Directory of Open Access Journals (Sweden)
Javier Antonio Escobar-Pérez
2014-04-01
Full Text Available Introducción. USA300 es un linaje genético que se encuentra en aislamientos de Staphylococcus aureus sensibles (SASM y resistentes a meticilina (SARM. Actualmente, en Colombia las infecciones por SARM en hospitales y en la comunidad son causadas principalmente por un clon con genotipo comunitario (SARM-GC relacionado genéticamente con el clon USA300. El origen de esta variante es aún desconocido. Objetivo. Identificar y caracterizar aislamientos de S. aureus resistentes y sensibles a meticilina con el fin de aportar información para establecer un posible origen de los aislamientos SARM-GC en Colombia. Materiales y métodos. Se realizó una caracterización de aislamientos SASM relacionados con el clon USA300 detectados a partir de un análisis de 184 aislamientos de S. aureus (90 SARM y 94 SASM causantes de infecciones. La relación genética de los aislamientos se determinó por electroforesis en gel de campo pulsado (PFGE, tipificación de secuencias multilocus (MLST y tipificación del gen de la proteína A (spa. Resultados. De los 184 aislamientos, 27 (14,7 % presentaron características moleculares y relación genética con el clon USA300, y de ellos, 18 fueron SARM y nueve fueron SASM. Todos los aislamientos SARM relacionados con este clon albergaban un casete estafilocócico cromosómico mec (SCCmec IVc (3.1.2. En ningún aislamiento SASM se detectaron secuencias remanentes de SCCmec o una duplicación del sitio attB que evidenciaran la pérdida del casete. Conclusión. El origen de los aislamientos SARM-GC en Colombia probablemente se encuentre en la diseminación de clones SASM relacionados con el clon USA300 que adquirieron el SCCmec IVc posteriormente.
ClonEvol: clonal ordering and visualization in cancer sequencing.
Dang, H X; White, B S; Foltz, S M; Miller, C A; Luo, J; Fields, R C; Maher, C A
2017-12-01
Reconstruction of clonal evolution is critical for understanding tumor progression and implementing personalized therapies. This is often done by clustering somatic variants based on their cellular prevalence estimated via bulk tumor sequencing of multiple samples. The clusters, consisting of the clonal marker variants, are then ordered based on their estimated cellular prevalence to reconstruct clonal evolution trees, a process referred to as 'clonal ordering'. However, cellular prevalence estimate is confounded by statistical variability and errors in sequencing/data analysis, and therefore inhibits accurate reconstruction of the clonal evolution. This problem is further complicated by intra- and inter-tumor heterogeneity. Furthermore, the field lacks a comprehensive visualization tool to facilitate the interpretation of complex clonal relationships. To address these challenges we developed ClonEvol, a unified software tool for clonal ordering, visualization, and interpretation. ClonEvol uses a bootstrap resampling technique to estimate the cellular fraction of the clones and probabilistically models the clonal ordering constraints to account for statistical variability. The bootstrapping allows identification of the sample founding- and sub-clones, thus enabling interpretation of clonal seeding. ClonEvol automates the generation of multiple widely used visualizations for reconstructing and interpreting clonal evolution. ClonEvol outperformed three of the state of the art tools (LICHeE, Canopy and PhyloWGS) for clonal evolution inference, showing more robust error tolerance and producing more accurate trees in a simulation. Building upon multiple recent publications that utilized ClonEvol to study metastasis and drug resistance in solid cancers, here we show that ClonEvol rediscovered relapsed subclones in two published acute myeloid leukemia patients. Furthermore, we demonstrated that through noninvasive monitoring ClonEvol recapitulated the emerging subclones
Javier Antonio Escobar; Ingrid Tatiana Gómez; Martha Johanna Murillo; Betsy Esperanza Castro; Bibiana Chavarro; Ricaurte Alejandro Márquez; Natasha Vanegas
2012-01-01
Introducción. Los aislamientos de Staphylococcus aureus resistente a la meticilina asociado a la comunidad (SARM-AC), están aumentando la frecuencia de infecciones en personas sanas de la comunidad y en pacientes hospitalizados. En Colombia y en la región andina estos aislamientos tienen un componente genético relacionado con el clon pandémico USA300. Objetivo. Diseñar y estandarizar dos metodologías para la diferenciación rápida de aislamientos colombianos de S. aureus resistente a la me...
Directory of Open Access Journals (Sweden)
Maria Teresa Reguero
2014-07-01
Full Text Available Título en español: Análisis genómico del resistoma de la cepa de Acinetobacter baumannii ABIBUN 107m multi-resistente y persistente en hospitales colombianos Título en ingles: Genomic analysis of the resistoma of the strain of Acinetobacter baumannii ABIBUN 107m multi-resistant and persistent in Colombian hospitals Título corto: Análisis genómico del resistoma de la cepa de Acinetobacter baumannii Resumen: Acinetobacter baumannii es una bacteria, causante de infecciones asociadas a la atención en salud como neumonía, septicemia, meningitis e infecciones urinarias entre otras. Se caracteriza por su capacidad para desarrollar y acumular rápidamente una gran variedad de mecanismos de resistencia a antibióticos. En esta investigación se realizó el análisis genómico de una cepa de A. baumannii ABIBUN 107m que forma parte de un clon persistente en hospitales colombianos, resistente a los antibióticos carbapenémicos (imipenem y meropenem, antibióticos de elección en el tratamiento infecciones causadas por este microorganismo. El genoma de esta bacteria fue secuenciado utilizando técnicas de alto rendimiento, ensamblado y anotado, obteniéndose un genoma constituido por 3954000 pb con 56 contigs; consta de 4256 genes con un tamaño promedio de 912 pb; 3796 CDS de los cuales por anotación 2884 se asignaron a COG; 57 tRNA y un porcentaje de GC de 38,74%. A. baumannii ABIBUN 107m es resistente a b-lactámicos, aminoglicósidos, quinolonas, tetraciclina, sulfonamida y colistina. En su genoma se localizaron genes asociados con el perfil de resistencia ya que presenta serin b-lactamasas (blaADC-38, blaOXA-64, blaOXA-23, blaampC-like, blaamp(H-like, metalo b-lactamasa_B; proteínas de unión a penicilina de elevada masa molecular, secuencias de inserción tipo ISAba1; mutaciones en los genes de DNA girasa y topoisomerasa IV subunidad A (gyrA y parC; enzimas modificadoras de aminoglicósidos (aph
Directory of Open Access Journals (Sweden)
C. H. Rodriguez
2009-09-01
Full Text Available Entre junio y diciembre de 2004 se estudiaron 33 aislamientos de Acinetobacter baumannii resistentes a los carbapenemes, aislados de materiales clínicos de 29 pacientes internados en la unidad de cuidados intensivos del Hospital de Clínicas de la Universidad de Buenos Aires. La distribución clonal de esos aislamientos fue la siguiente: clon I (n = 14, clon IV (n = 7, clon III (n = 6, clon VI (n = 3, clon II (n = 2 y clon X (n = 1.Veintiún aislamientos se recuperaron de materiales del tracto respiratorio inferior, 11 de ellos pertenecieron al clon I. Casi todos los aislamientos pertenecientes al clon III (5/6 se recuperaron de materiales no respiratorios, y todos los del clon IV se recuperaron de pacientes que no recibieron imipenem. En los aislamientos pertenecientes a los clones I y III se observó una mayor adherencia a catéteres, principalmente en los asociados con bacteriemias. La mayoría de los aislamientos de los clones I y IV sobrevivieron en materiales inertes durante un período superior a los 5 días. La totalidad de los aislamientos del clon III fueron sensibles a colistina, gentamicina y levofloxacina, mientras que los del clon I y la mayoría de los del clon IV sólo fueron sensibles a colistina y tetraciclinas.From June to December 2004, thirty-three carbapenem-resistant Acinetobacter baumannii isolates recovered from twenty nine patients at the intensive care unit in Hospital de Clínicas, Universidad de Buenos Aires, were studied. The isolates were categorized by molecular methods as: clone I (n = 14, clon IV (n = 7, clone III (n = 6, clone VI (n = 3, clone II (n = 2 and clone X (n = 1. Twenty one isolates were recovered from lower respiratory tract samples, 11 of which belonged to clon I. Clone III isolates were mainly recovered from non-respiratory samples (5/6. Clone IV isolates were recovered from patients not receiving previous imipenem therapy. The majority of the isolates belonging to clones I and IV were able to
Directory of Open Access Journals (Sweden)
José Leon Bernardo
1998-05-01
Full Text Available RESUMO: Os autores descrevem um caso clinic de tuberculose multi-resistente num doente recluse, toxicodependente e com SIDA que se encontrava sob terapêutiea antibacilar em virtude de anterior episodin de tuberculose âsendivelâ.Comentam alguns aspectos relacionadus com o diagnostic, tratamento e evoução exógena por estirpe multi-resistente.Em conclusão, us autores salientam o interesse do DNA âfingerprintingâ no diagnostic e epidemiologia da tuberculose multi-resistente e a necessidade de implementação de um efectivo programa de luta contra a tuberculose multi-resistente na comunidade prisional.REV PORT PNEUMOL 1998; IV (3: 319-325 ARSTRACT: A case of multidrug-resistant tuberculosis in a drug-addicted and jailed patient with AIDS is reported. The patient was in anti-tuberculosis therapy, because a question of ongoing âsensitiveâ tuberculosis.The authors comment some aspects of the clinical management of the patient. Exogenous reinfection with a multidrug-resistant strain was convincelly demonstrated with DNA fingerprinting.The relevance of DNA fingerprinting in the diagnosis and epidemiology of multidrug-resistant tuberculosis is emphasized and the reformulation of the anti-tuberculosis programme in the prisional setting is warranted, in the face of ongoing transmissionREV PORT PNEUMOL 1998; IV (3: 319-325 Palavras-chave: Tuberculose multirresistente, RFLP, Key-words: Multidrug-resistant tuberculosis (MDR-TB, RELP
Directory of Open Access Journals (Sweden)
Javier Antonio Escobar
2012-06-01
Full Text Available Introducción. Los aislamientos de Staphylococcus aureus resistente a la meticilina asociado a la comunidad (SARM-AC, están aumentando la frecuencia de infecciones en personas sanas de la comunidad y en pacientes hospitalizados. En Colombia y en la región andina estos aislamientos tienen un componente genético relacionado con el clon pandémico USA300. Objetivo. Diseñar y estandarizar dos metodologías para la diferenciación rápida de aislamientos colombianos de S. aureus resistente a la meticilina asociado a la comunidad de los asociados al hospital (SARM-AH. Materiales y métodos. Se estandarizaron dos metodologías moleculares para la identificación de aislamientos de S. aureus resistente a la meticilina asociado a la comunidad. La primera se basa en la digestión diferencial con tres enzimas de restricción de los genes cinasa de carbamato (arcC y cinasa de guanilato (gmk para los tipos de secuencia 5 (ST5 y 8 (ST8, correspondientes a aislamientos de S. aureus resistente a la meticilina asociado al hospital y asociado a la comunidad, respectivamente. La segunda se basa en la amplificación por reacción en cadena de la polimerasa de cinco factores de virulencia que se encuentran de manera diferencial en estos aislamientos. Las dos metodologías fueron validadas en 237 aislamientos clínicos de S. aureus resistente a la meticilina. Resultados. Con la primera metodología se identificaron el 100 % y 93,2 % de los aislamientos de S. aureus resistente a la meticilina asociado a la comunidad y asociado al hospital, respectivamente. Con la segunda metodología se identificaron correctamente los dos tipos de aislamientos. Conclusiones. Estas dos metodologías son una buena alternativa en términos de ahorro en tiempo y dinero comparadas con otras técnicas, como la electroforesis en campo pulsado y la tipificación de secuencias multilocus para la rápida identificación de aislamientos de S. aureus resistente a la meticilina asociado a la
Directory of Open Access Journals (Sweden)
Sandra Carolina Firacative Ropero
2006-01-01
resistentes a tetraciclina y cloranfenicol, estuvieron relacionados con el patrón electroforético A (n=32 y los subtipos A16 (n=1 y A28 (n=1, caracterizados por presentar una banda de 340 Kb, al igual que el clon. Estos resultados muestran la prevalencia y circulación continua de aislamientos de S. pneumoniae serotipo 5, los cuales están genéticamente relacionados con el clon 19-Colombia.
Directory of Open Access Journals (Sweden)
Manterola, J.
1968-09-01
Full Text Available A structure, as a whole, consists of an organised set of material parts, whose structural significance depends both on their topological nature and on the external forces acting on them. This duality, that is typical of a structure, is related on the one hand to the structural forms that man can construct, and on the other to progressive adaptation of the structural topology to the external forces acting on it. The integrated study of the constructive process and of the theory of structures does not exhaust the problem of structures. The characteristics of the materials are still to be considered. The effect of these three factors on the cost depends on the dynamic evolution of these factors themselves: their importance being greater or smaller according to the evolutionary stage that is considered and the purpose of the structure. Furthermore, the structural significance of an object is influenced by the changes in the surrounding structural elements. Thus, a form, whose development might be determined strictly by structural motives at a given period, at another stage may no longer depend on structural factors. Hence structure is only a relative concept.En la estructura resistente, tomada como un todo, subyace una organización de elementos materiales, cuyo valor de posición viene condicionado tanto por las condiciones mecánicas de trabajo resistente que se establece entre ellas como por la posibilidad de manejar y colocar en su sitio el peso y volumen que determinan. Esta partición, contenido mismo de lo estructural, nos remite, por un lado, a las condiciones variables en que se concretan las posibilidades energéticas de la humanidad, y por otro, sitúa la estructura enfrentada a las acciones exteriores en una serie de etapas intermedias que para ser resistidas va a ser construida, lo que le proporciona la operatividad que reside en todo proceso de crecimiento. La integración del proceso constructivo y la teoría de lo resistente no agota
Directory of Open Access Journals (Sweden)
Carolina Firacative
2006-06-01
Full Text Available Introducción. Streptococcus pneumoniae serotipo 5 es causa importante de enfermedad invasora en Colombia, donde se ha demostrado la circulación del clon 19-Colombia(5 susceptible a penicilina pero resistente a tetraciclina y a cloranfenicol. Objetivo. Establecer las relaciones genéticas de aislamientos invasores colombianos de S. pneumoniae serotipo 5 recuperados entre 1994 y 2004 con el clon 19-Colombia(5. Materiales y métodos. Se estudiaron 83 aislamientos que tenían datos de susceptibilidad a penicilina, vancomicina, ceftriaxona, eritromicina, trimetoprim sulfametoxazol, cloranfenicol y tetraciclina, de los cuales 29 fueron obtenidos de niños menores de cinco años. El patrón de restricción del ADN se determinó por electroforesis en gel de campo pulsado, usando la enzima Sma I. La similitud genética entre los aislamientos y el clon se estableció según los criterios de Tenover y utilizando el programa Fingerprinting II. Resultados. Todos los aislamientos se relacionaron con el clon 19-Colombia5 y se agruparon en el patrón electroforético A con 17 subtipos. El patrón A se estableció en 32 aislamientos (38,6%, el A8 en 18 (21,7% y el A5 en 10 (12%, los 15 patrones restantes agruparon los otros 23 aislamientos. Los 34 aislamientos resistentes a tetraciclina y cloranfenicol mostraron relación con los patrones electroforéticos A (n = 32, A16 (n = 1 y A28 (n = 1, caracterizados, al igual que el clon, por presentar una banda de 340 Kb. Conclusión. Estos resultados muestran la circulación continua en el país de aislamientos de S. pneumoniae serotipo 5 genéticamente relacionados con el clon 19-Colombia(5.
Informe sobre el Tercer Congreso Sudamericano de Neurocirugía
Directory of Open Access Journals (Sweden)
Alejandro Jiménez Arango
1949-07-01
Full Text Available Bogotá, abril 16 de 1949. Señor Profesor Dr. Jorge Bejarano, Ministro de Higiene. E.S.D. Señor Ministro: De conformidad con el Decreto No 540 de 2 de marzo del presente año, por el cual tuve el honor de ser nombrado Delegado de Colombia ad honorem al tercer Congreso Sudamericano de Neurocirugía que se reumo en Buenos Aires del 2 al 9 de los presentes, me permito informar a S. S. sobre el origen, desarrollo y acuerdos de dicho congreso.
LOS ALMIDONES RESISTENTES Y LA SALUD
Directory of Open Access Journals (Sweden)
Carmen Carla Quiroga Ledezma
2009-01-01
Para una mejor comprensión de los almidones resistentes y su efecto en la salud se hizo una revisión bibliográfica de los trabajos publicados: estructura del almidón, tipos de modificaciones a la estructura del almidón, digestión del almidón, tipos de almidones, consecuencias fisiológicas del almidón resistente y tendencias futuras.
Directory of Open Access Journals (Sweden)
Narda María Olarte
2010-09-01
Conclusiones. El 7,2% de los pacientes que ingresaron a la unidad de cuidados intensivos estaban colonizados con SARM. Éste es el primer reporte de colonización por aislamientos de SARM-ST8-SCCmec IVc adquirido en la comunidad y relacionado genéticamente con el clon pandémico USA300-0114 en Colombia.
Dinámicas migratorias transnacionales: el caso de los inmigrantes sudamericanos en Santiago de Chile
Baeza Virgilio, Pablo
2016-01-01
La presente investigación se centra en la inmigración sudamericana en la ciudad de Santiago de Chile. Se analizan los elementos políticos, económicos y sociales que conforman el espacio social de incorporación en el que los inmigrantes se insertan. A través de los datos producidos por una encuesta, identificamos las características, magnitud e intensidades de las prácticas transnacionales que los inmigrantes sudamericanos despliegan en la ciudad como parte de sus estrategias de incorporación....
El emprendimiento social: una comparativa entre España y países sudamericanos
Directory of Open Access Journals (Sweden)
Catalina Nicolás Martínez
2012-07-01
Full Text Available La crisis global que sufrimos en la actualidad está haciendo que las labores realizadas por las empresas sociales sean imprescindibles para alcanzar una sociedad igualitaria, eficiente y justa. El número empresas sociales va creciendo año tras año, atendiendo problemas sociales generalmente olvidados por las instituciones. Los estudios empíricos que profundizan en el conocimiento de este tipo de emprendimiento social son escasos. Este trabajo, bajo el marco del proyecto Global Entrepreneurship Monitor (GEM, analiza la influencia de una serie de variables objetivas y cognitivas del emprendedor social, sobre una muestra constituida por emprendedores sociales en España y en diversos países sudamericanos.
Directory of Open Access Journals (Sweden)
Carlos Alberto Mendoza Ticona
2003-10-01
Full Text Available Objetivo: Determinar las susceptibilidad a diversos antibacterianos de tres categorías de S. aureus según su sensibilidad a la meticilina. Materiales y Métodos: Se aislaron 76 cepas de S. aureus que colonizaban pacientes y personal de salud de tres servicios del Hospital Honorio Delgado de Arequipa, de los cuales 36 fueron sensibles a meticilina (MSSA, 15 con susceptibilidad "borderline" (BORSA y 25 fueron resistentes a la meticilina (MRSA. Se les sometió a antibiograma a 14 antibacterianos. Resultados: El único antibiótico al cual todas los aislamientos fueron sensibles fue vancomicina. Los MRSA fueron resistentes a todos los b-lactámicos excepto imipenem que obtuvo 64% de susceptibilidad. Los BORSA mantuvieron un 80% de sensibilidad a cefalotina y un 100% al imipenem. Los antibióticos cefalotina, imipenem, ciprofloxacina, cotrimoxazol, rifampicina, eritromicina, tetraciclina, cloranfenicol, lincomicina y gentamicina tuvieron sensibilidades variables (p<0.01 entre las tres categorías; una mayor proporción de MSSA fue sensible a estos antibióticos, luego los BORSA y finalmente los MRSA. Las cepas multi-resistentes fueron mucho más frecuentes en los MRSA que en los otros dos grupos (p <0.01. Conclusión: Existe en nuestro medio cepas de S. aureus con resistencia "borderline" a meticilina. Hay diferencias entre la sensibilidad a diversos antimicrobianos entre los tres grupos de S. aureus. Esta diferenciación podría beneficiar una terapia antimicrobiana más racional. Se debe aplicar en todo aislamiento de S. aureus las recomendaciones internacionales para la detección de meticilino resistencia.
SOJA IAC/IAS-5: CULTIVAR RESISTENTE AO CANCRO DA HASTE
Directory of Open Access Journals (Sweden)
MASCARENHAS HIPÓLITO ASSUNÇÃO ANTONIO
1998-01-01
Full Text Available Há aproximadamente oito anos, o cancro da haste (Phomopsis phaseoli f. sp. meridionalis/Diaporthe phaseolorum f. sp. meridionalis da soja tem sido o principal fator limitante da produtividade em áreas de manifestação da doença. O seu controle mediante cultivares resistentes é o método mais econômico. Num ensaio em casa de vegetação, visando avaliar o efeito de doses de potássio no controle do cancro da haste, no cultivar IAS-5, moderadamente resistente, verificou-se haver plantas altamente resistentes, comprovadas em três gerações, todas inoculadas com o fungo causador da doença. A importância da obtenção do IAS-5 e de sua multiplicação deve-se a ser o mais cultivado no Estado de São Paulo e apresentar resistência ao cancro da haste.
Ocorrência de fungos filamentosos termo-resistentes em polpa de tomate envasada assepticamente
Directory of Open Access Journals (Sweden)
BAGLIONI Flávio
1999-01-01
Full Text Available Este trabalho teve como objetivo principal determinar a ocorrência de fungos filamentosos termo-resistentes durante o processamento asséptico de polpa de tomate (8° BRIX. Durante o período de safra de tomate foram feitas amostragens em 9 lotes (3 no início, 3 no pico e 3 em fim de safra e no período de entresafra em 5 lotes. Foi feita a enumeração de fungos termo-resistentes nas amostras coletadas durante as diferentes etapas do processo asséptico de cada lote. Foram obtidas contagens médias relativamente baixas, variando entre <1 e 8UFC/100mL de amostra. As maiores contagens foram obtidas na matéria prima e na água de pré lavagem e transporte. Cinqüenta linhagens de fungos termo-resistentes detectadas no procedimento de enumeração foram isoladas, codificadas e estocadas. Os esporos de cada isolado com 1 mês de cultivo foram submetidos a diferentes choques térmicos para selecionar a linhagem de fungo mais termo-resistente. O isolado de fungo mais termo-resistente (sobrevivência ao choque à 100° C/25 minutos foi identificado como Neosartorya fischeri.
Eindrapportage onderzoek naar ontwikkeling Verticillium resistente Acer
Hiemstra, J.A.; Sluis, van der B.J.
2013-01-01
Dit project is de laatste fase in het onderzoek naar de ontwikkeling van Verticillium-resistente Acer platanoides (Noorse esdoorn) onderstammen wat in 1993 van start ging op het toenmalige CPRO-DLO (nu PRI) met grootschalige selectie-experimenten. PPO-Bomen heeft vanaf 1999 onderzoek gedaan naar
Clon: Cyberzine de Arte y Cultura. Un modelo de comunicación multimedia
Directory of Open Access Journals (Sweden)
Antonio del Rivero Herrera
2005-01-01
Full Text Available En nuestra vida existen circunstancias que, por su condición de cotidianas, parecerían desvanecerse en el quehacer de todos los días al que, sin embargo, le dan forma. Tal es el caso de mantener vivo un proyecto como Clon: Cyberzine de Arte y Cultura; para el que la preparación y elaboración de este texto significó brindarnos la oportunidad de hacer un alto en nuestra vida diaria, y dedicar un tiempo considerable a reflexionar sobre lo complejo de su producción y la variedad de aristas que caracterizan a los procesos que la hacen posible, así como del compromiso que implica la presencia, cada vez más sólida, del proyecto en la escena cultural, a través de su sitio en Internet.
Directory of Open Access Journals (Sweden)
Ana M. Ocampo
2014-04-01
Full Text Available Introducción. Parte del éxito de Staphylococcus aureus resistente a la meticilina (SARM como patógeno se debe a la rápida diseminación de linajes pandémicos con perfiles variables de virulencia y sensibilidad antimicrobiana. En Colombia se han identificado clones asociados al hospital como el pediátrico (CC5-ST5-SCCmecIV, el brasilero (CC8-ST239-SCCmecIII y el chileno/cordobés (CC5-ST5-SCCmecI. Asimismo, se describió el USA300 (CC8-ST8-SCCmecIV, tradicionalmente asociado a la comunidad, causante de infecciones hospitalarias. Objetivo. Describir el comportamiento en el tiempo de los clones de SARM provenientes de un hospital universitario de Medellín en aislamientos recolectados con una década de diferencia. Materiales y métodos. Se analizaron 398 aislamientos de SARM, 67 recolectados en 1994 y 331 recolectados entre 2008 y 2010. La identificación y la sensibilidad a la meticilina se confirmaron mediante los genes nuc y mecA. La caracterización molecular incluyó la tipificación de spa, SCCmec, la electroforesis en gel de campo pulsado (Pulsed Field Gel Electrophoresis, PFGE, y la tipificación por secuenciación de locus múltiples (Multilocus Sequence Typing, MLST. Resultados. Al analizar los aislamientos de SARM de 1994 se encontró que pertenecían a un único linaje, el CC5-SCCmecIV, mientras que los aislamientos de 2008 a 2010 presentaron dos linajes dominantes: el CC8-SCCmecIVc, con cepas de los tipos spa t008 y t1610, estrechamente relacionadas con el clon USA 300, y el CC5-SCCmecI, con las de tipo spa t149, relacionadas con el clon chileno; no se detectaron cepas del linaje encontrado en 1994. Conclusiones. En este estudio se demuestra una dinámica en el tiempo de las cepas de S. aureus, y se señala la importancia de la vigilancia local y la difusión de los resultados, sobre todo en países como el nuestro, donde SARM es prevalente y la comprensión de su epidemiología es limitada.
Tecidos moles (não resistentes: como se fossilizam?
Directory of Open Access Journals (Sweden)
Silvia Regina Gobbo
2015-06-01
Full Text Available A preservação de tecidos moles (não resistentes desperta atenção pela qualidade dos fósseis preservados, e pela raridade. Este trabalho faz ampla revisão do assunto, desfaz alguns dos mitos correntes sobre fossilização destes materiais, como anaerobiose e soterramento rápido, bem como assinala a relevância do papel da replicagem de estruturas morfológicas por colônias microbianas. No âmbito dos fatores que influenciam a preservação de tecidos não resistentes estão pH, processos de decomposição, soterramento rápido e mineralização rápida por meio de carbonatos ou fosfatos. É possível citar exemplos de fácies sedimentares nas quais há preservação de tecidos não resistentes, como os folhelhos pirobetuminosos, calcários litográficos, folhelhos e diatomitos. Destaca-se o papel das colônias microbianas, tanto na forma de microesferas, como aquelas não-esferulíticas. Os três mitos principais que se procurou desfazer no artigo são: (1 a presença de oxigênio; (2 o soterramento rápido e (3 as colônias microbianas.
Directory of Open Access Journals (Sweden)
Jorge León
2011-06-01
Full Text Available Objetivos. Determinar el potencial antimicrobiano de actinomicetos marinos frente a cepas S. aureus meticilino-resistentes (MRSA y E. faecalis vancomicina-resistentes (VRE. Materiales y métodos. En dos medios de cultivo se sembraron 29 cepas de actinomicetos aislados de sedimento marino. Se evaluó la capacidad inhibitoria mediante pruebas de antagonismo in vitro para MRSA y VRE. Se procesó los extractos orgánicos de tres actinomicetos seleccionados para determinar la Concentración Mínima Inhibitoria (CMI del compuesto activo. Resultados. La mayoría de los actinomicetos aislados correspondieron a un grupo homogéneo de blanco-grisáceos (62% con buen nivel de crecimiento en agar marino. Los porcentajes inhibitorios fueron superiores a 85% para ambos patógenos con halos de inhibición mayores a 69 y 78 mm de diámetro para MRSA y VRE respectivamente. Los extractos diclorometánicos de tres de los actinomicetos aislados (I-400A, B1-T61, M10-77 mostraron gran potencial inhibitorio de ambos patógenos, siendo M10-77 la cepa de actinomiceto de mayor actividad antibiótica frente a S. aureus ATCC 43300 resistente a meticilina y E. faecalis ATCC 51299 resistente a vancomicina con una Concentración Mínima Inhibitoria (CMI de 7,9 y 31,7 μg/ mL respectivamente. El análisis filogenético de la cepa M10- 77 presenta un 99% de similaridad con la especie marina Streptomyces erythrogriseus. Conclusiones. El sedimento marino de la costa central del Perú es fuente promisorio de cepas de actinomicetos con gran capacidad de producir compuestos bioactivos capaces de inhibir patógenos tipificados como multidrogo-resistentes tales como S. aureus meticilino resistentes y E. faecalis vancomicina resistentes.Objectives. To determine the antimicrobial potential of marine actinomycetes against drug-resistant pathogens represented by strains of methicillin-resistant Staphylococcus aureus (MRSA and vancomycin-resistant Enterococcus faecalis (VRE. Materials and
Staphylococcus aureus Meticilina Resistente (MRSA e Infecções Nosocomiais
Directory of Open Access Journals (Sweden)
CRISTINA PAIVA SOUSA
2009-12-01
Full Text Available Um número crescente de cepas de Staphylococcus aureus meticilina resistente (MRSA apresentam resistência a múltiplos agentes antimicrobianos e são implicadas como causas de infecções hospitalares. S. aureus podem ser isolados de ambiente hospitalar e profissionais da saúde, revelando o risco de transmissão desses microrganismos pelo contato direto ou indireto com pacientes hospitalizados. Objetivou-se nesta revisão correlacionar este microrganismo com infecções hospitalares e avaliar as possíveis fontes de infecção, bem como enfatizar a importância do investimento em ações de educação em saúde que culminem em minimização de infecções hospitalares. Palavras-chave: Staphylococcus aureus meticilina resistente. Infecções nosocomiais.
Falomir Lockhart, Nicolás
2010-01-01
El presente trabajo analiza la influencia de los proyectos políticos de Brasil y de Venezuela en el fenómeno de la integración y fragmentación latinoamericana; con especial referencia a la determinación de lo sudamericano. Desde el fin de la guerra fría, América Latina parece haber entrado en un proceso de diferenciación de sus partes, manifestado en la inserción económica de México a América del Norte, en la distinción entre el norte y el sur de América del Sur o en la multiplicidad de proce...
OCORRÊNCIA E CARACTERIZAÇÃO DO AMIDO RESISTENTE EM AMIDOS DE MILHO E DE BANANA
Directory of Open Access Journals (Sweden)
Teixeira Maria A.V.
1998-01-01
Full Text Available No presente trabalho foi estudada a ocorrência de Amido Resistente (AR em amidos de milho e de banana (naturalmente resistente e investigado o efeito das variáveis: umidade de condicionamento, tempo e temperatura de armazenamento dos géis, na formação do AR em amido normal de milho; além das características físico-químicas e a estrutura fina do AR de milho e de banana. Foi observado que o teor de AR em amidos de milho e banana (2,5% e 49,61%, respectivamente parece não estar relacionada com a composição química do grânulo. O amido de banana apresentou grânulos com certo poliformismo, padrão de raio-x tipo B, além de uma fração linear de DP 34 resistente à b-amilólise. A estrutura cristalina que mantém o grânulo do amido de banana coeso, por si só, não explicou o alto teor de AR encontrado. O amido de milho normal apresentou formas poliédricas e padrão difração em raio-x tipo A. Não foi observada a fração com DP 34 resistente à b-amilólise, apesar da sua maior coesividade quando comparado ao amido de banana. O tratamento hidrotérmico aplicado no amido normal de milho quase triplicou o teor de AR (7,15% devido à formação de estruturas cristalinas coesas. O AR de milho (7,15% de AR, constituído por fragmentos porosos, apresentou padrão de difração tipo C. A não significância do tempo de armazenamento dos géis na produção do AR e a fração linear com DP 34 resistente à b-amilólise presente nos cromatogramas, sugerem a participação da amilose na formação desta estrutura resistente.
Directory of Open Access Journals (Sweden)
Rosa Navarrete
2000-01-01
Full Text Available Genotipos de frijol (Phaseolus vulgaris L. resistentes a Xanthomonas campestris pv. phaseoli de México. Durante 1995 se evaluó la reacción de genotipos de frijol de diversos origenes a Xcp, bajo condiciones de invernadero en el Campo Experimental del Valle de México, del INIFAP. Se realizaron tres experimentos con a120, b44 y csiete genotipos de frijol. Las plantas se inocularon por corte con navajas en la etapa V3, a y b con una mezcla de nueve cepas de Xcp y el c, con cada una de siete cepas con diferente grado de patogenicidad. La severidad se evaluó 20 días después de la inoculación, por comparación con una escala visual de nueve grados. Los datos se analizaron bajo un diseño completamente al azar. En a, los genotipos que mostraron reacción de resistencia a Xcp fueron: A 36, A 475, G 5686, G 11867, Harowood, SEA 14, XAN 266, MCD 4012 y REN 27. En b los genotipos resistentes fueron: Sequía Durango, Taylor y XAN 30. En los experimentos anteriores la severidad de la enfermedad mostró una distribución normal, con el máximo número de genotipos en el grado de severidad cinco en a y seis en b. Los resultados obtenidos indican que el uso de mezclas de cepas de bacterias con diferente patogenicidad es eficiente para identificar genotipos de frijol resistentes a Xcp. Los genotipos resistentes identificados en el último experimento, mostraron respuesta diferencial e interacciones genotipo por cepa. REN 27 y SEA 14 mostraron resistencia a las cepas utilizadas
Directory of Open Access Journals (Sweden)
Misterbino Borges García
2009-07-01
Full Text Available El cultivo in vitro, como técnica, consiste en cultivar asépticamente una porción aislada de la planta bajo condiciones de ambiente controlado, para que las células expresen su potencial intrínseco e inducido. El presente trabajo tuvo como objetivo determinar el efecto de diferentes concentraciones y tiempos de inmersión en hipoclorito de sodio en el establecimiento in vitro de explantes primarios de ñame (Dioscorea alata L. clon caraqueño. Las variantes de desinfección consistieron en la utilización de diferentes concentraciones de hipoclorito de sodio (1,5; 2 y 2,5% durante distintos tiempos de inmersión (10; 20 y 30 min. A los 7 días se evaluó el porcentaje de contaminación de bacterias y hongos respectivamente, y a los 40 días el número de nudos de novo, la longitud del vástago, el número de hojas, y el porcentaje de explantes establecidos y necrosados. Se aplicó un diseño experimental completamente aleatorizado con análisis de varianza bifactorial y clasificación simple. Se realizó la prueba de comparación de medias de Tukey para un nivel de significación del 5%. Los resultados obtenidos arrojaron que el tratamiento de desinfección de segmentos uninodales de ñame con hipoclorito de sodio al 1,5% durante un tiempo de inmersión 30 min es el de mayor efectividad para el establecimiento in vitro de explantes primarios del ñame (D. alata L. clon caraqueño con altos porcentajes de supervivencia en condiciones ex vitro.
Anarquistas y policías en el atlántico sudamericano: una red transnacional, 1890-1910
Directory of Open Access Journals (Sweden)
Martín Albornoz
Full Text Available Este artículo analiza la emergencia de mecanismos de cooperación policial para la vigilancia y expulsión de anarquistas en el atlántico sudamericano. Buscando ampliar las aproximaciones más corrientes sobre el tema, en su mayoría enfocadas en los efectos de las políticas represivas dentro de las fronteras nacionales, propone un recorte geográfico que abarca las conexiones entre las policías de Buenos Aires, Montevideo y diversas ciudades portuarias brasileñas. A partir de la reconstrucción de intercambios epistolares y de una abundante circulación de telegramas se esboza una cartografía específica para repensar rutas de la represión y del destierro, con foco en la dinámica que las expulsiones de extranjeros provocaron en los puertos de la región. Aunque sean centrales para este estudio, el análisis no se ciñe únicamente a las fuentes policiales, incorporando documentos de la prensa comercial y relatos de los propios anarquistas.
Directory of Open Access Journals (Sweden)
Graciana Maria de Moraes
2013-01-01
Full Text Available OBJETIVO: Identificar os fatores preditores de infecção ou colonização por micro-organismos resistentes. MÉTODOS: Foi realizado estudo quantitativo de coorte prospectivo. Foram realizadas a análise descritiva, para conhecimento da população do estudo, e a análise discriminante, para identificação dos fatores preditores. RESULTADOS: Foram incluídos 85 pacientes com infecções por micro-organismos resistentes: Pseudomonas aeruginosas resistente aos carbapenêmicos (24,7%, Acinetobacter resistente aos carbapenêmicos (21,2%, Staphylococcus aureus resistente à meticilina (25,9%, Enterococcus spp. resistente à vancomicina (17,6% e Klebsiella pneumoniae resistente aos carbapenêmicos (10,6%. A análise discriminante identificou transferências de outros hospitais e internação na Unidade de Terapia Intensiva como fatores preditores para ocorrência de infecção pelos grupos S. aureus resistente à meticilina, Acinetobacter resistente aos carbapenêmicos e K. pneumoniae resistente aos carbapenêmicos. Nenhuma das variáveis estudadas foi discriminante para Enterococcus spp. resistente à vancomicina e P. aeruginosas resistente aos carbapenêmico. CONCLUSÃO: Os fatores preditores encontrados foram: internação na UTI e a transferências de outros hospitais.OBJECTIVE: Identifying predictors of infection or colonization with resistant microorganisms. METHODS: A quantitative study of prospective cohort was carried out. A descriptive analysis was performed in order to know the population of the study and a discriminant analysis was performed to identify the predictors. RESULTS: In this study were included 85 patients with infections caused by resistant microorganisms: carbapenem-resistant Pseudomonas aeruginosas (24.7%; carbapenem-resistant Acinetobacter (21.2%; methicillin-resistant Staphylococcus aureus (25.9%, vancomycin-resistant Enterococcus spp (17.6% and carbapenem-resistant Klebsiella pneumonia (10.6%. The discriminant analysis
Directory of Open Access Journals (Sweden)
Carolina Firacative
2009-04-01
Full Text Available OBJECTIVE: To determine genetic relatedness of clone Colombia5 ST289 with invasive Streptococcus pneumoniae serotype 5 isolates recovered in nine Latin American countries. METHODS: Forty-four invasive S. pneumoniae serotype 5 isolates recovered from children under 5 years of age in Bolivia, Chile, Dominican Republic, Ecuador, Nicaragua, Panama, Paraguay, Peru, and Venezuela were studied. Pulsed-field gel electrophoresis patterns of DNA treated with SmaI restriction enzyme were classified using Tenover's criteria and analyzed with the Fingerprinting II program to determine their genetic relatedness with the Colombian clone. RESULTS: All isolates had a genetic similarity of 78.5% or more with the Colombian clone. Thirteen electrophoretic subtypes derived of pattern A were identified, and five of them (A5, A6, A8, A13, A27 comprised 61.4% of the isolates. CONCLUSIONS: Clone Colombia5 ST289 is disseminated in Latin America. This is important because S. pneumoniae serotype 5 frequently causes invasive disease in the region and is associated with trimethoprim-sulfamethoxazole resistance.OBJETIVO: Determinar la relación genética del clon Colombia5 ST289 con los aislamientos invasores de Streptococcus pneumoniae serotipo 5 provenientes de nueve países latinoamericanos. MÉTODOS: Se estudiaron 45 aislamientos invasores de Streptococcus pneumoniae serotipo 5 procedentes de niños menores de 5 años de Bolivia, Chile, Ecuador, Nicaragua, Panamá, Paraguay, Perú, República Dominicana y Venezuela. Los patrones en electroforesis en gel de campo pulsante del ADN tratado con la enzima de restricción SmaI se clasificaron mediante el criterio de Tenover y se analizaron con el programa Fingerprinting II para determinar su relación genética con el clon colombiano. RESULTADOS: Todos los aislamientos tuvieron una similitud genética de 78,5% o mayor con el clon colombiano. Se identificaron 13 subtipos electroforéticos derivados del patrón A y cinco de ellos
Manuel Cabrera Jova; Rafael Gómez Kosky; Sergio Rodríguez Morales; Jorge López Torres; Aymé Rayas Cabrera; Milagros Basail Pérez; Arletys Santos Pino; Víctor Medero Vega; Germán Rodríguez Rodríguez
2009-01-01
Con el empleo del sistema de inmersión temporal fue posible incrementar la multiplicación in vitro de los segmentos nodales en el clon de ñame Blanco de Guinea. Con este tipo de sistema de cultivo se obtuvieron los más altos valores para la altura de la planta, número de entrenudos por planta, así como para la masa fresca y seca de las mismas. Las condiciones de cultivo creadas en el sistema de inmersión temporal para la multiplicación in vitro de los segmentos nodales lograron el más alto co...
