential Number...
76 FR 54071 - Noncompetitive Appointment of Certain Military Spouses
2011-08-31
... consideration under any hiring authority for which they are eligible, or apply through the competitive examining... reinstitute the Defense Civilian Intelligence Personnel System (DCIPS) interchange agreement. The other...
Unusual loop-sequence flexibility of the proximal RNA replication element in EMCV.
Directory of Open Access Journals (Sweden)
Jan Zoll
Full Text Available Picornaviruses contain stable RNA structures at the 5' and 3' ends of the RNA genome, OriL and OriR involved in viral RNA replication. The OriL RNA element found at the 5' end of the enterovirus genome folds into a cloverleaf-like configuration. In vivo SELEX experiments revealed that functioning of the poliovirus cloverleaf depends on a specific structure in this RNA element. Little is known about the OriL of cardioviruses. Here, we investigated structural aspects and requirements of the apical loop of proximal stem-loop SL-A of mengovirus, a strain of EMCV. Using NMR spectroscopy, we showed that the mengovirus SL-A apical loop consists of an octaloop. In vivo SELEX experiments demonstrated that a large number of random sequences are tolerated in the apical octaloop that support virus replication. Mutants in which the SL-A loop size and the length of the upper part of the stem were varied showed that both stem-length and stability of the octaloop are important determinants for viral RNA replication and virus reproduction. Together, these data show that stem-loop A plays an important role in virus replication. The high degree of sequence flexibility and the lack of selective pressure on the octaloop argue against a role in sequence specific RNA-protein or RNA-RNA interactions in which octaloop nucleotides are involved.
Directory of Open Access Journals (Sweden)
Fryns Jean-Pierre
2006-06-01
Full Text Available Abstract Pfeiffer syndrome is a rare autosomal dominantly inherited disorder that associates craniosynostosis, broad and deviated thumbs and big toes, and partial syndactyly on hands and feet. Hydrocephaly may be found occasionally, along with severe ocular proptosis, ankylosed elbows, abnormal viscera, and slow development. Based on the severity of the phenotype, Pfeiffer syndrome is divided into three clinical subtypes. Type 1 "classic" Pfeiffer syndrome involves individuals with mild manifestations including brachycephaly, midface hypoplasia and finger and toe abnormalities; it is associated with normal intelligence and generally good outcome. Type 2 consists of cloverleaf skull, extreme proptosis, finger and toe abnormalities, elbow ankylosis or synostosis, developmental delay and neurological complications. Type 3 is similar to type 2 but without a cloverleaf skull. Clinical overlap between the three types may occur. Pfeiffer syndrome affects about 1 in 100,000 individuals. The disorder can be caused by mutations in the fibroblast growth factor receptor genes FGFR-1 or FGFR-2. Pfeiffer syndrome can be diagnosed prenatally by sonography showing craniosynostosis, hypertelorism with proptosis, and broad thumb, or molecularly if it concerns a recurrence and the causative mutation was found. Molecular genetic testing is important to confirm the diagnosis. Management includes multiple-staged surgery of craniosynostosis. Midfacial surgery is performed to reduce the exophthalmos and the midfacial hypoplasia.
Kimura, Ibuki; Araki, Ryota; Yoshizato, Toshiyuki; Miyamoto, Shingo
2015-10-01
We present a case of osteogenesis imperfecta (OI) type 2A in which a natural course in utero was observed from 23 weeks' gestation to term. At 23 weeks' gestation, a sonographic examination showed a cloverleaf skull-like head, a narrow thorax, and marked shortening of the long bones with bowing of the femurs and humeri. Follow-up examinations showed that the cloverleaf skull-like head was not evident at 28 weeks' gestation. Discontinuity of the ribs and femurs was observed at 26 and 30 weeks' gestation, respectively. This finding suggested bone fractures, which were confirmed by three-dimensional computed tomography at 32 weeks' gestation. Ultrasonographic findings of bones, including the long bones and calvarium, changed with advancing gestation during the second trimester. Characteristic features of OI type 2A were evident during the late second to early third trimesters. Repeated ultrasonographic examinations together with three-dimensional computed tomography are necessary for the definitive diagnosis of OI type 2A in the second trimester.
J. Martignoni (Jens)
2015-01-01
textabstractCooperation, interchange or intertrade of complementary currencies is not yet very common, perhaps of because the funding impulse of most complementary currencies does not cover the question of interchange and cooperation yet, or because theoretical aspects are not often studied. The
Interoperable adaptive educational hypermedia : a web service definition
Meccawy, M.; Celik, I.; Cristea, A.I.; Stewart, C.; Ashman, H.; Kinshuk, xx; Koper, R.; Kommers, P.A.M.
2006-01-01
This paper presents an approach to resolve the problem of authoring and interchanging educational material, based on web services. Here we describe the ultimate goal, of reusing and interchanging freely adaptive elearning material, shortly sketch previous solutions, showing their benefits but also
McNeish, Daniel M.
2016-01-01
Mixed-effects models (MEMs) and latent growth models (LGMs) are often considered interchangeable save the discipline-specific nomenclature. Software implementations of these models, however, are not interchangeable, particularly with small sample sizes. Restricted maximum likelihood estimation that mitigates small sample bias in MEMs has not been…
78 FR 41993 - Ann Arbor Railroad, Inc.-Lease Exemption-Norfolk Southern Railway Company
2013-07-12
... number of carloads interchanged with NSR in a given year.\\1\\ AARR states that the interchange commitment..., Canadian National Railway Company (CN), CSX Transportation, Inc., and Wheeling & Lake Erie Railway in Toledo; the Indiana and Ohio Railway and CN in Diann, Mich.; NSR in Milan, Mich.; and Great Lakes Central...
An Empirical Study of Logistics Organization, Electronic Linkage, and Performance
1993-01-01
Anvari, M., "Electronic Data Interchange and Inventories," International Journal of Production Economics , 26, 1-3 (1992), 135-143. Baker, R. H., EDI: What...Electronic Data Interchange -- A Study of Norwegian Freight Forwarders Using EDI," International Journal of Production Economics , 24 (1991), 91-101. Henry, G
The ePNK: An Extensible Petri Net Tool for PNML
DEFF Research Database (Denmark)
Kindler, Ekkart
2011-01-01
The Petri Net Markup Language (PNML) is an XML-based interchange format for all kinds of Petri nets, which is an ISO/IEC International Standard 15909-2 now. The focus of this standard is on PNML as an interchange format for high-level Petri nets. PNML, however, is more general and allows exchanging...
19 CFR 122.50 - General order merchandise.
2010-04-01
... TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements for... appropriate Customs-authorized electronic data interchange system. Failure to provide such notification may...-authorized electronic data interchange system. If the party fails to notify Customs of the unentered...
2011-07-19
... the e-mail any past electronic data interchange (EDI) history with CBP. Written comments concerning... be transmitted in advance of arrival through a CBP-approved electronic data interchange (EDI).The..., 2008).\\1\\ Currently, the Automated Commercial System (ACS) is the CBP-approved EDI through which this...
48 CFR 552.216-72 - Placement of Orders.
2010-10-01
...] (b) Orders may be placed through Electronic Data Interchange (EDI) or mailed in paper form. EDI... Data Interchange (EDI) format. (c) If the Contractor agrees, General Services Administration's Federal Acquisition Service (FAS) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer...
2012-04-06
... Interchange (EDI). This notice also describes test particulars including commencement date, eligibility... Electronic Data Interchange (EDI) as part of the Document Image System (DIS) test. DIS is currently a stand... with supporting information via EDI in an Extensible Markup Language (XML) format, in lieu of...
78 FR 12322 - Agency Information Collection Activities: OMB Review; Comment Request
2013-02-22
... Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment Form; Use: The purpose of this... identification of Medicare providers/suppliers and authorization of requested Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are completed by Medicare providers...
77 FR 70708 - VA Acquisition Regulation: Electronic Submission of Payment Requests
2012-11-27
... electronic data interchange (EDI) formats; or (3) another electronic form as prescribed by the contract....fsc.va.gov/einvoice.asp .); or, (b) A system that conforms to the X12 electronic data interchange (EDI... Institute (ANSI). The X12 EDI Web site ( http://www.x12.org ) includes additional information on EDI 810 and...