Obras de fábrica resistentes. Consideraciones generales de cálculo
Directory of Open Access Journals (Sweden)
Jenaro Garrido, José María
1986-10-01
Full Text Available This work studies de resisting capacity of the non reinforced masonry works to normal requirements from the knowledge of the nominal value to compressive resistance of its elements, or from the results from compression tests carried out on masses or on masonry samples. The obtained expressions for homogeneous sections are also valid for sections that, because of their cavities, they can be considered heterogeneous, allowing a determination of its resistant behaviour by means of the introduction of the conceipt of resistant homogeneous equivalent section. Finaly it includes a study on deforming and buckling of the masonry works to which diverse expressions gathered already in the Model Code CEB-FIP and in the Instruction in force EH'82 for Concrete Works are applied.El presente artículo recoge un estudio de la capacidad resistente de las obras de fábrica no armadas ante las solicitaciones normales, a partir del conocimiento del valor nominal de la resistencia a compresión de los elementos componentes o de los resultados de ensayos a compresión realizados sobre macizos o probetas de obra de fábrica. Las expresiones obtenidas para secciones homogéneas se extienden a secciones que por comprender cavidades hayan de considerarse heterogéneas, haciendo posible una determinación de su comportamiento resistente mediante la introducción del concepto de sección resistente homogénea equivalente. Finalmente se incluye un estudio sobre la deformabilidad y pandeo de las obras de fábrica a los que se aplican diversas expresiones ya recogidas en el Código Modelo CEB-FIP y en la vigente Instrucción EH-82 para obras de hormigón.
Directory of Open Access Journals (Sweden)
A.M. Togneri
2005-03-01
Full Text Available En un período de cinco meses y 25 días se investigó la portación intestinal de enterococos resistentes a vancomicina (EVR. Se estudiaron 124 pacientes (73% de 171 admitidos en la unidad de terapia intensiva (UTI, 35 de los cuales (28% resultaron ser portadores. Los aislamientos de EVR (n=35 fueron identificados como Enterococcus faecium (n=18, Enterococcus gallinarum (n=16 y Enterococcus raffinosus (n=1. Todos los aislamientos estudiados fueron resistentes a vancomicina (VAN (CIM90= 512 µg/ml y teicoplanina (CIM90= 32 µg/ml y portaban el gen vanA. Los estudios de tipificación molecular mostraron un alto grado de homología entre los aislamientos de E. faecium (un clon dominante y E. gallinarum (dos tipos clonales, sugiriendo su diseminación a modo de brote. No se encontraron diferencias significativas con la edad y el sexo de los pacientes no portadores (p>0,05, pero si con el tiempo de hospitalización y el uso de esquemas antibióticos de amplio espectro (pIntestinal tract colonization with vancomycin resistant enterococci (VRE was studied during five months and 25 days. Out of 171 patients hospitalized in the intensive care unit, 124 (73% were included in this study. Thirty five of them (28% were recognized as colonized with VRE. VRE isolates (n = 35 were identified as Enterococcus faecium (n=18, Enterococcus gallinarum (n=16, and Enterococcus raffinosus (n=1. All of them were resistant to vancomycin (MIC90= 512 µg/ml and to teicoplanin (MIC90= 32 µg/ml, having the vanA gene. By means of molecular methods a high homology was found among E. faecium and E. gallinarum isolates, respectively, suggesting their spread as a kind of outbreak. No significant differences in age or sex were found among colonized and non-colonized patients (p>0.05. On the other hand, the hospitalization time and the use of broad-spectrum antibiotics were associated with colonization. From this study we highlight the importance of enhancing all measures of
Arquitectura sismo-resistente: respuesta morfológica
Directory of Open Access Journals (Sweden)
Giulani, Hugo
1994-12-01
Full Text Available In the previous reports (1 and (2 we raised the question of the necessity to develop an Earthquake-Resistant Architecture which would make the integral solution of the seismic problem in buildings possible. We established the grounds, objectives, basic principles and methodology for defining the guidelines to be followed in making the architectural design and structural earthquake-resistant design compatible. The present report brings the proposal of an architectural response from the morphological point of view, allowing us to reach an adequate final form which consists of eliminating all the incompatibilities produced by the seismic demands and determining factors, in other words, we search for an architectural design which, owing to its very morphology, is able to satisfy the said conditions; an "Adequate Final Form" which in itself avoids the bothersome guidelines for making the structural and architectural designs compatible, transforming them into morphological responses to each seismic determining factor.
En informes anteriores (1 y (2 planteamos la necesidad de desarrollar una Arquitectura Sismo-resistente, que posibilite la solución integral del problema sísmico de los edificios. Se establecieron los fundamentos, objetivos, principios básicos y metodología para deducir las pautas de compatibilización del diseño arquitectónico con el diseño estructural sismo-resistente. En el presente informe se propone una respuesta arquitectónica desde la morfología, que permite llegar a una forma final ajustada, en el sentido de eliminar toda incompatibilidad respecto de las exigencias o condicionantes sísmicos. Es decir, un proyecto arquitectónico que por su propia morfología satisfaga dichos condicionantes. Una "Forma Final Ajustada" que evita, por sí misma, las engorrosas pautas de compatibilización del diseño estructural con el diseño arquitectónico, transformándolas en respuestas morfológicas a cada condicionante sísmico.
Vieira, Ana Rita Ribeiro
2013-01-01
Dissertação para obtenção do Grau de Mestre em Engenharia Civil - Ramo de Estruturas e Geotecnia Nesta dissertação avalia-se a capacidade resistente última de estacas em compressão usando análises em tensão/deformação. A capacidade resistente última das estacas é avaliada através do programa computacional de elementos finitos Plaxis 2D v. 8 e é comparada com a capacidade resistente última prevista por métodos de extrapolação da curva carga vs. assetamento de ensaios de carga que não ...
Fagotipagem de cepas de Staphylococcus aureus resistentes a antibióticos, isoladas de leite
Directory of Open Access Journals (Sweden)
Wanderley Pereira de Araújo
1998-01-01
Full Text Available A partir de amostras de leite cru foram isoladas 201 cepas de S. aureus, as quais foram submetidas a provas de resistência a antibióticos pelo método dos discos impregnados com os seguintes antibacterianos: amicacina, ampicilina, cefalotina, cefoxitina, cloranfenicol, clindamicina, oxacilina, penicilina, tetraciclina, tobramicina e vancomicina. Com exceção de 88 (43,8%, 90 (44,8%, 24 (11,9% e 40 (19,9% cepas resistentes à penicilina, ampicilina, cloranfenicol e tetraciclina, respectivamente, a maioria das 201 cepas (95% ou mais foi sensível aos antibióticos utilizados. As cepas resistentes a estes quatro antibióticos foram fagotipadas, empregando-se os Conjuntos Básicos Internacionais de bacteriófagos para cepas de origem humana e bovina, verificando-se que houve predomínio de cepas sensíveis a fagos dos grupos III e III/NC do conjunto básico humano e a fagos dos grupos III, IV e da associação III/IV do conjunto bovino.
Directory of Open Access Journals (Sweden)
CECILIA PEÑACOBA PUENTE
2005-01-01
Full Text Available La medicina paliativa se dedica al cuidado de los pacientes con enfermedades en fase terminal. En España, existen varias unidades de cuidados paliativos, sin embargo, no en todas se lleva a cabo una intervención multidisciplinaria lo cual es esencial para conseguir que una persona muera en una situación de bienestar y con la mejor calidad posible. El objetivo de este estudio es analizar las estrategias de afrontamiento existentes en los enfermos ingresados en unidades de cuidados paliativos en fase de aceptación y su relación con la personalidad resistente. Para ello, se administró un instrumento corto en forma de entrevista. Los resultados encontrados muestran que este tipo de pacientes utilizan estrategias de afrontamiento positivas como acción para resolver problemas, búsqueda de recompensas alternativas y reevaluación positiva. Por otro lado, un aspecto de la personalidad resistente encontrada en estos pacientes es el reto lo cual indica que estos pacientes viven esta experiencia como una oportunidad de desarrollo personal.
Directory of Open Access Journals (Sweden)
Marina Regina Frizzas
2008-04-01
Full Text Available Plantas geneticamente modificadas resistentes aos insetos oferecem benefícios à agricultura moderna. No entanto, esta tecnologia pode afetar o controle biológico natural e a biodiversidade por meio de efeitos diretos e indiretos das plantas transgênicas sobre o valor adaptativo e comportamental de predadores, parasitóides, polinizadores e outros artrópodes não-alvo. Neste artigo, são discutidos os impactos ou os efeitos potenciais de plantas transgênicas resistentes a insetos sobre organismos não-alvo, com ênfase em artrópodes predadores, parasitóides e polinizadores, e os principais estudos com plantas transgênicas resistentes a insetos, publicados nos últimos dez anos.
Comprobaciones resistentes de elementos constructivos de tierra
Directory of Open Access Journals (Sweden)
Estrada, Enrique
1986-11-01
Full Text Available This work has the purpose to compare, by means of different tests on adobe bricks and masonry, the obtained resistant properties and those of other similar works carried out in countries having a wide tradition and knowledge about earth as construction material. Elements (adobe bricks and blocks have been tested to compression and bending, and masonry made of those elements to compression and diagonal compression.El presente trabajo pretende comparar, por medio de distintos ensayos sobre elementos y fábricas de mampostería de tierra, las propiedades resistentes obtenidas con las de otros trabajos similares realizados en países con dilatada tradición y conocimiento de la tierra como material de construcción. Se han ensayado elementos (adobes y bloques a compresión y flexotracción y fábricas formadas por conjuntos de los mismos a compresión y a compresión diagonal.
Cecotti, Martina; Morelli, Irma Susana; Coppotelli, Bibiana
2015-01-01
La contaminación mixta con PAH y metales pesados conlleva dificultades debido a la potencial toxicidad del metal, limitando la supervivencia solo a los microorganismos que toleren ambos contaminantes. El estudio de cepas degradadoras de PAH y resistentes a metales pesados promete proporcionar herramientas claves para el proceso de biorremediación. Este trabajo tuvo como objetivos la selección, identificación y caracterización de cepas degradadoras de PAH y resistentes a metales pesados aislad...
Directory of Open Access Journals (Sweden)
Daniel Angel Luján Roca
2013-01-01
Full Text Available El Staphylococcus aureus resistente a meticilina asociado a la comunidad (SARM-AC está ampliamente diseminado en el mundo. Es epidémico en algunos países y posee dos marcadores moleculares característicos: el SCCmec IV y la leucocidina de Panton-Valentine, ambos escasamente encontrados en el SARM asociado a la asistencia médica.
Evaluación de estructuras de muros resistentes
Directory of Open Access Journals (Sweden)
Lewicki, Bohdan
1988-12-01
Full Text Available The author of this article, who is one of the main International personalities in the field of the structural engineering, point out the importance of intuition as a component of the creative capacity of the engineer, as well as its necessity within de evaluation process of structures.
The article includes also some Indications about the general principles on reliability of masonry structures.
El autor del presente artículo, una de las máximas autoridades mundiales en el campo de la Ingeniería estructural, señala la importancia de la intuición como componente de la capacidad creadora del ingeniero y su necesidad en el proceso de evaluación de las estructuras.
En el artículo se dan también unas indicaciones referentes a principios generales sobre fiabilidad de las estructuras de muros resistentes.
Manejo de capim pé-de-galinha em lavouras de soja transgênica resistente ao glifosato
Directory of Open Access Journals (Sweden)
André da Rosa Ulguim
2013-01-01
Full Text Available O objetivo deste trabalho foi avaliar a resistência de capim pé-de-galinha (Eleusine indica ao glifosato, em lavouras de soja transgênica; avaliar o efeito de aplicações de glifosato em diferentes estádios de desenvolvimento; identificar práticas agronômicas associadas à seleção de biótipos resistentes; e avaliar a eficiência dos herbicidas cletodim, fluazifope-P-butílico, clomazona, glufosinato de amônio e glifosato nas plantas resistentes. Plantas escapes ao tratamento com glifosato foram coletadas em 24 propriedades, no Rio Grande do Sul. As plantas foram cultivadas em casa de vegetação, tendo-se avaliado a sua resistência ao glifosato. Os acessos resistentes foram selecionados e avaliados quanto ao efeito da aplicação do glifosato em diferentes estádios de crescimento e quanto à sensibilidade aos herbicidas. Foi aplicado um questionário aos produtores para identificação das práticas agronômicas associadas às falhas no controle. O controle de E. indica pelo glifosato é mais efetivo com a aplicação em estádios iniciais de desenvolvimento. Práticas agronômicas, como uso contínuo de baixas doses do herbicida, aplicação em estádios de desenvolvimento avançados das plantas daninhas (mais de um afilho e a ausência de rotação de culturas foram relacionadas às falhas de controle observadas. Os herbicidas cletodim, fluazifope-P-butílico e glufosinato de amônio são alternativas eficientes para o controle de E. indica.
Directory of Open Access Journals (Sweden)
Marcia Britto de Macedo Soares
2002-02-01
Full Text Available Electroconvulsive therapy is known to be effective in the treatment of mood disorders, more specifically for depression and mania. Although a large body of evidence confirms the efficacy of electroconvulsive therapy in the treatment of mania, few prospective studies have been done to assess its effectiveness in treatment-resistant manic episodes. These case reports describe the initial results of a study that is being conducted to evaluate the efficacy of Electroconvulsive therapy among treatment-resistant bipolar patients. METHODS: Three manic patients (according to DSM-IV criteria who were considered treatment-resistant underwent a series of 12 bilateral Electroconvulsive therapy sessions. Before the treatment and then weekly, they were evaluated with the following rating scales: Young Mania Rating Scale, Hamilton Rating Scale for Depression, Brief Psychiatric Rating Scale, and Clinical Global Impressions-Bipolar Version. RESULTS: The 3 patients showed a satisfactory response to Electroconvulsive therapy, although some differences in the course of response were observed. CONCLUSION: These case reports suggest that Electroconvulsive therapy needs further evaluation for the treatment of resistant bipolar patients.A Eletroconvulsoterapia é uma alternativa reconhecidamente eficaz no tratamento dos transtornos do humor. Embora vários estudos tenham confirmado a eficácia desta modalidade terapêutica no tratamento da mania aguda, poucos estudos foram realizados em pacientes maníacos resistentes à farmacoterapia. Esses relatos de casos descrevem resultados preliminares de um projeto de pesquisa que tem por objetivo avaliar a eficácia da Eletroconvulsoterapia no tratamento de transtornos bipolares resistentes. MÉTODOS: Três pacientes com diagnóstico de mania (de acordo com os critérios do DSM-IV, considerados resistentes ao tratamento medicamentoso, foram submetidos a 12 aplicações bilaterais de Eletroconvulsoterapia. Antes do tratamento e
Directory of Open Access Journals (Sweden)
Mirian Alves Freitas
2017-01-01
Full Text Available S. aureus é o agente etiológico de maior importância associado às infecções adquiridas tanto em âmbito comunitário ou hospitalar, devido a sua capacidade de desenvolver resistência às terapias convencionais. A Terapia Fotodinâmica (TFD surge como alternativa a ser utilizada no controle de cepas resistentes aos antibioticos. O objetivo do presente estudo é avaliar os efeitos da TFD com Azul de Metileno (AM sobre cepas de S. aureus resistente à meticilina (MRSA. As amostras foram diluídas em PBS estéril de acordo com a escala 0,5 de MacFarland. Os grupos foram compostos com diferentes concentrações de AM, incubados no escuro durante 15 minutos e irradiados por LED Biopdi/Irrad-Led5 em 660nm com fluência de 10 J/cm². Posteriormente, foram semeadas e incubadas à 37ºC por 24 horas. A contagem de Unidades Formadoras de Colônias (UFCs demonstrou que a TFD foi eficaz na menor concentração testada de AM sobre cepas de MRSA.
Directory of Open Access Journals (Sweden)
J.M. Paula
2011-03-01
Full Text Available C. bonariensis (Conyza bonariensis é uma planta daninha da família Asteraceae, amplamente distribuída no Brasil, com presença marcante nos Estados do Rio Grande do Sul e do Paraná. Biótipos de C. bonariensis resistentes ao glyphosate foram identificados nos Estados do Rio Grande do Sul, Paraná e São Paulo. O objetivo deste trabalho foi avaliar o efeito de diferentes manejos de inverno e na pré-semeadura da soja sobre a população de plantas de C. bonariensis resistente ao herbicida glyphosate. Os resultados evidenciaram que a população de C. bonariensis é maior em áreas mantidas sem cultivo (pousio do que naquelas áreas cultivadas com trigo ou aveia-preta durante o inverno. Observou-se que o trigo e a aveia-preta exercem efeito supressor sobre a população de C. bonariensis, proporcionando maior facilidade de controle com herbicida na pré-semeadura da cultura usada em sucessão. O controle de C. bonariensis resistente ao herbicida glyphosate foi satisfatório quando se utilizaram herbicidas pós-emergentes na cultura do trigo e glyphosate + 2,4-D ou glyphosate + diuron + paraquat na pré-semeadura da soja.Horseweed (Conyza bonariensis, which belongs to the Asteraceae family, is a weed species widely spread in Brazil. Horseweed biotypes resistant to glyphosate, the main herbicide used in Roundup Ready soybean fields, were identified in the states of Rio Grande do Sul and Parana. The aim of this study was to evaluate the effect of different winter and pre-sowing management techniques on soybean plant population of C. bonariensis resistant to glyphosate. The results showed that the population of C. bonariensis is larger in areas maintained fallow than in areas planted with wheat or oats during the winter. Wheat and oats were found to exert a suppressive effect on the population of C. bonariensis, providing greater ease of control with herbicide before seeding in the culture used in succession. The control of glyphosate-resistant C
Cepas de Campylobacter jejuni resistentes a quinolonas aisladas de humanos, gallinas y pollos
Directory of Open Access Journals (Sweden)
Rodolfo Notario
2011-08-01
Full Text Available Se compararon 8 aislamientos de Campylobacter jejuni provenientes de humanos con enfermedad diarreica aguda, con 23 aislamientos de cloaca de gallinas y pollos obtenidos de zonas próximas a la ciudad de Rosario, todos resistentes a la ciprofloxacina. Las muestras se sembraron en agar selectivo y se incubaron en microaerofilia a 42 °C. Las colonias se identificaron con el método tradicional. Los aislamientos se conservaron a -70 °C en caldo cerebro corazón con 17% v/v de glicerina. La clonalidad se determinó por RAPD-PCR, utilizando el primer 1254 (Stern NJ. Se interpretaron los aislamientos como clones distintos cuando diferían en una banda de amplificación. Se obtuvieron 5 clones diferentes. Los patrones I, II y V fueron aislados en criaderos industriales de pollos y en humanos (el II también en un establecimiento de gallinas ponedoras de huevos. En un gallinero familiar se obtuvo el patrón I. El patrón III sólo se obtuvo de humanos. El patrón IV se halló en uno de los criaderos pero no en humanos. Se pudo determinar que 93.5% de las cepas se aislaron tanto de animales como de humanos, por lo que se considera posible que la colonización de criaderos con cepas resistentes a los antimicrobianos pudiera ser el origen de la infección de humanos.
Directory of Open Access Journals (Sweden)
Sandra Liliana Valderrama
2016-04-01
Conclusión. Para el control de la aparición de P. aeruginosa resistente a carbapenémicos, se deben fortalecer los programas de control de antimicrobianos, promover el uso prudente de carbapenémicos y quinolonas, y vigilar el uso adecuado de la nutrición parenteral.
Directory of Open Access Journals (Sweden)
M. Florencia Grandi
2012-11-01
Full Text Available Interactions between killer whales and sea lions are widely known. This work describes the predator-prey behaviour of killer whales and South American sea lion associated with a trawling fishery. In Argentina the predatory behaviours of killer whales and anti-predatory behaviours of South American sea lions have been described from costal based observations, but predator-prey behaviour of these species is poorly known at open waters. Here we describe a killer whale group attack on an individual sea lion, using a video recorded from a trawling vessel and an interview of the ship captain. This predator-prey behaviour represents an example of the complexity of interactions between marine mammals and fisheries along the Patagonian coast.Las interacciones entre orcas y lobos marinos son ampliamente conocidas. Este trabajo describe el comportamiento predador-presa entre orcas y un lobo marino sudamericano asociados a un barco pesquero de arrastre. Particularmente en Argentina el comportamiento predatorio de las orcas y el anti-predatorio de los lobos marinos comunes fueron descriptos mediante observaciones costeras, pero se sabe poco sobre el comportamiento de estas especies en aguas abiertas. En este trabajo, a partir de un video grabado desde un barco de pesca arrastrero, junto con la entrevista del capitán del barco, se describe cómo un grupo de orcas ataca a un lobo marino Sudamericano. Este comportamiento predador-presa representa un ejemplo sobre la complejidad de las interacciones entre mamíferos marinos y las pesquerías a lo largo de la costa patagónica.
Directory of Open Access Journals (Sweden)
P.J. Christoffoleti
2001-04-01
Full Text Available O objetivo deste trabalho foi estudar o manejo de uma população da planta daninha capim-marmelada (Brachiaria plantaginea resistente aos herbicidas inibidores da ACCase (ariloxifenoxipropionatos e ciclohexanodionas, utilizados na cultura da soja no sistema de plantio direto. Para isso, foram realizados dois experimentos: um utilizando herbicidas de manejo, com mecanismos de ação alternativos, comparando a eficácia destes com os inibidores da ACCase; e outro apenas com herbicidas inibidores da ACCase e aditivos misturados à calda. As sementes resistentes foram produzidas a partir de plantas comprovadamente resistentes; para comparação de resultados, foi utilizada uma população de capim-marmelada que nunca tinha sido pulverizada com inibidores da ACCase, portanto uma população suscetível. O experimento com os herbicidas de manejo foi realizado em condições de campo, porém as plantas ficaram em caixas com capacidade de 50 L, evitando-se a disseminação destas para áreas adjacentes. Concluiu-se que as plantas resistentes não apresentam resistência múltipla com herbicidas de manejo com mecanismos de ação alternativos, podendo os herbicidas glyphosate, paraquat, sulfosate, paraquat + diuron, MSMA e glufosinate ser utilizados no período entressafra das áreas com sistema de plantio direto, para manejo de populações resistentes de capim-marmelada aos herbicidas inibidores da ACCase. O experimento com aditivos foi realizado em casa de vegetação, com plantas em vasos individuais, utilizando sementes das populações suscetíveis e resistentes. Os herbicidas utilizados foram inibidores da ACCase, em cuja calda foram adicionados aditivos nitrogenados, do tipo uréia e sulfato de amônio, além de um tratamento sem aditivos. Concluiu-se que os aditivos não alteraram a eficácia dos herbicidas inibidores da ACCase nas plantas provenientes tanto da população suscetível quanto da resistente.The objective of this research was to
Directory of Open Access Journals (Sweden)
Leonora González Mesa
2005-12-01
Full Text Available La resistencia a meticilina en el género Staphylococcus spp es un problema creciente en el ámbito mundial. La producción de una PBP alterada (PBP2a con baja afinidad a betalactámicos, mediada por el gen mec A, es la responsable de esta resistencia. Mientras que los Staphylococcus spp todavía permanecen sensibles a vancomicina, algunos Enterococcus spp han adquirido la capacidad de neutralizar esta droga. En nuestro país no se conocen datos actualizados sobre la tasa de infección por S. aureus meticilina resistente (SAMR, ni sobre la circulación de este germen en la comunidad, tampoco existen reportes de Enterococcus spp vancomicina resistente (EVR. En este estudio fueron analizadas 774 cepas, colectadas en hospitales del país. Se determinó el mecanismo de resistencia utilizando métodos sugeridos por las guías NCCLS. El 9.3 % (23 de los S. aureus aislados en los hospitales y 4.0% (7 S. aureus aislados en la comunidad, fueron SAMR, portadores del gen mec A, el 69.9 % (72 de Staphylococcus coagulasa negativo, fueron resistentes a oxacilina. En la detección del Enterococcus spp vancomicina resistente (EVR, se encontró una cepa portadora de este fenotipo. Nuestros resultados revelan que en nuestro país los SAMR no son un problema en los hospitales, ni en el ambiente comunitario, a pesar de que se reporta por primera vez la circulación de estos en la comunidad y la circulación de EVR en el ambiente hospitalario, su frecuencia es muy baja lo que refleja los avances obtenidos en la aplicación de políticas encaminadas a racionalizar el uso y consumo de antibióticos.Resistance to methicilline in Staphylococcus spp genus is a growing problem worldwide. The production of an altered penicillin-fixing protein with low mecA gen-mediated affinity to beta-lactams is responsible for this resistance. Although Staphylococcus spp still remain susceptible to vancomycin, some Enterococcus spp have acquired the capacity of neutralizing this drug. In
Directory of Open Access Journals (Sweden)
Úrsula Verdalles
2016-09-01
Conclusión: La prevalencia de HTA resistente aumenta con la edad, el grado de ERC y la albuminuria. Estrategias como el tratamiento con antagonistas de receptores de aldosterona se asocian con un mejor control tensional en este grupo de pacientes y disminuyen su prevalencia.
Directory of Open Access Journals (Sweden)
Ana Paula Cabral de Faria
2013-01-01
Full Text Available Hipertensão resistente (HAR é definida como a pressão arterial que permanece acima da meta pressórica, apesar do uso de três classes de anti-hipertensivos em doses otimizadas, sendo um deles um diurético. Além disso, são considerados também hipertensos resistentes os pacientes que usam quatro ou mais classes e possuem suas pressões controladas. Embora essa definição seja útil na categorização de um maior grupo de resistentes, visto esses dois subgrupos compartilharem alto risco cardiovascular, algumas importantes particularidades clínicas e fisiopatológicas necessitam ser mais bem avaliadas antes de resistentes controlados e não controlados pertencerem ao mesmo grupo. Foram comparadas algumas características cardiovasculares nesses dois subgrupos de hipertensos resistentes. Embora algumas semelhanças, o subgrupo HRNC apresenta fenótipos cardiovasculares com pior prognóstico como maior rigidez vascular e hipertrofia ventricular esquerda, além de função endotelial mais prejudicada e menor queda de pressão arterial no período noturno, entre outras. Frente às diferenças, o subgrupo HRNC está associado à maior risco cardiovascular, podendo ser considerado mais resistente ao tratamento anti-hipertensivo. Além da importância de melhor prevenção e tratamento da HAR com medidas de identificar precocemente os fatores de risco e otimizar a terapia farmacológica, algumas implicações clínicas devem ser consideradas na abordagem de pacientes controlados e não controlados como semelhantes ao grupo de resistentes.Resistant hypertension (RH is defined as blood pressure that remains above target in spite of the concurrent use of three or more classes of antihypertensive drugs at optimized doses (UCRH, with one of them being a diuretic. Moreover, patients whose blood pressure is controlled while using four or more antihypertensive medications are also considered controlled resistant hypertensive (CRH subjects. Although this
Directory of Open Access Journals (Sweden)
Hernán Del Castillo
2009-07-01
Full Text Available En este artículo se describe el estado actual de las epidemias de tuberculosis multidrogo resitente (TB MDR y tuberculosis extensivamente resistente a drogas (TB XDR en el Perú. Se realiza un análisis de nuestra situación con respecto al resto de Latinoamérica, y de la distribución temporo espacial de los casos de TB XDR en Lima. También presentamos nuestra reflexión de lo que está pasando y debe cambiar; lo que se resume en darle la importancia debida a un problema que nos está rebasando y anteponer a nuestros propios intereses, los intereses de la humanidad; por consiguiente no podemos callar, y debemos declarar a la tuberculosis como emergencia sanitaria nacional. Eso constituye una respuesta, esperamos, aún viable para el Perú.
Directory of Open Access Journals (Sweden)
Adriana Cristina de Oliveira
2010-12-01
Full Text Available O principal objetivo deste estudo é identificar, na literatura, artigos sobre a ocorrência de contaminação das superfícies inanimadas e uma possível disseminação de bactérias resistentes no ambiente hospitalar. Realizou-se um levantamento bibliográfico de artigos publicados nas bases de dados LILACS, MEDLINE, Science Direct, SCOPUS e ISI Web of Knowledge, entre 2000 e 2008. Foram selecionados e analisados vinte e um artigos. Nos estudos analisados, realçou-se a presença de bactérias em monitores, grades de cama, mesas, torneiras, telefones, teclados de computador e outros objetos. Houve predominância de Staphylococcus aureus resistente à meticilina, Clostridium difficile, Acine-to-bacter baumannii e Enterococcus resistentes à vancomicina, sendo fator preditivo a ocupação prévia por pacientes colonizados por tais microrganismos. Verificou-se semelhança entre as cepas isoladas de pacientes colonizados e/ou infectados e as cepas do ambiente por tipificação molecular. Essas evidências reforçam a necessidade de conhecimento e controle de fontes de patógenos no ambiente hospitalar.Se objetivó identificar en la literatura artículos sobre la ocurrencia de contaminación de superficies inanimadas y la posible diseminación de bacterias resistentes en el ambiente hospitalario. Se realizó una investigación bibliográfica en las bases de datos LLILACS, MEDLINE, Science Direct, SCOPUS e ISI Web of Knowledge acerca de artículos publicados entre 2000 y 2008. Fueron seleccionados veintiún artículos. En los estudios analizados, se puso de manifiesto la presencia de bacterias en monitores, barandas de camas, mesas, canillas, teléfonos, teclados de computadora y otras. Existió predominancia de Staphylococcus aureus resistente a la meticilina, Clostridium difficile, Acinetobacter baumannii y Enterococcus resistentes a la vancomicina, resultando como factor predictivo el uso previo por parte de pacientes colonizados por tales
Directory of Open Access Journals (Sweden)
Ana María Mejía-Jaramillo
2012-06-01
Full Text Available Introducción. La enfermedad de Chagas, causada por Trypanosoma cruzi, es uno de los problemas más graves de salud pública en el continente americano. El benzonidazol es uno de los dos medicamentos utilizados para tratar la enfermedad de Chagas. Sin embargo, la variación de la sensibilidad del parásito a este medicamento es una de las principales causas del fracaso del tratamiento. Objetivo. Evaluar la sensibilidad in vitro al benzonidazol de cepas colombianas de T. cruzi de diferentes orígenes y procedencia geográfica. Materiales y métodos. Treinta y tres cepas colombianas de T. cruzi aisladas de humanos, vectores y mamíferos, se analizaron in vitro mediante el micrométodo enzimático de MTT para determinar la concentración inhibitoria 50 (CI50 al benzonidazol. Se estudió la correlación entre la sensibilidad in vitro al medicamento y diferentes parámetros biológicos y eco-epidemiológicos. Resultados. El análisis de sensibilidad al medicamento indicó que el 36 % de las cepas eran sensibles, el 48 %, parcialmente resistentes y, el 16 %, resistentes al benzonidazol. Los análisis de correlación entre las CI50 con algunos parámetros biológicos y eco-epidemiológicos, mostraron diferencias en cuanto a la sensibilidad según el origen biológico y el área geográfica de procedencia de la cepa. Conclusiones. Existe una gran variabilidad en cuanto a la sensibilidad al benzonidazol de las cepas circulantes de T. cruzi en Colombia, lo cual sugiere la presencia de cepas naturalmente resistentes en el país. doi: http://dx.doi.org/10.7705/biomedica.v32i2.458
Directory of Open Access Journals (Sweden)
Jesús Tamariz
2010-01-01
Full Text Available Staphylococcus aureus es un importante patógeno involucrado en una serie de infecciones e intoxicaciones, presenta múltiples factores de virulencia y su impacto se incrementa por su notable resistencia a los antimicrobianos. Objetivo: Determinar la frecuencia de Staphylococcus aureus meticilino resistente adquiridos en la comunidad, en hospitales de Lima- Perú. Material y métodos: Se realizó un estudio descriptivo multicéntrico. La resistencia a meticilina se determinó por el método Oxacillin Agar Screen. El origen de la cepa fue determinado mediante los criterios de los CDC; la Leucocidina de Panton Valentine fue identificada por métodos moleculares. Resultados: Se aislaron 276 cepas de Staphylococcus aureus, 160 fueron resistentes a meticilina (58%, 9 de ellas fueron identificadas como adquiridas en la comunidad (5,6%. La PVL fue identificada en 25 cepas (9,1%, 14 fueron MSSA y 11 MRSA, de éstas últimas solo 4 fueron MRSAcom, 7 fueron MRSAhosp (p<0,001. Conclusiones: El estudio revela niveles elevados de resistencia a meticilina, pero niveles bajos de MRSAcom. En nuestro medio la presencia de PVL no constituiría un marcador para la identificación de los MRSAcom. (Rev Med Hered 2010;21:4-10.
Directory of Open Access Journals (Sweden)
Paula Bacelar Leite
2013-06-01
Full Text Available The "witch broom disease" caused by the fungus called Moniliophthora perniciosa is one of the most important cocoa diseases in Latin America, causing around 70% production reduction in the southern Bahia. In attempt to solve the problem, many cultivars resistant to the disease have been recommended to farmers. On the other hand, the chocolate flavour is composed by many compounds whose formation depends on the genetic background, environment where cocoa is grown and processing operations. Therefore, this work aimed at determining the monomeric phenolic compounds, methylxanthines and antioxidant activity of cocoa mass and dark chocolate from cocoa cultivars resistant to "witch broom disease" and non resistant to the disease. The total phenolic compounds in cocoa mass did not vary among cultivars with values ranging from 23.95mg g-1 to 25.03mg g-1. Chocolates made from non resistant cultivars showed higher total phenolic compounds (19.11mg g-1 than SR162 and PH16 with 16.08mg g-1 and 15.46mg g-1, respectively. Epicatechin had higher content than catechin and the levels of these two compounds were higher in SR162. There were significant differences among samples of cocoa mass analyzed for caffeine. Chocolate made from SR162 had the highest amount of monomeric compounds due to its high concentration of catechin and epicatechin. The chocolate sample with the highest antioxidant activity was the SR162, followed by non resistant blend and PH16, showing relationship between the antioxidant activity and monomeric phenolics content.A "vassoura bruxa" causada pelo fungo Moniliophthora perniciosa, é uma das doenças mais importantes do cacau na América Latina, provocando uma redução de cerca de 70% na produção das amêndoas na Bahia. Para tentar resolver o problema, muitos cultivares resistentes à enfermidade têm sido recomendados para os agricultores. Por outro lado, as características do chocolate são oriundas de várias substâncias, cuja forma
Directory of Open Access Journals (Sweden)
Jos\\u00E9 Carlos Jaenes S\\u00E1nchez
2009-01-01
Full Text Available La Personalidad Resistente se refiere a una constelación de características de personalidad relacionadas con las percepciones personales de control, compromiso y desafío, que ha sido ampliamente estudiada en relación con el estrés y su impacto en contextos de salud y laborales, entre otros, pero prácticamente ignorada en el ámbito deportivo. Sin embargo, las características que incluye este constructo son muy interesantes para la práctica y el rendimiento deportivos. El objetivo de este estudio ha sido conocer las características de Personalidad Resistente de maratonianos adultos españoles. Los resultados, pioneros hasta la fecha, nos han permitido establecer que los niveles de compromiso, control y desafío de estos deportistas son moderadamente altos y que ejercen un impacto fundamental tanto a nivel motivacional (metas propuestas y resultados esperados como de rendimiento (marcas obtenidas. Se puede diferenciar entre maratonianos con mejores y peores marcas en relación con el nivel de PR, lo cual nos permite predecir el éxito de los maratonianos en función de sus características de PR. Como consecuencia, un entrenamiento adecuado en estas aracterísticas podría resultar en mejores cotas de rendimiento. Además, estos deportistas muestran mayores niveles de Personalidad Resistente que jóvenes y adultos de la población general, lo que podría ser un beneficio derivado de la práctica deportiva muy relevante en la vida cotidiana.
Controle de plantas daninhas na cultura de soja resistente ao glyphosate
Directory of Open Access Journals (Sweden)
Núbia Maria Correia
2010-01-01
Full Text Available O objetivo da pesquisa foi avaliar o controle de plantas daninhas em área cultivada com soja resistente ao herbicida glyphosate, sem a utilização de práticas complementares de manejo de plantas daninhas. Foram desenvolvidos experimentos, em condições de campo, nos anos agrícolas 2005/2006 e 2006/2007 em Jaboticabal (SP. Foram avaliadas duas cultivares de soja resistentes ao glyphosate (CD 214 RR e M-SOY 8008 RR, oito tratamentos de herbicidas (glyphosate, em aplicação única, nas doses de 0,48; 0,72; 0,96 e 1,20 kg ha-1 de equivalente ácido, associadas ou não a aplicação sequencial na dose de 0,48 kg ha-1, além de duas testemunhas, uma capinada e outra mantida infestada. As cultivares de soja influenciaram na infestação das espécies de plantas daninhas na área. Sem a aplicação de glyphosate, houve o predomínio de X. strumarium na área, desfavorecendo a ocorrência de outras espécies. Quando utilizado glyphosate, independentemente da dose, a infestação contabilizada aos 35 e 40 dias após a primeira aplicação, no primeiro e segundo ano, respectivamente, foi baixa. O controle de plantas daninhas na cultura da soja transgênica é diretamente influenciado pela dose de glyphosate, havendo controle satisfatório com a aplicação única de 0,96 kg ha-1 ou a sequencial de 0,48 + 0,48 kg ha-1 de glyphosate. Em situação de menor infestação (2006/2007, a aplicação única de 0,48 kg ha-1 de glyphosate é suficiente para o controle das plantas daninhas. As cultivares de soja transgênica CD 214 RR e M-SOY 8008 RR influenciam diferencialmente a dinâmica das espécies de plantas daninhas, sendo o controle químico mais efetivo na situação de cultivo de M-SOY 8008 RR, em que houve menor diversidade e desenvolvimento das plantas daninhas.
Denervação Renal com Cateter Irrigado em Hipertensos Resistentes: Uma Estratégia Promissora?
Directory of Open Access Journals (Sweden)
Luciana Armaganijan
2014-04-01
Full Text Available Fundamento: A hipertensão arterial sistêmica constitui importante problema de saúde pública e significativa causa de mortalidade cardiovascular. A elevada prevalência e as reduzidas taxas de controle tensional despertaram o interesse por estratégias terapêuticas alternativas. A denervação simpática renal percutânea surgiu como perspectiva no tratamento de hipertensos resistentes. Objetivo: Avaliar a factibilidade e a segurança da denervação renal com cateter irrigado. Métodos: Dez hipertensos resistentes foram submetidos ao procedimento. O desfecho primário foi a segurança, avaliada por eventos adversos periprocedimento, função renal e anormalidade vascular renal aos 6 meses. Os desfechos secundários constituíram mudanças na pressão arterial (consultório e monitorização ambulatorial e no número de anti-hipertensivos aos 6 meses. Resultados: A média de idade foi de 47,3 (± 12 anos, 90% eram mulheres. No primeiro caso, houve dissecção de artéria renal causada por trauma da bainha, fato que não se repetiu após ajuste técnico, demonstrando efeito da curva de aprendizado. Nenhum caso de trombose/infarto renal ou óbito foi reportado. Não se observou elevação dos níveis séricos de creatinina durante o seguimento. Aos 6 meses, diagnosticou-se um caso de estenose significativa de artéria renal, sem repercussão clínica. A denervação renal reduziu a pressão arterial de consultório, em média, em 14,6/6,6 mmHg (p = 0,4 tanto para pressão arterial sistólica como para a diastólica. A redução média da pressão arterial pela monitorização ambulatorial foi de 28/17,6 mmHg (p = 0,02 e p = 0,07 para pressão arterial sistólica e diastólica, respectivamente. Houve redução média de 2,1 anti-hipertensivos. Conclusão: A denervação renal é factível e segura no tratamento da hipertensão arterial sistêmica resistente. Estudos maiores são necessários para confirmar nossos resultados.
Directory of Open Access Journals (Sweden)
Luz Fátima Huallpa Vargas
2011-01-01
Full Text Available En este trabajo se presenta el desarrollo de un procedimiento de autenticación de imágenes digitales combinando diversos métodos relacionados con watermarks (marcas de agua digitales y métodos de cifrado, con el fin de proteger los derechos de autor de imágenes digitales. Para que este procedimiento sea robusto, imperceptible y resistente a diferentes ataques intencionales o no intencionales se trabaja en el dominio de las frecuencias de la imagen utilizando la Transformada Discreta del Coseno (Discrete Cosine Transform, DCT. Para agregar mayor nivel de protección y seguridad a la imagen marcada, se cifra el mensaje insertado a partir de una clave del autor empleando el método de Autómatas Celulares. El mensaje insertado es resistente a la compresión JPEG, a los ruidos y filtros gaussiano y salt-and-pepper. La extracción del mensaje se realiza a partir de la imagen marcada para lo cual se hace uso estricto de la clave del autor para verificar la autenticidad del mismo.
Directory of Open Access Journals (Sweden)
Luciane Cristina Gelatti
2009-08-01
Full Text Available Staphylococcus aureus resistente à meticilina foi inicialmente descrito como um típico microrganismo adquirido em infecções nosocomiais. No entanto, nos últimos anos Staphylococcus aureus resistente à meticilina adquirido na comunidade é causa de infecções de pele e tecidos moles, mas infecções graves como pneumonia e sepse podem ocorrer. Este relato descreve um caso de sepse em criança, complicado com pneumonia secundária a lesão em partes moles por Staphylococcus aureus resistente à meticilina adquirido na comunidade no Sul do Brasil. O paciente foi atendido em Unidade de Emergência com história de ferimento provocado por trauma em membro inferior que evoluiu para celulite, pneumonia e sepse.Methicillin-resistant Staphylococcus aureus was initially described as a typical microorganism acquired in nosocomial infections. However, over recent years, community-acquired methicillin-resistant Staphylococcus aureus has been a cause of skin and soft-tissue infections. Serious infections such as pneumonia and sepsis can also occur. This report describes a case of sepsis in a child that was complicated by pneumonia secondary to soft tissue lesions that were due to community-acquired methicillin-resistant Staphylococcus aureus in southern Brazil. The patient was attended at the Emergency Unit with a history of injury caused by lower-limb trauma that evolved to cellulitis, pneumonia and sepsis.
Directory of Open Access Journals (Sweden)
Gislanne Brito Barros
2013-06-01
Full Text Available Dentre os vírus que infectam o feijão-caupi (Vigna unguiculata L. Walp. destacam-se, respectivamente, pela severidade e ampla ocorrência o Cowpea severe mosaic virus (CPSMV e o Cowpea aphid-borne mosaic virus (CABMV. Portanto, objetivaram-se, no presente trabalho, obter e avaliar plantas de feijão-caupi com resistência ao CPSMV e ao CABMV, visando ao desenvolvimento de cultivares essencialmente derivadas e novas cultivares. Realizaram-se oito cruzamentos seguidos de retrocruzamentos, utilizando a linhagem TE 97-309G-9 e a cultivar Patativa como genitores resistentes, e as cultivares BR3-Tracuateua, BRS-Urubuquara, BRS-Novaera, BRS-Guariba e Pretinho como genitores suscetíveis. As gerações F2 e F2RC1 foram desafiadas quanto à resistência por meio de inoculação mecânica com isolados do CPSMV e do CABMV. Nas gerações F2RC1, além da resistência foram avaliados os caracteres: número de dias para o início da floração, comprimento das vagens, número de grãos. vagem-1, peso de cem grãos e produção de grãos.planta-1. Todos os indivíduos F2 e F2RC1 foram analisados pelo teste χ² e se ajustaram à frequência esperada de 15 plantas suscetíveis 1 planta resistente a ambos os vírus. As médias das plantas F2RC1 resistentes, de cada retrocruzamento, foram comparadas com a média do seu respectivo genitor recorrente pelo teste 't' e as médias dos retrocruzamentos foram comparadas pelo teste de Scott-Knott. Foi detectada variabilidade genética entre os retrocruzamentos para todos os caracteres. Todos os retrocruzamentos foram considerados promissores para produção de cultivares essencialmente derivadas resistentes ao CPSMV e ao CABMV e as plantas selecionadas possuem características que possibilitam a seleção de linhagens com grãos de bom padrão comercial e altamente produtivas.
Directory of Open Access Journals (Sweden)
Edgardo R. Trémouilles
2005-07-01
Full Text Available We revised the South American members of the genus Hydrovatus Motschulsky. Each of the three recognized species is diagnosed, with emphasis on diagnostic characters. A key summarizing the main differences is provided. To identify South American specimens of H. caraibus Sharp, they were compared with Central American specimens, including type material. Based on the material examined, H. caraibus is a species broadly distributed in Central and South America, with representatives of different areas separated by minor differences. The geographical distributions of the three species are considerably enlarged: H. crassulus Sharp and H. turbinatus Zimmermann are recorded for the first time from Paraguay, and H. caraibus is recorded for the first time from Argentina and Nicaragua. Bionomical information of the species is presented.Se estudiaron los representantes sudamericanos del género Hydrovatus Motschulsky. Se diagnostica cada una de las tres especies conocidas, enfatizando el reconocimiento de caracteres valiosos para su identificación; las principales diferencias se resumen en una clave. Para identificar los ejemplares sudamericanos de H. caraibus Sharp, se los comparó con especímenes de América Central, incluyendo material tipo. En base al material examinado, H. caraibus se encuentra ampliamente distribuida en America Central y del Sur, con representantes de diferentes áreas separados por diferencias menores. Las distribuciones geográficas de las tres especies se amplían considerablemente: H. crassulus Sharp y H. turbinatus Zimmermann se citan por primera vez de Paraguay, y H. caraibus se cita por primera vez de Argentina y Nicaragua. Se presenta información bionómica de las especies.
Directory of Open Access Journals (Sweden)
Edison Omar Martínez-Mora
2015-10-01
Full Text Available Introducción: La investigación tuvo como objetivo fundamental, la caracterización morfológica del almidón nativo de banano (Musa sapientum, contenido en almidón resistente (AR y disponible (AD, de las variedades de banano de exportación: Cavendish (AC, Filipino (AF, Orito (AO y Valery (AV.Material y Métodos: Se determinó tamaño y forma del gránulo de almidón a través de microscopia electrónica de barrido. La cuantificación del AR por medición de su fracción no hidrolizada, luego de un ataque de pepsina, y para la fracción del AD un ataque de amilasa pancreática a la fracción no hidrolizada. Se midió la absorbancia de las dos soluciones de AR y AD a 510nm contra el blanco del reactivo.Resultados: El tamaño de los gránulos de almidón de: AF, AV y AC fueron en promedio 28μm y para el AO, de 35μm aproximadamente. La forma que predominó fue la oval esférica. El contenido de AR y AD estuvo en el rango de 49 a 58,5% y de 41 a 50%, respectivamente.Conclusiones: El almidón resistente, análogo de la fibra y útil en la nutrición humana, se presentó en valores importantes en las muestras de las diferentes variedades de banano exportable del Ecuador, alrededor del 54%. Según los resultados, el almidón de banano de las variedades estudiadas puede ser incorporado en la elaboración de alimentos que demanden características funcionales, principalmente por su alto contenido en almidón resistente.
Directory of Open Access Journals (Sweden)
Isabel C. Marín-Orozco
2015-11-01
El objetivo del presente reporte es describir detalladamente dos casos de hipertensión arterial resistente, tratados mediante ablación con radiofrecuencia con el nuevo dispositivo Vessix® de la compañía Boston Scientific.
AMIDO RESISTENTE EM FARINHAS DE BANANA VERDE
Directory of Open Access Journals (Sweden)
Dayana Portes RAMOS
2010-03-01
Full Text Available
Este trabalho teve por objetivo avaliar o teor de amido resistente (AR em farinhas de banana verde produzidas a partir de treze genótipos de bananeira. Para a produção da farinha foram separadas a 1ª, 3ª e 5ª pencas de cada genótipo, na qual cada penca correspondeu a uma repetição. Os frutos de cada penca no estádio 1 (casca completamente verde de maturação foram descascados manualmente, cortados em fatias circulares de 0,5 cm e desidratados em estufa com circulação de ar a 40ºC por 48 horas, sendo em seguida moídos. A análise de AR consistiu em um processo enzimático, calculando-se o conteúdo final pela concentração de glicose liberada. Os resultados foram submetidos à análise estatística e mostraram diferenças significativas para o teor de AR nas farinhas obtidas dos genótipos de bananeira, sendo que a farinha com maior teor de AR foi a produzida a partir do cultivar ‘Nam’ (40,25% e a menor pelo híbrido ‘Fhia 01’ (10,01%. Pode-se concluir que o conteúdo de AR varia em relação ao genótipo utilizado para a confecção da farinha e que a banana pode ser uma boa opção de estudo de alimento funcional.
Directory of Open Access Journals (Sweden)
Adália Dias Dourado Oliveira
2007-03-01
Full Text Available PURPOSE: To evaluate the fluoroquinolone susceptibilities of ocular isolate coagulase-negative staphylococci (CoNS, identified at the Microbiology Laboratory - UNIFESP. DESIGN: Experimental laboratory investigation. METHODS: The minimum inhibitory concentrations (MICs of 21 strains of methicillin-resistant coagulase-negative staphylococci (MRCoNS and 22 methicillin-sensitive coagulase-negative staphylococci (MSCoNS to ciprofloxacin, ofloxacin, gatifloxacin and moxifloxacin were determined, using the E-test method standardized by the Clinical and Laboratory Standards Institute (CLSI/NCCLS. RESULTS: The MIC90s (µg/ml for the second generation of tested fluoroquinolones were higher than the fourth generation, especially for the methicillin-resistant coagulase-negative staphylococci group. CONCLUSION: Our results indicate that methicillin-sensitive coagulase-negative staphylococci are more susceptible to quinolones than are methicillin-resistant coagulase-negative staphylococci and that fourth generation fluoroquinolones appear to be more potent, affecting even coagulase-negative staphylococcal strains resistant to second generation fluoroquinolones.OBJETIVOS: Avaliar a suscetibilidade a fluorquinolonas dos Staphylococcus coagulase-negativo (SCoN identificados no Laboratório de Microbiologia Ocular da Unifesp. MÉTODOS: Foi determinada a concentração inibitória mínima de 21 cepas de SCoN meticilina-resistentes e 22 meticilina-sensíveis para ciprofloxacina, ofloxacina, gatifloxacina e moxifloxacina, utilizando o E-test estandartizado pelo CLSI/NCCLS. RESULTADOS: Os MIC90 (µg/ml de 43 SCoN isolados para fluorquinolonas de segunda geração foram maiores do que os de quarta geração, principalmente para o grupo dos meticilina-resistentes. CONCLUSÃO: Nossos resultados indicam que Staphylococcus coagulase-negativo meticilina-sensíveis são mais suscetíveis às quinolonas do que os Staphylococcus coagulase-negativo meticilina-resistentes
Estudio fisicoquímico de la solubilidad del clonixinato de lisina en mezclas etanol + agua
Gutiérrez Castro, Rahumir Alfredo
2012-01-01
En el presente trabajo se presenta la información fisicoquímica del proceso de disolución en mezclas binarias etanol + agua de Clonixinato de lisina (ClonLis) en diferentes temperaturas. A partir de los datos experimentales de solubilidad determinados a diferentes temperaturas, mediante el uso de las ecuaciones de Van't Hoff y Gibbs, se calcularon las funciones termodinámicas estándar aparentes de solución, energía de Gibbs, entalpía y entropía de solución. La mayor solubilidad de ClonLis fu...
Directory of Open Access Journals (Sweden)
Carolina Rodrigues Costa
2011-12-01
estudo, os efeitos de agentes antifúngicos como o fluconazol e o itraconazol sobre a formação de hifas e caracterização genotípica de isolados de C. albicans suscetíveis ou resistentes foram investigados. MÉTODOS: A produção de hifas de cinco isolados de C. albicans, sob a ação de antifúngicos foi investigada pelo cultivo da levedura em meios de crescimento e de indução de hifas. A caracterização genotípica foi realizada para 13 isolados de C. albicans pelo método de RAPD-PCR. RESULTADOS: A análise do dimorfismo mostrou que a formação de hifas foi maior nos isolados resistentes do que nos suscetíveis aos antifúngicos. O método de RAPD-PCR identificou a formação de dois diferentes grupos. No grupo A, foram agrupados quatro isolados resistentes e dois suscetíveis e no grupo B um resistente e seis suscetíveis. CONCLUSÕES: Considerando que a formação hifal foi maior em isolados resistentes na presença de azólicos, concluimos que a produção hifal está muito relacionada a suscetibilidade a estes fámacos. Estes antifúngicos podem alterar a morfologia de C. albicans em dependência da sua suscetibilidade. No método de RAPD-PCR, o encontro da maioria dos isolados resistentes classificados como pertencentes ao grupo A e suscetíveis ao grupo B demonstrou que este método apresentou um padrão semelhante entre os dois grupos, sugerindo que por este método pode ser detectado uma estreita correlação entre genótipos e amostras resistentes ao fluconazol.
Raphael J Braga; Georgios Petrides
2007-01-01
OBJETIVO: O presente artigo é uma revisão do conhecimento atual relativo às terapias somáticas em psiquiatria, com foco em transtornos psiquiátricos resistentes ao tratamento usual. MÉTODO: Foi realizada uma pesquisa computadorizada da literatura no Medline utilizando as palavras "eletroconvulsoterapia", "estimulação magnética transcraniana", "terapia magnética convulsiva", "estimulação do nervo vago" e "estimulação cerebral profunda", com todos os termos traduzidos para o idioma inglês. Refe...
Directory of Open Access Journals (Sweden)
Giacomo Magnani
2005-03-01
Full Text Available Le endocarditi su valvole native (NVE da Stafilococchi coagulasi negativi (CoNS presentano un andamento aggressivo simile a quello da Staphylococcus aureus e sono difficili da trattare per l’alta incidenza da parte dei CoNS di resistenza a oxacillina.Viene riportato un caso di NVE da Staphylococcus haemolyticus meticillino sensibile, con risposta iniziale favorevole al trattamento con oxacillina, ma con successiva recidiva a distanza di tre mesi legata comparsa di ceppo oxacillino-resistente. L’ipotesi è che l’infezione sia stata sostenuta da una popolazione batterica con fenotipo eteroresistente, che in seguito al trattamento antibiotico ha sviluppato resistenza omogenea a oxacillina. Nell’impostare un trattamento per infezioni gravi da Stafilococchi sensibili in vitro ad oxacillina è necessario considerare sempre la presenza di un eteroresistenza.
Directory of Open Access Journals (Sweden)
Verónica Bermejo
2012-08-01
Full Text Available Recientemente se ha observado un aumento en la prevalencia de Staphylococcus aureus resistente a la meticilina (SAMR en pacientes ambulatorios con infecciones de piel y partes blandas (IPyPB. Los datos epidemiológicos locales disponibles son limitados. Se realizó un estudio descriptivo, prospectivo, de consultantes con IPyPB en la División Infectología del Hospital General de Agudos Juan A. Fernández, en el período 01/10/2009 a 31/01/2011. Fueron 130; edad mediana 36 años (RIC 25.9-43.5; hombres 61.5%. El 46.9% era HIV+. Cien cultivos (76.9%, de 100 pacientes, resultaron positivos: 83 S. aureus, 8 Streptococcus spp. y 9 con otros microorganismos. De los S. aureus aislados, 62 (74.7% fueron resistentes a oxacilina, 12 (14.4% a clindamicina, 14 (16.9% a eritromicina, 5 (6% a ciprofloxacina, presentando en algunos casos más de una resistencia. Todos fueron sensibles a rifampicina y minociclina, y 98.8% (82 a trimetoprima-sulfametoxazol. El 83.8% (52 de los pacientes con SAMR tenían algún factor de riesgo (FR, sin diferencias con los pacientes con otros aislamientos. La presentación clínica más frecuente de IPyPB / SAMR fue forunculosis: 56.4 (35/62 vs. 28.9% (11/38 en infecciones por otros microorganismos (p = 0.013. La resistencia a oxacilina fue similar entre pacientes HIV+ y negativos (79.1 vs. 70%, p = 0.179 (34/43 vs. 28/40. Concluimos que en la población estudiada se encontró una alta prevalencia de SAMR, independientemente de la serología para HIV o la presencia de FR. Las opciones de tratamiento empírico para este microorganismo son minociclina y trimetoprima-sulfametoxazol.
Nuevos genotipos de arroz resistentes a la Piriculariosis obtenidos por cultivo de anteras
Directory of Open Access Journals (Sweden)
Rodolfo I Castro
2012-01-01
Full Text Available Título en inglés: New blast resistant rice genotypes obtained by and anthers culture. Resumen: En la Estación Experimental del Arroz Los Palacios, perteneciente al Instituto Nacional de Ciencias Agrícolas de Cuba (INCA, se efectuaron cruzamientos entre cuatro cultivares resistentes a la Piriculariosis y seis de buen comportamiento agronómico y las anteras de las plantas F2 fueron cultivadas in vitro para evaluar la formación de callos en tres medios líquidos: N6-1, N6-m y NL, así como la regeneración de plantas verdes y albinas, en el medio MS. Las dos primeras generaciones de las nuevas líneas obtenidas fueron evaluadas para caracteres agronómicos y la segunda generación, además, para resistencia frente a la Piriculariosis. Las líneas que combinaron resistencia a la Piriculariosis y buenos caracteres agronómicos fueron evaluadas en condiciones de infección natural, con alta presión del patógeno. La utilización de la técnica del cultivo de anteras mostró alta dependencia del genotipo y el medio de cultivo. Con el medio NL se lograron los valores más altos para la formación de callos. Se obtuvieron nuevos genotipos resistentes a la Piriculariosis y de alto rendimiento agrícola. Palabras clave: Arroz; Mejoramiento genético; Cultivo in Vitro de anteras Summary: Crosses were made between four blast resistant and six rice varieties of good agronomic performance, at the Los Palacios Rice Research Station of the National Agricultural Sciences Institute of Cuba (INCA and the anthers from F2 plants were in vitro culture using three liquid media: N6-1, N6m, and NL, for callus formation and after plants regenerations using MS medium. The first two generations of breeding lines were evaluated for agronomic characters and the second generations, also, for Blast resistant. The lines that combined resistance to Blast and good agronomic performance were evaluated under high pressure of natural Blast infection conditions. The success
Leandro de Amorim Cavalcanti
2010-01-01
Este trabalho tem por objetivo investigar a contribuição da armadura para a capacidade resistente de vigas mistas parcialmente revestidas, bem como sua eficiência para promover o comportamento conjunto aço-concreto, imprescindível para a obtenção de vigas mistas. O estudo engloba uma investigação experimental com ensaios de vigas sob flexão em quatro pontos e uma simulação numérica utilizando o pacote computacional DIANA®, visando obter dados do comportamento de vigas mistas parcialmente reve...
Directory of Open Access Journals (Sweden)
Ibonne Aydee García Romero
2005-07-01
Full Text Available Antecedentes. Las enterobacterias, antaño flora normal del tracto gastrointestinal, han cambiado su biología y emergido como agentes patógenos nosocomiales que se tornan resistentes los antibióticos conocidos. Objetivo. Realizar la caracterización epidemiológico-molecular de 20 aislamientos de Enterobacter cloacae resistentes a cefalosporinas de tercera generación; provenientes de un hospital de tercer nivel de Bogotá-Colombia. Material y métodos. Los aislamientos fueron identificados mediante sistemas automatizados Microscan y VITEK, se utilizó el Enterobacter asbureae como control externo inter-especie. La confirmación de resistencia se hizo por técnica de difusión en agar, y una vez establecida se realizó BLEE para comprobación. La determinación de puntos isoeléctricos se hizo, mediante lisis por ultrasonido y la genotipificación mediante la metodología para bacterias Gramnegativas propuesta por Versalovic. Resultados: Los aislamientos colectados durante un año fueron causantes de 15 casos de infección Intrahospitalaria y dos colonizaciones. Todos los aislamientos presentaron resistencia a cefotaxima, ceftazidima, ceftriaxona, aztreonam y ciprofloxacina, 95% a amikacina, gentamicina y cloranfenicol, 75% a trimetoprim/sulfametoxazol, 20% a cefepime y todos fueron sensibles a imipenem. Dos aislamientos fueron confirmados como productores de â-lactamasas de espectro extendido (BLEE por la técnica microbiológica de disco combinado. Por isoelectroenfoque presentaron dos â-lactamasas con puntos isoeléctricos (pI de 5,4 y 8,2. En los 18 aislamientos no inhibidos por ácido clavulánico, se detectaron entre 2 y 4 â-lactamasas con pI de 5,4; 6,0; 7,0; 8,2 y mayor que 8,2; la resistencia a cefalosporinas de tercera generación podría ser atribuida a la hiperproducción de AmpC; los valores de pI sugieren la producción simultánea de â-lactamasas tipo SHV y TEM. La genotipificación mediante tres metodologías de rep
Directory of Open Access Journals (Sweden)
C Sánchez-García
2017-01-01
Full Text Available El síndrome nefrótico se define por la asociación de proteinuria, hipoalbuminemia, hiperlipidemia y edema. El 80% de los pacientes pediátricos con síndrome nefrótico primario responde a la terapia con esteroides; el 20% restante requiere asociar otros medicamentos para alcanzar la remisión (ciclofosfamida, ciclosporina. La hiperlipidemia en el síndrome nefrótico es debida tanto a un incremento en la síntesis acompañada de disminución en la eliminación de los lípidos de la sangre; siendo la causa directa de esto la proteinuria. La hiperlipidemia incrementa el riesgo cardiovascular, así como el daño glomerular. Con base en esto, la hiperlipidemia persistente en el síndrome nefrótico resistente a esteroides debe ser tratada. Los inhibidores de la 3-hidroxi-3-metilglutaril-coenzima A (HMG-CoA reductasa han demostrado efecto antiinflamatorio, inmunomodulador y antiproliferativo. Por ello el papel de las estatinas en el síndrome nefrótico va más allá de su efecto hipolipemiante. Presentamos dos casos de pacientes pediátricos con diagnóstico de síndrome nefrótico resistente a esteroides y su evolución durante el tratamiento con ciclosporina y estatinas.
Directory of Open Access Journals (Sweden)
Laura Errecalde
Full Text Available Describimos el primer caso en Argentina de Staphylococcus aureus resistente a la meticilina adquirido en la comunidad con sensibilidad intermedia a la vancomicina y no sensibilidad a la daptomicina. Caso clínico: Paciente masculino, con antecedente de insuficiencia renal crónica en hemodiálisis y osteosíntesis de cadera debido a una fractura. Se internó por síndrome febril persistente luego del desplazamiento de la prótesis por un traumatismo. Se aisló de hemocultivos S. aureus resistente a la meticilina adquirido en la comunidad. Durante el tratamiento con vancomicina y daptomicina, se observó un aumento gradual de la CIM de vancomicina de 1 µg/ml (VSSA a 2 µg/ml (h-VISA y a 4 µg/ml (VISA, y la emergencia de no sensibilidad a daptomicina (CIM = 4 µg/ml. Al suspender la vancomicina y la daptomicina, la cepa revirtió al fenotipo de sensibilidad a ambas drogas. Es mandatorio evaluar por CIM la sensibilidad a vancomicina y a daptomicina intratratamiento cuando estas drogas se usan como terapia.
Haemonchus resistente a lactona macrocíclica em caprinos naturalmente parasitados
Directory of Open Access Journals (Sweden)
Mattos Mary Jane Tweedie de
2004-01-01
Full Text Available O ivermectin, antiparasitário amplamente utilizado em caprinos jovens, foi avaliado sobre nematódeos gastrintestinais, em todas as fases parasitárias. Doze caprinos jovens, naturalmente parasitados foram utilizados no experimento, sendo um grupo de seis animais medicado com ivermectin, na dose de 200µg.kg-1 v.o. e o outro grupo utilizado como controle. Para a avaliação, utilizou-se o teste de redução na contagem de ovos (FECR, redução de larvas infectantes e carga parasitária. Amostras fecais de caprinos foram coletadas no dia da medicação (dia zero, aos sete e catorze dias. No décimo quarto dia pós-medicação, todos os caprinos foram sacrificados, para a coleta de helmintos e cálculo da carga parasitária total. A redução do número de ovos (FECR e a eficácia sobre adultos foi de 42,10 % e 32,62 %, respectivamente.O gênero Haemonchus representou 100 % da população do grupo medicado e 99,58 % do grupo controle. Estes resultados indicam que os caprinos já estavam parasitados por Haemonchus resistente ao ivermectin.
Noldin,J.A.; Yokoyama,S.; Antunes,P.; Luzzardi,R.
2002-01-01
A utilização de cultivares de arroz irrigado resistentes a herbicidas não-seletivos, como o glufosinato de amônio, pode se constituir numa alternativa de controle de arroz daninho em lavouras de arroz irrigado. O objetivo deste trabalho foi avaliar a taxa e o sentido do cruzamento natural entre plantas de uma linhagem modificada geneticamente para resistência ao herbicida glufosinato de amônio (arroz GM) e ao arroz daninho. A taxa de cruzamento natural entre o arroz GM como receptor feminino ...
Directory of Open Access Journals (Sweden)
Gislene G. F. Nascimento
2000-10-01
Full Text Available The antimicrobial activity of plant extracts and phytochemicals was evaluated with antibiotic susceptible and resistant microorganisms. In addition, the possible synergistic effects when associated with antibiotics were studied. Extracts from the following plants were utilized: Achillea millifolium (yarrow, Caryophyllus aromaticus (clove, Melissa offficinalis (lemon-balm, Ocimun basilucum (basil, Psidium guajava (guava, Punica granatum (pomegranate, Rosmarinus officinalis (rosemary, Salvia officinalis (sage, Syzygyum joabolanum (jambolan and Thymus vulgaris (thyme. The phytochemicals benzoic acid, cinnamic acid, eugenol and farnesol were also utilized. The highest antimicrobial potentials were observed for the extracts of Caryophyllus aromaticus and Syzygyum joabolanum, which inhibited 64.2 and 57.1% of the tested microorganisms, respectively, with higher activity against antibiotic-resistant bacteria (83.3%. Sage and yarrow extracts did not present any antimicrobial activity. Association of antibiotics and plant extracts showed synergistic antibacterial activity against antibiotic-resistant bacteria. The results obtained with Pseudomonas aeruginosa was particularly interesting, since it was inhibited by clove, jambolan, pomegranate and thyme extracts. This inhibition was observed with the individual extracts and when they were used in lower concentrations with ineffective antibiotics.Foi avaliada a atividade antimicrobiana de extratos vegetais e fitofármacos frente a microrganismos sensíveis e resistentes a antibióticos, bem como observado o possível efeito sinérgico da associação entre antibióticos e extratos vegetais. Foram utilizados os extratos de plantas cujo nomes populares são: tomilho, alecrim, cravo-da-Índia, jambolão, erva cidreira, romã, goiaba, sálvia, manjericão e mil-folhas, e ainda os fitofármacos, ácido benzóico, ácido cinâmico, eugenol e farnesol. Na avaliação da atividade antimicrobiana através do m
Directory of Open Access Journals (Sweden)
M.S. Moreira
2010-01-01
Full Text Available Após sucessivos anos, aplicações do herbicida glyphosate em pomares de citros no Estado de São Paulo selecionaram biótipos resistentes de Conyza bonariensis e C. canadensis. Na ocorrência de plantas daninhas resistentes em uma área agrícola, tornam-se necessárias mudanças nas práticas de manejo para obtenção de adequado controle das populações resistentes, bem como para a redução da pressão de seleção sobre outras espécies. Assim, este trabalho foi realizado com o objetivo de identificar herbicidas alternativos para controle de biótipos de Conyza spp. resistentes ao herbicida glyphosate, com aplicações em diferentes estádios fenológicos da planta daninha. Três experimentos foram conduzidos em campo, em pomares de citros em formação, sobre plantas de buva em estádio fenológico de dez folhas e no pré-florescimento. Para plantas no estádio de dez folhas, controle satisfatório foi obtido com aplicações de glyphosate + bromacil + diuron (1.440 + 1.200 + 1.200 g ha-1, glyphosate + atrazina (1.440 + 1.500 g ha-1 e glyphosate + diuron (1.440 + 1.500 g ha-1. Quando em estádio de pré-florescimento de Conyza spp., a aplicação do herbicida amônio-glufosinato, na dose de 400 g ha-1, isolado ou associado a MSMA, bromacil+diuron, metsulfuron, carfentrazone e paraquat, foi a alternativa viável para controle dos biótipos resistentes ao glyphosate.After successive years, glyphosate applications on São Paulo-Brazil citrus orchards selected resistant biotypes of Conyza bonariensis and C. canadensis. The occurrence of herbicide-resistant weed biotypes at some agricultural area makes it necessary to change the management practices to reach effective control of the selected resistant populations, as well as to reduce selection pressure on the other species. Thus, this work aimed to identify the alternative herbicides to control glyphosate-resistant biotypes of Conyza spp., with applications at different weed phenological
Directory of Open Access Journals (Sweden)
Gustavo A. Sabatini
2009-09-01
Full Text Available To investigate the kdr (knockdown resistance resistance-associated gene mutation and determine its frequency in pyrethroid-resistant horn fly (Haematobia irritans populations, a total of 1,804 horn flies of 37 different populations from all Brazilian regions (North, Northeast, Central-West, Southeast, and South were molecular screened through polymerase chain reaction (PCR. The kdr gene was not detected in 87.08% of the flies. However, the gene was amplified in 12.92% of the flies, of which 11.70% were resistant heterozygous and 1.22% were resistant homozygous. Deviation from Hardy-Weinberg equilibrium (HWE was found only in 1 ranch with an excess of heterozygous. When populations were grouped by region, three metapopulations showed significant deviations of HWE (Central-West population, South population and Southeast population. This indicates that populations are isolated one from another and kdr occurrence seems to be an independent effect probably reflecting the insecticide strategy used by each ranch. Although resistance to pyrethroids is disseminated throughout Brazil, only 48% of resistant populations had kdr flies, and the frequency of kdr individuals in each of these resistant populations was quite low. But this study shows that, with the apparent exception of the Northeast region, the kdr mechanism associated with pyrethroid resistance occurs all over Brazil.Com o objetivo de verificar a ocorrência e determinar a frequência da mutação kdr (knock down resistance em populações de Haematobia irritans (mosca-dos-chifres resistentes aos piretróides, foram analisados 1.804 indivíduos de 37 populações de todas as Regiões do Brasil. Com exceção da Região Nordeste, o kdr (knock down resistance gene foi encontrado em populações de todas as regiões. A mutação não foi detectada em 87,08% dos indivíduos. Entretanto, o gene foi amplificado de 12,92% das moscas, das quais 11,70% se mostraram heterozigotas resistentes e 1
alpha-Adrenoceptor and opioid receptor modulation of clonidine-induced antinociception.
Sierralta, F; Naquira, D; Pinardi, G; Miranda, H F
1996-10-01
1. The antinociceptive action of clonidine (Clon) and the interactions with alpha 1, alpha 2 adrenoceptor and opioid receptor antagonists was evaluated in mice by use of chemical algesiometric test (acetic acid writhing test). 2. Clon produced a dose-dependent antinociceptive action and the ED50 for intracerebroventricular (i.c.v.) was lower than for intraperitoneal (i.p.) administration (1 ng kg-1 vs 300 ng kg-1). The parallelism of the dose-response curves indicates activation of a common receptor subtype. 3. Systemic administration of prazosin and terazosin displayed antinociceptive activity. Pretreatment with prazosin produced a dual action: i.c.v. Clon effect did not change, and i.p. Clon effect was enhanced. Yohimbine i.c.v. or i.p. did not induce antinonciception, but antagonized Clon-induced activity. These results suggest that alpha 1- and alpha 2-adrenoceptors, either located at the pre- and/or post-synaptic level, are involved in the control of spinal antinociception. 4. Naloxone (NX) and naltrexone (NTX) induced antinociceptive effects at low doses (microgram kg-1 range) and a lower antinociceptive effect at higher doses (mg kg-1 range). Low doses of NX or NTX antagonized Clon antinociception, possibly in relation to a preferential mu opioid receptor antagonism. In contrast, high doses of NX or NTX increased the antinociceptive activity of Clon, which could be due to an enhanced inhibition of the release of substance P. 5. The results obtained in the present work suggest the involvement of alpha 1-, alpha 2-adrenoceptor and opioid receptors in the modulation of the antinociceptive activity of clonidine, which seems to be exerted either at spinal and/or supraspinal level.
Directory of Open Access Journals (Sweden)
P.J. Christoffoleti
1994-08-01
Full Text Available Greenhouse experiments were conducted to compare the competitive ability of sulfonylurea resistant and susceptible kochia (Kochia scoparia L. Schard compared to wheat. The results of several replacement series experiments indicate that wheat was the dominant competitor, and an average of one wheat plant reduced resistant kochia yield per plant equal to the effect of 4.8 resistant kochia or 5.4 susceptible kochia plants. Intraspeciflc competition was more important than interspecific competition for wheat, whereas the reverse was true for the resistant and susceptible kochia. The results of the niche differentiation index (NDI indicate that wheat and either resistant or susceptible kochia are only partly limited by the same resources. The resistant and susceptible kochia, however, are limited by the same resources.Experimentos foram instalados em condições de casa-de-vegetação com o objetivo de comparar a capacidade competitiva de biotipos resistentes e suscetíveis aos herbicidas inibidores da enzima acetolactase synthase da planta daninha kochia (Kochia scoparia L. Schard comparada com trigo. Os resultados de diversos experimentos, utilizando a metodologia chamada de substitutiva, indicaram que o trigo foi o competidor dominante, e em média uma planta de trigo reduziu o crescimento da planta de kochia resistente igual ao efeito de 4,8 plantas de kochia resistente ou 5,4 plantas de kochia suscetível. A competição chamada de intraespecífíca foi mais importante que a competição interespecífica para o trigo, porém o inverso foi verdadeiro para os biotípos resistentes e susceptíveis de kochia. Os resultados do índice de diferenciação ecológica indicaram que trigo e qualquer um dos dois biotípos de kochia estudados foram limitados apenas parcialmente pelos mesmos recursos de crescimento. No entanto, o crescimento dos biotípos resistentes e susceptíveis de kochia foram limitados pelos mesmos fatores de crescimento.
Directory of Open Access Journals (Sweden)
Murilo Sala Moreira
2010-01-01
Full Text Available Este trabalho foi realizado com o objetivo de comparar, em condição controlada e não-competitiva, o crescimento de biótipos de Conyza canadensis e C. bonariensis resistente e suscetível ao herbicida glifosato, a fim de quantificar os efeitos da pressão de seleção para resistência nos biótipos. Dois experimentos foram desenvolvidos com tratamentos organizados em esquema fatorial 9 x 2, com nove avaliações periódicas de crescimento e dois biótipos de cada espécie. As variáveis avaliadas por planta foram: área foliar; massa seca da parte aérea, das raízes e total, obtendo-se, a partir desta última, a taxa de crescimento absoluto. O biótipo de C. canadensis resistente ao glifosato possui crescimento mais lento, menor acúmulo de área foliar e de massa seca que o biótipo suscetível. Menores áreas foliar e massa seca também foram registradas para o biótipo de C. bonariensis resistente ao glifosato quando comparado ao suscetível, porém com diferenças mais sutis que aquelas constatadas para C. canadensis. O crescimento absoluto do biótipo suscetível foi superior ao do resistente em ambas as espécies. A pressão de seleção para resistência ao glifosato teve impactos negativos na habilidade de crescimento dos biótipos.This work was carried out with the objective of comparing, under controlled and non-competitive condition, the growth of glyphosate-resistant and susceptible biotypes of Conyza canadensis and C. bonariensis; to quantify the effects of resistance selection pressure on the biotypes. Two trials were developed with treatments organized according to a factorial scheme 9 x 2, where nine were periodical growth evaluations and two were biotypes of each species. The variables evaluated per plant were: leaf area and dry mass (shoot, root and total; to determine absolute growth rate from the total dry mass. The glyphosate-resistant biotype of C. canadensis exhibits slower growth and smaller accumulation of leaf area
Zoila Edith Hernández Zamora; Yamilet Ehrenzeweig Sánchez; Axel Manuel Navarro Hernández
2009-01-01
Se muestran los resultados encontrados con relación al constructo Personalidad Resistente (PR) y los niveles de estrés en una muestra de 102 adultos mayores. La mayoría de los y las participantes tienen un nivel alto de PR y ninguno resultó con un nivel bajo en este constructo. Las variables asociadas significativamente con una PR alta son: sexo, independencia, escolaridad, autopercepción de salud y repercusión en el estado de ánimo de sus enfermedades. Las variables asociadas con un nivel de...
Arquitectura sismo-resistente. Un nuevo enfoque para la solución integral del problema sísmico
Directory of Open Access Journals (Sweden)
Giuliani,, Hugo
1987-02-01
Full Text Available This work only pretend to state in general terms the reasons, foundations, objectives, action fields, basical principles and compatibilization rules of the Structural Design with the Architectural Design that have allowed us to draw an approach on Seismo-Resistant Architecture and that in the future will allow its study and scientific development.
El presente trabajo, sólo pretende la formulación en términos generales de las razones, fundamentos, objetivos, campos de acción, principios básicos y pautas de compatibilización del Diseño Estructural con el Diseño Arquitectónico que nos han permitido plantear una Arquitectura Sismo-Resistente y que permitirá en el futuro su profundización y el desarrollo científico de la misma.
Directory of Open Access Journals (Sweden)
Chacón, R.
2012-09-01
Full Text Available In this paper, an in-depth analysis of the structural response of concrete-filled tubular structures (CFT is presented. The main objective of the study is to assess the resistance of these structural elements when subjected to lateral displacements. These displacements, together with the corresponding axial forces, represent the actions to which the integral bridges piers are subjected to. For the sake of studying this response, a numerical model is used as a simulation tool over an hypothetical matrix of CFT. These numerical studies together with a wide experimental database found in the literature have been useful for drawing conclusions concerning the cross-sectional capacity of the CFT. A design proposal for this cross-sectional capacity which accounts for confinement is given. This proposal has been compared structurally with the present formulation found in EN1994.
Se presenta el análisis estructural de pilas metálicas tubulares rellenas de hormigón (CFT sometidas a flexo-compresión. El objetivo principal es valorar los mecanismos resistentes de las pilas cuando se someten a un desplazamiento en cabeza. Estos desplazamientos, conjuntamente con el esfuerzo axil de compresión, que en este trabajo se aproxima con un porcentaje de la resistencia plástica a compresión de los CFT, representan las acciones a las cuales se ven sometidos los elementos de este estudio. Se utiliza una herramienta numérica sobre una base hipotética de prototipos de pilas. Los resultados numéricos obtenidos así como los resultados experimentales encontrados en la literatura han permitido extraer conclusiones relativas a la capacidad seccional de los CFT. Se proponen expresiones de diseño relativas a la capacidad resistente de los CFT considerando el efecto del confinamiento y se comparan con los resultados que se derivan de la formulación de EN1994.
Directory of Open Access Journals (Sweden)
Colantonio, Sonia Edith
2002-01-01
Full Text Available Los comportamientos correlativos de los índices cefálicos y postcefálicos en los análisis de relaciones intergrupales no han sido suficientemente explorados hasta hoy. La escasez de datos de ambos segmentos corporales ha limitado este tipo de estudios. A la vez, otras estimaciones de la "forma" mediante ajustes del "tamaño" han sido propuestas, dándose por sentada su superioridad al uso de los índices. En este ensayo se analizan la correspondencia entre formas y la eficiencia discriminante de los índices, aprovechando los datos de la colección Vellard que comprende 1734 aborígenes provenientes de 12 grupos étnicos del Gran Chaco Sudamericano. Se empleó para ello el Análisis de Homogeneidad (HOMALS, mediante el cual se calcularon los vectores propios y los "pesos" tanto de las variables (índices cuanto de los grupos en las dimensiones principales de la variación, representando gráficamente su ubicación en el sistema coordenado de las mismas. Los resultados muestran similares relaciones entre las formas de la cabeza en hombres y en mujeres, pero en éstas hay una neta independencia entre las categorías de la porción neural y las de la facial. La mayor diferenciación morfológica de los chaquenses se registra en esas regiones cefálicas, mientras que a nivel del segmento postcefálico las etnias son más semejantes. Las relaciones morfológicas interétnicas son diferentes según el sexo considerado. En el interior de cada sexo, la topología obtenida es idéntica ya se tome en cuenta solamente la cabeza o ésta conjuntamente con el cuerpo.