2012-06-12
... report EDI Electronic data interchange FHWA Federal Highway Administration FMCSRs Federal Motor Carrier...-copy paperwork to unassisted electronic data interchange (EDI) transmissions. IANA added that the... system, or EDI and transmittals of files in various formats. IANA noted that its program offers IEPs and...
77 FR 57090 - Agency Information Collection Activities: Proposed Collection; Comment Request
2012-09-17
...: Medicare Electronic Data Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment... Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are... efficient uniform means by which Medicare captures information necessary to drive Medicare EDI security and...
19 CFR 10.510 - Filing of claim for preferential tariff treatment upon importation.
2010-04-01
... RATE, ETC. United States-Singapore Free Trade Agreement Import Requirements § 10.510 Filing of claim... method specified for equivalent reporting via an authorized electronic data interchange system. For all... classified, or by the method specified for equivalent reporting via an authorized electronic data interchange...
Zhang, Yulong; Shao, Dandan; Cai, Miao; Yin, Hong; Zhang, Daochuan
2016-01-01
The complete mitochondrial genome of Gryllotalpa unispina was 15,513 bp in length and contained 70.9% AT. All G. unispina protein-coding sequences except for the nad2 started with a typical ATN codon. The usual termination codons (TAA) and incomplete stop codons (T) were found from 13 protein-coding genes. All tRNA genes were folded into the typical cloverleaf secondary structure, except trnS(AGN) lacking the dihydrouridine arm. The sizes of the large and small ribosomal RNA genes were 1245 and 725 bp, respectively. The A + T-rich region was 917 bp in length with 76.8%. The orientation and gene order of the G. unispina mitogenome were identical to the G. orientalis and G. pluvialis, there was no phenomenon of "DK rearrangement" which has been widely reported in Caelifera.
Pfeiffer syndrome type 2: case report
Directory of Open Access Journals (Sweden)
Maria Kiyoko Oyamada
Full Text Available OBJECTIVE: To report on a case of Pfeiffer Syndrome, with a discussion of the diagnostic characteristics and features of disease types and the differential diagnosis. DESCRIPTION: The authors describe a newborn with cloverleaf skull, extreme bilateral exorbitism and choanal atresia, partial syndactyly of the second and third toes and broad medially-deviated big toes. The case reported was Pfeiffer Syndrome type 2, which usually has a poor prognosis. COMMENTS: Pfeiffer Syndrome is a clinically variable disorder and consists of an autosomal dominantly-inherited osteochondrodysplasia with craniosynostosis. It has been divided into three types. Type 1 is commonly associated with normal intelligence and generally good outcome. Types 2 and 3 generally have severe neurological compromise, poor prognosis, early death and sporadic occurrence. Potential for prolonged useful survival outcome can be achieved in some cases with early aggressive medical and surgical management according to recent literature.
Brewer, Alyssa A; Barton, Brian
2016-07-08
One of the fundamental properties of the mammalian brain is that sensory regions of cortex are formed of multiple, functionally specialized cortical field maps (CFMs). Each CFM comprises two orthogonal topographical representations, reflecting two essential aspects of sensory space. In auditory cortex, auditory field maps (AFMs) are defined by the combination of tonotopic gradients, representing the spectral aspects of sound (i.e., tones), with orthogonal periodotopic gradients, representing the temporal aspects of sound (i.e., period or temporal envelope). Converging evidence from cytoarchitectural and neuroimaging measurements underlies the definition of 11 AFMs across core and belt regions of human auditory cortex, with likely homology to those of macaque. On a macrostructural level, AFMs are grouped into cloverleaf clusters, an organizational structure also seen in visual cortex. Future research can now use these AFMs to investigate specific stages of auditory processing, key for understanding behaviors such as speech perception and multimodal sensory integration.
Thanatophoric dysplasia: Antenatal to postmortem
Directory of Open Access Journals (Sweden)
Chanabasappa V Chavadi
2015-01-01
Full Text Available Thanatophoric dwarfism (TD, literally meaning death seeking dwarf, is the most common form of lethal bone dysplasia characterized by severe micromelia, extra folds of skin and narrow chest. Other signs include small ribs, underdeveloped lungs, cloverleaf skull, hypertelorism and protuberant abdomen. A short neck, depressed nasal bridge and hypoplastic mandible may also be present. Hydrocephalus is uncommon but is another poor prognostic sign. The diagnosis is usually made with the ultrasonography in the second trimester. Based on the morphological characters, this condition is sub-divided into type 1 and type 2. Fetuses with this condition are either still-born or die shortly after birth. Antenatal sonographic, postpartum radiological and autopsy findings of a case of type 1 TD with a relatively uncommon association of hydrocephalus is discussed.
Complete mitochondrial genome of the blue shark Prionace glauca (Elasmobranchii: Carcharhiniformes).
Chen, Xiao; Xiang, Dan; Ai, Weiming; Shi, Xiaofang
2015-04-01
In this study, we first presented the complete mitochondrial genome of the blue shark Prionace Glauca, a pelagic and oceanic species. It is 16,705 bp in length and contains 2 rRNA genes, 22 tRNA genes, 13 protein-coding genes and 1 putative control region. The overall base composition is 31.6% A, 24.4% C, 13.1% G and 30.9% T. Overlaps and short inter-genic spaces are located in the genome. The tRNA-Ser2 loses the dihydrouridine arm and cannot be folded into the typical clover-leaf secondary structure. Two start codons (GTG and ATG) with two stop codons (TAG and TAA) or with one incomplete stop codon (T) are found in the 13 protein-coding genes. The control region contains high A + T (69.9%) and low G (12.0%).
Complete mitochondrial genome of the spadenose shark (Scoliodon macrorhynchos).
Chen, Xiao; Peng, Xin; Zhang, Peng; Yang, Shenyun; Liu, Min
2014-04-01
We firstly presented the complete mitogenome of the spadenose shark Scoliodon macrorhynchos (Carcharhinidae, Carcharhiniformes). The mitogenome is 16,693 bp long and contains 13 protein-coding genes, two rRNAs, 22 tRNAs and one control region, a typical vertebrate arrangement. The codon usage bias was different between the H-strand and L-strand encoded protein genes. All tRNA genes have the typical cloverleaf secondary structure excepting tRNA-Ser2, in which the dihydrouridine (DHU) arm is replaced by a simple loop with 12 unpaired nucleotides. A termination associated sequence and three conserved sequence blocks (CSB I-III) were identified in the control region, which were considered associating with the replication and transcription of mitogenome.
Chen, Xiao; Sonchaeng, Pichai; Yuvanatemiya, Vasin; Nuangsaeng, Bunlung; Ai, Weiming
2016-01-01
The complete mitochondrial genome of the whitetip reef shark Triaenodon obesus is determined in this study. It is 16,700 bp in length, with the typical gene composition, arrangement and transcriptional orientation in vertebrates. The overall base composition is 31.4% A, 25.8% C, 13.2% G and 29.7% T. Two start codons and two stop codons are found in the protein-coding genes. The 22 tRNA genes ranged from 67 to 75 nucleotides. The tRNA-Ser2 lost the DHU arm and could not be folded to the typical cloverleaf secondary structure. The origin of L-strand replication (OL) sequence was identified between tRNA-Asn and tRNA-Cys genes. The high A+T content of control region is due to a lot of poly A and poly T.
Chen, Xiao; Xiang, Dan; Xu, Yuziwei; Shi, Xiaofang
2015-08-01
The complete mitochondrial genome of the endangered scalloped hammerhead Sphyrna lewini was firstly determined in this study. It is 16,726 bp in length with the typical gene composition and orders in vertebrates. The overall base composition is 31.4% A, 26.3% C, 13.2% G and 29.1% T. Two start codon (ATG and GTG) and three stop codon (TAG, AGA and TAA/TA/T) patterns were found in protein-coding genes. Except for the tRNA-Ser2, the remaining 21 tRNAs can be folded into the typical cloverleaf structure. The control region possess the highest A + T content (66.1%) and lowest G content (12.6%) among all mitochondrial partitions.