Directory of Open Access Journals (Sweden)
Patrícia Andréa Monquero
2005-01-01
Full Text Available Organismos geneticamente modificados (OGMs ou transgênicos podem ser plantas, animais ou microorganismos que tiveram no seu material genético a introdução de DNA proveniente de outro organismo. Em alguns casos, esse organismo poder ser outro individuo da mesma espécie, ou o mais comum, de outra espécie com o qual não há cruzamento natural. O uso dessa técnica no melhoramento de plantas permitirá aumentar a produção, reduzir perdas na pós-colheita, obter culturas mais tolerantes ao estresse ambiental, obter culturas que usem mais eficientemente nitrogênio e fósforo; aumentar o valor nutricional dos alimentos; obter plantas resistentes a herbicidas, pragas e ou doenças; desenvolver alternativas para indústrias como as de combustíveis e farmacêuticas. Alguns consumidores acreditam que OGM não é natural e que o melhoramento convencional é melhor, pois segue os princípios naturais de seleção ou usa mutações naturais. Entretanto, é possível e muito comum obter combinações indesejáveis de genes através do melhoramento tradicional. Com relação a culturas resistentes a herbicidas, várias preocupações podem ser destacadas. Essas incluem: (a deriva de herbicida para vegetação suscetível vizinha à cultura tolerante; (b cultura resistente ao herbicida pode tornar-se planta daninha de difícil controle; (c uso ilegal de sementes; (d reação pública negativa à engenharia genética; (e escape de genes para espécies nativas e (f seleção de biótipos resistentes ou de espécies tolerantes ao herbicida utilizado. A geração dos organismos geneticamente modificados tem sido alvo de polêmica e discussão nos diversos segmentos da sociedade. Porém, não se deve generalizar o uso dos transgênicos, pois cada um deve ser analisado quanto às suas vantagens, desvantagens e contribuição à melhoria da qualidade de vida.Genetically modified organisms (GMOs or transgenic may be plants, animals or microorganisms that have
Directory of Open Access Journals (Sweden)
Vianed Marsán Suárez
1999-12-01
Full Text Available Se estudiaron 118 leucemias agudas en un período de 4 años. El fenotipaje celular se realizó a través del ultramicrométodo inmunocitoquímico (UMICIQ, mediante la utilización de un panel de anticuerpos monoclonales con el que se evaluó la expresión de antígenos linfoides y mieloides. La expresión de antígenos mieloides en pacientes con leucemia linfoide aguda se encontró en el 28,4 % y de antígenos linfoides en pacientes con leucemia mieloide aguda en el 56,7 %. Las leucemias agudas híbridas representaron el 16,1 % del total de pacientes estudiados: 73,7 % al inicio de la enfermedad y el 26,3 % restante en el estudio posterior al tratamiento de inducción de la remisión, lo que sugiere en estos últimos la posibilidad de cambio de linaje por la selección de variantes resistentes a drogas procedentes del clon original, o la aparición de neoplasias secundarias por el uso de drogas genotóxicas118 acute leukemias were studied during 4 years. The cellular phenotyping was carried out through the immunocytochemical ultramicromethod by using a panel of monoclonal antibodies with which the expression of lymphoid and myeloid antigens was evaluated. The expression of myeloid antigens in patients with acute lymphoid leukemia was found in 28.4 %, whereas the expression of lymphoid antigens in patients suffering from acute myeloid leukemia was observed in 56.7 %. The acute hybrid leukemias accounted for 16.1 % of the total of patients studied: 73.7 % at the onset of the disease and the other 26.3 % in the study following the induction treatment of the referred patients, which suggests in the latter the possibility of changing lineage by selecting variantes resistant to drugs from the original clon, or the appearance of secondary neoplasias due to the use of genotoxic drugs
Directory of Open Access Journals (Sweden)
Carlos M Luna
2010-12-01
Full Text Available The global spread of methicillin-resistant Staphylococcus aureus (MRSA means it is now a pathogen of worldwide public health concern. Within Latin America, MRSA is highly prevalent, with the proportion of S. aureus isolates that are methicillin-resistant on the rise, yet resources for managing the infection are limited. While several guidelines exist for the treatment of MRSA infections, many are written for the North American or European setting and need adaptation for use in Latin America. In this article, we aim to emphasize the importance of appropriate treatment of MRSA in the healthcare and community settings of Latin America. We present a summary of the available guidelines and antibiotics, and discuss particular considerations for clinicians treating MRSA in Latin AmericaA propagação global de Staphylococcus aureus resistente à meticilina (methicillin-resistant Staphylococcus aureus - MRSA significa que se trata agora de um patógeno de interesse para a saúde pública mundial. Na América Latina, o MRSA é altamente prevalente, com a proporção de S. aureus resistente à meticilina em ascensão, no entanto os recursos para o tratamento da infecção são limitados. Embora existam várias diretrizes para o tratamento de infecções por MRSA, muitas são elaboradas para a América do Norte ou a Europa e precisam ser adaptadas para sua utilização na América Latina. Neste artigo, procuramos destacar a importância do tratamento adequado do MRSA nas unidades de saúde e na comunidade na América Latina. Apresentamos um resumo das diretrizes e dos antibióticos disponíveis, e discutimos considerações específicas para os médicos que tratam de MRSA na América Latina.
Directory of Open Access Journals (Sweden)
D.J. Soares
2012-06-01
Full Text Available Auxyn type herbicides such as dicamba and 2,4-D are alternative herbicides that can be used to control glyphosate-resistant hairy fleabane. With the forthcoming possibility of releasing dicamba-resistant and 2,4-D-resistant crops, use of these growth regulator herbicides will likely be an alternative that can be applied to the control of glyphosate resistant hairy fleabane (Conyza bonariensis. The objective of this research was to model the efficacy, through dose-response curves, of glyphosate, 2,4-D, isolated dicamba and glyphosatedicamba combinations to control a brazilian hairy fleabane population resistant to glyphosate. The greenhouse dose-response studies were conducted as a completely randomized experimental design, and the rates used for dose response curve construction were 0, 120, 240, 480, 720 and 960 g a.i. ha-1 for 2,4-D, dicamba and the dicamba combination, with glyphosate at 540 g a.e. ha-1. The rates for glyphosate alone were 0, 180, 360, 540, 720 and 960 g a.e. ha-1. Herbicides were applied when the plants were in a vegetative stage with 10 to 12 leaves and height between 12 and 15 cm. Hairy fleabane had low sensitivity to glyphosate, with poor control even at the 960 g a.e. ha-1 rate. Dicamba and 2,4-D were effective in controlling the studied hairy fleabane. Hairy fleabane responds differently to 2,4-D and dicamba. The combination of glyphosate and dicamba was not antagonistic to hairy fleabane control, and glyphosate may cause an additive effect on the control, despite the population resistance.Os herbicidas mimetizadores de auxinas como dicamba e 2,4-D são alternativas para o controle de buva resistente ao glyphosate. Com a possível futura liberação comercial de culturas resistentes ao dicamba e 2,4-D, a aplicação destes herbicidas reguladores de crescimento será uma provável alternativa de controle de buva resistente ao glyphosate. O objetivo desta pesquisa foi modelar por meio de curvas de dose-resposta a efic
Noldin, J.A.; Yokoyama, S.; Stuker, H.; Rampelotti, F.T.; Gonçalves, M.I.F.; Eberhardt, D.S.; Abreu, A.; Antunes, P.; Vieira, J.
2004-01-01
O arroz-vermelho e o arroz-preto constituem-se nas principais plantas daninhas infestantes da cultura de arroz irrigado, devido à dificuldade de controle seletivo desta espécie em lavouras comerciais. A utilização de cultivares geneticamente modificados resistentes a herbicidas não-seletivos constitui uma alternativa de controle do arroz-vermelho e arroz-preto em arroz irrigado. O objetivo deste trabalho foi avaliar o comportamento de populações híbridas F2 originárias do cruzamento entre o a...
Directory of Open Access Journals (Sweden)
Luiz Felipe Pagotto
2012-01-01
Full Text Available CONTEXTO: Prazosina, um antagonista de receptores alfa-1 adrenérgicos, é utilizada no tratamento de pesadelos e insônia relacionados com TEPT. Apesar das evidências sugerindo sua eficácia também no tratamento de sintomas gerais de TEPT, sua curta meia-vida (2-3 horas pode limitar seus efeitos terapêuticos. OBJETIVO: Descrever quatro casos de pacientes com TEPT resistentes aos inibidores de recaptação de serotonina ou de serotonina e adrenalina (terapia convencional tratados com uma apresentação de prazosina de liberação lenta. MÉTODOS: Quatro pacientes com TEPT grave, resistentes à terapia convencional, tiveram a prazosina de liberação lenta (meia-vida de 10,8 horas adicionada as suas prescrições por pelo menos três meses. Os sintomas de TEPT foram avaliados pela PCL-C e pelos itens referentes a pesadelos e insônia da CAPS, na linha de base e no final do período de observação de cada paciente. RESULTADOS: Dois pacientes mostraram melhora dos sintomas gerais de TEPT (redução de 35,7% e 11,9% nos escores da PCL-C, e três mostraram melhora de pesadelos e insônia (nos escores da CAPS. O único paciente que recebeu doses da prazosina pela manhã e ao deitar-se foi o que mostrou a maior melhora dos sintomas gerais de TEPT. CONCLUSÃO: Possivelmente, a sustentação do bloqueio da atividade noradrenérgica no sistema nervoso central promovida pela prazosina de liberação lenta durante o dia se faz necessária para a melhora de sintomas residuais de TEPT em pacientes em tratamento convencional com antidepressivos.
Directory of Open Access Journals (Sweden)
José Evando Aguiar Beserra Júnior
2007-10-01
Full Text Available Foram avaliadas 20 linhagens de melancia, provenientes do cruzamento da cultivar comercial suscetível Crimson Sweet e da introdução PI 595201 resistente ao Watermelon mosaic virus (WMV e Papaya ringspot virus (PRSV-W. As linhagens, e os parentais foram inoculados com o WMV ou com o PRSV-W em casa-de-vegetação distintas. Aos 35 e 49 dias após a primeira inoculação (DAI, as plantas foram avaliadas por meio de uma escala de notas, em que 1 (ausência de sintomas a 5 (intenso mosaico e deformações foliares. Pelos resultados infere-se que, aos 35 DAI, as linhagens 1, 2 e 20 apresentaram resistência tanto para o WMV como para o PRSV-W, com médias de 1,95, 1,80 e 2,25 para o WMV, e de 2,50, 2,30 e 2,50 para o PRSV-W, respectivamente. As linhagens 5, 7 e 13 foram resistentes somente ao WMV e as plantas das linhagens 3, 10 e 18 para o PRSV-W. A reação das linhagens permaneceu em geral pouco alterada aos 49 DAI. A existência de linhagens resistentes somente ao WMV e somente ao PRSV-W, ao lado de linhagens resistentes a ambos os vírus, é indicativo de que as resistências ao WMV e ao PRSV-W não são controladas pelos mesmos genes.Twenty advanced watermelon breeding lines, derived from the cross between cv. Crimson Sweet (susceptible and PI 595201 (resistant to WMV and PRSV-W, were screened for resistance to both potyviruses. The twenty lines, among with Crimson Sweet and PI 595201, were inoculated with either WMV or PRSV-W, in two different greenhouse trials. Plants were evaluated for symptoms 35 and 49 days after the first inoculation (DAI, using a scale from 1 (no symptoms to 5 (severe mosaic and foliar distortion. Evaluations at 35 DAI indicated that lines 1, 2 and 20 had good levels of resistance to both WMV and PRSV-W, with ratings of 1,95, 1,80 and 2,25 for WMV, and of 2,50, 2,30 and 2,50 for PRSV-W, respectively. Lines 5, 7 and 13 were resistant to WMV only, whereas lines 3, 10 and 18 were resistant to PRSV-W only. The reaction of
Directory of Open Access Journals (Sweden)
G. Concenço
2008-03-01
Full Text Available Objetivou-se com este trabalho avaliar a competitividade de dois biótipos de capim-arroz, resistente e suscetível ao quinclorac, coletados em regiões orizícolas do Estado de Santa Catarina. O experimento foi instalado em ambiente protegido, e os tratamentos constaram de diferentes densidades de plantas dos biótipos de capim-arroz comprovadamente resistente (ITJ-13 e suscetível (ITJ-17 ao quinclorac, oriundos da região arrozeira de Itajaí/SC. No centro da unidade experimental, foram semeadas três sementes do biótipo de capim-arroz, considerado como o tratamento da unidade experimental. Na periferia foram semeadas dez sementes do biótipo oposto ao do tratamento (central. Dez dias após a germinação foi efetuado o desbaste, deixando-se apenas uma planta no centro da unidade experimental e um número variável de plantas do biótipo oposto, de acordo com o tratamento (0, 1, 2, 3, 4 ou 5 plantas por vaso. O delineamento experimental utilizado foi o completamente casualizado, em esquema fatorial 2 x 6, com quatro repetições. Aos 40 dias após a emergência, foram avaliados altura de plantas, número de afilhos e de folhas, área foliar, massa fresca e seca e conteúdo de água de colmos e folhas. Os dados foram analisados pelo teste F, sendo efetuado teste de Duncan para comparar o efeito de densidade de plantas e teste da Diferença Mínima Significativa (DMS para avaliar diferenças entre os biótipos resistente e suscetível, além de correlação linear simples entre as variáveis avaliadas. Nas análises, utilizou-se o nível de 5% de probabilidade. Os biótipos estudados de capim-arroz resistente e suscetível ao quinclorac são similares quando sob alta intensidade de competição, com vantagem em algumas variáveis para o biótipo suscetível sob baixa ou moderada intensidade competitiva.The objective of this research was to evaluate the competitive potential of two Echinochloa sp. biotypes, resistant and susceptible to
Amido resistente em diversas fontes não convencionais de amido
Directory of Open Access Journals (Sweden)
C. Fontinha
2016-02-01
Full Text Available Amido resistente (AR é aquele que não é digerido no intestino delgado, conduzindo a efeitos benéficos para a saúde, tal como a fibra dietética faz. Procedeu-se à determinação do AR em farinhas e amidos extraídos de duas variedades de castanha (Castanea sativa Mill, Longal e Martainha, da bolota de azinheira (Quercus rotundifolia e da glande do sobreiro (Quercus suber. As farinhas foram obtidas por moenda dos frutos após secagem a diferentes temperaturas, 40º C, 50º C, 60ºC e 70ºC. Posteriormente, procedeu-se ao isolamento dos amidos das farinhas, através da aplicação de dois métodos de extracção: um físico-químico e outro enzimático. Verificou-se que os teores de AR mais elevados foram os apresentados pelas farinhas dos frutos secos a 60ºC, sendo de 46,8%, 36,5%, 39,9% e 43,9%, respectivamente para as castanhas das variedades Longal e Martainha, para a bolota e para a glande. O método de extracção que apresentou valores mais elevados de AR para os amidos extraídos dos diferentes materiais foi o método físico-químico. Tudo indica que a secagem dos frutos a 60ºC e a aplicação do método de extracção do amido pelo processo físico-químico nas farinhas dos frutos secos a esta temperatura são aqueles que melhor preservam a estrutura dos amidos.
Fagoterapia frente a infecciones por Staphylococcus aureus meticilino resistente en ratones
Directory of Open Access Journals (Sweden)
Jesús H Tamariz
Full Text Available Objetivos: Evaluar la actividad de los bacteriófagos frente a infecciones localizadas y sistémicas producidas por Staphylococcus aureus resistente a meticilina (MRSA Materiales y métodos. Se realizó un estudio de tipo experimental en 45 ratones de la cepa Balb/c divididos en nueve grupos de cinco individuos. Se aislaron diez bacteriófagos nativos a partir de muestras clínicas y efluentes hospitalarios, se evaluó su capacidad lítica y su espectro de actividad, en base a lo cual se seleccionaron seis fagos para los ensayos de fagoterapia. Adicionalmente, se empleó un bacteriófago de origen comercial. La fagoterapia fue evaluada mediante profilaxis y terapia de infecciones localizadas y sistémicas causadas por la inoculación de MRSA por vía subcutánea y endovenosa respectivamente. Se probó la efectividad de tres esquemas terapéuticos: monoterapia, cóctel de fagos en múltiples dosis y de cóctel de fagos en una sola dosis. También se comparó la actividad terapéutica de los fagos frente a vancomicina y clindamicina. Resultados. El cóctel de fagos y la terapia a diversas dosis fueron efectivos para prevenir y controlar infecciones localizadas por MRSA, su actividad fue similar a la de vancomicina y clindamicina. La dosis única del cóctel de fagos no logró controlar la infección localizada; asimismo, la fagoterapia no resultó efectiva en infecciones sistémicas. Conclusiones. La fagoterapia se proyecta como una alternativa viable frente a infecciones causadas por MRSA. Se requieren estudios que evalúen aspectos relacionados con la inocuidad de los fagos frente al paciente
Directory of Open Access Journals (Sweden)
Marcelo del Castillo
2004-04-01
Full Text Available Las endocarditis causadas por hongos, (Candida en particular, requieren tratamiento médico-quirúrgico, siendo la anfotericina B la droga de elección. Caspofungina es una equinocandina con gran actividad sobre Candida y Aspergillus. Se presenta un paciente con una endocarditis por Candida tropicalis resistente a fluconazol tratado con caspofungina bajo un esquema de salvataje, luego de haber presentado efectos adversos por anfotericina B. El paciente tuvo respuesta microbiológica.Fungal endocarditis, in particular due to Candida species, requires medical and surgical treatment and amphotericin B is the drug of choice. Caspofungin is an echinocandin very effective against Candida and Aspergillus. We present a patient with Candida tropicalis endocarditis, fluconazol resistant, treated with caspofungin, on a compassional basis as a result of adverse effects with amphotericin B. The patient had a microbiological response.
Directory of Open Access Journals (Sweden)
Luz Adriana Botero
2007-01-01
Resultados. El clon T. cruzi I fue más infectivo, observándose un tropismo preferencial por corazón, recto y músculo esquelético, mientras que el clon T. cruzi II presentó un tropismo preferencial por bazo e hígado. Durante la infección con la mezcla de los clones, se observó que el clon T. cruzi I predominó sobre el T. cruzi II tanto en sangre como en órganos. Conclusiones. Los resultados confirman que las diferencias genéticas entre los grupos de T. cruzi podrían estar determinando el tropismo tisular y de esta manera jugar un papel fundamental en el entendimiento de las manifestaciones clínicas de la enfermedad de Chagas en Colombia.
Directory of Open Access Journals (Sweden)
Roseane Cavalcanti dos Santos
2000-04-01
Full Text Available O uso da técnica de eletroforese para separar múltiplas formas moleculares de enzimas tem sido bastante explorada na área biológica, cujas diferenças detectadas nos tecidos podem ser eficientemente usadas para diferenciação de cultivares em qualquer fase de seu desenvolvimento fenológico. Nesse trabalho, procedeu-se ao estudo da variabilidade isoenzimática em seis linhagens de amendoim resistentes à seca, com o objetivo de se verificar as possíveis relações da variação encontrada na base desses descritores com essa aptidão no amendoim. Estudaram-se folíolos da parte apical com 5 dias após a germinação, utilizando-se a técnica de eletroforese em gel de poliacrilamida (7% sistema horizontal e contínuo de tampão. Os sistemas estudados foram fosfatase ácida (ACP, malato desidrogenase (MDH, leucina aminopeptidase (LAP, peroxidase (PO, e esterase (EST. A caracterização fenotípica dos genótipos permitiu a separação de quatro grupos para ACP, três para LAP, dois para MDH e seis para PO e EST. A partir da análise dos componentes principais dos grupos obtidos, observou-se que a cultivar IAC Tupã (sensível à seca foi separada das demais, especialmente da cultivar resistente Senegal 55437.The use of electrophoretic techniques to separate multiple molecular forms of enzymes has been used in the biological science, where differences in isozymes among tissues can be used efficiently on cultivar differentiation during any life cycle phase. In this paper, the variability of six drought resistant peanut lines was studied by isozymes analysis aiming to verify the possible relations between enzymatic descriptors and drought resistance character. Leaflets were analyzed by horizontal poliacrylamide gel electrophoresis technique and buffer continuos systems for the following systems: acid phosphatase (ACP, malate dehydrogenase (MDH, leucine aminopeptidase (LAP, peroxidase (POX and esterase (EST. The phenotypic characterization of the
Castoldi, Renata [UNESP
2011-01-01
A alface é a hortaliça folhosa de maior consumo no Brasil, no entanto a dificuldade em produzi-la vem aumentando, principalmente pela infestação das áreas de produção por Bremia lactucae, sendo necessário o monitoramento anual para utilização ou desenvolvimento de cultivares resistentes. Diante do exposto, os objetivos do presente trabalho foram: identificação de raças de B. lactucae no Estado de São Paulo, durante os anos de 2008, 2009 e 2010 e obtenção de linhagens de alface crespa resisten...
Directory of Open Access Journals (Sweden)
Diazgranados Cristina
2007-06-01
Full Text Available
En el presente estudio se obtuvo un 46% de regeneración en explantes sin cocultivo de Solanum phureja (Juzet et Buck variedad Yema de huevo clon 1 con la utilización del medio CIP-MS suplementado con reguladores de crecimiento (2 mg· L-1 ZR, 0,02 mg· L-1 ANA, 0,02 mg· L-1 AG3. A fin de mejorar los porcentajes de regeneración se modificó la proporción citoquininas:auxinas del CIP-MS obteniéndose un 55% de formación de callo con concentraciones de 2 mg· L -1 ZR y 0,04 mg· L-1 ANA. Posteriormente se evaluó el efecto de tres concentraciones de ácido giberélico (0,02 mg· L-1 , 0,05 mg· L-1 y 0,1 mg· L-1 obteniéndose un 87,6% de callogénesis y un 48,6% de regeneración mediante la utilización de un medio que contenía 2 mg· L-1 ZR, 0,04 mg· L-1 ANA, 0,02 mg· L-1 AG3 en explantes bajo condiciones de cocultivo. Estos resultados fueron corroborados en un segundo ensayo de regeneración bajo condiciones de cocultivo con Agrobacterium tumefaciens cepa LBA4404 transformada mediante el vector binario pNOV022, de lo cual se obtuvieron porcentajes de callogénesis y regeneración muy similares. Previamente se reportó un promedio de 4 ± 3,3 regenerantes por callo utilizando entrenudos de S. phureja mientras en este estudio se obtuvieron 15,2 ± 3 regenerantes por callo.
Directory of Open Access Journals (Sweden)
Célia Lúcia Siqueira
2010-10-01
Full Text Available O cultivar Prata Anã é o mais plantada no Norte de Minas Gerais, o que demonstra estar a bananicultura regional baseada numa variedade suscetível à sigatoca-negra. Apesar de existirem cultivares resistentes em fase de recomendação para o cultivo na região, ainda são escassos os trabalhos relacionados a metodologias de conservação pós-colheita. Assim, o objetivo deste trabalho foi avaliar o período de armazenamento e as características físico-químicas e sensoriais dos cultivares de bananeira Fhia - 02 e Precioso, ambos resistentes à sigatoca-negra, e o efeito da atmosfera modificada associada à refrigeração. Foram realizados três experimentos, o primeiro em temperatura ambiente, o segundo a 12 ºC e o terceiro a 15 ºC. Esses experimentos foram instalados no delineamento em blocos casualizados em esquema de parcelas subdivididas no tempo, tendo nas parcelas um fatorial 2 (com e sem embalagem x 2 (Fhia - 02 e Precioso e nas subparcelas as avaliações em intervalo de seis e dois dias para frutos armazenados nas temperaturas de 12, 15 e 25 ºC, com quatro repetições e três frutos por unidade experimental. Após o tratamento, os frutos foram dispostos em bandejas de poliestireno expandido (sem embalagem e embalagens de 10 e 16 µm e umidade relativa de 90%. As características avaliadas foram: tamanho, diâmetro, cor, firmeza, perda de matéria fresca, sólidos solúveis totais (SST, acidez total titulável (ATT, SST/ATT, pH e análise sensorial. O uso da embalagem associada à refrigeração permitiu armazenar os frutos por 28 dias, mantendo as características físico-químicas.
Directory of Open Access Journals (Sweden)
Alexander Galindo
2000-07-01
Full Text Available Los individuos afectados con Mycobacterium tuberculosis son más de un billon y cerca de 3,5 millones enferman anualmente en el mundo. La Organizaci6n Mundial de la Salud (OMS considera que estarnos ante una emergencia global de tuberculosis que podría provocar 200 millones de casos nuevos y 70 millones de muertes antes del 2020. Se estima que en 1998 fueron reportados 8.8 millones de casos nuevos y que fallecieron por esta causa cerca de 3 millones de personas, 6% de la mortalidad global del año, La alta incidencia en la población, la convierte en la principal causa de muerte en adultos en edad productiva, es decir de 15 a 49 años. Se considera que 80% de la población está dentro del grupo de alto riesgo que puede padecer esta enfermedad y se asume que más de 50 millones de personas están infectadas con cepas resistentes (Guerrero,1998 y Rattan 1998.
Directory of Open Access Journals (Sweden)
Violeta Fernández-Lansac
2011-01-01
Full Text Available La investigación en torno al cuidado no profesional de mayores con demencia ha proliferado a lo largo de los últimos años, constatando muchos autores que, del mismo modo en que el cuidado se asocia a un buen número de consecuencias negativas, diversos efectos positivos pueden derivarse de esta experiencia. Sin embargo, y a pesar del impacto de la corriente positiva en la actualidad, son muy escasos los estudios que valoran la personalidad resistente (hardiness, la resiliencia y el crecimiento personal en cuidadores. El presente artículo hace una revisión sistemática de las contribuciones más relevantes a este campo, a partir del análisis de nueve publicaciones. Todos estos trabajos evalúan, de un modo cuantitativo, la resiliencia, el hardiness o el crecimiento en familiares de personas con demencia. Las características y resultados de dichos trabajos serán valoradas, teniendo en consideración sus implicaciones para el estudio y la atención a los cuidadores
Directory of Open Access Journals (Sweden)
Angela Da Cas Bundt
2010-09-01
Full Text Available Os herbicidas imazetapir e imazapique, usados em cultivares de arroz Clearfield®, possuem alta persistência e mobilidade no solo, ocasionando danos em genótipos de arroz não resistentes cultivados em rotação. Tais herbicidas podem lixiviar e atingir maiores profundidades ao longo do perfil. Esse posicionamento em profundidade pode ser um fator de seletividade e explicar parcialmente os diferentes resultados encontrados na literatura sobre o efeito residual do herbicida no solo. O objetivo do estudo foi avaliar o efeito da profundidade de localização no solo e da mistura formulada pelos herbicidas imazetapir e imazapique (75 e 25g e.a. L-1 na fitotoxicidade em genótipos de arroz não resistentes. Nesse sentido, foram conduzidos dois experimentos em solo com 15% de argila e 1,2% de matéria orgânica, em casa-de-vegetação, no campus da Universidade Federal de Pelotas (UFPel, em Pelotas, Rio Grande do Sul (RS. O experimento I consistiu de estudo preliminar visando a determinar a profundidade máxima de localização do herbicida no solo que causa danos ao arroz não resistente, e o herbicida foi alocado nas profundidades de 0, 5, 10, 20, 30, 50 e 70cm. O experimento II também consistiu na alocação do herbicida em profundidades ao longo do perfil do solo de 3, 6, 9, 12, 15 e 18cm. As variáveis analisadas foram fitotoxicidade, massa da matéria seca e estatura das plantas. O herbicida resultante da mistura formulada de imazetapir com imazapique localizado próximo à superfície do solo causa danos intensos em plantas de arroz não resistente, porém, quando alocado em profundidades maiores que 20cm da superfície do solo, não prejudica o desenvolvimento de genótipos de arroz não resistentes a essa mistura de herbicidas.The herbicides imazethapyr and imazapic, used in Clearfield® rice, have high mobility and persistence in the soil, causing injury to non-resistant rice grown in rotation. These herbicides can leach and reach greater
Directory of Open Access Journals (Sweden)
André da Rosa Ulguim
2013-01-01
Full Text Available O objetivo deste trabalho foi avaliar a resistência de capim pé-de-galinha (Eleusine indica ao glifosato, em lavouras de soja transgênica; avaliar o efeito de aplicações de glifosato em diferentes estádios de desenvolvimento; identificar práticas agronômicas associadas à seleção de biótipos resistentes; e avaliar a eficiência dos herbicidas cletodim, fluazifope-P-butílico, clomazona, glufosinato de amônio e glifosato nas plantas resistentes. Plantas escapes ao tratamento com glifosato foram coletadas em 24 propriedades, no Rio Grande do Sul. As plantas foram cultivadas em casa de vegetação, tendo-se avaliado a sua resistência ao glifosato. Os acessos resistentes foram selecionados e avaliados quanto ao efeito da aplicação do glifosato em diferentes estádios de crescimento e quanto à sensibilidade aos herbicidas. Foi aplicado um questionário aos produtores para identificação das práticas agronômicas associadas às falhas no controle. O controle de E. indica pelo glifosato é mais efetivo com a aplicação em estádios iniciais de desenvolvimento. Práticas agronômicas, como uso contínuo de baixas doses do herbicida, aplicação em estádios de desenvolvimento avançados das plantas daninhas (mais de um afilho e a ausência de rotação de culturas foram relacionadas às falhas de controle observadas. Os herbicidas cletodim, fluazifope-P-butílico e glufosinato de amônio são alternativas eficientes para o controle de E. indica.The objective of this work was to evaluate the resistance of goose grass (Eleusine indica to glyphosate application in transgenic soybean crops; evaluate the effect of glyphosate applications in different growth stages; identify the main agronomic practices associated with the selection of resistant biotypes; and evaluate the effect of the herbicides clethodim, fluazifop-p-butyl, clomazone, glufosinate ammonium, and glyphosate on resistant plants. Plants that survived glyphosate application
Infeção por staphylococcus aureus meticilina-resistente da comunidade em Portugal
Directory of Open Access Journals (Sweden)
R. Nazareth
2012-01-01
Full Text Available Resumo: Recentemente assistiu-se à emergência de infeções na comunidade por Staphylococcus aureus meticilina-resistente (MRSA em indivíduos sem fatores de risco. O MRSA associado à comunidade (CA-MRSA parece ser mais virulento, causando desde infeções superficiais da pele e tecidos moles até fasceíte necrosante e, raramente, pneumonia.O CA-MRSA foi inicialmente identificado na Austrália no início da década de 80 e, após cerca de duas décadas, surgiu nos EUA e em vários países da Europa, Ásia e América do Sul. Não existe informação disponível acerca da prevalência em Portugal.Os autores reportam o primeiro caso de infeção por CA-MRSA em Portugal, num adulto jovem com pneumonia necrotizante grave complicada por empiema bilateral e insuficiência respiratória. Abstract: Methicillin-resistant Staphylococcus aureus (MRSA has recently emerged as a cause of community-acquired infections among individuals without risk factors. Community-associated MRSA (CA-MRSA appears to be more virulent, causing superficial mild skin and soft tissue infections to severe necrotizing fasciitis, and in rare cases, pneumonia.Community-associated MRSA was first reported in Australia in the early 80s, after almost two decades in the USA, and then in several countries in Europe, Asia and South America. No data exists in Portugal.We report the first case of CA-MRSA infection in Portugal, in a young adult with severe necrotizing pneumonia, complicated with bilateral empyema and respiratory failure. Palavras-chave: comunidade associada, MRSA, Staphylococcus aureus, pneumonia necrosante, empiema, Keywords: Community-associated, MRSA, Staphylococcus aureus, Necrotizing pneumonia, Empyema
Directory of Open Access Journals (Sweden)
Carolina Jahn
2017-01-01
Full Text Available Justificativa e objetivo: P. aeruginosa é responsável por causar grande variedade de infecções agudas e crônicas. A resistência aos carbapenêmicos está se tornando um problema terapêutico mundial e a produção de metalo-beta-lactamases (MBL tem surgido como um dos mecanismos responsáveis por esta resistência. Objetivou-se identificar as cepas produtoras de MBL e verificar a presença dos genes codificador blaNDM, blaSPM e blaIMP em isolados de P. aeruginosa resistentes aos carbapenens. Métodos: Foram analisadas 16 cepas de P. aeruginosa, isoladas de diferentes sítios de indivíduos atendidos pelo Hospital do Vale do Rio Pardo-RS, no período de março 2014 a fevereiro de 2015. A identificação bioquímica foi realizada segundo protocolo da ANVISA e o antibiograma pelo método de ágar difusão em disco. A triagem fenotípica foi feita pelo teste modificado de aproximação de discos utilizando o EDTA como inibidor e a presença dos genes através da técnica de reação em cadeia da polimerase. Resultados: O setor clínico com maior prevalência de isolamento de P. aeruginosa resistente aos carbapenens é a unidade de terapia intensiva (50%. Em relação aos espécimes clínicos, 62,5% dos isolados foram identificados no trato respiratório inferior. Através do teste fenotípico, 50% das amostras analisadas mostraram ser produtora da enzima MBL. Através da técnica de reação em cadeia da polimerase foi possível identificar a presença de um dos três genes propostos, sendo eles blaSPM. Conclusão: Os isolados de P. aeruginosa mostraram serem produtores de MBL e apresentaram o gene de resistência blaSPM nesta espécie no interior do Rio Grande do Sul. Palavras Chaves: Pseudomonas aeruginosa; metalo-beta-lactamases; blaNDM, blaIMP, e blaSPM .
Directory of Open Access Journals (Sweden)
Zoila Edith Hernández Zamora
2009-01-01
Full Text Available Se muestran los resultados encontrados con relación al constructo Personalidad Resistente (PR y los niveles de estrés en una muestra de 102 adultos mayores. La mayoría de los y las participantes tienen un nivel alto de PR y ninguno resultó con un nivel bajo en este constructo. Las variables asociadas significativamente con una PR alta son: sexo, independencia, escolaridad, autopercepción de salud y repercusión en el estado de ánimo de sus enfermedades. Las variables asociadas con un nivel de estrés bajo son: satisfacción con el apoyo familiar y de amistades, escolaridad, número de enfermedades, autopercepción de salud, influencia en el estado de ánimo de sus enfermedades y estado de ánimo. Estos resultados, además, comprueban la hipótesis de que tener una PR alta está relacionado significativamente con un nivel de estrés bajo.
Directory of Open Access Journals (Sweden)
Elba Guerrero
2013-03-01
Full Text Available The relation of ethambutol resistance to embB mutations remains unclear, and there are no reports on ethambutol resistance from the Caribbean. We examined the sequence of embB in 57 distinct Multi-Drug Resistant (MDR and non-MDR strains of Mycobacterium tuberculosis, mostly from Cuba and the Dominican Republic. embB306 codon mutations were found exclusively in MDR-TB, but in both ethambutol sensitive and resistant strains. Valine substitutions predominated in ethambutol resistant strains, while isoleucine replacements were more common in sensitive strains. Three ethambutol resistant MDR strains without embB306 substitutions had replacements in embB406 or embB497, but these were also found in ethambutol sensitive MDR strains. The results confirm previous findings that amino acid substitutions in EmbB306, EmbB406 and EmbB497 are found only in MDR-TB strains but in both phenotypically resistant and sensitive strains. One ethambutol resistant non-MDR strain did not have any embB mutation suggesting that other undefined mutations can also confer ethambutol resistance.La relación entre resistencia a etambutol y mutaciones en embB no se ha establecido claramente y no existen comunicaciones sobre la resistencia a etambutol en cepas provenientes de países Caribeños. Se evaluó la secuencia del gen embB en 57 cepas de Mycobacterium tuberculosis multi-drogo resistentes (MDR y no-MDR, la mayoría aislada en Cuba y República Dominicana. Se encontraron mutaciones en el codón embB306 exclusivamente en cepas MDR, tanto en cepas sensibles como resistentes a etambutol. Tres cepas MDR resistentes a etambutol, sin sustituciones en embB306, tenían mutaciones en los codones embB406 o embB497, pero estos cambios se encontraron también en cepas sensibles. Los resultados confirman otros estudios, mostrando que sustituciones aminoacídicas en EmbB306, EmbB406 y EmbB497 se encuentran exclusivamente en cepas MDR, tanto resistentes como sensibles a etambutol
Directory of Open Access Journals (Sweden)
Aline Marchese
2010-09-01
Full Text Available O objetivo deste trabalho foi selecionar clones de batata-doce (Ipomoea batatas resistentes à raça 1 de Meloidogyne incognita e avaliar a eficiência do método de seleção empregado, pela estimação dos coeficientes de variação genética e ambiental e das herdabilidades no sentido amplo. Foram utilizados 123 genótipos de batata-doce, entre os quais quatro cultivares comerciais - Brazlândia Rosada, Brazlândia Roxa, Brazlândia Branca e Palmas -, e 119 acessos previamente selecionados no programa de melhoramento vegetal da Universidade Federal de Lavras. O delineamento experimental utilizado foi o de blocos aumentados, com três tratamentos comuns: as cultivares de batata-doce Brazlândia Branca e Palmas, e a cultivar de tomate Santa Clara, suscetível ao nematoide. A classificação dos níveis de resistência foi realizada de acordo com o fator de reprodução do nematoide e o índice de reprodução relativo à cultivar Santa Clara, de tomateiro. A relação entre os coeficientes de variação genética e ambiental e as herdabilidades no sentido amplo foram altas, tanto para o fator de reprodução quanto para o índice de reprodução dos nematoides, o que demonstra a eficiência do método empregado para a seleção de genótipos resistentes. Foram identificados 57 genótipos promissores de batata-doce, resistentes à raça 1 de M. incognita, e selecionados para continuar no programa de melhoramento.The objective of this work was to select sweetpotato (Ipomoea batatas resistant clones to Meloidogyne incognita race 1, and to assess the efficiency of the selection method deployed, through the estimation of genetic and environmental coefficients of variation, and broad-sense heritabilities. Genotypes assessed comprised 123 sweetpotato entries altogether, including four commercial cultivars - Brazlândia Rosada, Brazlândia Roxa, Brazlândia Branca, Palmas - and 119 clones previously selected by the Universidade Federal de Lavras
Directory of Open Access Journals (Sweden)
Gabriel Pérez Giffoni
2011-12-01
Full Text Available El objetivo de este trabajo fue caracterizar fenotípica y genotípicamente dos aislamientos de Neisseria meningitidis resistentes a rifampicina relacionados con dos eventos independientes de transmisión de enfermedad meningocócica grave que se presentaron en septiembre y octubre de 2010 en Montevideo, Uruguay. Se revisó también la base de datos de la vigilancia nacional de resistencia a los antimicrobianos de los últimos 10 años, para estimar la frecuencia de la particularidad de los meningococos caracterizados. La resistencia a rifampicina se estudió por el método epsilométrico. El serotipo y serosubtipo de los aislamientos se determinaron por ELISA y la caracterización genotípica se realizó por digestión del ADN con NheI y electroforesis en gel con campo pulsátil. Ambos aislamientos eran idénticos, B:2a:P1.5, y su fenotipo no figuraba en la colección de 408 cepas de N. meningitidis aisladas en el Uruguay en los últimos 10 años, con la excepción de dos aislamientos sensibles a rifampicina. Los dos aislamientos estudiados también compartían un pulsotipo único, diferente del de otros dos aislamientos resistentes a rifampicina obtenidos en 2003 y 2007. Por lo tanto, ambos eventos de transmisión fueron causados por una única cepa resistente a rifampicina, que podría haberse introducido al país desde otras regiones o haberse originado por un cambio del serogrupo C al B, como producto de la presión selectiva ejercida por vacunas administradas a la población. Es necesario mantener y extremar la vigilancia. No obstante, en vista de que hasta el momento este tipo de hallazgo ha sido esporádico, no se justifica cambiar el fármaco antimicrobiano que se administra a los contactos para la profilaxis, a menos que se identifique un caso secundario.The objective of this study was to characterize the phenotype and genotype of two isolates of rifampicin-resistant Neisseria meningitidis associated with two independent events
EVALUACIÓN DEL DISEÑO DE UNA PEQUEÑA MESA VIBRATORIA PARA ENSAYOS EN INGENIERÍA SISMO-RESISTENTE
Directory of Open Access Journals (Sweden)
Julián Carrillo
2013-01-01
Full Text Available Las consecuencias catastróficas de los sismos han incentivado la realización de estudios experimentales para mitigar los efectos de los sismos sobre las estructuras. En el artículo se presenta la evaluación de los diseños mecánico, neumático, estructural, de control y de adquisición de datos, de una pequeña mesa vibratoria uniaxial para ensayos de estructuras a escala reducida. Inicialmente se eligieron los elementos mecánicos que permiten el movimiento de la mesa. Luego se validó el desempeño del sistema a partir de herramientas de simulación. Finalmente se estudió la automatización de la mesa por medio de un control con sistema de lazo abierto, implementado en un micro-controlador. La mesa vibratoria propuesta es una herramienta versátil y económica para realizar pruebas experimentales orientadas al análisis y diseño de estructuras sometidas a eventos sísmicos. El dispositivo propuesto promoverá la investigación no sólo en nuevos materiales, sino en diseño y rehabilitación de viviendas, edificios y puentes sismo-resistentes.
Directory of Open Access Journals (Sweden)
Ray Ticse
2012-03-01
Full Text Available La piomiositis tropical difusa primaria es una enfermedad de presentación infrecuente en nuestro medio, con pocos casos asociados a Staphylococcus aureus meticilino resistente, adquirido en la comunidad (MRSA-AC. Se presenta el caso de un paciente de 70 años, con tratamiento irregular para diabetes mellitus tipo 2, que fue hospitalizado por presentar un cuadro de diez días de evolución, con dolor lumbar irradiado a miembro inferior izquierdo, fiebre y flexión forzada de la cadera derecha por dolor a la movilización. El diagnóstico de piomiositis difusa de ambos psoas se realizó con resonancia magnética. Del cultivo de una colección paravertebral posterior se aisló Staphylococcus aureus resistente a oxacilina, penicilina y dicloxacilina.Diffuse tropical primary pyomyositis is an infrequent entity in our country, with few cases associated to communityacquired Methicillin- resistant Staphylococcus aureus. There are no reported cases of Community-Acquired Methicillin- Resistant Staphylococcus aureus (CA- MRSA in Peru. We present the case of a 70 year old male with a previous diagnosis of type 2 diabetes mellitus, receiving irregular treatment, who was admitted to the hospital with a history of 10 days of low back pain radiating to the left leg, fever and forced flexion of the right hip due to pain during movement. The diagnosis of diffuse pyomyositis of both psoas muscles was performed with MRI and culture of a posterior paravertebral collection, from which Staphylococcus aureus resistant to oxacillin, penicillin and dicloxacillin was isolated.
Directory of Open Access Journals (Sweden)
Rodolfo Notario
2011-08-01
Full Text Available Se compararon 8 aislamientos de Campylobacter jejuni provenientes de humanos con enfermedad diarreica aguda, con 23 aislamientos de cloaca de gallinas y pollos obtenidos de zonas próximas a la ciudad de Rosario, todos resistentes a la ciprofloxacina. Las muestras se sembraron en agar selectivo y se incubaron en microaerofilia a 42 °C. Las colonias se identificaron con el método tradicional. Los aislamientos se conservaron a -70 °C en caldo cerebro corazón con 17% v/v de glicerina. La clonalidad se determinó por RAPD-PCR, utilizando el primer 1254 (Stern NJ. Se interpretaron los aislamientos como clones distintos cuando diferían en una banda de amplificación. Se obtuvieron 5 clones diferentes. Los patrones I, II y V fueron aislados en criaderos industriales de pollos y en humanos (el II también en un establecimiento de gallinas ponedoras de huevos. En un gallinero familiar se obtuvo el patrón I. El patrón III sólo se obtuvo de humanos. El patrón IV se halló en uno de los criaderos pero no en humanos. Se pudo determinar que 93.5% de las cepas se aislaron tanto de animales como de humanos, por lo que se considera posible que la colonización de criaderos con cepas resistentes a los antimicrobianos pudiera ser el origen de la infección de humanos.Eight quinolone resistant Campylobacter jejuni strains isolated from humans with diarrheal disease were compared with 23 isolates from chicken and from laying hens. Samples were cultured on selective agar in microaerophilia, identified by conventional tests, and conserved in 17% glycerol at -70 °C. Clones were determined by RAPD-PCR employing the 1254 primer (Stern NJ. Five patterns were obtained. Patterns I, II, and V were found in both poultry and human isolates. Pattern I was obtained from poultry in a domestic henhouse. Pattern III was only obtained from humans whereas pattern IV was only obtained from poultry. A 95.3% of clones were found in both, humans and poultry. According to these
Directory of Open Access Journals (Sweden)
L.O.B. Schuch
2008-01-01
Full Text Available Objetivou-se com este trabalho avaliar o potencial competitivo de biótipos de capim-arroz resistente e suscetível ao quinclorac no ambiente do solo, como forma de inferir qual deles possui maior potencial de extração de recursos. O experimento foi instalado em casa de vegetação, constando de diferentes populações de plantas dos biótipos de capim-arroz resistente (R e suscetível (S ao herbicida quinclorac, oriundos da região arrozeira de Itajaí/SC. Foi estabelecida uma planta do biótipo de capim-arroz considerado como tratamento, no centro da unidade experimental; na periferia, foram semeadas dez sementes do biótipo oposto ao do tratamento central, sendo posteriormente estabelecido o número de plantas de acordo com o tratamento (0, 1, 2, 3, 4 ou 5 plantas. O delineamento experimental foi o completamente casualizado, em esquema fatorial 2 x 6, com quatro repetições. Aos 40 DAE, foram avaliados o comprimento, volume, massa fresca, massa seca e conteúdo de água das raízes das plantas. Os dados obtidos foram submetidos à análise de variância e, em caso de significância, efetuou-se o teste de Duncan, para avaliar o efeito do aumento na população de plantas, e o teste da Diferença Mínima Significativa (DMS, para avaliar diferenças entre biótipo resistente e suscetível, além da matriz de correlação. A imposição de competição no ambiente das raízes pode afetar mais o biótipo resistente ao quinclorac que o suscetível, sendo esta característica essencial para a sobrevivência do biótipo, principalmente sob escassez do recurso.The objective of this work was to evaluate the competitive potential of Echinochloa plants resistant and susceptible to quinclorac in the soil, to evaluate whether there are potential differences in extracting nutrients from the soil. The trial was carried out under greenhouse conditions. The treatments consisted of amounts of Echinochloa plants resistant or susceptible to quinclorac. At the
Directory of Open Access Journals (Sweden)
Cristina Boccaccio
2014-06-01
Full Text Available La mastitis y los abscesos de mama representan un factor de riesgo para el abandono de la lactancia. Se incluyen dentro de las infecciones de piel y partes blandas y comparten los cambios epidemiológicos que llevan a replantear el tratamiento empírico inicial. Se estudiaron 137 casos de abscesos de mama desde enero de 2007 a diciembre de 2011. Se analizó incidencia, días postparto, factores de riesgo, datos microbiológicos y tratamiento antibiótico. Desde 2007a 2011 se observó un constante aumento de la incidencia de casos: 0.19 vs. 0.84% (p < 0.001. Días postparto de aparición del absceso 41.9 ± 35.8 días (Media ± DE, primiparidad 70.6%. Los factores de riesgo más frecuentemente encontrados fueron grietas del pezón e ingurgitación mamaria (95%. Staphylococcus aureus (SA fue el responsable de 82.3 a 95.0% de los abscesos según los años; la resistencia a oxacilina de las cepas de SA superó el 60%. Las cepas aisladas de SA meticilino resistentes (SAMR fueron sensibles a eritromicina clindamicina, gentamicina, rifampicina, ciprofloxacina y trimetroprima-sulfametoxasol en diferentes porcentajes según los años. Requirieron drenaje el 100% de los casos; en 60% el tratamiento empírico inicial fue inadecuado. Continuaron amamantando 90% de las madres. Estos datos enfatizan la necesidad de prevenir los factores de riesgo: grietas del pezón e ingurgitación mamaria. La modificación del tratamiento antibiótico inicial requiere el estudio bacteriológico de las infecciones de piel y partes blandas dado que la prevalencia de SAMR no es uniforme y varía en diferentes poblaciones y ubicaciones geográficas.
Mastite bovina causada por Staphylococcus spp. resistentes à meticilina: revisão de literatura
Directory of Open Access Journals (Sweden)
José Givanildo Silva
Full Text Available RESUMO: Staphylococcus spp. são os micro-organismos mais relacionados a casos de mastite bovina. Algumas cepas destes micro-organismos têm apresentado fatores de virulência como genes de resistência a antimicrobianos com destaque para a resistência à meticilina que é um problema de saúde pública. Esta revisão de literatura tem o objetivo de compilar dados sobre a mastite bovina causada por Staphylococcus spp. resistente à meticilina (MRS. Apesar desse antimicrobiano não ser comumente utilizado no tratamento das mastites, a frequência de casos de infecção da glândula mamária causada por MRS tem variado entre 1,34 a 47,6%. Acredita-se que o contato dos humanos com animais positivos para MRS e vice-versa favoreça a transmissão deste patógeno entre as espécies, contribuindo para a variação nas taxas de infecção. A detecção de MRS pode ser realizada por meio de provas fenotípicas, moleculares ou sorológicas e as medidas de controle devem contemplar a identificação dos casos, segregação dos animais, estudo epidemiológico da fonte de infecção do rebanho, além da constante limpeza e higienização do ambiente de confinamento, equipamentos e utensílios de ordenha. Casos de mastite ocasionados por esse patógeno assumem relevância para a saúde pública, pois a ingestão de leite e/ou derivados contaminados podem desencadear a transferência de MRS para seres humanos. Com isso, é necessário um alerta constante quanto à vigilância epidemiológica em fazendas leiteiras.
Directory of Open Access Journals (Sweden)
Guilherme Amorim Homem de Abreu Loureiro
2017-09-01
Full Text Available Los desafíos técnicos y cientícos actuales para el cultivo del cacao implican la necesidad de evaluar múltiples atributos relacionados con la producción primaria y con los criterios de calidad. El estudio se realizó con el clon de cacao PH-16 en la zona húmeda de la región cacaotera de Bahia, Brasil. El objetivo fue conocer la inuencia del sitio de cultivo sobre las variables físicas y químicas antes y después de la fermentación de los granos de cacao. Las variables químicas más inuenciadas por el medio ambiente fueron el pH y la acidez total de los granos con mucílago, y el pH, acidez total e índice de pigmentos de los granos fermentados. El sitio de cultivo que corresponde al Argisol Amarillo Distróco latosólico, en el sistema agroforestal Cabruca con densidad media de 35 árboles de sombra por hectárea, presentó los granos con mejores atributos de calidad.
Sistema de autoconstrucción sismorresistente: características resistentes y proceso constructivo
Directory of Open Access Journals (Sweden)
Orta, B.
2016-06-01
Full Text Available The dwelling construction with soil, adobe or brick without call for technical advice is very typical in countries in process of development that are in areas of high seismic risk. To give an answer to the problem of earthquake building using these materials, providing simplicity of construction, we have worked for years in the use of the Integral Masonry System (IMS. The IMS is a system that, used combined with native materials, has earthquake resistant properties and its ease of implementation makes it suitable for self-build earthquake-resistant dwellings. This article describes the IMS, develops the constructive process applied to a type of two storey houses, and shows the seismic behaviour by means of the results obtained in the three test campaigns. The originality of the system lies in the use of a single type of prefabricated trusses, intertwined in the three spatial directions allowing create a dimensional mesh.La autoconstrucción con tierra, adobe o ladrillo es muy habitual en los países en vías de desarrollo que están en zonas de alto riesgo sísmico. Ante la necesidad de dar respuesta al problema, aportando sencillez constructiva, hemos trabajado desde hace años en el empleo del Sistema de Albañilería Integral (SAI. El SAI es un sistema que, combinado con materiales autóctonos, aporta resistencia sísmica y su facilidad de ejecución lo hace adecuado para la autoconstrucción de viviendas antisísmicas. Este artículo describe el SAI, desarrolla el proceso constructivo aplicado a una vivienda tipo de dos alturas y muestra su comportamiento sismo-resistente mediante los resultados obtenidos en tres campañas de ensayos. La originalidad del sistema radica en el empleo de un solo tipo de armaduras prefabricadas en forma de cercha que se entrelazan entre si en las tres direcciones del espacio permitiendo crear una malla tridimensional.
Directory of Open Access Journals (Sweden)
Renata Rodrigues Teixeira de Castro
2006-11-01
Full Text Available A epilepsia é uma das causas mais freqüentes de distúrbios neurológicos em adultos jovens. Relatamos um caso em que uma paciente conviveu durante doze anos com o diagnóstico de epilepsia resistente ao tratamento, quando, na verdade, a causa de seus sintomas pôde ser encontrada com a realização do teste de inclinação (tilt teste. O cardiologista deve estar alerta para o possível diagnóstico de síncope neurocardiogênica em pacientes previamente diagnosticados como portadores de epilepsia, especialmente naqueles com difícil controle terapêutico.Epilepsy is one of the most frequent causes of neurological disorders in young adults. We report the case of a patient who lived with the diagnosis of refractory epilepsy for twelve years, when actually the cause of the symptoms could be found with the performance of a tilt table test. Cardiologists should be aware of the possible diagnosis of neurocardiogenic syncope in patients previously diagnosed with epilepsy, especially in those with difficult therapeutic control.
Directory of Open Access Journals (Sweden)
Mario Andrés Salgado-Gálvez
2015-03-01
Full Text Available De acuerdo al Reglamento NSR-10 las ciudades de Bogotá y Medellín tienen los mismos coeficientes de diseño Aa y Av que, desde una primera lectura, indicarían el mismo nivel de amenaza sísmica. Sin embargo, la selección del período de retorno para diseño sismo resistente corresponde a una decisión arbitraria y valores iguales de amenaza en ambas ciudades corresponden a una mera coincidencia, dado que, la amenaza sísmica en cada caso se ve influenciada por entornos sismo-tectónicos totalmente diferentes. La comparación de los resultados de riesgo sísmico, desde el punto de vista físico, de ambas ciudades, permite identificar la influencia de las fuentes sismogénicas, los efectos de sitio y la vulnerabilidad física en dichos análisis.
Directory of Open Access Journals (Sweden)
Jorge Antonio Freile Almeida
2018-01-01
Full Text Available El objetivo de la presente investigación fue analizar la relación de los microorganismos del suelo y las principales enfermedades que afectan los clones promisorios de cacao (Theobroma cacao L. en la Amazonía Ecuatoriana. Se evaluaron los clones EET-95, EET-96, EET-103 y CCN-51, respectivamente, éste último utilizado como control, para ello, se determinó la cantidad de bacterias, hongos y actinomicetos totales, expresados en unidades formadoras de colonias (UFC por gramo de suelo, presentes en la rizósfera de los tres clones de cacao, así como la aparición de las principales enfermedades que atacan al cultivo del cacao. Los datos fueron analizados estadísticamente mediante ANOVA de un factor y prueba HSD de Tukey p≤0,05. Las bacterias fueron los microorganismos de mayor asociación a los clones en este estudio, seguido de actinomicetos y hongos. El clon CCN-51 presentó la mayor cantidad de bacterias, los clones EET-96 y EET-103, presentaron mayor incidencia de actinomicetos y el clon EET-103, la mayor presencia de hongos. La enfermedad escoba de bruja, cuyo agente causal es Cripinellis perniciosa Sthael Singer., afectó en menor medida a los clones EET-103 y CCN-51, mientras que la moniliasis causada por el hongo Moniliophthora roreri (Cif & Par Evans et al., puso en evidencia al clon EET-103 con la mayor incidencia de esta enfermedad y conversivamente al clon CCN-51 con la menor incidencia del patógeno.
Directory of Open Access Journals (Sweden)
ADRIANA E. MARVALDI
2005-03-01
, Mesoptiliinae (= Magdalidinae, Molytinae, Baridinae, Lixinae, Conoderinae (= Zygopinae, Cossoninae, Scolytinae y Platypodinae. En la presente contribución se brinda una clave dicotómica para la identificación de las siete familias y 28 subfamilias de Curculionoidea sudamericanos, y para varias (21 tribus de Curculioninae y Molytinae. Estas tribus son Curculionini, Anthonomini, Ceutorhynchini, Derelomini, Otidocephalini, Erodiscini, Camarotini, Piazorhinini, Prionobrachiini, Smicronychini, Rhamphini y Tychiini, dentro de Curculioninae, e Hylobiini, Pissodini, Conotrachelini, Cleogonini, Sternechini, Pacholenini, Cholini, Petalochilini y Amalactini, dentro de Molytinae. La mayoría de estas tribus han sido clasificadas como subfamilias en los esquemas tradicionales. La clave se basa principalmente en caracteres morfológicos externos, e incluye además datos de la genitalia, piezas bucales, y rasgos biológicos de las especies. El trabajo provee definiciones e ilustraciones de los caracteres diagnósticos utilizados en la clave
Rodríguez Aguilar, Daniel Eduardo
2013-01-01
El almidón resistente retrogradado (AR3) de las variedades Pastusa (Solanum tuberosum grupo andigena) y Guaneña (Solanum tuberosum grupo phureja) fue evaluado como aditivo funcional con características similares a la fibra dietaria. En un primer experimento se comparó con manano oligosacáridos (MOS) a tres niveles de inclusión (0.5%, 1.0% y 1.5%) y un control sin suplementar, donde 600 pollos machos Ross de un día de edad fueron repartidos aleatoriamente a 10 tratamientos ex...
Multiplicación del clon de banano ‘FHIA-18’ (AAAB en Sistema de Inmersión Temporal
Directory of Open Access Journals (Sweden)
Milagros Basail Pérez
2012-01-01
Full Text Available Título en inglés: Multiplication of banana clone 'FHIA-18' (AAAB in Temporary Immersion System Resumen Con el propósito de desarrollar un protocolo para la multiplicación del clon de banano ´FHIA-18´ (AAAB en sistema de inmersión temporal, se definieron como objetivos del trabajo determinar el efecto del tiempo (5, 10 y 15 minutos y la frecuencia de inmersión (3, 6 y 8 horas por día, así como la influencia de diferentes combinaciones de reguladores del crecimiento (2,0; 3,0 y 4,0 mg.L-1 de 6-BAP y 2,0; 2,5; 3,0; 3,5 y 4,0 mg.L-1 de 6 AIA, el efecto del volumen de medio de cultivo por planta (20, 30, 40 y 50 ml/explante y la densidad de explantes por frasco de cultivo (30, 50, 70 y 90 explantes/frasco para incrementar el coeficiente de multiplicación. Con el empleo de un tiempo de 10 minutos y una frecuencia de inmersión cada tres horas, se alcanzaron los mejores resultados en cuanto al número de explantes obtenidos. Con este tiempo y frecuencia de inmersión los explantes presentaron el mayor diámetro del pseudotallo. Para cada frasco de 10,0 L se inocularon 70 explantes y la renovación con 2800 ml de medio de cultivo (40 ml/explante con un tiempo de cultivo de 21 días permitió alcanzar la mayor productividad del material en fase de multiplicación. Además al utilizar las sales MS suplementadas con 3,0 mg.L-1 de 6-BAP; 2,0 mg.L-1 de AIA; 10,0 mg.L-1 de ácido ascórbico, se logró disminuir el crecimiento innecesario de los tallos y hojas de los brotes en la fase de multiplicación y por lo tanto un mayor número de explantes. Palabras claves: coeficiente, densidad de explantes, tiempo, frecuencia, volumen de medio de cultivo. Abstract In order to develop a protocol for multiplication of Banana clone 'FHIA-18' (AAAB in temporary immersion systems, the following working objectives were defined: to determine the effect of immersion time (5, 10 and 15 minutes and frequency (3, 6 and 8 hours per day, as well as, the influence
Directory of Open Access Journals (Sweden)
M.A. García-Moreno
2017-01-01
Full Text Available Introducción : La resistencia a los antibióticos por parte de las bacterias está provocando gran impacto negativo en la salud humana y en la producción animal. Actualmente, Staphylococcus aureus es considerada dentro de los seis principales grupos bacterianos con mayores reportes de aparición de resistencia a nivel mundial . Por otro lado , durante décadas las plantas de uso medicinal han sido fuente importante de compuestos bactericida s ; sin embargo, también se ha empezado a documentar otras moléculas con otros mecanismos antimicrobianos , como es la inhibici ón de la percepción de quórum ( anti - p ercepción de q u ó rum ( APQ . En la medicina tradicional mexicana las hojas de aguacate mexicano ( Persea americana var drymifolia han sido empleadas para tratar diversos padecimientos que involucran infecciones bacterianas, por lo que es factible contenga compuesto s que pose a n efectos antioxidantes , bactericidas y APQ, que ayuden a combat ir las infecciones de cepas resistentes. De t al manera , que e l objetivo de esta investigación fue determinar el efecto de los polifenoles totales de las hojas de Persea americana var. drymifolia y su actividad APQ sobre cepas de S. aureus resistente s a meticilina (MRSA . Método s : Se obtuvieron l os polifenoles presente s en las hojas de 18 cultivares de aguacate mexicano mediante extracción asistida por ultrasonido y fueron purificados en una columna de amberlita . E stos polifenoles fueron analizados funcionalmente y evaluados contra cepas de S. aureu s MRSA para determinar su efecto APQ sobre el sistema denominado Agr . Resultados : Los polifenoles extraídos de las hojas de aguacate de raza mexicana exhiben una fuerte actividad bactericida . D e los 18 cultivares probados, la variedad María Elena fue la que presentó el mayor efecto , exhibiendo una CMI de 116 μg∙ mL - 1 y un CMB de 133 μg∙ mL - 1 contra la cepa de MRSA μ3 . Sin embargo, también logran inhibir los niveles
Directory of Open Access Journals (Sweden)
Fernando Machado dos Santos
2015-12-01
Full Text Available RESUMO A buva (Conyza sumatrensis, uma das principais plantas daninhas já identificadas no sul do Brasil, vem apresentando controle insatisfatório, em resposta à aplicação dos herbicidas chlorimuron-ethyl e glyphosate. Por esta razão, o objetivo deste estudo foi avaliar herbicidas alternativos, visando ao controle de biótipos de C. sumatrensis, com resistência de nível baixo ao herbicida chlorimuron-ethyl e resistentes ao herbicida glyphosate. O experimento foi realizado em casa de vegetação, entre abril e agosto de 2012, no município de Passo Fundo, RS. O delineamento experimental foi o inteiramente casualizado, com quatro repetições, sendo avaliados 15 tratamentos com herbicidas, além de uma testemunha sem aplicação. As variáveis consideradas foram controle percentual, aos 14, 21 e 28 dias após a aplicação dos tratamentos (DAT e a matéria seca da parte aérea, aos 28 DAT. Como resultados, observou-se que os biótipos foram 100% controlados, aos 28 DAT, pelos tratamentos alternativos de paraquat + diuron; ammonium glufosinate; glyphosate + 2,4-D; glyphosate + ammonium glufosinate; 2,4-D; tembotrione e tembotrione + atrazine. O biótipo 17 evidenciou menor sensibilidade aos herbicidas inibidores da ALS e os biótipos 05, 17 e 20 não foram controlados pelo herbicida glyphosate.
Directory of Open Access Journals (Sweden)
Consuelo Montes Rojas
2010-04-01
Full Text Available En el noroccidente de Popayán, Colombia, se evaluó la presencia de plagas causadas por patógenos en 42 clones de lulo (Solanum quitoense Lam.. Los clones fueron plantados en bolsas plásticas, donde se desarrollaron por 3 semanas antes de ser trasplantados al campo. Se utilizó un diseño de bloques completos al azar con cuatro repeticiones, la parcela útil estuvo conformada por 6 plantas, las cuales se sembraron a ‘tresbolillo’ a 2.5 m entre surcos y 2 m entre plantas. Para determinar el efecto de las plagas en el cultivo, se calculó el porcentaje de incidencia y severidad del ataque. La incidencia se evaluó como porcentaje de plantas afectadas, y la severidad como porcentaje de tejido afectado por el patógeno. Las enfermedades más limitantes para los 42 clones fueron: gota (Phytophthora infestans que provocó una mortalidad de plantas superior a 40%; fusarium (Fusarium oxysporum que se presentó en 12 de los clones evaluados; antracnosis (Colletotrichum sp. que afectó 21 clones, los cuales se clasificaron entre tolerantes y medianamente tolerantes; y mancha clorótica (Cladosporium sp. que afectó 21 clones, clasificados como susceptibles. Los clones PL19, PL24, PL11, PL35 fueron medianamente tolerantes. Se seleccionaron por supervivencia los clones: JY E1 (52.2%, PH E 1 (45.8%, VM E2 (45.8%; por supervivencia y por tolerancia a Fusarium oxysporum los clones PL35, PL11, PL24, PL8, PL19, 120052, 120043, ORE1, AGE1. Los clones SER 7, SER 15, SER 9, SEC 31, SEC 27 presentaron alta mortalidad pero se seleccionaron por ser medianamente tolerantes a gota, tolerantes a antracnosis y medianamente resistentes a nematodos, con buen vigor y producción.Presence of plant disease caused by pathogens on 42 clones of Solanum quitoense Lam. were evaluated in the north-western region of Popayán, Colombia. The seed of the clons were planted in plastic bags during three weeks and afterwards transplanted to the field. The statistical design
J.A. Noldin; S. Yokoyama; H. Stuker; F.T. Rampelotti; M.I.F. Gonçalves; D.S. Eberhardt; A. Abreu; P. Antunes; J. Vieira
2004-01-01
O arroz-vermelho e o arroz-preto constituem-se nas principais plantas daninhas infestantes da cultura de arroz irrigado, devido à dificuldade de controle seletivo desta espécie em lavouras comerciais. A utilização de cultivares geneticamente modificados resistentes a herbicidas não-seletivos constitui uma alternativa de controle do arroz-vermelho e arroz-preto em arroz irrigado. O objetivo deste trabalho foi avaliar o comportamento de populações híbridas F2 originárias do cruzamento entre o a...
Leandra Zafalon Jaekel
2013-01-01
Resumo: O interesse dos consumidores por alimentos com características funcionais tem aumentado nos últimos anos. A farinha de trigo de grão inteiro (FTGI) contém constituintes com efeitos benéficos a saúde (fibras, minerais, vitaminas, antioxidantes e aminoácidos). O amido resistente (AR) também tem sua contribuição à saúde, atuando como fibra alimentar. Massas alimentícias, cuja produção brasileira cresce a cada ano, constituem uma excelente forma de aplicação dessas matérias-primas. Contud...
AMIDO DISPONÍVEL E RESISTENTE EM ALIMENTOS: ADAPTAÇÃO DO MÉTODO DA AOAC 996.11
Directory of Open Access Journals (Sweden)
M. WALTER
2008-09-01
Full Text Available
Muitos métodos para a quantificação do amido disponível (AD e resistente (AR foram desenvolvidos nos últimos anos. Entretanto, a utilização de diferentes enzimas, assim como de diferentes quantidades de amostra, leva a variações no teor destas frações dificultando a comparação dos resultados obtidos. Desta forma, o objetivo do presente trabalho foi avaliar o efeito da utilização de protease, do aumento da quantidade de amostra (de 100mg para 300mg e da substituição do tampão MOPS pH 7,0 por tampão fosfato pH 6,8 na determinação de AD e AR pela técnica da AOAC 996.11. Para tanto, utilizou-se como amostra amido de milho, arroz branco polido, banana verde e flocos de milho. A utilização de protease no processo de digestão, bem como o aumento na quantidade de amostra, influenciaram significativamente o teor de AD e AR para a maioria dos materiais analisados. Já, a substituição por tampão fosfato não resultou em variação significativa para os teores de AD e AR. Portanto, o protocolo com as três modificações, por apresentar melhor simulação das condições hidrolíticas no trato gastrintestinal, menores coeficientes de variação e custo reduzido pela substituição do tampão, seria o mais adequado à quantificação destas frações do amido.
Directory of Open Access Journals (Sweden)
Cleudson Castro
1995-09-01
Full Text Available Descreve-se um caso de calazar grave resistente a dez cursos de antimonial petitavalente (glucantime à base de 20mg de Sb5/kg/dia, que respondeu favoravelmente ao sulfato de aminosidine intramuscular na dose de 20mg/kg/dia por 20 dias, repetido após 20 dias. O parasitismo esplénico passou de 50 parasitos por campo a 3 parasitos em 10 campos logo após a primeira série de sulfato de aminosidine, tornando-se negativo depois de sete meses. A melhora clínica foi imediata, com redução gradual da hepatoesplenomegalia, e desaparecimento 26 meses após. Neste período aumentou 13 kg. Após o uso de aminosidine a reação de Monténégro tornou-se positiva e as células mononucleares responderam quando estimuladas com antígenos de leishmânia.A grave kala-azar infection in a 14 years old boy is described. The leishmanial infection failed to respond to ten interrupted courses of glucantime of variable duration (14-56 days at a dose of 20mg Sb5/kg/day. However a favorable response ocurred to intramuscular aminosidine sulphate (20mg/kg/day for 20 days. This same regimen was repeated 20 days later. After the first treatment splenic puncture parasite density fell from 50 amastigotes per oil immersion field to 3 amastigotes in 10 fields. A further splenic puncture 7 months after treatment was negative. The marked hepatoesplenomegaly gradually resolved over 26 months follow up and he gained 13 kilogramas in weight. After aminosidine sulphate therapy his Montenegro reaction become positive and his lymphocytes responded to leishmania antigens.
Directory of Open Access Journals (Sweden)
Gaspar-Tébar, Demetrio
1980-09-01
Full Text Available Not available
En el presente trabajo (segundo de otro amplio en el que se estudia la influencia que ejercen diversas adiciones a tres cementos portland, desde un punto de vista de su comportamiento químico-resistente, frente a la acción de distintos medios potencialmente agresivos y que será objeto de otras publicaciones se da cuenta de la evolución que experimenta la resistencia química por el método de Koch-Steinegger y de las variaciones de las resistencias mecánicas a flexotracción de las probetas de mortero (1:3 de 1 X 1 X 6 cm hechas con un cemento portland industrial resistente al yeso (cemento 2 <> P-450-Y y con las mezclas cemento 2/escoria granulada (vítrea = 85/15 - 65/35 - 40/60 y 30/70 (en peso, sumergidas en agua potable filtrada, unas series de 12 probetas, y en agua de mar artificial (ASTM D 1141-75, otras series análogas, durante 56-90-180 y 360 días, después de haberlas curado 24 horas en un recinto saturado de humedad y hasta 21 días bajo agua potable filtrada.
Directory of Open Access Journals (Sweden)
Alexis Monzote López
2016-01-01
Full Text Available Objetivo: Definir la tasa de resistencia a la meticilina entre los aislamientos de Staphylococcus aureus investigados y describir la susceptibilidad a los antimicrobianos no betalactámicos. Método: Se realizó un estudio observacional prospectivo durante el período 2010-2012 en el Hospital Pediátrico “Juan Manuel Márquez” de La Habana, que incluyó 333 aislamientos de Staphylococcus aureus resistente a la meticilina (SARM, recuperados a partir de diferentes muestras clínicas de pacientes hospitalizados. Para la confirmación de SARM se emplearon los métodos de difusión con discos de cefoxitina y el de microdilución en caldo para la oxacilina. La susceptibilidad a 14 antimicrobianos no betalactámicos se realizó por el método de microdilución en caldo y el de difusión en disco (Bauer-Kirby. Resultados: Se demostró una alta tasa de resistencia a la meticilina (52,4% - 59,3%. Se puso de manifiesto la emergencia de infecciones de la piel y tejidos blandos (62,5% por SARM. Se corroboró una alta resistencia a la eritromicina (82% y la ciprofloxacina (73,5%. La sensibilidad frente al cotrimoxazol, la clindamicina y la vancomicina los ratificaron como antimicrobianos de primera línea para el tratamiento. Conclusiones: Se evidencia una tendencia al incremento de las infecciones por SARM y se señala como un problema clínico epidemiológico emergente para los diferentes servicios del hospital, que demanda la implementación de un sistema para su activa vigilancia y control.
Directory of Open Access Journals (Sweden)
Luciane Cristina Gelatti
2009-10-01
Full Text Available Staphylococcus aureus é uma bactéria responsável por uma ampla variedade de enfermidades infecciosas. A grande preocupação está relacionada, principalmente, com os isolados resistentes à meticilina (MRSA, que, tradicionalmente, estavam limitados aos hospitais. Nos últimos anos, infecções causadas por MRSA associadas ou adquiridas na comunidade (CA-MRSA têm sido relatadas com frequência crescente em todo o mundo. Algumas características fenotípicas e genéticas são distintas entre a forma de infecção hospitalar e a comunitária. Atualmente, verifica-se um perfil de sensibilidade reduzido para diferentes antimicrobianos; sendo assim faz-se necessário um alerta aos profissionais da saúde, particularmente aos dermatologistas, para a importância da distinção entre as formas de infecções, evitando uma terapia empírica incorreta e sem sucesso.Staphylococcus aureus is responsible for a broad variety of infectious diseases. The main concern is about methicillin-resistant isolates (MRSA, which are usually limited to hospitals. In recent years, community associated or acquired MRSA infections (CA-MRSA have been frequently reported and emerged in the world. Some phenotypic and genotypic characteristics are distinct between hospital and community infection. Currently, there is reduced sensibility profile to different antimicrobials, reason why it is necessary to issue an alert to healthcare professionals, dermatologists in particular, about the importance of knowing the differences between the infections, preventing wrong and unsuccessful empirical therapy.
Directory of Open Access Journals (Sweden)
Edgardo R. TRÉMOUILLES
2005-01-01
Full Text Available Se estudiaron los representantes sudamericanos del género Hydrovatus Motschulsky. Se diagnostica cada una de las tres especies conocidas, enfatizando el reconocimiento de caracteres valiosos para su identificación; las principales diferencias se resumen en una clave. Para identificar los ejemplares sudamericanos de H. caraibus Sharp, se los comparó con especímenes de AméricaCentral, incluyendo material tipo. En base al material examinado, H. caraibus se encuentra ampliamente distribuida en America Central y del Sur, con representantes de diferentes áreas separados por diferencias menores. Lasdistribuciones geográficas de las tres especies se amplían considerablemente: H. crassulus Sharp y H. turbinatus Zimmermann se citan por primera vez de Paraguay, y H. caraibus se cita por primera vez de Argentina y Nicaragua. Se presenta información bionómica de las especies.
Energy Technology Data Exchange (ETDEWEB)
Kwan, W.H.; Cheah, C.B.; Ramli, M.; Chang, K.Y.
2018-04-01
The durability of the alkali-resistant (AR) glass fiber reinforced concrete (GFRC) in three simulated aggresive environments, namely tropical climate, cyclic air and seawater and seawater immersion was investigated. Durability examinations include chloride diffusion, gas permeability, X-ray diffraction (XRD) and scanning electron microscopy examination (SEM). The fiber content is in the range of 0.6 % to 2.4 %. Results reveal that the specimen containing highest AR glass fiber content suffered severe strength loss in seawater environment and relatively milder strength loss under cyclic conditions. The permeability property was found to be more inferior with the increase in the fiber content of the concrete. This suggests that the AR glass fiber is not suitable for use as the fiber reinforcement in concrete is exposed to seawater. However, in both the tropical climate and cyclic wetting and drying, the incorporation of AR glass fiber prevents a drastic increase in permeability. [Spanish] Este trabajo se centra en el estudio de la durabilidad de hormigón reforzado con fibra de vidrio resistente a álcalis (CRFVRA) en tres ambientes agresivos simulados como son, condiciones de clima tropical, ciclos de aire y agua de mar e inmersión marina. Los tests de durabilidad incluyeron la difusión de cloruros, permeabilidad de gas, difracción de rayos X (XRD) y evaluacion por microscopía electrónica de barrido (SEM). Los contenidos de fibra evaluados estuvieron en el rango desde 0.6% hasta 2.4%. Los resultados revelan que la muestra que contiene el mayor porcentaje de fibra sufre una severa pérdida de resistencia en condiciones de agua de mar, y una menor disminución de resistencia bajo condiciones cíclicas. Su permeabilidad disminuyó al incrementar el contenido de fibras en el hormigón. Lo anterior sugiere que el refuerzo con fibra resistente a alcalinos no es adecuado para su uso en hormigón en ambiente de agua de mar. Sin embargo, bajo condiciones de clima
Directory of Open Access Journals (Sweden)
D. Rodríguez-Aguilar
2014-01-01
Full Text Available El almidón resistente retrogradado (AR3 de las variedades de papa Pastusa (Solanum tuberosum grupo tuberosum y Guaneña (Solanum tuberosum grupo phureja fue evaluado como aditivo funcional con características similares a la fibra dietaria y por su potencial prebiótico en pollos de engorde. Se asignaron aleatoriamente 792 pollos machos Ross de un día de edad a uno de cinco tratamientos experimentales bajo un diseño completamente al azar. Se evaluaron niveles de suplementación de 1,0% de AR3 –Pastusa (AR3P y Guaneña (AR3G–, frente a manano-oligosacáridos (MOS, 0,5%, carboximetilcelulosa (CMC, 1%, levadura comercial (LEV, 0,5% y un control sin suplementar. Los datos se analizaron mediante el procedimiento GLM del programa SAS®. MOS y AR3P mostraron el mayor peso y ganancia de peso corporal al día 42 de edad (P<0,05, MOS presentó el menor consumo de alimento frente al tratamiento CMC (P<0,05, con una mejor conversión alimenticia comparado con CMC y el control sin suplementar (P<0,05. Los grupos AR3P y AR3G tuvieron un comportamiento intermedio para la conversión de alimento. El mayor porcentaje de eficiencia americana e índice de productividad fue para MOS, seguido de AR3P frente al control sin suplementar (P<0,05. Con referencia al ingreso neto parcial por pollo fraccionado, MOS mostró el mayor ingreso comparado con AR3G, observando para los demás tratamientos un comportamiento intermedio (P<0,05. Los resultados sugieren que el AR3P tiene potencial para ser usado como un aditivo funcional en dietas para pollos de engorde durante un ciclo comercial de producción.
Directory of Open Access Journals (Sweden)
Gabriela Sandoval-Cancino
2013-01-01
Full Text Available El objetivo de este estudio fue evaluar el efecto de biofertilizantes y medios de cultivo sobre la tolerancia al establecimiento aséptico y la inducción de la organogénesis en banano. Se utilizaron explantes de hijuelos de dos genotipos de Musa cavendish AAA, cultivares ‘Clon Francés’ y ‘Clon Oaxaqueño’. Se evaluaron tres aplicaciones de biofertilizante (1 g de Glomus intraradices, 1 ml de la bacteria diazotrófica 11B y la interacción de ambos microorganismos y una sin biofertilizantes. Se sembraron los ápices en tres medios de cultivo: MS sin reguladores de crecimiento, MS adicionado con 22.2 μM de bencilaminopurina (BAP y MS adicionado con 11.4 μM de ácido indolacético (AIA y 22.2 μM de BAP. Se midieron las relaciones hídricas, el contenido de catalasa y peroxidasa, los explantes con brotes y los brotes por explante. En ambos clones se elevó la inducción de la organogénesis con la adición de BAP y por la biofertilización previa de los hijuelos. En el ‘Clon Oaxaqueño’ los tratamientos 6, 8 y 11 indujeron mayor organogénesis, con promedios entre 66 y 71 % de explantes con brotes y entre 3.16 y 2.28 brotes por explante. Para el ‘Clon Francés’ los tratamientos 8 y 9 elevaron la inducción de la organogénesis con promedios de 66 hasta 83 % de explantes con brotes y 1.83 a 2.16 brotes por explante. En ambos genotipos, los biofertilizantes propiciaron mayor porcentaje de supervivencia, mayor tolerancia a la oxidación y menor contaminación. En los dos genotipos, los tratamientos 1 (Glomus intraradices y 4 (Testigo produjeron menos estrés en las plantas.
Identificación de una nueva proteína en Leishmania (Viannia peruviana
Directory of Open Access Journals (Sweden)
Maxy De los Santos
1998-01-01
Full Text Available El análisis de la secuencia nucleotídica y aminoacídica de un clon de la biblioteca de expresión en fago λgt11 de Leishmania (Viannia peruviana, estableció identidad parcial con los genes de las proteínas acídicas ribosomales P2 de Leishmania (Leishmania infantum. Este hallazgo unido a ciertos dominios geonómicos conservados, sugeridos de la comparación de 14 secuencias de otras proteínas P1 eucarióticas, confirman que la secuencia del inserto de clon codifica la proteína acídica ribosomal P1 de L. (V. peruviana denominada LpP1. Este es el primer reporte sobre este tipo de proteína en el género Leishmania.
Directory of Open Access Journals (Sweden)
Naomi Kato Simas
2007-08-01
Full Text Available Fractionation of Piper nigrum ethanol extract, biomonitored by assays on pyrethroid-resistant Aedes aegypti larvae yielded isolation of the larvicidal amides piperolein-A and piperine. Comparing LC50 values, the ethanol extract (0. 98 ppm was the most toxic, followed by piperolein-A (1. 46ppm and piperine (1. 53ppm.O fracionamento do extrato etanólico de Piper nigrum biomonitorado por ensaios em larvas de Aedes aegypti resistentes a piretróides resultou no isolamento das amidas larvicidas piperoleína-A e piperina. Comparando-se os valores de CL50, o extrato etanólico (0. 98ppm foi o mais tóxico, seguido pela piperoleína-A (1. 46ppm e piperina (1. 53ppm.