Periasamy, Rengaiyan; Chen, Xiao; Ingole, Baban; Liu, Wenai
2016-09-01
The complete mitochondrial genome of the Spadenose shark Scoliodon laticaudus has been determined for the first time in this study. It was 16,695 bp in length and consisted of 37 genes with typical gene order in vertebrate mitogenome. The nucleotide base content of S. laticaudus mitogenome was 31.5% A, 23.7% C, 13.2% G and 31.6% T. Two start codons (GTG and ATG) and three stop codons (AGA, TAG and TAA/T) were used in the protein-coding genes. The 22 tRNAs ranged from 67 bp (tRNA-Cys and tRNA-Ser2) to 75 bp (tRNA-Leu1) in length. The tRNA-Ser2 could not be folded into typical cloverleaf secondary structure by lacking the dihydrouridine (DHC) arm stem.
Chen, Xiao; Shen, Xue-Juan; Arunrugstichai, Sirachai; Ai, Weiming; Xiang, Dan
2016-01-01
The complete mitochondrial genome of the blacktip reef shark Carcharhinus melanopterus is determined for the first time in this study. The gene composition and order in the mitogenome of C. melanopterus is identical to most vertebrates. The overall base composition is 31.3% A, 25.3% C, 13.3% G and 30.1% T. There are 29 bp overlaps and 21 bp short intergenic spaces in the mitogenome. Two start codons and three stop codons were found in protein-coding genes. The dihydrouridine arm of tRNA-Ser2 was replaced by a simple loop and the other tRNAs could be folded into the typical cloverleaf structure. The termination associated sequence (TAS) and the conserved sequence blocks (CSB1-3) are found in the control region.
Mitochondrial genome of the bull shark Carcharhinus leucas (Carcharhiniformes: Carcharhinidae).
Chen, Xiao; Liu, Min; Peng, Zaiqing; Shi, Xiaofang
2015-01-01
The bull shark Carcharhinus leucas is a large elasmobranch species widespread in tropical and warm oceans, rivers and lakes. We first determine the complete mitogenome of C. leucas in this article. It is 16,704 bp in length, consists 37 genes and one control region with the typical gene order in vertebrates. The ND6 gene used the rare AGG as stop codon. The 22 tRNA genes ranged from 67 to 75 bp. The tRNA-Ser2 lacks the dihydrouridine arm and cannot form the typical cloverleaf structure. The control region is 1066 bp in length with high A+T and low G contents.
Feutry, Pierre; Every, Sharon L; Kyne, Peter M; Sun, Renjie; Chen, Xiao
2016-05-01
In this manuscript we describe the first complete mitochondrial sequence for the Data Deficient Pigeye Shark Carcharhinus amboinensis. The mitogenome is 16,704 bp long and consists of 1 control region, 2 rRNA genes, 22 tRNA genes and 13 protein-coding genes with an overall base composition of 31.6% A, 24.9% C, 13.1% G and 30.4% T. The gene arrangement pattern and transcriptional direction were typical for a vertebrate species. The tRNA-Ser2 lacks the dihydrouridine arm and forms a simple loop, therefore it cannot be folded into the typical cloverleaf secondary structures like other tRNAs.
Clinical and Microbiological Aspects of β-Lactam Resistance in Staphylococcus lugdunensis.
McHardy, Ian H; Veltman, Jennifer; Hindler, Janet; Bruxvoort, Katia; Carvalho, Marissa M; Humphries, Romney M
2017-02-01
Antimicrobial susceptibility results from broth microdilution MIC testing of 993 Staphylococcus lugdunensis isolates recovered from patients at a tertiary care medical center from 2008 to 2015 were reviewed. Ninety-two oxacillin-susceptible isolates were selected to assess the accuracy of penicillin MIC testing, the penicillin disk diffusion test, and three β-lactamase tests, including the cefoxitin-induced nitrocefin test, penicillin cloverleaf assay, and penicillin disk zone edge test. The results of all phenotypic tests were compared to the results of blaZ PCR. The medical records of 62 patients from whom S. lugdunensis was isolated, including 31 penicillin-susceptible and 31 penicillin-resistant strains, were retrospectively reviewed to evaluate the clinical significance of S. lugdunensis isolation, the antimicrobial agents prescribed, if any, and the clinical outcome. MIC testing revealed that 517/993 (52.1%) isolates were susceptible to penicillin and 946/993 (95.3%) were susceptible to oxacillin. The induced nitrocefin test was 100% sensitive and specific for the detection of β-lactamase compared to the blaZ PCR results, whereas the penicillin disk zone edge and cloverleaf tests showed sensitivities of 100% but specificities of only 9.1% and 89.1%, respectively. The penicillin MIC test had 100% categorical agreement with blaZ PCR, while penicillin disk diffusion yielded one major error. Only 3/31 patients with penicillin-susceptible isolates were treated with a penicillin family antimicrobial. The majority of cases were treated with other β-lactams, trimethoprim-sulfamethoxazole, or vancomycin. These data indicate that nearly all isolates of S. lugdunensis are susceptible to narrow-spectrum antimicrobial agents. Clinical laboratories in areas with resistance levels similar to those described here can help promote the use of these agents versus vancomycin by effectively designing their antimicrobial susceptibility reports to convey this message. Copyright
BAND-9 ALMA OBSERVATIONS OF THE [N II] 122 μm LINE AND FIR CONTINUUM IN TWO HIGH-z GALAXIES
Energy Technology Data Exchange (ETDEWEB)
Ferkinhoff, Carl [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Brisbin, Drew; Stacey, Gordon J. [Department of Astronomy, Cornell University, Ithaca, NY 14853 (United States); Nikola, Thomas [Center for Radiophysics and Space Research, Cornell University, Ithaca, NY 14853 (United States); Sheth, Kartik [National Radio Astronomy Observatory, Charlottesville, VA 22903 (United States); Hailey-Dunsheath, Steve [California Institute of Technology, Mail Code 301-17, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Falgarone, Edith, E-mail: ferkinhoff@mpia.de [LERMA, CNRS, Observatoire de Paris and ENS (France)
2015-06-20
We present Atacama Large Millimeter Array (ALMA) observations of two high-redshift systems (SMMJ02399-0136 at z{sub 1} ∼ 2.8 and the Cloverleaf QSO at z{sub 1} ∼ 2.5) in their rest-frame 122 μm continuum (ν{sub sky} ∼ 650 GHz, λ{sub sky} ∼ 450 μm) and [N ii] 122 μm line emission. The continuum observations with a synthesized beam of ∼0.″ 25 resolve both sources and recover the expected flux. The Cloverleaf is resolved into a partial Einstein ring, while SMMJ02399-0136 is unambiguously separated into two components: a point source associated with an active galactic nucleus and an extended region at the location of a previously identified dusty starburst. We detect the [N ii] line in both systems, though significantly weaker than our previous detections made with the first generation z (Redshift) and Early Universe Spectrometer. We show that this discrepancy is mostly explained if the line flux is resolved out due to significantly more extended emission and longer ALMA baselines than expected. Based on the ALMA observations we determine that ≥75% of the total [N ii] line flux in each source is produced via star formation. We use the [N ii] line flux that is recovered by ALMA to constrain the N/H abundance, ionized gas mass, hydrogen- ionizing photon rate, and star formation rate. In SMMJ02399-0136 we discover it contains a significant amount (∼1000 M{sub ⊙} yr{sup −1}) of unobscured star formation in addition to its dusty starburst and argue that SMMJ02399-0136 may be similar to the Antennae Galaxies (Arp 244) locally. In total these observations provide a new look at two well-studied systems while demonstrating the power and challenges of Band-9 ALMA observations of high-z systems.
Band-9 ALMA Observations of the [N II] 122 μm Line and FIR Continuum in Two High-z galaxies.