Directory of Open Access Journals (Sweden)
Nelson Enrique Arenas
2012-09-01
Full Text Available Objetivo: Analizar los factores sociodemográficos y clínicos de los pacientes con diagnóstico de tuberculosis resistente en el municipio de Armenia durante el período 2006-2009. Métodos: Se realizó un estudio descriptivo y retrospectivo con base en la notificación de pacientes con tuberculosis resistentes durante el período de estudio. Los datos fueron tomados de los registros consignados en las fichas de notificación y las tarjetas individuales de tratamiento categoría IV. Resultados: Entre 2006 y 2009, 678 pacientes ingresaron en el programa de control de la tuberculosis. De ellos, 14 casos (2,0% fueron resistentes al menos a un medicamento, y entre estos, 7 (50% fueron multirresistentes. El 21% estuvo asociado a infección por virus de la inmunodeficiencia humana. La tasa de fallecimientos en pacientes con tuberculosis con farmacorresistencia múltiple fue del 71%. Se encontró amplificación de la resistencia en 2 casos, quienes presentaron deterioro en el estado de salud y deceso. Conclusión: La situación en Armenia de resistencia a antituberculosos es de proporción similar a la del resto del país. Se encontraron factores de riesgo conocidos en los casos de resistencia (coinfección con virus de la inmunodeficiencia humana, farmacodependencia, abandono social en la mayoría de casos, pero también de resistencia primaria y sin factores de riesgo con farmacorresistencia múltiple y una alta mortalidad, lo que llama la atención para mejorar la vigilancia y el control de los casos en tratamiento en la ciudad.Objective: To analyze the socio-demographic and clinical diagnosis of patients with resistant tuberculosis in the municipality of Armenia in the period 2006-2009. Methods: We performed a retrospective descriptive study based on the notification of patients with resistant tuberculosis during the study period, data were taken from registrations under notification forms and individual treatment cards category IV. Results: 678
Genotype, phenotype and cancer: Role of low penetrance genes ...
Indian Academy of Sciences (India)
Unknown
cancer families using linkage analysis and positional clon- ing and have ... Analysis of such data provide evidence ..... polygenic disorders like cancer, diabetes, obesity etc. it is ... Boffetta P 2003 Meta- and pooled analyses of GSTM1,. GSTT1 ...
Lifescience Database Archive (English)
Full Text Available 3'HPRT insertion targeting and chromosome engineering clone MHPP164a17. 46 1.3 1 CK255549 |CK255549.1 EST73...nd read from insert in 3'HPRT insertion targeting and chromosome engineering clon
Directory of Open Access Journals (Sweden)
A. Corso
2009-03-01
Full Text Available During the period 1993-2001, a total of 1,499 pneumococci isolates were recovered through the Argentinean surveillance of Streptococcus pneumoniae causing invasive disease in children under 6 years of age, 3.5% of which were erythromycin resistant. Among the 50 erythromycin-resistant strains available, 58% (n=29 harbored mefA/E genes (15 mefA, 30%; and 14 mefE, 28%, 34% (n=17 ermB, and 6% (n=3 both mefA/E plus ermB genes, while one isolate was negative for all the acquired genes studied. The England14-9 (42%, Poland6B-20 (20% and Spain9v-3 (16% clones were responsible for the emergence of pneumococcal macrolide resistance in pediatric population from Argentina.En el marco del programa de vigilancia regional SIREVA, se analizaron 1499 aislamientos de Streptococcus pneumoniae causantes de enfermedad invasiva en menores de 6 años, recuperados entre 1993 y 2001. Se detectó un 3,5% de resistencia a eritromicina. De los 50 aislamientos resistentes a eritromicina que pudieron ser estudiados, el 58% (n=29 tenían los genes mefA/E (15 mefA, 30% y 14 mefE, 28%, el 34% (n=17 el gen ermB y el 6% (n=3 la combinación de genes mefA/E y ermB. Sólo un aislamiento fue negativo para todos los genes analizados. Los clones internacionales England14-9, Poland6B-20 y Spain9v-3 representaron el 78% del total de aislamientos resistentes (42, 20 y 16%, respectivamente y se consideraron los responsables de la emergencia de la resistencia a macrólidos entre los neumococos que afectan a la población pediátrica de Argentina.
Directory of Open Access Journals (Sweden)
Deborah dos Santos Garruti
2012-05-01
Full Text Available O Mal da Sigatoka Negra é devastador para as cultivares tradicionais de banana. No Brasil, cultivares resistentes estão sendo desenvolvidas, mas se a preferência do consumidor não for considerada, o programa de melhoramento pode falhar. Neste trabalho, a aceitabilidade de quatro cultivares resistentes foi acessada no Nordeste brasileiro e comparada a quatro variedades comerciais. Dois grupos de consumidores participaram: adultos jovens e donas de casa. Escala hedônica foi aplicada para aparência externa dos cachos, aceitação global e aceitação por atributos dos frutos (aparência sem a casca, aroma, sabor e textura, além de testes de preferência e intenção de compra. Os dados foram submetidos à ANOVA e Mapa de Preferência Interno. Mulheres e jovens mostraram opiniões semelhantes. As cultivares 'Preciosa' e 'Pacovan Ken' mostraram ser as mais promissoras, sendo que a primeira já pode substituir as cultivares comerciais 'Prata' e 'Pacovan' sem prejudicar a sua aceitabilidade, mas a 'Pacovan Ken' ainda precisa ser melhorada quanto à aparência.The Black Sigatoka Disease is devastating to traditional banana cultivars. In Brazil, resistant cultivars are being developed but if the consumer's preference is not taken into account, the breeding program may not succeed. In this research the acceptability of four resistant cultivars was accessed in the Northeastern Brazilian region and compared to four commercial varieties. Two groups of consumers participated: young adults and housewives. Hedonic scale was applied to external appearance of bunches, global acceptance and acceptance of fruits' attributes (appearance without peel, aroma, flavor and texture. Preference and purchase intent were also evaluated. Data were submitted to ANOVA and Preference Mapping. Women and young adults showed similar opinions. 'Preciosa' and 'Pacovan Ken' cultivars showed to be the most promising ones. 'Preciosa' can already substitute the commercial 'Prata
Directory of Open Access Journals (Sweden)
Paula Lüttjohann Rodrigues
2015-09-01
Full Text Available Introdução: Nos últimos anos, a incidência mundial de enterobactérias resistentes a carbapenêmicos (ERC tem aumentado. A disseminação de ERC é preocupante considerando as limitações terapêuticas e a alta mortalidade de infecções causadas por essas bactérias. O objetivo deste estudo foi determinar a incidência de infecções por ERC em pacientes previamente colonizados. Métodos: Estudo de coorte, retrospectivo, realizado em hospital universitário de Porto Alegre, no período de janeiro a dezembro de 2014. Foram incluídos todos os pacientes com coleta de swab retal para pesquisa de ERC. Foram considerados infectados pacientes com isolado de ERC em amostra clínica que apresentaram swab retal prévio positivo para a mesma espécie. A mortalidade bruta foi analisada em 30 dias após o isolamento de ERC. Resultados: Foram coletados 2.733 swabs retais, sendo 78 (2,85% destes positivos para ERC (pacientes colonizados. Um total de 33% (26/78 dos pacientes colonizados também apresentaram ERC em amostra clínica. O tempo médio entre o isolamento de ERC em swab (colonização e em material clínico (infecção foi de 14,9 dias (± 13,6. A maior parte das amostras clínicas positivas para ERC foi em urina (46,1%; 12/26. A mortalidade foi de 61% (16/26 nos pacientes colonizados e com infecção versus 46% (24/52 nos pacientes colonizados que não desenvolveram infecção. Conclusão: Nossos dados demonstram que 1/3 de pacientes colonizados desenvolveram infecção por ERC. Foi possível observar uma mortalidade maior em pacientes infectados em relação a pacientes apenas colonizados por ERC.
Directory of Open Access Journals (Sweden)
Clara Inés Agudelo
2006-06-01
Full Text Available Introducción. Streptococcus pneumoniae es una las principales causas de morbilidad y mortalidad en niños y adultos en el mundo. Objetivo. Realizar un análisis de los datos de la vigilancia por el laboratorio de los aislamientos invasores de S. pneumoniae recuperados entre 1994 y 2004. Materiales y métodos. Se empleó la información de los aislamientos invasores de S. pneumoniae recibidos en el Grupo de Microbiología del Instituto Nacional de Salud durante la vigilancia de meningitis bacteriana aguda e infección respiratoria aguda entre 1994 y 2004. Los aislamientos contaban con datos epidemiológicos, serotipo, patrones de susceptibilidad antimicrobiana y algunos con tipificación molecular. Resultados. Se analizaron los datos de 2.022 aislamientos procedentes de 120 hospitales de diferentes regiones del país, recuperados principalmente de hemocultivos (50,7% y líquido cefalorraquídeo (42%. Los serotipos más importantes fueron el 14, 6B, 23F, 1, 5, 6A, 19F, 18C y 9V, los cuales corresponden al 83,6% en niños menores de 6 años, al 74,0% en el grupo de 6 a 14 años y al 61,4% en mayores de 14 años. El 29,8% de los aislamientos presentó susceptibilidad disminuida a la penicilina (SDP, 44,3% a trimetoprim-sulfametoxazol, 32,4% a tetraciclina, 8,2% a cloranfenicol, 3,8% a eritromicina; todos fueron sensibles a vancomicina y el 13% fue multirresistente. Se tipificaron 602 aislamientos con SDP, de los cuales 27 (4,5% se relacionaron con el clon 1-España23F, 38 (6,3% con el clon 2-España6B, 301 (50% con el 3- España9V y 75 (12,5% con el clon 26-Colombia23F, además, los 138 aislamientos con tipo capsular 5 se relacionaron con el clon 19-Colombia5. Conclusiones. Los resultados proporcionan información básica necesaria para el diseño e implementación de estrategias para la prevención de la enfermedad neumocócica en nuestro país.
The plasma membrane intrinsic proteins (PIP) are one of the five aquaporin protein subfamilies. Aquaporin proteins are known to facilitate water transport through biological membranes. In order to identify NIP aquaporin gene candidates in cotton (Gossypium hirsutum L.), in silico and molecular clon...
Directory of Open Access Journals (Sweden)
Monterde Comba, Guillermo J.
1984-12-01
Full Text Available This theoretical and experimental study on cement or lime and cement mortars brings up to date the contents of Chapter 3: MORTARS, of Norm MV 201-1972 "Resistant brick-work walls" which lost its validity when disappeared portland cement P-250, substituted by portland cement PA-350 with active additions, prescribed in the new Standard RC-75 "Standard of general technical prescriptions for cements acceptance" being obligatory its fulfilment.
El presente estudio teórico y experimental sobre morteros, de cemento o de cal y cemento, constituye la puesta al día del contenido del Capítulo 3º MORTEROS, de la Norma MV 201-1972 "Muros resistentes de fábrica de ladrillo'', que perdió su vigencia con la desaparición del cemento portland P-250, sustituido por el cemento portland PA-350 con adiciones activas prescrito en el nuevo Pliego RC-75 "Pliego de prescripciones técnicas generales para la recepción de cementos" de obligado cumplimiento.
Tuta absoluta: una nueva plaga para el cultivo del tomate en Europa (Sesión Técnia: Hortalizas)
Stol, W.; Griepink, F.C.; Deventer, van P.
2009-01-01
Tuta absoluta es una polilla originaria de Chile cuyas larvas producen minas en las hojas de las plantas de tomate. En las últimas décadas de este insecto se ha extendido por gran parte del continente sudamericano. Después de su primera observación en Europa (España, Valencia) en 2007, esta polilla
Stol, W.; Griepink, F.C.; Deventer, van P.
2009-01-01
Tuta absoluta es una polilla originaria de Chile cuyas larvas producen minas en las hojas de las plantas de tomate. En las últimas décadas de este insecto se ha extendido por gran parte del continente sudamericano. Después de su primera observación en Europa (España, Valencia) en 2007, esta polilla
Directory of Open Access Journals (Sweden)
A. Jasovich
2008-12-01
Full Text Available Enterococcus raffinosus is scarcely found in clinical samples and even less frequently as etiologic agent of endocarditis. We are herein presenting one case of mitral prosthetic-valve endocarditis in a 77-y-o male due to a vancomycinresistant Enterococcus raffinosus isolate, successfully treated with 6 weeks of linezolid, and a two-year follow up.Enterococcus raffinosus es una especie poco frecuente en materiales clínicos y menos aún como agente etiológico de endocarditis. En este trabajo se presenta un caso de endocarditis de válvula mitral protésica en un paciente de 77 años debida a Enterococcus raffinosus resistente a vancomicina y que fue exitosamente tratada con linezolid durante 6 semanas, con un seguimiento de 2 años.
Calidad de consumo en variedades de boniato
Directory of Open Access Journals (Sweden)
Sergio Caballo
2011-04-01
Full Text Available El presente trabajo describe una experiencia de degustación de cuatro variedades de boniatos, Beauregard, INIA- Arapey, Morada INTA, y el clon E9227.1, en dos formas de cocción, hervidos y horneados, realizada en INIA y LATU. Dos paneles pilotos de consumidores de ambas instituciones, evaluaron los atributos de sabor, textura, color y agrado general, empleando una escala hedónica de nueve puntos. El aspecto comercial fue evaluado estableciendo el orden de preferencia de las variedades sin cocinar. Se realizaron ensayos fisicoquímicos de fructosa, glucosa, sacarosa y maltosa sobre el material crudo y de materia seca y sólidos solubles totales a las muestras crudas y cocidas. El Morada se diferenció por su alto contenido de materia seca y sólidos solubles totales (SST del material procesado. El análisis estadístico determinó mayor preferencia en aspecto comercial de Morada y clon E9227.1, como también un mayor valor en sabor y agrado general, tanto en la forma hervida como horneada. El valor obtenido en el atributo de color fue mayor en las variedades de pulpa naranja, Beauregard y clon E9227.1. Estos resultados podrían tomarse como orientativos de las preferencias de consumidores uruguayos y una referencia para el mejoramiento genético, la producción, el comercio y el consumo. Sería recomendable ajustar medidas analíticas que se correlacionen con las preferencias sensoriales.
Directory of Open Access Journals (Sweden)
Josely Pinto de Moura
2007-09-01
Full Text Available OBJECTIVE: To assess professional nurses', associate degree prepared nurses', licensed practical nurses', and nursing assistants' knowledge of the causes of multi-resistant bacterial infections, the risks theses infections pose to health care providers, the chain of transmission of these infections, and patients' susceptibility to colonization of these multi-resistant bacterial infections. METHODS: This descriptive study was conducted in a major general hospital in Minas Gerais, Brazil. The sample consisted of 42 nursing staff from a medical clinical unit. Descriptive statistics were used to analyze and present the data. RESULTS: Nursing staff had unsatisfactory knowledge of the causes of multi-resistant bacterial infections, the chain of transmission of multi-resistant bacterial infections, and patients' susceptibility to colonization of multi-resistant bacterial infections. However, the majority of participants had some knowledge about the risks that multi-resistant bacterial infections posed to health care providers. CONCLUSION: Lack of knowledge among nursing staff compromise adherence to preventive measures and nursing management of multi-resistant bacterial infections.OBJETIVO: Evaluar el conocimiento de los enfermeros, técnicos y auxiliares de enfermería de un hospital general de Minas Gerais, en cuanto a las causas da multirresistencia bacteriana, los riesgos para el equipo de salud, el modo de transmisión y susceptibilidad de los pacientes a la colonización por bacterias resistentes a múltiples drogas. MÉTODOS: Realizado en la clínica médica, fueron entrevistados 42 profesionales de enfermería encontrados en la unidad. En este estudio de tipo cuantitativo se realizó un análisis descriptivo de sus datos, utilizándose la estadística descriptiva con base en el cálculo de porcentaje, los cuales fueron presentados en tablas. RESULTADOS: Los profesionales demostraron conocimiento restricto y limitado sobre la tem
Directory of Open Access Journals (Sweden)
Guerrero Riascos Ricardo
1996-06-01
Full Text Available En un sistema de fertirrigación (por goteo se efectuó un experimento para evaluar la eficiencia agronómica y económica de dos fertilizantes potásicos (KN03 y K2S04 y su mezcla en el cultivo del banano (Clon «Gran Enano», 3ª. cepa. En comparación con el K2S04, la fertirrigación con KN03 consiguió incrementar en 4,6 kg el peso promedio por racimo (P<0,01, produjo cerca de una mano más por racimo (P<0,01 y dos dedos adicionales por mano (P<0,01, incrementando también la longitud del dedo central . La mezcla en partes iguales de KN03 y K2S04 resultó, para algunas variables, en efectos análogos, pero de magnitud cuántica y estadística inferior. El KN03, en comparación con el K2S04, incrementó el rendimiento en cajas/racimo de 1,7 a 1,9 (319 cajas/Ha y su relación Beneficio/Costo (B/C fue de 10/1.
This experiment was conducted to examine the agronomic and economic impact of different sources of potassium (K2S04" KN03 and [K2S04 (50% + KN03 (50%] in a drip
irrigation system in a banana farm planted with the «Gran Enano clone (3rd harvest, in Ciénaga, Colombia. In comparison with potassium sulfate, potassium nitrate increased the average weight of banana bunches in 4,6 kg (P<0,01. Potassium nitrate also produced nearly one hand more per bunch (P<0,01 and two fingers more per hand (P<0,01. In addition, fingers were larger with KN03 than with K2S04. The combination of K2S04 and KN03 produced similar effects for sorne response variables, but with lower statistical confidence. Potassium nitrate increased the yield ratio in boxeslbunch from 1,7 to 1,9 (319 boxes/Ha, and its benefit/cost was 10/1.
Directory of Open Access Journals (Sweden)
Paulo André Vicente Fernandes
2007-12-01
14, frente a bactérias multidroga-resistentes. Durante o cultivo em meio quimicamente definido, a tensão superficial do meio foi reduzida de 54 mN/m no início do crescimento microbiano para 30 mN/m depois de 20 h. Uma concentração de surfactante bruto de 2 g/L foi obtida depois de 40h de cultivo. Uma caracterização preliminar sugeriu que dois surfactantes foram produzidos. A avaliação antimicrobiana destes compostos foi realizada frente a vinte e nove bactérias. O perfil de multidroga-resistência foi previamente definido para Enterococcus faecalis (11 cepas Staphylococcus aureus (6 cepas, Pseudomonas aeruginosa (7 cepas e Escherichia coli IC18. Todas as cepas foram sensíveis aos surfactantes, em particular Enterococcus faecalis. Os resultados demonstraram que os lipopeptídios têm um amplo espectro de ação, incluindo microrganismos multidroga-resistentes.
Comparación resistente de cuatro métodos de refuerzo de pilares de hormigón armado
Directory of Open Access Journals (Sweden)
Ramírez Ortiz, J. L.
1977-05-01
Full Text Available This report, which is a continuation of another appearing in Construction Report no. 272 (July 1975, studies the stress performance of reinforced concrete columns in insulated floors, usíng four different procedures: — Two of the reinforcement methods presently used are an improvement over those previously used in the other report. They consist of increasing the croas section with concrete which penetrates in grooves made in the original concrete or by backing the steel angles to the columns edges with angular members against the forging, but obtaining the best possible fitting between the concrete and steel by using resins. — The other two methods are new in our experiments. They consist in creating an outer liner of concrete with binder framework and in the metal solution by going through the column with the double T which transfers part of the load directy to the two strongest clips.Este trabajo, que es continuación de otro aparecido en INFORMES DE LA CONSTRUCCIÓN, número 272 (julio 1975, estudia el comportamiento resistente de pilares de hormigón armado reforzados en pisos aislados, por otros cuatro procedimientos diferentes: — Dos de los métodos de refuerzo actualmente utilizados son una mejora de los empleados en el trabajo anterior. Consisten en el recrecido de la sección transversal con hormigón que penetra en cajeras practicadas en el hormigón original o adosado de angulares de acero a las aristas del pilar con capitel de angulares contra el forjado, pero procurando el mejor ajuste entre hormigón y acero mediante resinas. — Los otros dos métodos son nuevos en nuestra experimentación. Consisten en crear una camisa exterior de hormigón con armadura de zuncho y en la solución metálica en atravesar el pilar con una doble T que transfiera parte de la carga directamente a dos presillas más robustas y, por tanto, dar menos importancia a la transmisión de esfuerzos por ei capitel que siempre es algo flexible.
Lifescience Database Archive (English)
Full Text Available 090 3 NP line. Received from the National Institute of Genetics. TM6UW23-1 - 2 - - 0 - weak tr (DT) sg, tr -...0 Chr. 3 Comments NP line. Received from the National Institute of Genetics. Balancer TM6UW23-1 Link to Clon
Multi-view Multi-sparsity Kernel Reconstruction for Multi-class Image Classification
Zhu, Xiaofeng; Xie, Qing; Zhu, Yonghua; Liu, Xingyi; Zhang, Shichao
2015-01-01
This paper addresses the problem of multi-class image classification by proposing a novel multi-view multi-sparsity kernel reconstruction (MMKR for short) model. Given images (including test images and training images) representing with multiple
Directory of Open Access Journals (Sweden)
Stefano Palestini
Full Text Available A pesar de haber sido considerada un área prioritaria de cooperación, el regionalismo energético sudamericano muestra signos de estancamiento, evidenciados por las infructuosas negociaciones de un Tratado Energético Sudamericano. Este artículo explica la paradoja de por qué, no obstante la voluntad política, las favorables condiciones estructurales para la integración, y la creación de instituciones regionales ad hoc, el regionalismo energético no consiguió pasar de las declaraciones intergubernamentales a la implementación de políticas. Se argumenta que ninguna de las instituciones creadas ha sido capaz de mediar la divergencia entre mercados y entre preferencias gubernamentales. Se requiere por tanto de un nuevo consenso que replantee la necesidad y la capacidad de la región para llevar adelante la agenda de integración energética. A un nivel más general, el caso del sector energético brinda lecciones importantes acerca de los desafíos futuros que enfrenta la cooperación regional en materia de políticas públicas en Sudamérica.
Directory of Open Access Journals (Sweden)
Pardiñas, U. F. J.
1996-12-01
nuevamente todas las especies de marsupiales fósiles asignable al género Hyperdidelphys Ameghino, 1904 (Didelphidae, Didelphinae, Didelphini: H. inexpectata (Ameghino, 1889, H. pawula (Rovereto, 1914, H. pattersoni (Reig, 1952 y la nueva especie H. dimartinoi. El biocrón del género se extiende desde el Mioceno tardío (PisoIEdad Huayqueriense hasta el Plioceno tardío (PisotEdad Chapadmalalense; la totalidad de los registros procede de yacimientos del centro y noroeste del territorio argentino. Hyperdidelphys y Lutreolina conforman un grupo monofilético en el contexto de los Didelphini, siendo Lutreolina el grupo hermano plesiomorfo de Hyperdidelphys. Entre los representantes de este género, H. pattersoni es el grupo hermano de un clado conformado por dos grupos monofiléticos, uno integrado por H. pawula y el otro por H. inexpectata + H. dimartinoi. Se descartan varios taxones previamente referidos a este género: (1 Hyperdidelphys brachyodonta» (Reig, 1952 es un sinónimo junior de Didelphis crucialis Ameghino, 1904; (2 Hyperdidelphys biforata (Ameghino, 1904 es una especie de Lutreolina (L. biforata n. comb., y (3 «Paradidelphys nodosu» Ameghino, 1904 es un sinónimo junior de Thylophorops perplana (Ameghino, 1904, n. comb. Es poco clara la significación bioestratigráfica de las especies de Hyperdidelphys en el contexto del Cenozoico tardío del Cono Sur sudamericano: su registro en los distintos niveles es poco frecuente, la identificación de dos de ellas (H. inexpectata y H. parvula es compleja sobre la base de las estructuras confrontables, y los biocrones de casi todas son poco restringidos en el marco estratigráfico de referencia. Las adaptaciones carnívoras de las especies de Hyperdidelphys se corresponden con un proceso general de declinación de los marsupiales Sparassodonta hacia el Mioceno tardío y Plioceno de América del Sur, un proceso que precedió a la llegada de los carnívoros placentarios inmigrantes de origen holártico a partir del
Directory of Open Access Journals (Sweden)
S.P. Tironi
2009-06-01
Full Text Available Objetivou-se com este trabalho avaliar a habilidade competitiva de plantas de arroz cultivar BRS Pelota com biótipos de capim-arroz resistente ou suscetível ao herbicida quinclorac. Para isso, foi instalado experimento em casa de vegetação, em delineamento completamente casualizado com quatro repetições, sendo os tratamentos dispostos em esquema fatorial 2 x 6. As unidades experimentais constaram de vasos plásticos contendo 10 dm³ de solo, cujo pH e nível de nutrientes foram previamente corrigidos. Os tratamentos consistiram na competição entre uma planta de arroz, cultivar BRS Pelota, com populações (0, 1, 2, 3, 4 ou 5 plantas por vaso dos biótipos de capim-arroz resistente (ECH-13 ou suscetível (ECH-12 ao herbicida quinclorac. As avaliações foram realizadas aos 40 dias após emergência, sendo avaliados; massa seca da parte aérea (MSPA, taxa de crescimento (TC, área foliar específica (AFE, razão de massa foliar (RMF, razão de área foliar (RAF e índice de área foliar (IAF. A interferência no desenvolvimento do cultivar de arroz BRS Pelota foi proporcionalmente maior com o aumento da população de ambos os biótipos de capim-arroz. Os biótipos apresentaram, em geral, habilidade competitiva similar.The objective of this study was to evaluate the competitive ability of the rice cultivar BRS Pelota with biotypes resistant or susceptible to the herbicide Quinclorac. The experiment was conducted under greenhouse conditions in a completely randomized design with four replications, with the treatments arranged in a 2 x 6 factorial. The experimental units consisted of plastic pots containing 10 dm³ of soil, with pH and nutrient level being previously corrected. The treatments consisted of a competition between a rice plant, BRS Pelota cultivar, with populations (0, 1, 2, 3, 4 or 5 plants per pot of the barnyardgrass biotypes resistant (ECH-13 or susceptible (ECH -12 to the herbicide Quinclorac. The evaluations were performed
Directory of Open Access Journals (Sweden)
Mirta Beatriz Reynaldo
2004-09-01
Full Text Available OBJETIVOS: Evaluar cómo responden los estafilococos hospitalarios sensibles y resistentes a la meticilina ante la acción de diferentes antisépticos y desinfectantes empleados habitualmente en los hospitales de la Provincia de Buenos Aires, Argentina. Demostrar la eficacia de esas sustancias mediante la determinación de sus concentraciones bactericidas eficaces, así como analizar si existe correlación entre la resistencia a biocidas y la resistencia a la meticilina en esta población bacteriana. MÉTODOS: Se evaluó la acción de siete biocidas con 25 cepas de estafilococos nosocomiales sensibles y resistentes a la meticilina y una cepa de colección, Staphylococcus aureus ATCC 6538. Las cepas hospitalarias provienen de dos hospitales de máxima complejidad y fueron obtenidas, durante los meses de abril de 2000 a mayo de 2002, de muestras clínicas (hemocultivo, urocultivo, punta de catéter y abceso pertenecientes a pacientes de ambos sexos, internados y ambulatorios. Después del aislamiento de dichas cepas, determinamos la sensibilidad a antibióticos mediante el método de difusión en agar de Kirby y Bauer. Para estudiar la acción de los biocidas de uso hospitalario sobre estas cepas, empleamos el ensayo de Kelsey-Sykes, que permite establecer las concentraciones bactericidas eficaces de tales compuestos. RESULTADOS: Los resultados muestran que la respuesta de las cepas hospitalarias resistentes y sensibles a la meticilina varía con respecto a la cepa de colección. El digluconato de clorhexidina, la yodopovidona, la tintura de yodo débil y el glutaraldehído alcalino fueron eficaces contra la mayoría de las cepas, independientemente de su resistencia o sensibilidad a los antibióticos. CONCLUSIONES: Estas evaluaciones no indican ninguna asociación entre la resistencia a la meticilina y la resistencia a los biocidas evaluados. Asimismo, apuntan a la necesidad de seguir investigando para valorar la eficacia de los agentes qu
Directory of Open Access Journals (Sweden)
Bruno Soares Laurindo
2015-02-01
Full Text Available O objetivo deste trabalho foi selecionar acessos resistentes à pinta-preta (Alternaria tomatophila por meio da análise de agrupamento das curvas de progresso da doença em tomateiro (Solanum lycopersicum. Foram avaliados 134 acessos de tomateiro do Banco de Germoplasma de Hortaliças da Universidade Federal de Viçosa (BGH-UFV, no delineamento de blocos ao acaso, além das testemunhas suscetíveis 'Débora' e 'Santa Clara'. As plantas foram inoculadas com uma mistura de conídios de diferentes isolados de Alternaria spp. e avaliadas regularmente quanto à severidade da doença a cada três dias após a inoculação, no total de seis avaliações. Ajustou-se o modelo logístico aos dados de severidade da pinta-preta, e as estimativas obtidas para a incidência final da doença (B1 e a taxa de progresso da doença (B3 foram submetidas à análise de variância multivariada (Manova. As médias dessas estimativas, para cada acesso, foram submetidas à análise de agrupamento. Foram formados 24 grupos distintos com base no agrupamento das curvas de progresso da doença, o que possibilitou identificar os acessos BGH-2143, BGH-2235, BGH-2270 e BGH-2118 de tomateiro como potenciais fontes de resistência à pinta-preta.
Directory of Open Access Journals (Sweden)
Clarisa Brezzo
2006-10-01
Full Text Available Se presenta un caso de enfermedad invasora por Staphylococcus aureus meticilino resistente (SAMR adquirido en la comunidad (SAMR-c. Paciente varón de 21 años, previamente sano, que consultó por nódulos subcutáneos compatibles con gomas. La ultrasonografía reveló múltiples abscesos subcutáneos e imágenes consistentes con piomiositis, además de derrame pleural y pericárdico. En el cultivo del material purulento obtenido por punción-aspiración con aguja fina de las lesiones se aisló S. aureus. El antibiograma por difusión mostró resistencia a cefalotina, eritromicina y clindamicina, y sensibilidad a trimetroprima-sulfametoxazol, ciprofloxacina y rifampicina. La meticilino resistencia se confirmó por aglutinación con partículas de látex sensibilizadas con anticuerpos monoclonales dirigidos contra la proteína ligadora de penicilina 2A. El paciente fue tratado con ciprofloxacina y rifampicina durante cuatro semanas, con evolución favorable. La frecuencia de infecciones por SAMR-c está en aumento, observándose en personas sin factores de riesgo aparentes. Esto llevaría a fracaso en el tratamiento empírico para infecciones de la comunidad en los que se presume etiología estafilocócica.A 21 year old man, previously healthy, presented with subcutaneous nodes consistent with gummas. Ultrasonography disclosed multiple subcutaneous abscesses and images suitable with piomiositis, pleural and pericardium effusion. A puncture-aspirate with fine-needle was performed and produced purulent material, with isolate of Staphylococcus aureus. Antimicrobial susceptibility testing by disk diffusion showed resistant to cefalotin, erythromycin and clindamycin, and susceptibility to trimethoprim-sulfamethoxazole, ciprofloxacin and rifampicin. Methicilin-resistance was confirmed by Staphyslide agglutination testing (Biomérieux. The patient was treated with ciprofloxacin and rifampicin during four weeks, with a good clinical response. The
Directory of Open Access Journals (Sweden)
Eduardo Andrada Pessoa de Figueiredo
2007-12-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: A multi-resistência bacteriana tem crescido significativamente nos últimos anos. Entre os gram-negativos a P. aeruginosa demonstra maior facilidade de desenvolvimento de resistência aos antibióticos. O objetivo deste estudo foi determinar os padrões de susceptibilidade antimicrobiana, freqüência de resistência a múltiplos fármacos e de resistência cruzada entre antimicrobianos das cepas de Pseudomonas aeruginosa. MÉTODO: O estudo foi realizado entre setembro de 2004 e janeiro de 2006. Os testes de susceptibilidade antimicrobiana foram realizados em 304 cepas de P. aeruginosa segundo os padrões do National Committee for Clinical and Laboratory Standards (NCCLS. RESULTADOS: Os materiais mais freqüentes foram urina com 26,7% e secreção traqueal com 26,1%. Os seguintes antibióticos, com respectivos percentuais de susceptibilidade, foram observados: piperacilina-tazobactam (66,2%; aztreonam (59,8%; amicacina (59,4%; meropenem (58,2%; imipenem (57,7%; ciprofloxacina (49,7%; gentamicina e cefepima (48,6%; ceftazidima (30% e cefotaxima (6,8%. Detectou-se elevada prevalência de multi-resistência, com 49,7% das cepas resistentes a três antibióticos ou mais e 28% resistentes a seis antibióticos ou mais. Adicionalmente se demonstraram taxas de resistência cruzada entre os beta-lactâmicos (carbapenêmicos e piperacilina/tazobactam e os aminoglicosídeos e quinolonas entre 22,9% e 38,1% (fármacos comumente utilizados como adjuvantes no tratamento das infecções graves por pseudomonas, refletindo dificuldade nas opções de associação de antimicrobianos para tratamentos combinados. CONCLUSÕES: A freqüência de cepas multi-resistentes de P. aeruginosa foi semelhante à descrita na literatura nacional e maior do que a mundial. Para reduzir a freqüência destes clones multi-resistentes, monitorização epidemiológica e racionalização de antimicrobianos devem ser implementadas urgentemente.BACKGROUND AND
Directory of Open Access Journals (Sweden)
J Gordon Millichap
2002-03-01
Full Text Available The efficacy of methylphenidate (MPH and clonidine (CLON, alone and in combination, in 136 children with attention deficit hyperactivity disorder (ADHD and chronic tic disorder, was evaluated in a multicenter, randomized, double-blind clinical trial, and reported by the Tourette Syndrome Study Group from the University of Rochester, NY.
Jain, Rakesh; Segal, Scott; Kollins, Scott H.; Khayrallah, Moise
2011-01-01
Objective: This study examined the efficacy and safety of clonidine hydrochloride extended-release tablets (CLON-XR) in children and adolescents with attention-deficit/hyperactivity disorder (ADHD). Method: This 8-week, placebo-controlled, fixed-dose trial, including 3 weeks of dose escalation, of patients 6 to 17 years old with ADHD evaluated the…
Directory of Open Access Journals (Sweden)
Kaveh Khalili-Damghani
2017-07-01
Full Text Available In this paper a multi-period multi-product multi-objective aggregate production planning (APP model is proposed for an uncertain multi-echelon supply chain considering financial risk, customer satisfaction, and human resource training. Three conflictive objective functions and several sets of real constraints are considered concurrently in the proposed APP model. Some parameters of the proposed model are assumed to be uncertain and handled through a two-stage stochastic programming (TSSP approach. The proposed TSSP is solved using three multi-objective solution procedures, i.e., the goal attainment technique, the modified ε-constraint method, and STEM method. The whole procedure is applied in an automotive resin and oil supply chain as a real case study wherein the efficacy and applicability of the proposed approaches are illustrated in comparison with existing experimental production planning method.
Industrial applications of multi-functional, multi-phase reactors
Harmsen, G.J.; Chewter, L.A.
1999-01-01
To reveal trends in the design and operation of multi-functional, multi-phase reactors, this paper describes, in historical sequence, three industrial applications of multi-functional, multi-phase reactors developed and operated by Shell Chemicals during the last five decades. For each case, we
CLON: Overlay Networks and Gossip Protocols for Cloud Environments
Matos, Miguel; Sousa, António; Pereira, José; Oliveira, Rui; Deliot, Eric; Murray, Paul
Although epidemic or gossip-based multicast is a robust and scalable approach to reliable data dissemination, its inherent redundancy results in high resource consumption on both links and nodes. This problem is aggravated in settings that have costlier or resource constrained links as happens in Cloud Computing infrastructures composed by several interconnected data centers across the globe.
Sanbonmatsu, David M; Strayer, David L; Medeiros-Ward, Nathan; Watson, Jason M
2013-01-01
The present study examined the relationship between personality and individual differences in multi-tasking ability. Participants enrolled at the University of Utah completed measures of multi-tasking activity, perceived multi-tasking ability, impulsivity, and sensation seeking. In addition, they performed the Operation Span in order to assess their executive control and actual multi-tasking ability. The findings indicate that the persons who are most capable of multi-tasking effectively are not the persons who are most likely to engage in multiple tasks simultaneously. To the contrary, multi-tasking activity as measured by the Media Multitasking Inventory and self-reported cell phone usage while driving were negatively correlated with actual multi-tasking ability. Multi-tasking was positively correlated with participants' perceived ability to multi-task ability which was found to be significantly inflated. Participants with a strong approach orientation and a weak avoidance orientation--high levels of impulsivity and sensation seeking--reported greater multi-tasking behavior. Finally, the findings suggest that people often engage in multi-tasking because they are less able to block out distractions and focus on a singular task. Participants with less executive control--low scorers on the Operation Span task and persons high in impulsivity--tended to report higher levels of multi-tasking activity.
Directory of Open Access Journals (Sweden)
David M Sanbonmatsu
Full Text Available The present study examined the relationship between personality and individual differences in multi-tasking ability. Participants enrolled at the University of Utah completed measures of multi-tasking activity, perceived multi-tasking ability, impulsivity, and sensation seeking. In addition, they performed the Operation Span in order to assess their executive control and actual multi-tasking ability. The findings indicate that the persons who are most capable of multi-tasking effectively are not the persons who are most likely to engage in multiple tasks simultaneously. To the contrary, multi-tasking activity as measured by the Media Multitasking Inventory and self-reported cell phone usage while driving were negatively correlated with actual multi-tasking ability. Multi-tasking was positively correlated with participants' perceived ability to multi-task ability which was found to be significantly inflated. Participants with a strong approach orientation and a weak avoidance orientation--high levels of impulsivity and sensation seeking--reported greater multi-tasking behavior. Finally, the findings suggest that people often engage in multi-tasking because they are less able to block out distractions and focus on a singular task. Participants with less executive control--low scorers on the Operation Span task and persons high in impulsivity--tended to report higher levels of multi-tasking activity.
Sanbonmatsu, David M.; Strayer, David L.; Medeiros-Ward, Nathan; Watson, Jason M.
2013-01-01
The present study examined the relationship between personality and individual differences in multi-tasking ability. Participants enrolled at the University of Utah completed measures of multi-tasking activity, perceived multi-tasking ability, impulsivity, and sensation seeking. In addition, they performed the Operation Span in order to assess their executive control and actual multi-tasking ability. The findings indicate that the persons who are most capable of multi-tasking effectively are not the persons who are most likely to engage in multiple tasks simultaneously. To the contrary, multi-tasking activity as measured by the Media Multitasking Inventory and self-reported cell phone usage while driving were negatively correlated with actual multi-tasking ability. Multi-tasking was positively correlated with participants’ perceived ability to multi-task ability which was found to be significantly inflated. Participants with a strong approach orientation and a weak avoidance orientation – high levels of impulsivity and sensation seeking – reported greater multi-tasking behavior. Finally, the findings suggest that people often engage in multi-tasking because they are less able to block out distractions and focus on a singular task. Participants with less executive control - low scorers on the Operation Span task and persons high in impulsivity - tended to report higher levels of multi-tasking activity. PMID:23372720
Directory of Open Access Journals (Sweden)
P.A. D'Azevedo
2008-12-01
Full Text Available In the last decades, coagulase-negative staphylococci (CoNS, especially Staphylococcus epidermidis have become an important cause of bloodstream infections. In addition, rates of methicillin-resistance among CoNS have increased substantially, leading to the use of glicopeptides for therapy. The objective of this study was to evaluate eleven consecutives clinically relevant cases of oxacillin-resistant CoNS bacteremia in a general hospital localized in São Paulo city, Brazil. Five different species were identified by different phenotypic methods, including S. epidermidis (5, S. haemolyticus (3, S. hominis (1, S. warneri (1 and S. cohnii subsp urealyticus (1. A variety of Pulsed Field Gel Electrophoresis profiles was observed by macrorestriction DNA analysis in S. epidermidis isolates, but two of three S. haemolyticus isolates presented the same profile. These data indicated the heterogeneity of the CoNS isolates, suggesting that horizontal dissemination of these microorganisms in the investigated hospital was not frequent. One S. epidermidis and one S. haemolyticus isolates were resistant to teicoplanin and susceptible to vancomycin. The selective pressure due to the use of teicoplanin in this hospital is relevant.Staphylococcus coagulase negativos (SCoN, especialmente Staphylococcus epidermidis tem se tornado causa importante de infecções da corrente circulatória nas últimas décadas. Além disso, percentuais de resistência a meticilina entre os SCoN têm aumentado significativamente, levando ao uso de glicopeptídeos nestes pacientes. O objetivo deste estudo foi avaliar onze casos consecutivos de bacteremia clinicamente relevantes por SCoN oxacilina resistentes em um hospital localizado na cidade de São Paulo, Brasil. Cinco diferentes espécies foram identificadas por diferentes métodos fenotípicos, incluindo S. epidermidis (5, S. haemolyticus (3, S. hominis (1, S. warneri (1 e S. cohnii subsp urealyticus (1. Diferentes perfis
Directory of Open Access Journals (Sweden)
Thaís Cristina Tebaldi
2008-12-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: Adição de clonidina subaracnóidea (±-agonista prolonga a ação analgésica da combinação sufentanil e bupivacaína isobárica em analgesia combinada para o trabalho de parto ¹. O objetivo deste estudo foi comparar a qualidade de analgesia e a prevalência de efeitos colaterais após a adição de clonidina subaracnóidea à solução anestésica em gestantes durante trabalho de parto. MÉTODO: Após aprovação da Comissão de Ética, 22 gestantes em trabalho de parto receberam aleatoriamente no espaço subaracnóideo 2,5 mg de bupivacaína hiperbárica 0,5% (grupo CLON/HIPER; n = 11 ou 2,5 mg de bupivacaína isobárica 0,5% (grupo CLON/ISO; n = 11 em associação ao sufentanil 2,5 µg e à clonidina 30 µg. A dor avaliada pela Escala Analógica Visual, a freqüência cardíaca e a pressão arterial média foram estudadas a cada 5 minutos nos primeiros 15 minutos e, a seguir, a cada 15 minutos até o nascimento. Foi avaliada a prevalência de efeitos colaterais (náusea, vômito, prurido e sedação. O estudo foi encerrado no momento em que foi necessária complementação analgésica peridural (dor > 3 cm ou ao nascimento. A análise estatística foi realizada pelos testes t de Student, Qui-quadrado, Fisher e ANOVA de duas vias para medidas repetidas, considerando como significativo p JUSTIFICATIVA Y OBJETIVOS: La adición de la clonidina subaracnoidea (±-agonista, prolonga la acción analgésica de la combinación sufentanil y bupivacaína isobárica en analgesia combinada para el trabajo de parto ¹. El objetivo de este estudio fue comparar la calidad de analgesia y la prevalencia de los efectos colaterales, después de la adición de clonidina subaracnoidea a la solución anestésica en gestantes durante el parto. MÉTODO: Después de la aprobación de la Comisión de Ética, 22 gestantes en trabajo de parto recibieron aleatoriamente en el espacio subaracnoideo 2,5 mg de bupivacaína hiperbárica 0
Sanbonmatsu, David M.; Strayer, David L.; Medeiros-Ward, Nathan; Watson, Jason M.
2013-01-01
The present study examined the relationship between personality and individual differences in multi-tasking ability. Participants enrolled at the University of Utah completed measures of multi-tasking activity, perceived multi-tasking ability, impulsivity, and sensation seeking. In addition, they performed the Operation Span in order to assess their executive control and actual multi-tasking ability. The findings indicate that the persons who are most capable of multi-tasking effectively are ...
Directory of Open Access Journals (Sweden)
Gustavo A. Daneri
2005-09-01
Full Text Available The skull morphometrics of adult male Antarctic fur seal, Arctocephalus gazella (Peters, 1875 and South American fur seal, A. australis (Zimmermann, 1783 were investigated using a collection of 45 and 38 skulls, respectively. Eighteen measurements were taken for each specimen. Comparative univariate and multivariate statistical analyses included standard statistics, one-way analysis of variance, principal component analysis and discriminant analysis. Individual variation was relatively high for some variables, as expressed by the coefficient of variation. Skulls of A. gazella were larger than those of A. australis for all but two variables: squamosal jugal suture and rostral length. Both species differed significantly as shown by both univariate and multivariate analyses. The discriminant function correctly classified all specimens. The standardized canonical coefficients showed that the variables which most contribute to the differentiation between species were, in decreasing order, the rostral length, palatal length, palatal width at postcanine 5 and braincase width. The present study corroborates that A. gazella and A. australis are phenotipically distinct species.Se estudió la morfometría craneana de especímenes machos adultos de lobo fino Antártico, Arctocephalus gazella (Peters, 1875 y lobo fino sudamericano, A. australis (Zimmermann, 1783, consultando una colección de 45 y 38 cráneos respectivamente. Para cada ejemplar se tomó un total de 18 medidas. El análisis comparativo univariado y multivariado incluyó estadística standard, análisis de varianza, análisis de componentes principales y análisis discriminante. La variación individual, según lo expresado por el coeficiente de variación, fue relativamente alta para algunas variables. Los cráneos de A. gazella fueron proporcionalmente más grandes que aquellos de A. australis para todas las variables estudiadas, excepto dos: longitud de la sutura escamoso-yugal y longitud
Directory of Open Access Journals (Sweden)
Rafael Salles Rubin
2014-10-01
Full Text Available O uso intenso de herbicidas com o mesmo mecanismo de ação na cultura do arroz (Oryza sativa L. tem selecionado biótipos resistentes, como, por exemplo, o arroz-vermelho (planta daninha resistente aos herbicidas imidazolinonas. Por essa razão, este trabalho foi desenvolvido com o objetivo de avaliar a resistência de arroz-vermelho ao herbicida imazapyr + imazapic, na região sul do Rio Grande do Sul, e o controle do biótipo resistente de arroz-vermelho com os herbicidas alternativos clethodim e glyphosate. Foram realizados três experimentos, em delineamento casualizado, arranjados em esquema fatorial. No primeiro experimento, o fator A testou biótipos de arroz-vermelho [ORYSA 184 (resistente e ORYSA 188 (susceptível], o fator B comparou herbicidas (imazapyr + imazapic, clethodim e glyphosate e o fator C avaliou doses dos herbicidas (0; 0,5; 1; 2; 4; 8; 16 e 32 vezes a dose recomendada. No segundo, compararam-se biótipos de arroz-vermelho e doses do herbicida imazapyr + imazapic (0; 0,5; 1; 2; 4; 8; 16; 32 e 64 vezes a dose recomendada. No terceiro, testaram-se biótipos de arroz-vermelho e doses diferentes do herbicida imazapyr + imazapic para cada biótipo. O biótipo ORYSA 184 é resistente ao imazapyr + imazapic, quando aplicada a dose máxima de registro e estádio indicado. Os herbicidas clethodim e glyphosate, detentores de mecanismos de ação alternativos, controlam o biótipo resistente ORYSA 184 de arroz-vermelho.
Directory of Open Access Journals (Sweden)
Manoel Paes de Oliveira-Neto
2006-08-01
Full Text Available Two mucocutaneous leishmaniasis cases resistant to therapy are reported here. After the failure of initial therapies (antimony, amphotericin B and/or pentamidine patients received a low-dose schedule: one ampoule of meglumine antimoniate (405mg of pentavalent antimony [Sb v] by intramuscular injection, three times a week until complete healing of the lesions. One patient was cured with a total of 30 ampoules in 10 weeks and the other received 36 ampoules in 12 weeks. Both remain clinically cured after one year of follow-up.São relatados dois casos de leishmaniose mucocutânea resistentes ao tratamento. Depois das terapêuticas iniciais (antimônio, anfotericina B e/ou pentamidina, os pacientes receberam um esquema alternativo: uma ampola de antimoniato de meglumina (405mg de antimônio pentavalnte [Sb v] por via intramuscular, três vezes por semana até a cura completa das lesões. Um paciente recebeu um total de 30 ampolas durante 10 semanas e o outro, 36 ampolas durante 12 semanas. Ambos permanecem clinicamente curados até um ano após o tratamento.
Puma (Herpailurus) pumoides (Castellanos, 1958) nov. comb: Comentarios sistemáticos y registro fósil
Chimento, Nicolás R; Derguy, Maria Rosa; Hemmer, Helmut
2014-01-01
Entre los Felinae de procedencia dudosa descritos para Argentina se encuentra Felis pumoides Castellanos 1958, hallado en estratos asignados al Plioceno ("horizonte Brocherense”) de la provincia de Córdoba (Argentina). Los restos craneanos y post-craneanos que posee el ejemplar tipo (MUFyCA 767) fueron comparados primeramente con todos los felinos sudamericanos y con Acinonyx jubatus concluyendo que posee un gran parecido a la especie actual Puma (Herpailurus) yagouaroundi, con algunos rasgos...
Leptina e aldosterona na atividade simpática na hipertensão resistente, com ou sem Diabetes Tipo 2
Directory of Open Access Journals (Sweden)
Leandro Boer-Martins
2012-07-01
Full Text Available FUNDAMENTO: A descoberta da leptina como um estimulador da atividade simpática trouxe uma nova perspectiva para os mecanismos fisiopatológicos da obesidade-hipertensão. OBJETIVO: Avaliamos a relação entre a atividade simpática aumentada e as concentrações plasmáticas de leptina e aldosterona em Hipertensos Resistentes (HR, comparando os grupos com e sem Diabetes Tipo 2 (DT2. MÉTODOS: Vinte e cinco pacientes HR foram avaliados por eletrocardiografia ambulatorial para análise da Variabilidade da Frequência Cardíaca (VFC nos domínios do tempo e frequência, os quais foram estratificados em dois períodos: 24 horas e período Diurno (D, compreendendo as medidas entre 14 e 18h (domínio do tempo e uma hora às 15h (domínio da frequência. RESULTADOS: O grupo DT2 (n = 10 apresentou maiores concentrações de aldosterona e leptina que o grupo não DT2 (n = 15 (26,0 ± 11,5 vs. 16,9 ± 7,0 ng/dL - p = 0,021; 81,368.7 ± 47,086.1 vs. 41,228.1 ± 24,523.1 pg/mL - p = 0,048, respectivamente. Houve correlação entre aldosterona e VFC no domínio da frequência em ambos os grupos. Não-DT2 apresentaram a aldosterona correlacionada com D baixa frequência em unidades normalizadas (BFnu (r = 0,6 [0,12 - 0,85] p = 0,018 e D alta frequência em unidades normalizadas (AFnu (r = -0,6 [-0,85 - -0,12] p = 0,018. No grupo com diabetes, a aldosterona correlacionou-se com DBFnu (r = 0,72 [0,16 - 0,93] p = 0,019 e DAFnu (r = -0,72 [-0,93 - -0,16] p = 0,019. Apesar da importância da leptina na atividade simpática aumentada na hipertensão, não houve correlação com VFC. CONCLUSÃO: A aldosterona parece estimular a atividade simpática em HR com ou sem DT2. Essa informação combinada com a eficácia clínica dos bloqueadores de receptor mineralocorticoide em HR pode reforçar a aldosterona como alvo terapêutico relevantes em HR. (Arq Bras Cardiol. 2012; [online].ahead print, PP.0-0
Multi-Language and Multi-Purpose Educational Tool for Kids
DEFF Research Database (Denmark)
Holmen, Hee; Valente, Andrea; Marchetti, E.
2005-01-01
‘Crazipes’ is one of the prototype games within SMAALL, a multi-language and multi-purpose games project for young kids of age 3-5 years old. The main goal of SMAALL is to expose young learners in multi-purpose and multi-module games. In the prototype of Crazipes, the game is designed to teach fo...
Pei, Huiqin; Chen, Shiming; Lai, Qiang
2016-12-01
This paper studies the multi-target consensus pursuit problem of multi-agent systems. For solving the problem, a distributed multi-flocking method is designed based on the partial information exchange, which is employed to realise the pursuit of multi-target and the uniform distribution of the number of pursuing agents with the dynamic target. Combining with the proposed circle formation control strategy, agents can adaptively choose the target to form the different circle formation groups accomplishing a multi-target pursuit. The speed state of pursuing agents in each group converges to the same value. A Lyapunov approach is utilised to analyse the stability of multi-agent systems. In addition, a sufficient condition is given for achieving the dynamic target consensus pursuit, and which is then analysed. Finally, simulation results verify the effectiveness of the proposed approaches.
Directory of Open Access Journals (Sweden)
Gonzales-Vila, Victoriano
1985-06-01
Full Text Available This study, first part of a work where an account of the evolution of the mechanical resistances of various series of mortar and concrete tests submitted to the action of different agressive solutions will be given, sets up the chemical resistant behaviour of a sulphate resistant portland cement (with a content calculated —Bogue— null of C3A, of 10,8% of C4AF and of 81,7% of C3S + C2S against the CaSO4.2 H2O through the Le Chatelier-Anstett methods, and described in the ASTM C 452-73 and against the following agressive solutions: saturated solution calcium sulphate, Na2SO4 (2,1 g/l, MgSO4.7H2O (3,22 g/l, MgSO4.7 H2O (32,2 g/l, saturated of calcium sulphate + MgSO4.7H2O (3,22 g/l, saturated of calcium sulphate + MgSO4.7H2O (32,2g/l, Na2SO4 (3,5 g/l + NaCl (20,0 g/l, artificial sea water and, also, filtered drinking water, through of the Wittekindt and Kock Steinegger methods, during diverse periods, which allowed to establish a classification, according to his behaviour, of the studied cement against those agressive solutions.
En el presente trabajo, primera parte de otro en el que se dará cuenta de la evolución de las resistencias mecánicas de diversas series de probetas de mortero y de hormigón sometidas a la acción de distintas disoluciones agresivas, se estudia el comportamiento químico-resistente de un cemento portland industrial resistente al yeso (con un contenido calculado, Bogue, nulo de C3A, del 10,8% de C4AFy del 81,7% de C3S + C2S frente al CaSO4.2 H2O por los métodos de Le Chatelier-Anstett y el descrito en la norma ASTM C 452-73 y frente a las siguientes disoluciones agresivas: disolución saturada de sulfato de calcio, de Na2SO4 (2
Directory of Open Access Journals (Sweden)
Milton Luiz Paz Lima
2010-03-01
Full Text Available Visando relacionar a reação de Capsicum spp. resistentes e suscetíveis à Oidiopsis haplophylli com o padrão dos respectivos complexos estomáticos, foram analisados em dois ensaios, 5 e 15 genótipos de Capsicum spp. em delineamento inteiramente casualizado. Avaliou-se a abertura do ostíolo, a morfometria do estômato (comprimento, largura e área, o número de estômatos.mm-2 e a freqüência de estômatos (unidades de estômatos por células da epiderme nas superfícies adaxial e abaxial da epiderme foliar de plantas cultivadas em casa-de-vegetação. A variável abertura ostiolar não explicou a reação dos genótipos ao oídio, nem na face adaxial (R²=0,16 nem na abaxial (R²=0,13. Entretanto, o número de estômatos.mm-2 explicou a reação ao oídio em 84 % (face adaxial ou 74 % (face abaxial. Para a freqüência de estômatos, o modelo ajustou-se melhor na face adaxial (R² = 0,76, do que na face abaxial (R²=0,48. Maiores números e freqüências de estômatos em ambas as faces foliares ocorreram em pimentão 'Magali' (altamente suscetível, com valores significativamente maiores do que em 'HV-12' (altamente resistente. Sugere-se que a suscetibilidade de genótipos de Capsicum a O. haplophylli está parcialmente relacionada a mecanismos de defesa estruturais pré-formados, como o número e freqüência de estômatos, os quais se relacionam com o número de sítios de infecção. Por outro lado, para alguns genótipos, esta relação não foi significativa, indicando que outros mecanismos de resistência também estejam envolvidos.This work reports the reaction of Capsicum genotypes to the powdery mildew pathogen with variables of the stomatal complex, from samples of five to 15 Capsicum genotypes in a complete randomized experiments. Ostiolum size, stomatal morphometry (length, width and surface area, the number of stomata.mm-2, and the frequency of stomata (stomatal units per unit of epidermal cells were evaluated on both leaf
Directory of Open Access Journals (Sweden)
L. Galon
2009-01-01
Full Text Available Objetivou-se com este trabalho avaliar a competitividade interespecífica de biótipos de capim-arroz resistente (R e suscetível (S ao herbicida quinclorac com a cultura do arroz irrigado. O experimento foi instalado em casa de vegetação e os tratamentos consistiram em manter uma planta de arroz cv. BRS Pelota no centro da unidade experimental, variando-se na periferia as densidades de capim-arroz em: 0, 1, 2, 3, 4 ou 5 plantas do biótipo R (ITJ-13 ou S (ITJ-17 oriundos da região de Itajaí-SC. O delineamento experimental utilizado foi o completamente casualizado, em esquema fatorial 2 x 6 com quatro repetições. Aos 40 dias após a emergência, foram avaliados as massas fresca e seca e o conteúdo de água de folhas, colmos e total da parte aérea do arroz e do capim-arroz. Houve efeito significativo dos tratamentos para todas as variáveis estudadas quando a cultura do arroz foi cultivada na presença de biótipos de capim-arroz R ou S. Esse efeito foi aditivo na proporção de 1 planta m-2. Entretanto, a capacidade competitiva dos biótipos de capim-arroz resistente e suscetível ao quinclorac, com as plantas de arroz, apresentou comportamento similar quando se variou a densidade de plantas por área.This work aimed to evaluate the interspecific competitiveness of Echinochloa spp. biotypes resistant or susceptible to the herbicide quinclorac. The trial was installed under greenhouse conditions, with the biotypes resistant (ITJ-13 and susceptible (ITJ-17 to quinclorac under competition with the rice plants. The treatments consisted of maintaining one rice plant at the center of the experimental unit, surrounded by 0, 1, 2, 3, 4 or 5 Echinochloa plants, according to the treatment. The trial was arranged in a completely randomized blocks design and factorial scheme 2 x 6, with four replications. Forty days after emergence, fresh dry weights and water content of the shoots were evaluated. There was a significant effect for all the variables
Multi-view Multi-sparsity Kernel Reconstruction for Multi-class Image Classification
Zhu, Xiaofeng
2015-05-28
This paper addresses the problem of multi-class image classification by proposing a novel multi-view multi-sparsity kernel reconstruction (MMKR for short) model. Given images (including test images and training images) representing with multiple visual features, the MMKR first maps them into a high-dimensional space, e.g., a reproducing kernel Hilbert space (RKHS), where test images are then linearly reconstructed by some representative training images, rather than all of them. Furthermore a classification rule is proposed to classify test images. Experimental results on real datasets show the effectiveness of the proposed MMKR while comparing to state-of-the-art algorithms.
Li, Bing; Yuan, Chunfeng; Xiong, Weihua; Hu, Weiming; Peng, Houwen; Ding, Xinmiao; Maybank, Steve
2017-12-01
In multi-instance learning (MIL), the relations among instances in a bag convey important contextual information in many applications. Previous studies on MIL either ignore such relations or simply model them with a fixed graph structure so that the overall performance inevitably degrades in complex environments. To address this problem, this paper proposes a novel multi-view multi-instance learning algorithm (MIL) that combines multiple context structures in a bag into a unified framework. The novel aspects are: (i) we propose a sparse -graph model that can generate different graphs with different parameters to represent various context relations in a bag, (ii) we propose a multi-view joint sparse representation that integrates these graphs into a unified framework for bag classification, and (iii) we propose a multi-view dictionary learning algorithm to obtain a multi-view graph dictionary that considers cues from all views simultaneously to improve the discrimination of the MIL. Experiments and analyses in many practical applications prove the effectiveness of the M IL.
Directory of Open Access Journals (Sweden)
Carlos Mena Frau
Full Text Available Los avances tecnológicos de las últimas décadas han permitido determinar cada vez con mayor precisión, las dimensiones, forma y campo gravitacional de la Tierra. Estas nuevas tecnologías y sus métodos de observación y análisis, admiten el uso de distintos Sistemas Geodésicos de Referencia (SGR que hacen posible la descripción de posición de cualquier punto sobre la superficie terrestre con precisiones sub-métricas. Actualmente en Chile hay diversos SGR usados en la generación de productos cartográficos, tales como el Datum Provisorio Sudamericano de 1956 (PSAD56, el Datum Sudamericano de 1969 (SAD69 y el nuevo Sistema de Referencia Geocéntrico para las Américas (SIRGAS. Este último, a diferencia de los dos anteriores, es un sistema geocéntrico actual, compatible en precisión y exactitud con las modernas tecnologías de posicionamiento. Actualmente, el Instituto Geográfico Militar de Chile (IGM promueve la adopción del nuevo sistema SIRGAS e indica el modelo y los parámetros oficiales de transformación para la cartografía nacional a escala 1:50.000. Con la adopción de SIRGAS, una cantidad significativa de documentos cartográficos, en pleno uso actualmente, deberán ser transformados o adecuados al nuevo referencial geodésico. Existen diversos métodos y modelos, propuestos en la geodesia, para la transformación de valores de coordenadas asociados a un SGR en valores de coordenadas asociados a otro SGR. En el presente trabajo se realiza un análisis del impacto del cambio de referencial geodésico SIRGAS en la geometría de los rasgos representados en el sistema de proyección Universal Transversa de Mercator, para el caso de Chile continental sudamericano. Posteriormente, se definen modelos y parámetros alternativos al procedimiento clásico de transformación de coordenadas. Los resultados muestran que los modelos alternativos son eficaces en el caso de Chile.
Müller, Ruben; Schütze, Niels
2014-05-01
Water resources systems with reservoirs are expected to be sensitive to climate change. Assessment studies that analyze the impact of climate change on the performance of reservoirs can be divided in two groups: (1) Studies that simulate the operation under projected inflows with the current set of operational rules. Due to non adapted operational rules the future performance of these reservoirs can be underestimated and the impact overestimated. (2) Studies that optimize the operational rules for best adaption of the system to the projected conditions before the assessment of the impact. The latter allows for estimating more realistically future performance and adaption strategies based on new operation rules are available if required. Multi-purpose reservoirs serve various, often conflicting functions. If all functions cannot be served simultaneously at a maximum level, an effective compromise between multiple objectives of the reservoir operation has to be provided. Yet under climate change the historically preferenced compromise may no longer be the most suitable compromise in the future. Therefore a multi-objective based climate change impact assessment approach for multi-purpose multi-reservoir systems is proposed in the study. Projected inflows are provided in a first step using a physically based rainfall-runoff model. In a second step, a time series model is applied to generate long-term inflow time series. Finally, the long-term inflow series are used as driving variables for a simulation-based multi-objective optimization of the reservoir system in order to derive optimal operation rules. As a result, the adapted Pareto-optimal set of diverse best compromise solutions can be presented to the decision maker in order to assist him in assessing climate change adaption measures with respect to the future performance of the multi-purpose reservoir system. The approach is tested on a multi-purpose multi-reservoir system in a mountainous catchment in Germany. A
Timing system for multi-bunch/multi-train operation at ATF
International Nuclear Information System (INIS)
Naito, T.; Hayano, H.; Urakawa, J.; Imai, T.
2000-01-01
A timing system has been constructed for multi-bunch/multi-train operation at KEK-ATF. The linac accelerates 20 bunches of multi-bunch with 2.8 ns spacing. The Damping Ring stores up to 5 trains of multi-bunch. The timing system is required to provide flexible operation mode and bucket selection. A personal computer is used for manipulating the timing. The performance of kicker magnets at the injection/extruction is key issue for multi-train operation. The hardware and the test results are presented. (author)
Establecimiento de plántulas in vitro de clones de ajo peruano (Allium sativum L.
Directory of Open Access Journals (Sweden)
Leidy López Quintero
2014-06-01
Full Text Available Se evaluó el establecimiento in vitro de dos clones de ajo peruano mediante el uso de procesos estandarizados de desinfección e introducción in vitro de meristemos de ajo de clones nacionales. Se validó el uso de hipocloritode calcio (1 g.L-1 e hipoclorito de sodio (0.1% como desinfectantes, permitiendo la eliminación total de los microorganismos presentes en los explantes yuna viabilidad del 66.3 y 64.5% en los clones P-007A y P-007B. El establecimiento in vitro de las plántulas se realizó en medio de cultivo MS con 0,5 mg.L-1 de ácido naftalen acético (ANA y 0,64 mg.L-1 de 2-Isopentil adenina(2ip, donde el clon P-007A desarrollo plántulas de 15mm con 2.52 hojas, mientras en el clon P-007B las plántulas tenían 13.6mm con 2.16 hojas. Las plántulas establecidas de ajo de los clones peruanos lograron los parámetros de desarrollo indicados para la etapa de establecimiento de la especie.
Multi-stage decoding of multi-level modulation codes
Lin, Shu; Kasami, Tadao; Costello, Daniel J., Jr.
1991-01-01
Various types of multi-stage decoding for multi-level modulation codes are investigated. It is shown that if the component codes of a multi-level modulation code and types of decoding at various stages are chosen properly, high spectral efficiency and large coding gain can be achieved with reduced decoding complexity. Particularly, it is shown that the difference in performance between the suboptimum multi-stage soft-decision maximum likelihood decoding of a modulation code and the single-stage optimum soft-decision decoding of the code is very small, only a fraction of dB loss in signal to noise ratio at a bit error rate (BER) of 10(exp -6).
Directory of Open Access Journals (Sweden)
José Luis Blas Arroyo
2017-05-01
Full Text Available Mediante la utilización del paradigma variacionista y el empleo de un corpus integrado por textos de inmediatez comunicativa, mayoritariamente de carácter epistolar, en esta investigación se analiza un caso de la sintaxis particularmente resistente al cambio: la alternancia entre soluciones pronominales (que y, en menor medida, cual y adverbiales (donde en las relativas oblicuas locativas desde el siglo XVI hasta la primera mitad del XX. De los tres análisis de regresión independientes realizados, uno por cada periodo (siglos XVI, XVIII y XX, se deriva un avance paulatino, aunque moderado, de las formas pronominales a lo largo de los siglos y la progresiva disminución del adverbio donde. Con todo, algunos factores lingüísticos se revelan especialmente persistentes en la explicación de la variabilidad (semántica, función sintáctica y categoría del antecedente, junto al priming estructural y la sintaxis de la cláusula regente, lo que dificulta la progresión del cambio. Con respecto a los factores extralingüísticos, la frecuencia de los relativos pronominales en los contextos comunicativos más distantes, así como su uso preferente por parte de las élites sociales y las generaciones adultas, muestra que estas formas se han adscrito a lo largo de la historia a los registros más formales y prestigiosos.
Multi-stage decoding for multi-level block modulation codes
Lin, Shu
1991-01-01
In this paper, we investigate various types of multi-stage decoding for multi-level block modulation codes, in which the decoding of a component code at each stage can be either soft-decision or hard-decision, maximum likelihood or bounded-distance. Error performance of codes is analyzed for a memoryless additive channel based on various types of multi-stage decoding, and upper bounds on the probability of an incorrect decoding are derived. Based on our study and computation results, we find that, if component codes of a multi-level modulation code and types of decoding at various stages are chosen properly, high spectral efficiency and large coding gain can be achieved with reduced decoding complexity. In particular, we find that the difference in performance between the suboptimum multi-stage soft-decision maximum likelihood decoding of a modulation code and the single-stage optimum decoding of the overall code is very small: only a fraction of dB loss in SNR at the probability of an incorrect decoding for a block of 10(exp -6). Multi-stage decoding of multi-level modulation codes really offers a way to achieve the best of three worlds, bandwidth efficiency, coding gain, and decoding complexity.
Dicty_cDB: Contig-U16444-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 001503 |pid:none) Burkholderia glumae BGR1 chromos... 130 5e-30 AF511570_1( AF511570 |pid:none) Uncultured soil...) Pseudomonas syringae pv. phaseo... 80 2e-13 AF511571_1( AF511571 |pid:none) Uncultured soil bacterium clon...00390 |pid:none) Mesorhizobium sp. BNC1, complete... 57 3e-09 AF511572_1( AF511572 |pid:none) Uncultured soil
Lifescience Database Archive (English)
Full Text Available |CB367289.1 E38 early-oocyst library Plasmodium berghei/Anopheles stephensi mixe...7 |CB367287.1 E830 early-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone ...oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clon...ly-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone E3015 similar to Plasm
Dicty_cDB: Contig-U16439-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cDNA clon... 50 6e-16 3 ( FK739797 ) av01001d15r1.1 Symbiotic sea anemone (Anemonia vi... 84 4e-15 2 ( D872... ( CB933531 ) ri31b11.y1 Meloidogyne chitwoodi egg pAMP1 v1 Mel... 64 4e-11 2 ( FK729638 ) av02130e15r1.1 Symbiotic
Directory of Open Access Journals (Sweden)
Clara Pechmann Mendonça
1975-03-01
Full Text Available Apresentação do resultado comparativo entre dois métodos de coloração Osol e Ziehl-Neelsen para a pesquisa do bacilo álcool-ácido resistente, em 337 amostras secreção pulmonar. Foi realizada uma avaliação cultural de 287 amostras, mostrando que o método de Osol apresenta-se melhor nas baciloscopias discordantes e que há tendência em apresentar maior riqueza de germe.The comparative results obtained with the study of two staining methods, the Ziehl-Neelsen and the Osol ones, are presented. The study was performed with the alcohol acid resistant bacilli of 337 pulmonary secretion specimens. Evaluation cultures of 287 of these specimens were made. The Osol method proved to be better than the Ziehl-Neelsen one when dealing with discordant baciloscopic evidence. There tended to be a larger ammount of bacilli, too, when the former was used.
Analysis and synthesis of multi-qubit, multi-mode quantum devices
Energy Technology Data Exchange (ETDEWEB)
Solgun, Firat
2015-03-27
In this thesis we propose new methods in multi-qubit multi-mode circuit quantum electrodynamics (circuit-QED) architectures. First we describe a direct parity measurement method for three qubits, which can be realized in 2D circuit-QED with a possible extension to four qubits in a 3D circuit-QED setup for the implementation of the surface code. In Chapter 3 we show how to derive Hamiltonians and compute relaxation rates of the multi-mode superconducting microwave circuits consisting of single Josephson junctions using an exact impedance synthesis technique (the Brune synthesis) and applying previous formalisms for lumped element circuit quantization. In the rest of the thesis we extend our method to multi-junction (multi-qubit) multi-mode circuits through the use of state-space descriptions which allows us to quantize any multiport microwave superconducting circuit with a reciprocal lossy impedance response.
Multi-view clustering via multi-manifold regularized non-negative matrix factorization.
Zong, Linlin; Zhang, Xianchao; Zhao, Long; Yu, Hong; Zhao, Qianli
2017-04-01
Non-negative matrix factorization based multi-view clustering algorithms have shown their competitiveness among different multi-view clustering algorithms. However, non-negative matrix factorization fails to preserve the locally geometrical structure of the data space. In this paper, we propose a multi-manifold regularized non-negative matrix factorization framework (MMNMF) which can preserve the locally geometrical structure of the manifolds for multi-view clustering. MMNMF incorporates consensus manifold and consensus coefficient matrix with multi-manifold regularization to preserve the locally geometrical structure of the multi-view data space. We use two methods to construct the consensus manifold and two methods to find the consensus coefficient matrix, which leads to four instances of the framework. Experimental results show that the proposed algorithms outperform existing non-negative matrix factorization based algorithms for multi-view clustering. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Sagrera-Moreno, José Luis
1981-06-01
Full Text Available Not available
En el presente trabajo [continuación de otro en el que se dio cuenta de las variaciones que experimentan las resistencias mecánicas a flexotracción y la evolución de los coeficientes de corrosión de probetas de mortero (1:3 conservadas bajo agua potable filtrada y agua de mar artificial ASTM D 1141-75] se estudia por DRX la composición estructural de las nuevas fases sólidas formadas en los medios de curado y de conservación (agua potable filtrada en donde han estado sumergidas las series testigo de probetas de mortero (1:3 de 1 X. 1 X 6 cm hechas con un cemento portland industrial resistente al yeso, cemento 2 < > P-450-Y, y con las mezclas de cemento 2/escoria granulada (vítrea = 85/ /15-65/35-40/60 y 30/70 (en peso, durante 21 días en el primer período y 56-90-180 y 360 días en el segundo, así como la evolución de las fases cristalinas de la fracción enriquecida (cemento hidratado extraída de uno de los prismas de cada serie de probetas de mortero.
Simulation-optimization framework for multi-site multi-season hybrid stochastic streamflow modeling
Srivastav, Roshan; Srinivasan, K.; Sudheer, K. P.
2016-11-01
A simulation-optimization (S-O) framework is developed for the hybrid stochastic modeling of multi-site multi-season streamflows. The multi-objective optimization model formulated is the driver and the multi-site, multi-season hybrid matched block bootstrap model (MHMABB) is the simulation engine within this framework. The multi-site multi-season simulation model is the extension of the existing single-site multi-season simulation model. A robust and efficient evolutionary search based technique, namely, non-dominated sorting based genetic algorithm (NSGA - II) is employed as the solution technique for the multi-objective optimization within the S-O framework. The objective functions employed are related to the preservation of the multi-site critical deficit run sum and the constraints introduced are concerned with the hybrid model parameter space, and the preservation of certain statistics (such as inter-annual dependence and/or skewness of aggregated annual flows). The efficacy of the proposed S-O framework is brought out through a case example from the Colorado River basin. The proposed multi-site multi-season model AMHMABB (whose parameters are obtained from the proposed S-O framework) preserves the temporal as well as the spatial statistics of the historical flows. Also, the other multi-site deficit run characteristics namely, the number of runs, the maximum run length, the mean run sum and the mean run length are well preserved by the AMHMABB model. Overall, the proposed AMHMABB model is able to show better streamflow modeling performance when compared with the simulation based SMHMABB model, plausibly due to the significant role played by: (i) the objective functions related to the preservation of multi-site critical deficit run sum; (ii) the huge hybrid model parameter space available for the evolutionary search and (iii) the constraint on the preservation of the inter-annual dependence. Split-sample validation results indicate that the AMHMABB model is
Directory of Open Access Journals (Sweden)
Javier Andres Bustamante Rengifo
2010-05-01
Full Text Available La detección de bacilos ácido alcohol resistentes (BAAR en frotis resulta un aporte significativo al diagnóstico y tratamiento de individuos con inflamación granulomatosa crónica (IGC. Con el objetivo de evaluar la presencia de BAAR en diferentes tejidos de pacientes con IGC demostrada y comparar la frecuencia de los extendidos positivos para BAAR con el grado de formación de granulomas y necrosis, se diseño un estudio retrospectivo, en el que se seleccionaron 57 bloques embebidos en parafina que contenían biopsias de pleura, pulmón, pericardio, ganglio linfático y lóbulo cerebral, correspondientes a 30 pacientes (63.3% hombres, mayores de 18 años, con IGC demostrada y remitidos al departamento de patología del Hospital Universitario del Valle entre el 2002-2008, a cada muestra se le realizaron 3 cortes y se sometieron a tinciones de H/E, Zielh Neelsen y Auramina. La detección de BAAR en frotis fue similar para ambas tinciones especiales en pacientes con IGC necrotizante, reflejando una excelente concordancia en el diagnostico (kappa=0.89, IC95%[0.68-1.0]. Sin embargo, la tinción con Auramina fue superior a la tinción Ziehl Neelsen para la detección de BAAR en pacientes con IGC no necrotizante (kappa=0.65, IC95%[0.23-1.0]. No se encontraron diferencias significativas entre la presencia de BAAR y el tipo de inflamacion, sexo y localización anatómica comprometida. En general, fue buena la concordancia entre los métodos histológicos empleados. Además, se hizo evidente la importancia de implementar el uso de técnicas moleculares mínimamente afectadas por el escaso número de bacilos presentes en las muestras, que finalmente ayudan en el reconocimiento del microorganismo.
Directory of Open Access Journals (Sweden)
Letícia Pimenta Lopes
2017-01-01
Full Text Available Objetivo: identificar el estado del cargador y el perfil de susceptibilidad a los antibióticos de los Staphylococcus aureus aislados de la saliva y de la secreción nasal de los profesionales de enfermería. Método: estudio transversal, que utilizó muestras de saliva y secreción nasal, obtenidas de 100 profesionales de enfermería que asisten a personas con VIH/SIDA. Resultados: se identificó que 43,0% de los participantes presentaron muestras de saliva y/o secreción nasal positiva por Staphylococcus aureus . De las 74 muestras de secreción nasal con Staphylococcus aureus , 14,9% presentaron resistencia a la oxacilina; 91,9% a la penicilina; 44,6% a la eritromicina y 41,9% a la clindamicina. De las 12 muestras de saliva positivas, 16,7% fueron resistentes a la oxacilina; 100% a la penicilina; 33,4% a la eritromicina y 25,0% a la clindamicina. Conclusión: se cree que el profesional al obtener conocimiento de su estado de portador del microorganismos multi-resistentes, pasará a supervisar sus prácticas asistenciales y adoptar con mayor eficacia las medidas para la prevención y el control de la cadena epidemiológica de estas bacterias en el ambiente laboral.
Directory of Open Access Journals (Sweden)
Mariluz Hernández
2003-12-01
Full Text Available Actualmente, Streptococcus pneumoniae resistente a penicilina es un patógeno común en infecciones pediátricas, lo cual plantea dificultades en el tratamiento. La rifampicina y el cloranfenicol se han recomendado como antibióticos útiles y como alternativas en estos casos, pues son menos costosos y más accesibles a las comunidades de recursos limitados. Su uso, sin embargo, puede estar limitado por los niveles de resistencia encontrados en diferentes poblaciones. El objetivo del presente estudio fue determinar la concentración inhibitoria mínima (CIM y la concentración bactericida mínima (CBM a la rifampicina y al cloranfenicol en aislamientos de S. pneumoniae pertenecientes a un grupo recolectado entre 1994 a 1996 de niños menores de 5 años con infección sistémica y meningitis. Se estudiaron 107 aislamientos, 60 de ellos resistentes a penicilina y 47 sensibles, 53 de los cuales fueron aislamientos de LCR. La CIM y la CBM se realizaron de acuerdo con las recomendaciones de la NCCLS; se utilizó S. pneumoniae ATCC 49619 como control. Se consideraron como sensibles al cloranfenicol los aislamientos con CIM=4 ?g/ml y resistentes, con CIM=8 ?g/ml; sensibles a rifampicina con CIM=1 ?g/ml y resistentes con CIM=4 ?g/ml. La CBM se determinó con la menor concentración del antibiótico que inhibió el crecimiento del 99,9% del inóculo. Se encontró resistencia al cloranfenicol en 20,5% de los 107 aislamientos estudiados. En el grupo resistente a la penicilina, 28% fue resistente al cloranfenicol y 11% en el grupo sensible a la penicilina. La CBM para el cloranfenicol fue >4 ?g/ml en 28% de los aislamientos sensibles a la penicilina y en 60% de los resistentes. No se encontraron aislamientos resistentes a la rifampicina; sin embargo, 2 aislamientos mostraron CBM>1 ?g/ml y una CBM=16 ?g/ml. Los aislamientos de LCR presentaron la CIM y la CBM más altas que el grupo total de aislamientos. Los datos sugieren que en Colombia el cloranfenicol no
Directory of Open Access Journals (Sweden)
Adriana Cristina de Oliveira
2010-12-01
Full Text Available The goal was to identify risk factors for healthcare-associated infections by resistant microorganisms and patient mortality in an Intensive Care Unit. A prospective and descriptive epidemiological research was conducted from 2005 till 2008, involving 2300 patients. Descriptive statistics, bivariate and multivariate logistic regression analysis were used. In bivariate analysis, infection caused by resistant microorganism was significantly associated to patients with community-acquired infection (p=0.03; OR=1.79 and colonization by resistant microorganism (pSe objetivó identificar factores de riesgo para el desarrollo de infecciones relacionadas al cuidar en salud, por microorganismos resistentes, y también investigar su relación con la mortalidad de los pacientes en un centro de terapia intensiva. Se trata de un estudio epidemiológico prospectivo realizado entre 2005 y 2008, envolviendo 2.300 pacientes. Se utilizó la estadística descriptiva y el análisis de regresión logístico bivariado y multivariado. En el análisis bivariado, la infección por microorganismos resistentes estuvo significativamente asociada a pacientes con infección comunitaria (p=0,03; OR=1,79 y a la colonización por microorganismo resistente (pObjetivou-se identificar fatores de risco para o desenvolvimento de infecções, relacionadas ao cuidar em saúde, por microrganismos resistentes e a mortalidade dos pacientes em um centro de terapia intensiva. Trata-se de estudo epidemiológico prospectivo, realizado entre 2005 e 2008, envolvendo 2.300 pacientes. Utilizou-se estatística descritiva, análise de regressão logística bivariada e multivariada. Na análise bivariada, a infecção por microrganismo resistente esteve significativamente associada a pacientes com infecção comunitária (p=0,03; OR=1,79 e colonização por microrganismo resistente (p<0,01; OR=14,22. Na análise multivariada, severidade clínica C (p=0,03; OR=0,25 e colonização por microrganismo
Directory of Open Access Journals (Sweden)
Josely Pinto de Moura
2010-06-01
Full Text Available OBJETIVOS: Avaliar a colonização por Staphylococcus aureus sensíveis e resistentes à meticilina na saliva de profissionais de enfermagem e o perfil de resistência à mupirocina. MÉTODOS: Foram coletadas três amostras da saliva de 356 (94,2% profissionais participantes da pesquisa, totalizando 1.068 amostras processadas. Todos os aspectos éticos foram contemplados. A análise microbiológica compreendeu a identificação fenotípica, segundo normas do Clinical and Laboratory Standards Institute. RESULTADOS: Foram obtidos 73 indivíduos colonizados por Staphylococcus aureus na primeira coleta, 48 na segunda e 37 na terceira, somando 158 isolados de Staphylococcus aureus. Desses, 24 (15,2% eram resistentes à oxacilina e 30 resistentes à mupirocina (18,9%. A resistência à mupirocina foi observada de forma pronunciada nos Staphylococcus aureus metacilina resistente (MRSA; dos 24 MRSA, 17 (70,8% apresentaram-se resistentes a este antimicrobiano. CONCLUSÃO: Os resultados indicaram que a resistência à mupirocina é um importante problema, pois esse antibiótico é um excelente aliado nas medidas de controle das infecções de serviços de saúde.OBJETIVOS: Evaluar la colonización por Staphylococcus aureus sensibles y resistentes al meticilín en la saliva de profesionales de enfermería y, reconocer el perfil de resistencia a la mupirocina. MÉTODOS: Fueron recolectadas tres muestras de saliva de 356 (94,2% profesionales participantes de la investigación, totalizando 1.068 muestras procesadas. Todos los aspectos éticos fueron contemplados. El análisis microbiológico comprendió la identificación fenotípica, según normas del Clinical and Laboratory Standards Institute. RESULTADOS: Fueron obtenidos 73 individuos colonizados por Staphylococcus aureus en la primera recolección, 48 en la segunda y 37 en la tercera, sumando 158 muestras aisladas de Staphylococcus aureus. De esas, 24 (15,2% eran resistentes a la oxacilina y 30
EU-lande i fælles front mod kartoffelskimmel
DEFF Research Database (Denmark)
Hansen, Jens Grønbech; Lassen, Poul; Nielsen, Bent J.