Ferkinhoff, Carl; Brisbin, Drew; Nikola, Thomas; Stacey, Gordon J.; Sheth, Kartik; Hailey-Dunsheath, Steve; Falgarone, Edith
2015-06-01
We present Atacama Large Millimeter Array (ALMA) observations of two high-redshift systems (SMMJ02399-0136 at z 1 ˜ 2.8 and the Cloverleaf QSO at z 1 ˜ 2.5) in their rest-frame 122 μm continuum (ν sky ˜ 650 GHz, λ sky ˜ 450 μm) and [N ii] 122 μm line emission. The continuum observations with a synthesized beam of ˜0.″ 25 resolve both sources and recover the expected flux. The Cloverleaf is resolved into a partial Einstein ring, while SMMJ02399-0136 is unambiguously separated into two components: a point source associated with an active galactic nucleus and an extended region at the location of a previously identified dusty starburst. We detect the [N ii] line in both systems, though significantly weaker than our previous detections made with the first generation z (Redshift) and Early Universe Spectrometer. We show that this discrepancy is mostly explained if the line flux is resolved out due to significantly more extended emission and longer ALMA baselines than expected. Based on the ALMA observations we determine that ≥75% of the total [N ii] line flux in each source is produced via star formation. We use the [N ii] line flux that is recovered by ALMA to constrain the N/H abundance, ionized gas mass, hydrogen- ionizing photon rate, and star formation rate. In SMMJ02399-0136 we discover it contains a significant amount (˜1000 M ⊙ yr-1) of unobscured star formation in addition to its dusty starburst and argue that SMMJ02399-0136 may be similar to the Antennae Galaxies (Arp 244) locally. In total these observations provide a new look at two well-studied systems while demonstrating the power and challenges of Band-9 ALMA observations of high-z systems.
Anisotropy effects on curvature-driven flute instabilities in a hot-electron plasma
International Nuclear Information System (INIS)
Spong, D.A.; Berk, H.L.; Van Dam, J.W.; Rosenbluth, M.N.
1982-08-01
The effects of finite parallel temperature are investigated for a hot electron plasma with sufficiently large beta that the magnetic field scale length (Δ/sub B/) is small compared with the vacuum field radius of curvature (R). Numerical and analytical estimates of stability boundaries are obtained for the four possible modes that can be treated in this limit: the conventional hot electron interchange, the high frequency hot electron interchange (ω > ω/sub ci/), the compressional Alfven mode, and the interacting pressure-driven interchange
Mechanism and scaling for convection of isolated structures in nonuniformly magnetized plasmas
DEFF Research Database (Denmark)
Garcia, O.E.; Bian, N.H.; Naulin, V.
2005-01-01
Large-scale radial advection of isolated structures in nonuniformly magnetized plasmas is investigated. The underlying mechanism considered is due to the nonlinear evolution of interchange motions, without any presumption of plasma sheaths. Theoretical arguments supported by numerical simulations...
The new numbers contrast sensitivity chart for contrast sensitivity measurement
Directory of Open Access Journals (Sweden)
Bharkbhum Khambhiphant
2011-10-01
Conclusions: These charts show reasonable agreement and can be used interchangeably with the MARS. It is helpful for Thai people who can only read numbers in doing the test. We can use them in routinely contrast sensitivity measurement.
Guidelines for PWR safety research and development at NUCLEBRAS
International Nuclear Information System (INIS)
Pinheiro, R.B.
1980-01-01
A review of the main areas of research developed at the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) is presented, as well as its interchange programs with Germany for personned training. (E.G.) [pt
Warning Signs of Heart Failure
... the two terms are used interchangeably. View an animation of heart failure . If you have been diagnosed ... resources here Popular Articles 1 Understanding Blood Pressure Readings 2 Sodium and Salt 3 Heart Attack Symptoms ...
Platform-independent method for computer aided schematic drawings
Vell, Jeffrey L [Slingerlands, NY; Siganporia, Darius M [Clifton Park, NY; Levy, Arthur J [Fort Lauderdale, FL
2012-02-14
A CAD/CAM method is disclosed for a computer system to capture and interchange schematic drawing and associated design information. The schematic drawing and design information are stored in an extensible, platform-independent format.
Acceleromyography for use in scientific and clinical practice: a systematic review of the evidence
DEFF Research Database (Denmark)
Claudius, C.; Viby-Mogensen, J.
2008-01-01
This systematic review describes the evidence on the use of acceleromyography for perioperative neuromuscular monitoring in clinical practice and research. The review documents that although acceleromyography is widely used in research, it cannot be used interchangeably with mechanomyography...
THE NORMALIZATION OF FINANCIAL DATA EXCHANGE OVER THE INTERNET: ADOPTING INTERNATIONAL STANDARD XBRL
Directory of Open Access Journals (Sweden)
Catalin Georgel Tudor
2009-05-01
Full Text Available The development of a common syntax for EDI (Electronic Data Interchange, XML (eXtensible Markup Language, opened new formalization perspectives for interorganizational data exchanges over the Internet. Many of the organizations involved in the normaliza
Displaced, Homeless and Abused: The Dynamics of Gender-Based ...
African Journals Online (AJOL)
based abuse (SPGBV) experienced by displaced Zimbabwean refugees, perpetrators of such abuses and the gender of perpetrators in South Africa. Refugee and Internally displaced persons are interchangeably used in this study. Through in-depth ...
Study Of Robotic Replacement Of Equipment Modules
Backes, Paul G.; Tso, Kam S.
1992-01-01
Report discusses issues pertaining to control of single-arm robotic manipulator to remove and install interchangeable equipment modules. Presents preliminary control strategy intended to guide development of control algorithms, along with analyses of problems arising in implementing strategy.
Tonnaer, F.; Cima, M.; Arntz, A.R.; Cima, M.
2016-01-01
Aggression, violence and deviant behavior are terms frequently used interchangeable, but relate to different theoretical concepts. Therefore, this chapter starts with a definition of aggression. Furthermore, several theories regarding the development of aggression will be presented. According to
Jet-quenching and correlations
Indian Academy of Sciences (India)
2015-05-06
May 6, 2015 ... pseudorapidity (ridge) correlations in small systems. Section 7 ... words of 'jet' and 'parton' are often used interchangeably. ...... [118] STAR Collaboration: Joshua Konzer, Poster presentation at Quark Matter 2012 (2012).
Factors that affect South African Reading Literacy Achievement ...
African Journals Online (AJOL)
Turner (1995) refers to motivation and cognitive engagement interchangeably as voluntary ..... Goldstein, 2009) to test for significant effects of aspects of aptitude, opportunity and ..... Educational Psychology Review,. 17(2):99-123. Howie SJ ...
Femoral venous oxygen saturation is no surrogate for central venous oxygen saturation
van Beest, Paul A.; van der Schors, Alice; Liefers, Henriëtte; Coenen, Ludo G. J.; Braam, Richard L.; Habib, Najib; Braber, Annemarije; Scheeren, Thomas W. L.; Kuiper, Michaël A.; Spronk, Peter E.
2012-01-01
Objective: The purpose of our study was to determine if central venous oxygen saturation and femoral venous oxygen saturation can be used interchangeably during surgery and in critically ill patients. Design: Prospective observational controlled study. Setting: Nonacademic university-affiliated
Precarious, informalizing, and flexible work: transforming concepts and new understandings
Arnold, D.; Bongiovi, J.R.
2013-01-01
There is a considerable body of academic and activist research that studies the prevalence of precariousness in contemporary societies. It goes by many names that are often interchangeable, including precarious work, precarity, informalization, and casualization. These are typically rooted in
2011-08-01
Traffic signal and high-mast poles are used by transportation agencies to control and illuminate intersections; their structural design is governed by national specifications. High-mast poles are luminaire supports located near highway interchanges t...
45 CFR 1150.1 - What definitions apply to the regulations in this part?
2010-10-01
..., a Sunday, or a Federal legal holiday. (f) Debt and claim are deemed synonymous and interchangeable... Samoa, Guam, the United States Virgin Islands, the Commonwealth of the Northern Marina Islands, or the...
78 FR 17748 - Notice of Final Federal Agency Actions on Proposed Highway in Utah
2013-03-22
... are 7:30 a.m. to 4:30 p.m. (Mountain Standard Time), Monday through Friday, except Federal holidays...; replacing the I-15 bridges over the Virgin River; converting the existing diamond interchange to a diverging...
25 CFR 513.1 - What definitions apply to the regulations in this part?
2010-04-01
..., Sunday, or Federal legal holiday. (g) Debt and claim are synonymous and interchangeable. They refer to.... Virgin Islands, the Commonwealth of the Northern Mariana Islands, or the Commonwealth of Puerto Rico. (h...
A Note on "Accuracy" and "Precision"
Stallings, William M.; Gillmore, Gerald M.
1971-01-01
Advocates the use of precision" rather than accuracy" in defining reliability. These terms are consistently differentiated in certain sciences. Review of psychological and measurement literature reveals, however, interchangeable usage of the terms in defining reliability. (Author/GS)
1996-11-01
This report describes the proceedings of the Workshop on Human Factors Research held in Reston, Virginia. The : objectives of the workshop were to: foster an interchange of experience in measuring and analyzing operator performance : data; encourage ...
National Research Council Canada - National Science Library
Jansen, Wayne
2001-01-01
.... One such category of technologies is active content. Broadly speaking, active content refers to electronic documents that, unlike past character documents based on the American Standard Code for Information Interchange (ASCII...
2018-06-14T11:55:43Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
... it is possible to use the words interchangeably, and still mean the same thing. ... employment, and normal internal entitlements for the citizens to such things as ... a resurgence of old infections with a virulence and velocity hard to compare.
Towards consensus in operational definitions in functional capacity evaluation: A Delphi survey
Soer, R.; Van Der Schans, C.; Groothoff, J.; Geertzen, J.; Reneman, M.
2009-01-01
Background: The problem of inconsistent terminology in Functional Capacity Evaluation (FCE) has been widely addressed in the international literature. Many different terms seem to be used interchangeably while other terms appear to be interpreted differently. Objective: To gain consensus in
19 CFR 143.44 - RLF procedure.
2010-04-01
... transactions, a customs broker or importer of record must direct the electronic payment of duties, taxes and... electronic data interchange system will be accepted for RLF. For a listing of entry types that may be filed...
Economic and quality of life impacts of route 21 freeway construction : final report, October 2009.
2009-10-01
Opened to traffic in December 2000, the missing section of the Route 21 Freeway in Clifton : and Passaic (Hope Ave. to the Route 46 Interchange) was designed utilizing the equivalent to : the Context Sensitive Solutions (CSS) approach at ...
75 FR 71613 - Mandatory Reliability Standards for Interconnection Reliability Operating Limits
2010-11-24
... Interconnection to relieve overloads on the facilities modeled in the Interchange Distribution Calculator (IDC... for other SOLs. But the Functional Model assigns a much broader role to the reliability coordinator to...
Normalization Of Thermal-Radiation Form-Factor Matrix
Tsuyuki, Glenn T.
1994-01-01
Report describes algorithm that adjusts form-factor matrix in TRASYS computer program, which calculates intraspacecraft radiative interchange among various surfaces and environmental heat loading from sources such as sun.
Process model repositories and PNML
Hee, van K.M.; Post, R.D.J.; Somers, L.J.A.M.; Werf, van der J.M.E.M.; Kindler, E.
2004-01-01
Bringing system and process models together in repositories facilitates the interchange of model information between modelling tools, and allows the combination and interlinking of complementary models. Petriweb is a web application for managing such repositories. It supports hierarchical process
Design and scope of impact of auxiliary lanes : technical report.
2014-06-01
For decades, Texas Department of Transportation districts have constructed auxiliary lanes to support interchange : ramp operations and to resolve congestion proximate to freeway entrance and exit ramps. While auxiliary lanes are : built throughout T...
Obtaining of supports macro and micro nutrients with base in zeolites mexicans
International Nuclear Information System (INIS)
Cordova H, A.; Islas M, M.; Bascunan S, C.; Martines G, M.; Nikolaev N, S.
2001-01-01
Study the effect of application of the zeolites modified by the ionico interchange with fertilizers (NPK), N-p in the production of tomatos. The cultive of tomatos was made in lands of the Benemerita Autonoma Universidad de Puebla, Mexico, taking equal quadrants with the following ground treatments: 1) zeolite interchanged with fertilizers, 2) zeolite interchanged with a solution that contained only N-p, 3) natural zeolite without ionica modification and a quadrant witness represented by the ground without treatment. The collected data show an increase in the harvest of tomatos, as well as the retention of the decomposition of the harvested tomatos. In addition, it determinated that the optimal concentrations in the case of the zeolite dealt with 3% of fertilizer NPK are: 0,91% of potassium and 0.61% of nitrogen. These results allow to suggest the use of zeolites modified by ionico interchange in agriculture to elevate the level of the harvests of the tomato [es
76 FR 9780 - Consumer Advisory Council; Notice of Meeting
2011-02-22
... place at the Federal Reserve Board's offices in Washington, DC, in Dining Room E on the Terrace Level of... stabilization strategies. Proposed rules regarding debit card interchange fees and routing Members will discuss...
2012-08-10
... electronic data interchange (EDI). Through the use of electronic funds transfers (EFT) for health care claim... care transactions results in higher use of EDI by health care providers.\\8\\ We expect usage of EFT and...
National Research Council Canada - National Science Library
Bridges, W
1997-01-01
...-IN). This report identifies the issues that DFAS-IN needs to resolve before it can pay transportation FAR contracts and presents an operating concept for paying those bills using electronic data interchange (EDI...
77 FR 72788 - Reduction of Use of Social Security Numbers in the Department of Defense
2012-12-06
... recommended replacing the SSN with the DoD Electronic Data Interchange Personal Identifier (EDI- PI... Number, the common name for the EDI-PI, is identified by both policies as the primary alternative for the...
GPM Level 3 IMERG Monthly 0.1 x 0.1 degree V03
National Aeronautics and Space Administration — This Directory Interchange Format (DIF) describes a collection of fields for the GPM Level 3 IMERG Final Monthly 0.1 x 0.1 degree V03 (GPM_3IMERGM) at the NASA...
Bag-model quantum chromodynamics for hyperons at low energy
International Nuclear Information System (INIS)
Weber, H.J.; Maslow, J.N.
1980-01-01
In a non-perturbative bag model framework, gluon exchange which mediates quark exchange scattering in conjunction with quark interchange is shown to be the basis of the OBE interactions of hyperons at low energy. (orig.)
General Forms of Wave Functions for Dipositronium, Ps2
Schrader, D.M.
2007-01-01
The consequences of particle interchange symmetry for the structure of wave functions of the states of dipositronium was recently discussed by the author [I]. In the present work, the methodology is simply explained, and the wave functions are explicitly given.
Author Correction: The physics of spreading processes in multilayer networks
De Domenico, Manlio; Granell, Clara; Porter, Mason A.; Arenas, Alex
2018-05-01
In the version of this Progress Article originally published, the left and right panels of Fig. 3, clarifying the details indicated within the centre panel, were mistakenly interchanged. This has now been corrected in all versions of the Progress Article.
Dambacher, F.; Sack, A.T.; Lobbestael, J.; Arntz, A.; Brugman, S.; Schuhmann, T.
2014-01-01
The ability to inhibit action tendencies is vital for adaptive human behaviour. Various paradigms are supposed to assess action inhibition and are often used interchangeably. However, these paradigms are based on different conceptualizations (action restraint vs. action cancellation) and the
48 CFR 213.270 - Use of the Governmentwide commercial purchase card.
2010-10-01
... exception for an electronic commerce/electronic data interchange system or operational requirement that... Medical Electronic Catalog Program are two examples where use of the purchase card may not be cost...
Boezen, M; Schouten, Jan; Rijcken, B; Vonk, J; Gerritsen, J; Hoek, G; Brunekreef, B; Postma, D
1998-01-01
Bronchial hyperresponsiveness (BHR) and peak expiratory flow (PEF) variability are associated expressions of airway lability, yet probably reflect different underlying pathophysiologic mechanisms. We investigated whether both measures can be used interchangeably to identify subjects who are
Martin, A P; Bermingham, E
2000-01-01
The lower Central American landscape was fully emergent approximately three million years ago, an event which marked the beginning of the Great American biotic interchange. Freshwater fishes participated in the biotic interchange. Because primary freshwater fishes are restricted to freshwater, they provide an excellent system for investigating the interplay of historical and recent processes on the assembly, structure and diversity of the regions' aquatic ecosystems. We focused on examining t...
An incremental approach to a secure e-commerce environment
2014-01-01
M.Sc. (Computer Science) The terms "Electronic Commerce" and "Internet Commerce" are often used interchangeably to mean similar processes. By definition, electronic commerce (e-commerce) means any exchange of information that occurs electronically. There are various types of electronic commerce transactions to name a few; electronic data interchange (EDI), fax, electronic funds transfer, interorganisational systems, technical data and document exchange, customer credit approval systems, in...
Definition of an automatic information retrieval system independent from the data base used
International Nuclear Information System (INIS)
Cunha, E.R.
1983-04-01
A bibliographic information retrieval system using data stored at the standardized interchange format ISO 2709 or ANSI Z39.2, is specified. A set of comands for interchange format manipulation wich allows the data access at the logical level, achieving the data independence, are used. A data base description language, a storage structure and data base manipulation comands are specified, using retrieval techniques which consider the applications needs. (Author) [pt
Using hybrid latent class model for city-HUBs´users behaviour analysis
Di Ciommo, Floridea; Monzón de Cáceres, Andrés; Oña, Rocío de; Oña López, Juan de; Hernández del Olmo, Sara
2014-01-01
Data from an attitudinal survey and stated preference ranking experiment conducted in two urban European interchanges (i.e. City-HUBs) in Madrid (Spain) and Thessaloniki (Greece) show that the importance that City-HUBs users attach to the intermodal infrastructure varies strongly as a function of their perceptions of time spent in the interchange (i.e.intermodal transfer and waiting time). A principal components analysis allocates respondents (i.e. city-HUB users) to two classes with substant...
Molecular Species of the Enzymatically Synthesized Polyunsaturated Fatty Acid Rich Triglyceride
長田, 恭一; 高橋, 是太郎; 羽田野, 六男; 細川, 雅史
1991-01-01
Enzymatic glyceride synthesis and acid interchange using icosapentaenoic acid (EPA), docosahexaenoic acid (DHA), γ-linolenic acid (GLA), and EPA and DHA concentrated saponified fatty acid mixture obtained from sardine oil were carried out through the use of four kinds of microbial lipases. Lipase TOYO (Chromobacterium viscosum) was the most effective enzyme for glyceride synthesis as well as acid interchange of triglyceride (TG) rich in polyunsaturated fatty acids. There was a general tendenc...
1985-01-01
brigade to battery inclusive. Interchangeability of all dry cells for all F. A. equipment. Kinds of projectiles fuzes and charges in use at...Battery, inclusive. Interchangeability of all dry cells used for all Field Artillery equipment. Kinds of projectiles and fuzes in use at present...obtaining horses of sufficient stamins and in sufficient numbers to properly handle the ammunition supply during combat, together with the serious
Studies of instabilities and waves in a mirror confined hot electron plasma
International Nuclear Information System (INIS)
Huang Chaosong; Qiu Lijian; Ren Zhaoxing
1989-01-01
The stability of hot electron plasmas is studied. The hot electron component can stabilize the low frequency drift wave and the interchange mode driven by the plasma, which depends only on α=N h /N i , the density ratio of the hot electrons to the plasma ions, but not on the beta value and the annular structure of the hot electrons. Stabilization of the drift wave occurs for α > 40%, and that of the interchange mode for α > 5%, which allows the prediction that the interchange mode can be suppressed in hot electron plasma experiments. The experiments have been conducted in a simple mirror machine. It is observed that the plasma drives a drift wave at 40 kHz and an interchange mode at about 100 kHz. The fluctuation amplitude of the drift wave is much higher than that of the interchange mode. The hot electrons reduce the density gradient, the fluctuation amplitude and the radial loss of the plasma. On the other hand, the hot electrons drive the interchange mode and drift wave in the ion cyclotron frequency region. The effects of a cold plasma on hot electron perturbations are discussed. (author). 10 refs, 6 figs
Communication growth in minimally verbal children with ASD: The importance of interaction.
DiStefano, Charlotte; Shih, Wendy; Kaiser, Ann; Landa, Rebecca; Kasari, Connie
2016-10-01
Little is known about language development in children with Autism Spectrum Disorders (ASD) who remain minimally verbal past age 5. While there is evidence that children can develop language after age 5, we lack detailed information. Studies of this population generally focus on discrete language skills without addressing broader social-communication abilities. As communication and social deficits are both inherent to ASD, an examination of not only what language skills are acquired, but how those skills are used in interactions is relevant. Research in typical development has examined how communication interchanges (unbroken back-and-forth exchanges around a unified purpose) develop, which can be used as a framework for studying minimally verbal children. This study examined the interchange use by 55 children with ASD over the course of a 6-month play and engagement-based communication intervention. Half of the children received intervention sessions that also incorporated a speech-generating device (SGD). Interchanges were coded by: frequency, length, function, and initiator (child or adult). Results indicated that children initiated a large proportion of interchanges and this proportion increased over time. The average length and number of interchanges increased over time, with children in the SGD group showing even greater growth. Finally, children's total number of interchanges at baseline was positively associated with their spoken language gains over the course of intervention. This study supports the crucial relationship between social engagement and expressive language development, and highlights the need to include sustained communication interchanges as a target for intervention with this population. Autism Res 2016, 9: 1093-1102. © 2016 International Society for Autism Research, Wiley Periodicals, Inc. © 2016 International Society for Autism Research, Wiley Periodicals, Inc.
Sato, Aya; Suematsu, Takuma; Aihara, Koh-Ki; Kita, Kiyoshi; Suzuki, Tsutomu; Watanabe, Kimitsuna; Ohtsuki, Takashi; Watanabe, Yoh-Ichi
2017-03-07
Translation elongation factor Tu (EF-Tu) delivers aminoacyl-tRNA (aa-tRNA) to ribosomes in protein synthesis. EF-Tu generally recognizes aminoacyl moieties and acceptor- and T-stems of aa-tRNAs. However, nematode mitochondrial (mt) tRNAs frequently lack all or part of the T-arm that is recognized by canonical EF-Tu. We previously reported that two distinct EF-Tu species, EF-Tu1 and EF-Tu2, respectively, recognize mt tRNAs lacking T-arms and D-arms in the mitochondria of the chromadorean nematode Caenorhabditis elegans C. elegans EF-Tu2 specifically recognizes the seryl moiety of serylated D-armless tRNAs. Mitochondria of the enoplean nematode Trichinella possess three structural types of tRNAs: T-armless tRNAs, D-armless tRNAs, and cloverleaf tRNAs with a short T-arm. Trichinella mt EF-Tu1 binds to all three types and EF-Tu2 binds only to D-armless Ser-tRNAs, showing an evolutionary intermediate state from canonical EF-Tu to chromadorean nematode (e.g. C. elegans ) EF-Tu species. We report here that two EF-Tu species also participate in Drosophila melanogaster mitochondria. Both D. melanogaster EF-Tu1 and EF-Tu2 bound to cloverleaf and D-armless tRNAs. D. melanogaster EF-Tu1 has the ability to recognize T-armless tRNAs that do not evidently exist in D. melanogaster mitochondria, but do exist in related arthropod species. In addition, D. melanogaster EF-Tu2 preferentially bound to aa-tRNAs carrying small amino acids, but not to aa-tRNAs carrying bulky amino acids. These results suggest that the Drosophila mt translation system could be another intermediate state between the canonical and nematode mitochondria-type translation systems. © 2017 The Author(s); published by Portland Press Limited on behalf of the Biochemical Society.
International Nuclear Information System (INIS)
Foureman, P.A.
1986-01-01
Little is known about the relative frequency of induction of nondisjunction in the first and second divisions of meiosis. The killer of prune system is a semiselective Drosophila aneuploidy assay designed to detect chromosome gain resulting from first- or second-division nondisjunction in males. The system can also detect X-Y interchange. Extensive data from nonmutagenized controls indicate that all the expected phenotypes can be recovered. Spontaneous nondisjunction in the first division is three times more frequent than in the second division. Spontaneous interchange between the X chromosome and YS is six times more frequent than between the X chromosome and YL. Exposures of larval males to X-rays, 35 degrees C heat shock, and colchicine were performed. X-ray exposure induced an increase in X-Y interchange events only. A 24-hr heat shock induced an increase in first-division nondisjunction and one type of interchange event. Colchicine failed to induce both nondisjunction and interchange, although it did decrease fertility. The Killer of prune test is of potential value because it allows for the assessment of the relative sensitivities of the two meiotic divisions to perturbations in chromosome number
Dynamics of Coronal Hole Boundaries
Energy Technology Data Exchange (ETDEWEB)
Higginson, A. K.; Zurbuchen, T. H. [Department of Climate and Space Sciences and Engineering, University of Michigan, Ann Arbor, MI 48109 (United States); Antiochos, S. K.; DeVore, C. R. [Heliophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Wyper, P. F. [Universities Space Research Association, NASA Goddard Space Flight Center, 8800 Greenbelt Road, Greenbelt, MD 20771 (United States)
2017-03-10
Remote and in situ observations strongly imply that the slow solar wind consists of plasma from the hot, closed-field corona that is released onto open magnetic field lines. The Separatrix Web theory for the slow wind proposes that photospheric motions at the scale of supergranules are responsible for generating dynamics at coronal-hole boundaries, which result in the closed plasma release. We use three-dimensional magnetohydrodynamic simulations to determine the effect of photospheric flows on the open and closed magnetic flux of a model corona with a dipole magnetic field and an isothermal solar wind. A rotational surface motion is used to approximate photospheric supergranular driving and is applied at the boundary between the coronal hole and helmet streamer. The resulting dynamics consist primarily of prolific and efficient interchange reconnection between open and closed flux. The magnetic flux near the coronal-hole boundary experiences multiple interchange events, with some flux interchanging over 50 times in one day. Additionally, we find that the interchange reconnection occurs all along the coronal-hole boundary and even produces a lasting change in magnetic-field connectivity in regions that were not driven by the applied motions. Our results show that these dynamics should be ubiquitous in the Sun and heliosphere. We discuss the implications of our simulations for understanding the observed properties of the slow solar wind, with particular focus on the global-scale consequences of interchange reconnection.
Radiation-induced chromosome breakages in bread wheat (Triticum aestivum L.)
International Nuclear Information System (INIS)
Larik, A.S.
1975-01-01
Meiosis and pollen fertility were studied in the M 2 generation in four varieties of hexaploid wheat. Meiosis was characterized by the formation of interchange configurations, such as rings and chains of four chromosomes in several cells. Chromosomal aberrations showed linear relationship with gamma irradiation; 45 kR dose induced the highest chromosomal abnormalities. Most multivalents were interchange rings of four chromosomes. Translocations involving two pairs of homologous or nonhomologous chromosomes seemed to be higher in frequency than those involving more than two pairs of chromosomes. Anaphase abnormalities, such as laggards, bridges and fragments and unequal segregation of chromosomes, were frequently observed. Pollen fertility was considerably reduced in the M 2 plants arising form the treatments of higher doses of gamma rays because of the induced chromosome interchanges. (author)
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
The R and D were conducted on the standardization for interoperability of optical disk system, and the FY 1999 results were summarized. In the study, for the volume/file structure specified by ISO/IEC 13346, the development of standards was made for interoperation of the UDF specified by OSTA. In this fiscal year, to avoid the problem on non-interchangeability of UDF which actually exists, enhancement of functions of a test tool for UDF interchangeability was tried. Namely, development was carried out of UDF interchangeability test tool, UAF related standards, and UAF related standards assessment system. Especially, it was formally announced that UDF security enhancement of UAF related standards will be included in UDF2.x in the OSTA conference held at the end of FY 1999. Also, a draft on the standard information was drawn up domestically. The standards including API are expected to be established as standards through activities in the next fiscal year. (NEDO)
Brodszky, Valentin; Rencz, Fanni; Péntek, Márta; Baji, Petra; Lakatos, Péter L; Gulácsi, László
2016-01-01
To estimate the budget impact of the introduction of biosimilar infliximab for the treatment of Crohn's disease (CD) in Bulgaria, the Czech Republic, Hungary, Poland, Romania and Slovakia. A 3-year, prevalence-based budget impact analysis for biosimilar infliximab to treat CD was developed from third-party payers' perspective. The model included various scenarios depending on whether interchanging originator infliximab with biosimilar infliximab was allowed or not. Total cost savings achieved in biosimilar scenario 1 (interchanging not allowed) and BSc2 (interchanging allowed in 80% of the patients) were estimated to €8.0 million and €16.9 million in the six countries. Budget savings may cover the biosimilar infliximab therapy for 722-1530 additional CD patients. Introduction of biosimilar infliximab to treat CD may offset the inequity in access to biological therapy for CD between Central and Eastern European countries.
Ring power balance observing plasma stability constraints
International Nuclear Information System (INIS)
Campbell, R.B.; Logan, B.G.
1982-01-01
Ring power balance is performed for an E-ring stabilized tandem mirror reactor, taking into account constraints imposed by plasma stability. The two most important criteria are the stability of the core interchange and hot electron interchange modes. The former determines the ring thickness, the latter determines the minimum hot electron temperature; both quantities are important for power balance. The combination of the hot electron interchange constraint and the fact that the barrier density is low places the operating point on the synchrotron dominated branch of power balance. The reference case considered here requires a reasonable 34 MW of heating power deposited in the rings. We also have examined the sensitivity of the required ring power on uncertainties in the numerical coefficients of the stability constraints. We have found that the heating power is strongly affected
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
The R and D were conducted on the standardization for interoperability of optical disk system, and the FY 1999 results were summarized. In the study, for the volume/file structure specified by ISO/IEC 13346, the development of standards was made for interoperation of the UDF specified by OSTA. In this fiscal year, to avoid the problem on non-interchangeability of UDF which actually exists, enhancement of functions of a test tool for UDF interchangeability was tried. Namely, development was carried out of UDF interchangeability test tool, UAF related standards, and UAF related standards assessment system. Especially, it was formally announced that UDF security enhancement of UAF related standards will be included in UDF2.x in the OSTA conference held at the end of FY 1999. Also, a draft on the standard information was drawn up domestically. The standards including API are expected to be established as standards through activities in the next fiscal year. (NEDO)
Demonstration of Hydrogen Energy Network and Fuel Cells in Residential Homes
International Nuclear Information System (INIS)
Hirohisa Aki; Tetsuhiko Maeda; Itaru Tamura; Akeshi Kegasa; Yoshiro Ishikawa; Ichiro Sugimoto; Itaru Ishii
2006-01-01
The authors proposed the setting up of an energy interchange system by establishing energy networks of electricity, hot water, and hydrogen in residential homes. In such networks, some homes are equipped with fuel cell stacks, fuel processors, hydrogen storage devices, and large storage tanks for hot water. The energy network enables the flexible operation of the fuel cell stacks and fuel processors. A demonstration project has been planned in existing residential homes to evaluate the proposal. The demonstration will be presented in a small apartment building. The building will be renovated and will be equipped with a hydrogen production facility, a hydrogen interchange pipe, and fuel cell stacks with a heat recovery device. The energy flow process from hydrogen production to consumption in the homes will be demonstrated. This paper presents the proposed energy interchange system and demonstration project. (authors)
Ion exchange of Cobalt and Cadmium in Zeolite X
International Nuclear Information System (INIS)
Nava M, I.
1994-01-01
The growing development in the industry has an important contribution to the environmental damage, where the natural effluents are each day more contaminated by toxic elements, such as: mercury, chromium, lead and cadmium. So as to separate such elements it has sorbent must have enough stability, and have a sharp capacity of sorption. In this work it was studied the sorption behavior of cobalt and on the other hand, cadmium in aqueous solutions, which along with sodic form of the Zeolite X, undergoes a phenomenon of ionic interchange. Such interchange was verify to different concentration of cadmium, cobalt and hydronium ion. The content of cobalt and sodium in the interchanged samples was detected through the neutronic activation analysis. The results disclose a higher selectivity for cadmium than cobalt. (Author)
Babinet's principle in double-refraction systems
Ropars, Guy; Le Floch, Albert
2014-06-01
Babinet's principle applied to systems with double refraction is shown to involve spatial interchanges between the ordinary and extraordinary patterns observed through two complementary screens. As in the case of metamaterials, the extraordinary beam does not follow the Snell-Descartes refraction law, the superposition principle has to be applied simultaneously at two points. Surprisingly, by contrast to the intuitive impression, in the presence of the screen with an opaque region, we observe that the emerging extraordinary photon pattern, which however has undergone a deviation, remains fixed when a natural birefringent crystal is rotated while the ordinary one rotates with the crystal. The twofold application of Babinet's principle implies intensity and polarization interchanges but also spatial and dynamic interchanges which should occur in birefringent metamaterials.
Radiation induced pseudoisochromosomes in sunn hemp (Crotalaria juncea L.)
International Nuclear Information System (INIS)
Gupta, P.K.; Gupta, Rani
1978-01-01
In a population of sunn hemp (C. juncea), irradiated with gamma rays (30 Kr), a single plant was found to exhibit the presence of two ring univalents in 75.5% pollen mother cells. This was interpreted as a result of an interchange between the opposite arms of two homologous chromosomes giving rise to pseudoisochromosomes. In few other cells, four univalents and a single quadrivalent were also observed, thus indicating that two other interchanges involved very small segments, one of them between homologous chromosomes and the other between non-homologous chromosomes. (auth.)
Portability and the National Energy Software Center
International Nuclear Information System (INIS)
Butler, M.K.
1978-01-01
The software portability problem is examined from the viewpoint of experience gained in the operation of a software exchange and information center. First, the factors contributing to the program interchange to date are identified, then major problem areas remaining are noted. The import of the development of programing language and documentation standards is noted, and the program packaging procedures and dissemination practices employed by the Center to facilitate successful software transport are described. Organization, or installation, dependencies of the computing environment, often hidden from the program author, and data interchange complexities are seen as today's primary issues, with dedicated processors and network communications offering an alternative solution
A novel approach for UI charge reduction using AMI based load prioritization in smart grid
Directory of Open Access Journals (Sweden)
Avani Pujara
2017-09-01
Full Text Available System frequency is vital part for power system balance. As per India Electricity Grid code frequency should be in the range of 49.5 Hz–50.5 Hz. Deviation from above mentioned range is charged as Unscheduled Interchange (UI charge. This paper proposes a new method for load and frequency control based on control of third parameter of three-part Availability Based Tariff (ABT i.e. Unscheduled Interchange charges. New circuit is designed considering prioritization of load and using Advanced Metering Infrastructure (AMI under Smart Grid environment.
Plastic Clashes: Competition among Closed and Open Systems in the Credit Card Industry.
Fabio M. Manenti; Ernesto Somma
2002-01-01
This paper analyses market competition between two different types of credit card platforms: not-for-profit associations and proprietary systems. The main focus is on the role of the interchange fee set by not-for-profit platforms. We show that when the interchange fee is set so as to maximise the sum of issuers' and acquirers' profits, the equilibrium values of platforms' profits, of the sum of the fees charged by each platform and their market shares are independent of the competitive condi...
Directory of Open Access Journals (Sweden)
Rahmawati Rahmawati
2012-11-01
Full Text Available Developments and changes in a language occur because of changes in social, economic and cultural. The interchange between a language to another language is unavoidable. Interchange between language must have happened, for example, in vocabulary. Interference is a language error caused by the tendency of bias pronunciation (speech of a language to another language. This paper describes about interference between Indonesian to Arabic in several aspects of language such as sounds (phonology, grammar forms of words (morphology, syntax (syntax, vocabulary (lexicon, grammar meaning (semantics, and culture .
Resistive instabilities in general toroidal plasma configurations
International Nuclear Information System (INIS)
Glasser, A.H.; Greene, J.M.; Johnson, J.L.
1975-01-01
Previous work by Johnson and Greene on resistive instabilities is extended to finite-pressure configurations. The Mercier criterion for the stability of the ideal magnetohydrodynamic interchange mode is rederived, the generalization of the earlier stability criterion for the resistive interchange mode is obtained, and a relation between the two is noted. Conditions for tearing mode instability are recovered with the growth rate scaling with the resistivity in a more complicated manner than eta 3 / 5 . Nyquist techniques are used to show that favorable average curvature can convert the tearing mode into an overstable mode and can often stabilize it
Radiation induced pseudoisochromosomes in sunn hemp (Crotalaria juncea L. )
Energy Technology Data Exchange (ETDEWEB)
Gupta, P K; Gupta, R [Meerut Univ. (India). Inst. of Advanced Studies
1978-01-01
In a population of sunn hemp (C. juncea), irradiated with gamma rays (30 Kr), a single plant was found to exhibit the presence of two ring univalents in 75.5% pollen mother cells. This was interpreted as a result of an interchange between the opposite arms of two homologous chromosomes giving rise to pseudoisochromosomes. In few other cells, four univalents and a single quadrivalent were also observed, thus indicating that two other interchanges involved very small segments, one of them between homologous chromosomes and the other between non-homologous chromosomes.
Logistics of in-wood chipping and trucking of chips; Palstahaketuksen logistinen ketju
Energy Technology Data Exchange (ETDEWEB)
Nuuja, J. [Joensuu Univ. (Finland). Faculty of Forestry; Asikainen, A. [Metsaeosaamiskeskus, Joensuu (Finland). Joensuu Science Park
1996-12-31
In this study a in wood chipper and truck transport of chips were modelled and studied by discrete-event simulation. The input data, which included stand characteristics and information about transport distances was compiled by GRASS-program. This data based on the inventory done by Forestry Center TAPIO. With the model various transport alternatives were compared and the effect of work condition factors were studied. It was find out, that a long distance transport with interchangeable container truck gives better productivity than a truck with a trailer. This results from shorter loading time for the interchangeable container truck
Logistics of in-wood chipping and trucking of chips; Palstahaketuksen logistinen ketju
Energy Technology Data Exchange (ETDEWEB)
Nuuja, J [Joensuu Univ. (Finland). Faculty of Forestry; Asikainen, A [Metsaeosaamiskeskus, Joensuu (Finland). Joensuu Science Park
1997-12-31
In this study a in wood chipper and truck transport of chips were modelled and studied by discrete-event simulation. The input data, which included stand characteristics and information about transport distances was compiled by GRASS-program. This data based on the inventory done by Forestry Center TAPIO. With the model various transport alternatives were compared and the effect of work condition factors were studied. It was find out, that a long distance transport with interchangeable container truck gives better productivity than a truck with a trailer. This results from shorter loading time for the interchangeable container truck
Curvature effects in the nonlinear growth of the cylindrical tearing mode
International Nuclear Information System (INIS)
Somon, J. P.
1984-01-01
The full set of the usual resistive massless equations is used to investigate the nonlinear growth of the helical perturbation to a cylindrical equilibrium with tokamak ordering. There is a curvature dependant critical magnetic island width xsub(T)sup(*) α set containing D/Δ' above which the Rutherford solution is recovered for the tearing mode as well as for the linear slow interchange modes with Δ' > 0. Non linearity stabilizes at this critical width the linearly unstable slow interchange modes with Δ' > 0
Thermodynamics of Binary Mixed Crystals in the Sub-quasi-chemical/Debye Approximation
van der Kemp, W. J. M.; Verdonk, M. L.
1995-03-01
A new statistical model for the description of the thermodynamic properties of binary mixed crystals is discussed. The model is based on an asymmetrical analogue of the quasi-chemical approximation and the Debye model of a solid. With two interchange -energy parameters and two interchange-Debye-temperature parameters, all important thermodynamic functions, at constant volume, of the binary mixed crystal can be calculated as a function of temperature and composition. The binary system {( 1 - x)Nai + xKI}(s) is used for illustration of the model.
International Nuclear Information System (INIS)
Moreira, R.M.; Sabino, C.S.V.; Macedo, W.A.
1996-01-01
Three transport mechanisms control the contaminant migration in saturated soils: advection, diffusion and interchanges between liquid and solid phases. These interchanges define the retention by the soil and the contaminant delay related to the liquid phase flow. Therefore, the knowledge of the adsorption/desorption characteristics of the solute in solid surfaces is fundamental for the evaluation of toxic agent releases to the compartment soil. This communication reports the study which is being performed by the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) in this area, particularly with cesium and mercury by using X-ray absorption spectroscopy for contaminants migration
International Nuclear Information System (INIS)
Rodriguez M, F.J.; Galotto Lopez, M.J.; Guarda M, A.
2009-01-01
The aim of this work was synthesized organo clays using different methodologies oriented to improve the cationic interchange between montmorillonite and organic salts. Thermal and thermal-ultrasonic methods were studied. According to obtained results, the ultrasonic application improved the interchange between organic ammonium and sodium ion of the clay. On the other hand, an important effect of molecular weight of organic surfactant was observed. Formation of organo clays was evidenced through ray-X diffraction (RXD), thermogravimetric analysis (TGA) and Fourier transform infrared spectroscopy (FTIR). (author)