2006-01-01
resistente kartoffelsorter. Hvis udbyttetab og sprøjtemiddelforbrug skal begrænses, er det nødvendigt at følge og forstå ændringer i den måde kartoffelskimmel opfører sig på og at udvikle nye resistente kartoffelsorter. Et fælles EU-projekt ved navn Eucablight samler trådene. Udgivelsesdato: januar 2006...
Multi-view L2-SVM and its multi-view core vector machine.
Huang, Chengquan; Chung, Fu-lai; Wang, Shitong
2016-03-01
In this paper, a novel L2-SVM based classifier Multi-view L2-SVM is proposed to address multi-view classification tasks. The proposed Multi-view L2-SVM classifier does not have any bias in its objective function and hence has the flexibility like μ-SVC in the sense that the number of the yielded support vectors can be controlled by a pre-specified parameter. The proposed Multi-view L2-SVM classifier can make full use of the coherence and the difference of different views through imposing the consensus among multiple views to improve the overall classification performance. Besides, based on the generalized core vector machine GCVM, the proposed Multi-view L2-SVM classifier is extended into its GCVM version MvCVM which can realize its fast training on large scale multi-view datasets, with its asymptotic linear time complexity with the sample size and its space complexity independent of the sample size. Our experimental results demonstrated the effectiveness of the proposed Multi-view L2-SVM classifier for small scale multi-view datasets and the proposed MvCVM classifier for large scale multi-view datasets. Copyright © 2015 Elsevier Ltd. All rights reserved.
Automatic Multi-Level Thresholding Segmentation Based on Multi-Objective Optimization
Directory of Open Access Journals (Sweden)
L. DJEROU,
2012-01-01
Full Text Available In this paper, we present a new multi-level image thresholding technique, called Automatic Threshold based on Multi-objective Optimization "ATMO" that combines the flexibility of multi-objective fitness functions with the power of a Binary Particle Swarm Optimization algorithm "BPSO", for searching the "optimum" number of the thresholds and simultaneously the optimal thresholds of three criteria: the between-class variances criterion, the minimum error criterion and the entropy criterion. Some examples of test images are presented to compare our segmentation method, based on the multi-objective optimization approach with Otsu’s, Kapur’s and Kittler’s methods. Our experimental results show that the thresholding method based on multi-objective optimization is more efficient than the classical Otsu’s, Kapur’s and Kittler’s methods.
A human D1 dopamine receptor gene is located on chromosome 5 at q35.1 and identifies an EcoRI RFLP.
Grandy, D K; Zhou, Q Y; Allen, L; Litt, R; Magenis, R E; Civelli, O; Litt, M
1990-01-01
Dopaminergic neurons have been shown to affect voluntary movement, hormone secretion, and emotional tone. Mediating these activities are two receptor subtypes, D1 and D2, which are biochemically and pharmacologically distinct. The D1 subtype, the most abundant form of dopamine receptor in the central nervous system, stimulates adenylate cyclase, modulates D2 receptor activity, regulates neuron growth and differentiation, and mediates several behavioral responses. Recently we reported the clon...
Multi-Hop Link Capacity of Multi-Route Multi-Hop MRC Diversity for a Virtual Cellular Network
Daou, Imane; Kudoh, Eisuke; Adachi, Fumiyuki
In virtual cellular network (VCN), proposed for high-speed mobile communications, the signal transmitted from a mobile terminal is received by some wireless ports distributed in each virtual cell and relayed to the central port that acts as a gateway to the core network. In this paper, we apply the multi-route MHMRC diversity in order to decrease the transmit power and increase the multi-hop link capacity. The transmit power, the interference power and the link capacity are evaluated for DS-CDMA multi-hop VCN by computer simulation. The multi-route MHMRC diversity can be applied to not only DS-CDMA but also other access schemes (i. e. MC-CDMA, OFDM, etc.).
Box-Particle Cardinality Balanced Multi-Target Multi-Bernoulli Filter
L. Song; X. Zhao
2014-01-01
As a generalized particle filtering, the box-particle filter (Box-PF) has a potential to process the measurements affected by bounded error of unknown distributions and biases. Inspired by the Box-PF, a novel implementation for multi-target tracking, called box-particle cardinality balanced multi-target multi-Bernoulli (Box-CBMeMBer) filter is presented in this paper. More important, to eliminate the negative effect of clutters in the estimation of the numbers of targets, an improved generali...
Multi-wavelength and multi-colour temporal and spatial optical solitons
DEFF Research Database (Denmark)
Kivshar, Y. S.; Sukhorukov, A. A.; Ostrovskaya, E. A.
2000-01-01
We present an overview of several novel types of multi- component envelope solitary waves that appear in fiber and waveguide nonlinear optics. In particular, we describe multi-channel solitary waves in bit-parallel-wavelength fiber transmission systems for high performance computer networks, multi......-color parametric spatial solitary waves due to cascaded nonlinearities of quadratic materials, and quasiperiodic envelope solitons in Fibonacci optical superlattices....
Directory of Open Access Journals (Sweden)
Prado, J. L.
1987-04-01
Full Text Available The present study is a revision of the terminal forms of the South-American horses coming from the archeological sites of Patagonia. They are compared with those from the Northwest of Argentine. The study also includes paleoenvironmental and cronological related aspects.El presente estudio comprende una revisión de las formas terminales de caballos sudamericanos recuperados de sitios arqueológicos de la Patagonia. Se comparan con las formas del noroeste argentino. Incluye aspectos paleoambientales y cronológicos relacionados.
Rodríguez, M. Fernanda; Wolff, Marcelo; Cortés, Claudia
2015-01-01
Introducción: Chile ha experimentado un aumento de inmigrantes, especialmente sudamericanos. La literatura médica internacional describe necesidades de atención diferenciadas entre migrantes y poblaciones autóctonas. En Chile se han mantenido estrategias de prevención de la infección por virus de inmunodeficiencia humana (VIH) únicamente basadas en necesidades de la población nacional. Objetivos: Describir las características clínicas y epidemiológicas de la infección por VIH en pacientes inm...
José Andrés Peña-Pinzón; Carmen Gómez-Berrocal; Antonio Fernández-Parra
2014-01-01
Se explora el efecto de la saliencia de la categorización social inmigrante y su interacción con diferencias sociodemográficas (nivel de estudios, situación laboral, sexo) de los sujetos, en ajuste psicológico, bienestar psicológico y autoestima. 210 inmigrantes de origen sudamericano, residentes en las provincias de Granada y Almería, fueron distribuidos en dos condiciones experimentales: "saliencia baja/alta de la categorización social inmigrante". Encontramos efecto de la manipulación sobr...
Directory of Open Access Journals (Sweden)
Marcela Sanchez
Full Text Available Introducción: Staphylococcus aureus resistente a la meticilina (SARM es responsable de infecciones intrahospitalarias, las que constituyen una importante causa de morbilidad y mortalidad en nuestro medio, por lo cual la rápida identificación y tipificación molecular de la resistencia como el complejo SSCmec es esencial para entender la epidemiología de la infección. Objetivo: Caracterizar fenotípicamente la resistencia a meticilina y genotípicamente el casete cromosomal SSCmec en cepas de S. aureus aislados de individuos de la ciudad de Medellín mediante PCR múltiple. Materiales y métodos: A 41 aislamientos (hospitalarios y de la comunidad de S. aureus se les estableció la resistencia a cefoxitin mediante la técnica de Kirby-Bauer y la concentración inhibitoria mínima para oxacilina. Mediante PCR convencional se les confirmó la presencia del gen mecA. Para la tipificación del complejo SSCmec se utilizó PCR múltiple para amplificar 6 loci diferentes de este gen. Resultados: A todos los aislamientos se les confirmó resistencia a meticilina y la presencia del gen mecA, de los cuales 17 fueron clasificados como SSC mec I, 1 como SSC mec II, 21 como SSC mecIV; dos aislamientos no fue posible clasificarlos. Conclusiones: Con el uso de esta técnica clasificamos el 95% de los aislamientos del estudio, encontrando una mayor prevalencia de los SSCmec I y IV. La implementación de esta técnica permite una fácil caracterización de los aislamientos SARM y un apropiado manejo de la información de los integrantes de los comités de infecciones hospitalarios, lo cual podría impactar positivamente en el tratamiento a los pacientes y el control de enfermedades infecciosas intrahospitalarias.
Multi-scale and multi-orientation medical image analysis
Haar Romenij, ter B.M.; Deserno, T.M.
2011-01-01
Inspired by multi-scale and multi-orientation mechanisms recognized in the first stages of our visual system, this chapter gives a tutorial overview of the basic principles. Images are discrete, measured data. The optimal aperture for an observation with as little artefacts as possible, is derived
Multi-level trellis coded modulation and multi-stage decoding
Costello, Daniel J., Jr.; Wu, Jiantian; Lin, Shu
1990-01-01
Several constructions for multi-level trellis codes are presented and many codes with better performance than previously known codes are found. These codes provide a flexible trade-off between coding gain, decoding complexity, and decoding delay. New multi-level trellis coded modulation schemes using generalized set partitioning methods are developed for Quadrature Amplitude Modulation (QAM) and Phase Shift Keying (PSK) signal sets. New rotationally invariant multi-level trellis codes which can be combined with differential encoding to resolve phase ambiguity are presented.
Multi-objective optimization of linear multi-state multiple sliding window system
International Nuclear Information System (INIS)
Konak, Abdullah; Kulturel-Konak, Sadan; Levitin, Gregory
2012-01-01
This paper considers the optimal element sequencing in a linear multi-state multiple sliding window system that consists of n linearly ordered multi-state elements. Each multi-state element can have different states: from complete failure up to perfect functioning. A performance rate is associated with each state. The failure of type i in the system occurs if for any i (1≤i≤I) the cumulative performance of any r i consecutive elements is lower than w i . The element sequence strongly affects the probability of any type of system failure. The sequence that minimizes the probability of certain type of failure can provide high probability of other types of failures. Therefore the optimization problem for the multiple sliding window system is essentially multi-objective. The paper formulates and solves the multi-objective optimization problem for the multiple sliding window systems. A multi-objective Genetic Algorithm is used as the optimization engine. Illustrative examples are presented.
PMHT Approach for Multi-Target Multi-Sensor Sonar Tracking in Clutter.
Li, Xiaohua; Li, Yaan; Yu, Jing; Chen, Xiao; Dai, Miao
2015-11-06
Multi-sensor sonar tracking has many advantages, such as the potential to reduce the overall measurement uncertainty and the possibility to hide the receiver. However, the use of multi-target multi-sensor sonar tracking is challenging because of the complexity of the underwater environment, especially the low target detection probability and extremely large number of false alarms caused by reverberation. In this work, to solve the problem of multi-target multi-sensor sonar tracking in the presence of clutter, a novel probabilistic multi-hypothesis tracker (PMHT) approach based on the extended Kalman filter (EKF) and unscented Kalman filter (UKF) is proposed. The PMHT can efficiently handle the unknown measurements-to-targets and measurements-to-transmitters data association ambiguity. The EKF and UKF are used to deal with the high degree of nonlinearity in the measurement model. The simulation results show that the proposed algorithm can improve the target tracking performance in a cluttered environment greatly, and its computational load is low.
Tebaldi, Thaís Cristina; Malbouisson, Luíz Marcelo Sá; Kondo, Mario M; Cardoso, Mônica M S C
2008-01-01
The addition of subarachnoid clonidine (alpha-agonist) prolongs the analgesia produced by the combination of sufentanil and isobaric bupivacaine in combined labor analgesia(1). The objective of this study was to compare the quality of analgesia and the prevalence of side effects after the addition of subarachnoid clonidine to the anesthetic solution in labor analgesia. After approval by the Ethics Commission, 22 pregnant women in labor were randomly assigned to the subarachnoid administration of either 2.5 mg of 0.5% hyperbaric bupivacaine (CLON/HYPER Group; n = 11) or 2.5 mg of 0.5% isobaric bupivacaine (CLON/ISO Group; n = 11) associated with 2.5 microg of sufentanil and 30 microg of clonidine. Pain, evaluated by the Visual Analogue Scale, heart rate, and mean arterial pressure were assessed every 5 minutes during the first 15 minutes, and then every 15 minutes afterwards until delivery. The prevalence of side effects (nausea, vomiting, pruritus, and sedation) was evaluated. The study was terminated whenever the patient needed supplemental epidural analgesia (pain > 3) or upon delivery of the fetus. The Student t test, Chi-square test, Fisher exact test, and two-way ANOVA for repeated measurements were used in the statistical analysis and a p hyperbaric and isobaric solutions showed similar behavior.
International Nuclear Information System (INIS)
Morita, K.; Fukuda, K.; Tobita, Y.; Kondo, Sa.; Suzuki, T.; Maschek, W.
2003-01-01
A new multi-component vaporization/condensation (V/C) model was developed to provide a generalized model for safety analysis codes of liquid metal cooled reactors (LMRs). These codes simulate thermal-hydraulic phenomena of multi-phase, multi-component flows, which is essential to investigate core disruptive accidents of LMRs such as fast breeder reactors and accelerator driven systems. The developed model characterizes the V/C processes associated with phase transition by employing heat transfer and mass-diffusion limited models for analyses of relatively short-time-scale multi-phase, multi-component hydraulic problems, among which vaporization and condensation, or simultaneous heat and mass transfer, play an important role. The heat transfer limited model describes the non-equilibrium phase transition processes occurring at interfaces, while the mass-diffusion limited model is employed to represent effects of non-condensable gases and multi-component mixture on V/C processes. Verification of the model and method employed in the multi-component V/C model of a multi-phase flow code was performed successfully by analyzing a series of multi-bubble condensation experiments. The applicability of the model to the accident analysis of LMRs is also discussed by comparison between steam and metallic vapor systems. (orig.)
Consideraciones sobre granulometrías discontinuas de máxima compactación
Directory of Open Access Journals (Sweden)
Olaya, Manuel
1978-06-01
Full Text Available Los materiales conglomerados que se presentan en la naturaleza deben su génesis estructural a la acomodación geométrica de unos y otros componentes. Tras un proceso de "cimentación", este acomodo, según sea la disposición particular, conlleva por parte del material una respuesta resistente frente a las acciones exteriores impuestas. Sobre esta idea cabe suponer que los conglomerados más resistentes serán aquellos que tengan su estructura fundamentada en los interapoyos de los granos más duros y resistentes. ya que de por sí el material cementante proviene en la mayoría de los casos de otros previamente meteorizados a los que la evolución geológica ha colocado entre los primeros.
Recomendaciones para el control de la transmisión de la tuberculosis en los hospitales
Directory of Open Access Journals (Sweden)
Luz Huaroto
2009-07-01
Full Text Available La transmisión nosocomial de la tuberculosis (TB es un problema vigente en el Perú, tanto por el riesgo de enfermar que corre el personal de salud y pacientes, como por la presencia cada vez más frecuente de cepas resistentes: TB MDR (multidrogo resistente, TB XDR (extensivamente resistente a drogas. Se describen los factores condicionantes de la transmisión de TB en los hospitales, así como las medidas de control recomendadas, incluyendo: 1 control administrativo, 2 control ambiental y 3 protección respiratoria personal. Además, se señala la importancia de los Planes de Control de Infecciones de Tuberculosis en los hospitales y la experiencia en su implementación en 19 centros hospitalarios del país.
MULTI-TEMPORAL REMOTE SENSING IMAGE CLASSIFICATION - A MULTI-VIEW APPROACH
National Aeronautics and Space Administration — MULTI-TEMPORAL REMOTE SENSING IMAGE CLASSIFICATION - A MULTI-VIEW APPROACH VARUN CHANDOLA AND RANGA RAJU VATSAVAI Abstract. Multispectral remote sensing images have...
Dicty_cDB: Contig-U15883-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi
Gene : CBRC-HSAP-13-0003 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-13-0003 13 B UNKNOWN PCFT_XENLA 8e-30 30% gb|AAH60850.1| SLC46A3 protein [Homo sapi...ens] emb|CAI17158.1| novel protein [Homo sapiens] gb|EAX08438.1| hypothetical protein LOC283537, isoform CRA_b [Homo sapi...ens] 1e-159 100% gnl|UG|Hs#S16817523 Homo sapiens mRNA; cDNA DKFZp686H0448 (from clon...SSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLGEFQV ...
Multi-population genomic prediction using a multi-task Bayesian learning model.
Chen, Liuhong; Li, Changxi; Miller, Stephen; Schenkel, Flavio
2014-05-03
Genomic prediction in multiple populations can be viewed as a multi-task learning problem where tasks are to derive prediction equations for each population and multi-task learning property can be improved by sharing information across populations. The goal of this study was to develop a multi-task Bayesian learning model for multi-population genomic prediction with a strategy to effectively share information across populations. Simulation studies and real data from Holstein and Ayrshire dairy breeds with phenotypes on five milk production traits were used to evaluate the proposed multi-task Bayesian learning model and compare with a single-task model and a simple data pooling method. A multi-task Bayesian learning model was proposed for multi-population genomic prediction. Information was shared across populations through a common set of latent indicator variables while SNP effects were allowed to vary in different populations. Both simulation studies and real data analysis showed the effectiveness of the multi-task model in improving genomic prediction accuracy for the smaller Ayshire breed. Simulation studies suggested that the multi-task model was most effective when the number of QTL was small (n = 20), with an increase of accuracy by up to 0.09 when QTL effects were lowly correlated between two populations (ρ = 0.2), and up to 0.16 when QTL effects were highly correlated (ρ = 0.8). When QTL genotypes were included for training and validation, the improvements were 0.16 and 0.22, respectively, for scenarios of the low and high correlation of QTL effects between two populations. When the number of QTL was large (n = 200), improvement was small with a maximum of 0.02 when QTL genotypes were not included for genomic prediction. Reduction in accuracy was observed for the simple pooling method when the number of QTL was small and correlation of QTL effects between the two populations was low. For the real data, the multi-task model achieved an
Kautz, Christian
2017-01-01
Multiresistente Erreger (MRE), wie der Methicillin-resistente Staphylococcus aureus, Vancomycin-resistente Enterokokken und multiresistente gramnegative Bakterien, die β Lactamasen mit erweitertem Wirkspektrum produzieren und/oder Carbapenem resistent sind, verursachen immer häufiger nosokomiale Infektionen. Diese sind schwer zu behandeln und gehen mit einer höheren Morbidität und Mortalität einher. Da besiedelte oder infizierte Patienten ein Reservoir und Vehikel für die Verbreitung von MRE ...
Multi-armed spirals and multi-pairs antispirals in spatial rock–paper–scissors games
Energy Technology Data Exchange (ETDEWEB)
Jiang, Luo-Luo, E-mail: jiangluoluo@gmail.com [College of Physics and Electronic Information Engineering, Wenzhou University, Wenzhou 325035 (China); College of Physics and Technology, Guangxi Normal University, Guilin, Guangxi 541004 (China); Wang, Wen-Xu [School of Electrical, Computer and Energy Engineering, Arizona State University, Tempe, AZ 85287 (United States); Department of Physics, Beijing Normal University, Beijing 100875 (China); Lai, Ying-Cheng [School of Electrical, Computer and Energy Engineering, Arizona State University, Tempe, AZ 85287 (United States); Department of Physics, Arizona State University, Tempe, AZ 85287 (United States); Ni, Xuan [School of Electrical, Computer and Energy Engineering, Arizona State University, Tempe, AZ 85287 (United States)
2012-07-09
We study the formation of multi-armed spirals and multi-pairs antispirals in spatial rock–paper–scissors games with mobile individuals. We discover a set of seed distributions of species, which is able to produce multi-armed spirals and multi-pairs antispirals with a finite number of arms and pairs based on stochastic processes. The joint spiral waves are also predicted by a theoretical model based on partial differential equations associated with specific initial conditions. The spatial entropy of patterns is introduced to differentiate the multi-armed spirals and multi-pairs antispirals. For the given mobility, the spatial entropy of multi-armed spirals is higher than that of single armed spirals. The stability of the waves is explored with respect to individual mobility. Particularly, we find that both two armed spirals and one pair antispirals transform to the single armed spirals. Furthermore, multi-armed spirals and multi-pairs antispirals are relatively stable for intermediate mobility. The joint spirals with lower numbers of arms and pairs are relatively more stable than those with higher numbers of arms and pairs. In addition, comparing to large amount of previous work, we employ the no flux boundary conditions which enables quantitative studies of pattern formation and stability in the system of stochastic interactions in the absence of excitable media. -- Highlights: ► Multi-armed spirals and multi-pairs antispirals are observed. ► Patterns are predicted by computer simulations and partial differential equations. ► The spatial entropy of patterns is introduced. ► Patterns are relatively stable for intermediate mobility. ► The joint spirals with lower numbers of arms and pairs are relatively more stable.
Multi-armed spirals and multi-pairs antispirals in spatial rock–paper–scissors games
International Nuclear Information System (INIS)
Jiang, Luo-Luo; Wang, Wen-Xu; Lai, Ying-Cheng; Ni, Xuan
2012-01-01
We study the formation of multi-armed spirals and multi-pairs antispirals in spatial rock–paper–scissors games with mobile individuals. We discover a set of seed distributions of species, which is able to produce multi-armed spirals and multi-pairs antispirals with a finite number of arms and pairs based on stochastic processes. The joint spiral waves are also predicted by a theoretical model based on partial differential equations associated with specific initial conditions. The spatial entropy of patterns is introduced to differentiate the multi-armed spirals and multi-pairs antispirals. For the given mobility, the spatial entropy of multi-armed spirals is higher than that of single armed spirals. The stability of the waves is explored with respect to individual mobility. Particularly, we find that both two armed spirals and one pair antispirals transform to the single armed spirals. Furthermore, multi-armed spirals and multi-pairs antispirals are relatively stable for intermediate mobility. The joint spirals with lower numbers of arms and pairs are relatively more stable than those with higher numbers of arms and pairs. In addition, comparing to large amount of previous work, we employ the no flux boundary conditions which enables quantitative studies of pattern formation and stability in the system of stochastic interactions in the absence of excitable media. -- Highlights: ► Multi-armed spirals and multi-pairs antispirals are observed. ► Patterns are predicted by computer simulations and partial differential equations. ► The spatial entropy of patterns is introduced. ► Patterns are relatively stable for intermediate mobility. ► The joint spirals with lower numbers of arms and pairs are relatively more stable.
Directory of Open Access Journals (Sweden)
Carlos E. Lange
2004-07-01
Full Text Available La ameba patógena Malameba locustae King y Taylor fue detectada parasitando ejemplares del acridio Ronderosia bergi (Stal recolectados en las cercanías del Parque Nacional Iguazú, Misiones. El hallazgo constituye el segundo registro de M. locustae para acridios sudamericanos.Individuals of the grasshopper Ronderosia bergi (Stal collected in the surroundings of Iguazú National Park, Misiones, were found to be parasitized by the pathogenic amoeba Malameba locustae King & Taylor. The finding constitutes the second record of M. locustae for southamerican grasshoppers.
Justich Zabala, Pablo Ricardo
2010-01-01
Esta tesis estudia la relación experimentada entre la Globalización Neoliberal en Sudamérica y la mortalidad por grupos de edad y causa, clasificados según la teoría de la transición epidemiológica. Se han estudiado 4 países sudamericanos (Argentina, Brasil, Chile y Venezuela). Se demuestra que la Globalización Neoliberal no experimenta las mejoras esperables en términos de reducción de mortalidad por causas prevenibles, presentando en muchos casos efectos negativos sobre la reducción de las ...
Estudio de la variabilidad genética en camélidos bolivianos
Barreta Pinto, Julia
2013-01-01
El estudio de los camélidos sudamericanos es de gran interés en los países andinoscomo Perú, Bolivia, Chile, Argentina, debido a su importante valor económico y suimportancia en el mantenimiento y desarrollo de las poblaciones rurales en dichos países. Dada la falta de estudios genéticos centrados en las poblaciones de camélidos quehabitan en Bolivia, y la necesidad de realizar una valoración de la diversidad genética deestas poblaciones, la presente Tesis doctoral ha abordado el estudio gené...
Engorde de bagres (Rhamdia quelen) en sistema de cultivo intensivo por sexos separados
Comolli, J; Roux, J.P; Sánchez, S; Hernández, D
2013-01-01
El bagre sudamericano (ramdiá o jundiá) se caracteriza por rápido crecimiento en los primeros meses de vida e importante diferencia de desarrollo entre ambos sexos. La madurez sexual del macho es precoz, por lo cual la hembra alcanza un peso vivo 30% mayor que el del macho. El presente trabajo tuvo por objetivo analizar el engorde de especimenes de Rhamdia quelen separados por sexos en un sistema intensivo. Se llevaron a cabo tres tratamientos: TA- hembra, TB- mixto y TC- macho. El engorde se...
EL CHOCOLATE, UN PLACER SALUDABLE
Valenzuela B, Alfonso
2007-01-01
El cacao, que se obtiene de la almendra del árbol del cacao, fue utilizado durante cientos de años por los indígenas sudamericanos en la preparación de una bebida amarga, que los europeos modificaron en su preparación y composición, hasta originar lo que hoy se conoce como el chocolate, en sus variedades negro (u oscuro), con leche, y blanco. De ellos el más interesante es el chocolate negro, debido a su alto contenido de los flavanoles epicatequina, catequina y procianidinas. Se ha demostrad...
Identidades Islámicas Contemporáneas en América Latina
Caro, Isaac
2007-01-01
En este artículo, distinguimos cuatro grandes modelos del "Islam latinoamericano". Primero, la conformación de comunidades musulmanas a partir de un "islam indo-asiático". Segundo, el predominio, especialmente en los países sudamericanos, de un "islam árabe". Tercero, un proceso creciente de conversión al islam a través de la formación de "nuevos musulmanes". Cuarto, un fenómeno de carácter minoritario, que tiene que ver con la presencia de una tendencia islamista. Postulamos que la diversida...
Cruz Páez, Pamela Johana
2009-01-01
En 1993, cuando diario Hoy fue el pionero sudamericano en la entrega de noticias por Internet, la prensa escrita y periódica del Ecuador se introdujo en la exploración de las posibilidades de la red de redes digitales. En la actualidad, más del 50 por ciento de los miembros de la Asociación Ecuatoriana de Editores de Periódicos ha construido sus versiones on line que, a diario, difunden información sobre la migración internacional de ecuatorianos: deportaciones, remesas, demandas nacionales e...
Directory of Open Access Journals (Sweden)
Zoila Edith Hernández Zamora*
2009-10-01
Full Text Available Resumen:El objetivo de esta investigación fue determinar el nivel de Personalidad Resistente (PR, su relación con el nivel deestrategias de afrontamiento así como con otras variables psicológicas y sociodemográficas de una muestra de 102 adultosmayores que asisten a una estancia diurna especial para este grupo etario. Los resultados muestran que la mayoría de losparticipantes tienen un nivel alto de PR y ninguna resultó con un nivel bajo en este constructo. Las variables asociadassignificativamente con una PR alta son: sexo, independencia, escolaridad, autopercepción de salud y repercusión en elestado de ánimo de sus enfermedades. En cuanto al nivel de estrategias de afrontamiento la mayoría se ubicó en el nivelmedio, no existiendo correlaciones en este aspecto con otras variables de estudio. Se recomienda hacer otras investigacionescon poblaciones de este mismo grupo etario aunque en diferentes hábitats, así como con otros grupos etarios para compararresultados.Abstract:The purpose of this research was to determine the level of Resistant Personality (RP, its relationship with the level ofmanagement strategies, as well as with other psychological and sociodemographic variables of a sample of 102 agedpersons who attend a diurnal home special for this kind of people. The results show that most of the participants have a highlevel of RP, and no one resulted with a low level in this constructo. The variables significantly associated with a high RP are:sex, independence, education, self perception of health, and repercussion on their mood of their illnesses. According to thelevel of management strategies, most of them were placed at middle level, without exixting correlations in this aspect withother variables of study. Werecommend to carry out further research with populations of this same kind of group, althoughin different habitas, as well as with other groups to compare the results.
Energy Technology Data Exchange (ETDEWEB)
Vokkarane, Vinod [University of Massachusetts
2013-09-01
We intend to implement a Coordinated Multi-layer Multi-domain Optical Network (COMMON) Framework for Large-scale Science Applications. In the COMMON project, specific problems to be addressed include 1) anycast/multicast/manycast request provisioning, 2) deployable OSCARS enhancements, 3) multi-layer, multi-domain quality of service (QoS), and 4) multi-layer, multidomain path survivability. In what follows, we outline the progress in the above categories (Year 1, 2, and 3 deliverables).
Middleware for multi-client and multi-server mobile applications
Rocha, B.P.S.; Rezende, C.G.; Loureiro, A.A.F.
2007-01-01
With popularization of mobile computing, many developers have faced problems due to great heterogeneity of devices. To address this issue, we present in this work a middleware for multi-client and multi-server mobile applications. We assume that the middleware at the server side has no resource
Multi-dimensional Fuzzy Euler Approximation
Directory of Open Access Journals (Sweden)
Yangyang Hao
2017-05-01
Full Text Available Multi-dimensional Fuzzy differential equations driven by multi-dimen-sional Liu process, have been intensively applied in many fields. However, we can not obtain the analytic solution of every multi-dimensional fuzzy differential equation. Then, it is necessary for us to discuss the numerical results in most situations. This paper focuses on the numerical method of multi-dimensional fuzzy differential equations. The multi-dimensional fuzzy Taylor expansion is given, based on this expansion, a numerical method which is designed for giving the solution of multi-dimensional fuzzy differential equation via multi-dimensional Euler method will be presented, and its local convergence also will be discussed.
Instance annotation for multi-instance multi-label learning
F. Briggs; X.Z. Fern; R. Raich; Q. Lou
2013-01-01
Multi-instance multi-label learning (MIML) is a framework for supervised classification where the objects to be classified are bags of instances associated with multiple labels. For example, an image can be represented as a bag of segments and associated with a list of objects it contains. Prior work on MIML has focused on predicting label sets for previously unseen...
International Nuclear Information System (INIS)
Cowle, E.S.; Hall, L.D.; Koss, P.; Saheb, E.; Setrakian, V.
1995-01-01
This paper addresses the viability of multi-office project engineering as has been made possible in a large part by the computer age. Brief discussions are provided on two past projects describing the authors' initial efforts at multi-office engineering, and an in-depth discussion is provided on a current Bechtel project that demonstrates their multi-office engineering capabilities. Efficiencies and cost savings associated with executing an engineering project from multiple office locations was identified as a viable and cost-effective execution approach. The paper also discusses how the need for multi-office engineering came about, what is required to succeed, and where they are going from here. Furthermore, it summarizes the benefits to their clients and to Bechtel
Granovsky, Alexander A
2011-06-07
The distinctive desirable features, both mathematically and physically meaningful, for all partially contracted multi-state multi-reference perturbation theories (MS-MR-PT) are explicitly formulated. The original approach to MS-MR-PT theory, called extended multi-configuration quasi-degenerate perturbation theory (XMCQDPT), having most, if not all, of the desirable properties is introduced. The new method is applied at the second order of perturbation theory (XMCQDPT2) to the 1(1)A(')-2(1)A(') conical intersection in allene molecule, the avoided crossing in LiF molecule, and the 1(1)A(1) to 2(1)A(1) electronic transition in cis-1,3-butadiene. The new theory has several advantages compared to those of well-established approaches, such as second order multi-configuration quasi-degenerate perturbation theory and multi-state-second order complete active space perturbation theory. The analysis of the prevalent approaches to the MS-MR-PT theory performed within the framework of the XMCQDPT theory unveils the origin of their common inherent problems. We describe the efficient implementation strategy that makes XMCQDPT2 an especially useful general-purpose tool in the high-level modeling of small to large molecular systems. © 2011 American Institute of Physics
Directory of Open Access Journals (Sweden)
Patrícia A. G. Velasquez
2009-12-01
Full Text Available OBJETIVOS: Investigar a prevalência de Streptococcus pneumoniae (pneumococos na nasofaringe de crianças sadias atendidas em creches municipais da cidade de Umuarama (PR. Avaliar a susceptibilidade aos antimicrobianos dos pneumococos isolados. MÉTODOS: Secreção da nasofaringe de 212 crianças foi coletada no período de abril a outubro de 2008. Após semeadura dos espécimes em ágar sangue e incubação a 37 °C por 24-48 horas, as colônias suspeitas de pertencerem a S. pneumoniae foram identificadas pela α-hemólise, sensibilidade à optoquina e bile solubilidade. A susceptibilidade à penicilina foi investigada pelos testes de disco-difusão e de diluição. A susceptibilidade aos demais antimicrobianos indicados no tratamento das infecções pneumocócicas foi realizada por disco-difusão RESULTADOS: A prevalência de pneumococos na nasofaringe foi de 43,4% (92/212, sendo maior em crianças com idade entre 2 e 5 anos (p = 0,0005. Não houve diferença significativa entre os sexos. Resistência intermediária e resistência plena à penicilina foram encontradas respectivamente em 34,8 (32/92 e 22,8% (21/92 dos isolados. Sessenta e sete amostras (72,8% foram resistentes ao sulfametoxazol-trimetoprim, oito (8,7% à eritromicina e seis (6,5% à tetraciclina. Uma amostra apresentou resistência à clindamicina (1,1%, e outra ao cloranfenicol (1,1%. Todas as amostras foram sensíveis a levofloxacina, ofloxacina, rifampicina, telitromicina, linezolide e vancomicina. Nove amostras foram consideradas multirresistentes, por apresentarem resistência a três ou mais classes de antimicrobianos. CONCLUSÕES: O presente estudo registrou uma alta prevalência de crianças portadoras sadias de amostras de S. pneumoniae resistentes à penicilina que podem constituir importantes reservatórios desse patógeno na comunidade.OBJECTIVES: To investigate the prevalence of Streptococcus pneumoniae (pneumococci in the nasopharynx of healthy children enrolled
Multi-Threaded DNA Tag/Anti-Tag Library Generator for Multi-Core Platforms
2009-05-01
base pair) Watson ‐ Crick strand pairs that bind perfectly within pairs, but poorly across pairs. A variety of DNA strand hybridization metrics...AFRL-RI-RS-TR-2009-131 Final Technical Report May 2009 MULTI-THREADED DNA TAG/ANTI-TAG LIBRARY GENERATOR FOR MULTI-CORE PLATFORMS...TYPE Final 3. DATES COVERED (From - To) Jun 08 – Feb 09 4. TITLE AND SUBTITLE MULTI-THREADED DNA TAG/ANTI-TAG LIBRARY GENERATOR FOR MULTI-CORE
A quantum-classical simulation of a multi-surface multi-mode ...
Indian Academy of Sciences (India)
Multi surface multi mode quantum dynamics; parallelized quantum classical approach; TDDVR method. 1. ... cal simulation on molecular system is a great cha- llenge for ..... on a multiple core cluster with shared memory using. OpenMP based ...
Directory of Open Access Journals (Sweden)
L. Vargas
2004-12-01
Full Text Available O glyphosate é um herbicida de amplo espectro utilizado há mais de 15 anos em pomares de maçã na região de Vacaria-RS, para manejo da vegetação nas linhas da cultura. São realizadas, em geral, três a quatro aplicações por ciclo e a dose normalmente utilizada é de 720 a 1.080 g e.a. ha-1 de glyphosate (2 a 3 L ha-1 do produto comercial. O azevém (Lolium multiflorum é uma planta daninha comum em pomares e, tradicionalmente, sensível ao glyphosate. Entretanto, nos últimos anos a ocorrência de plantas de azevém que, após receberem o tratamento com glyphosate, não manifestam sintomas significativos de toxicidade sugere que elas adquiriram resistência ao produto. Assim, com o objetivo de avaliar a resposta de uma população de plantas de azevém ao glyphosate, foram realizados três experimentos: um em campo e dois em casa de vegetação. No experimento em campo os tratamentos avaliados constaram de doses crescentes de glyphosate (0, 360, 720, 1.440, 2.880, 5.760 e 11.520 g e.a. ha-1, e os herbicidas paraquat, glufosinate, haloxyfop e diclofop foram empregados como produtos-padrão, aplicados em dois estádios vegetativos do azevém. No experimento em casa de vegetação, os tratamentos constaram de doses crescentes de glyphosate (0, 360, 720, 1.440, 2.880 e 5.760 g e.a. ha-1 mais os herbicidas testemunhas, aplicados sobre plantas do biótipo considerado resistente e de um sensível. No segundo experimento realizado em casa de vegetação foram avaliados tratamentos contendo glyphosate (720, 1.440, 2.880, 720 + 720 e 720 + 1.440 g e.a. ha-1, em aplicações únicas e seqüenciais, mais os herbicidas paraquat, glufosinate, haloxyfop, clethodim, sethoxydim, diclofop, fenoxaprop, fluazifop, paraquat + diuron, atrazine + simazine, trifluralin e metolachlor. A toxicidade dos tratamentos herbicidas foi avaliada aos 15, 30 e 45 DAT (dias após tratamento. Os resultados obtidos nos experimentos em campo e em casa de vegetação, de forma
Directory of Open Access Journals (Sweden)
M.S. Osman
2018-03-01
Full Text Available In this paper, an interactive approach for solving multi-level multi-objective fractional programming (ML-MOFP problems with fuzzy parameters is presented. The proposed interactive approach makes an extended work of Shi and Xia (1997. In the first phase, the numerical crisp model of the ML-MOFP problem has been developed at a confidence level without changing the fuzzy gist of the problem. Then, the linear model for the ML-MOFP problem is formulated. In the second phase, the interactive approach simplifies the linear multi-level multi-objective model by converting it into separate multi-objective programming problems. Also, each separate multi-objective programming problem of the linear model is solved by the ∊-constraint method and the concept of satisfactoriness. Finally, illustrative examples and comparisons with the previous approaches are utilized to evince the feasibility of the proposed approach.
Image-Based Multi-Target Tracking through Multi-Bernoulli Filtering with Interactive Likelihoods.
Hoak, Anthony; Medeiros, Henry; Povinelli, Richard J
2017-03-03
We develop an interactive likelihood (ILH) for sequential Monte Carlo (SMC) methods for image-based multiple target tracking applications. The purpose of the ILH is to improve tracking accuracy by reducing the need for data association. In addition, we integrate a recently developed deep neural network for pedestrian detection along with the ILH with a multi-Bernoulli filter. We evaluate the performance of the multi-Bernoulli filter with the ILH and the pedestrian detector in a number of publicly available datasets (2003 PETS INMOVE, Australian Rules Football League (AFL) and TUD-Stadtmitte) using standard, well-known multi-target tracking metrics (optimal sub-pattern assignment (OSPA) and classification of events, activities and relationships for multi-object trackers (CLEAR MOT)). In all datasets, the ILH term increases the tracking accuracy of the multi-Bernoulli filter.
Improving Multi-Instance Multi-Label Learning by Extreme Learning Machine
Directory of Open Access Journals (Sweden)
Ying Yin
2016-05-01
Full Text Available Multi-instance multi-label learning is a learning framework, where every object is represented by a bag of instances and associated with multiple labels simultaneously. The existing degeneration strategy-based methods often suffer from some common drawbacks: (1 the user-specific parameter for the number of clusters may incur the effective problem; (2 SVM may bring a high computational cost when utilized as the classifier builder. In this paper, we propose an algorithm, namely multi-instance multi-label (MIML-extreme learning machine (ELM, to address the problems. To our best knowledge, we are the first to utilize ELM in the MIML problem and to conduct the comparison of ELM and SVM on MIML. Extensive experiments have been conducted on real datasets and synthetic datasets. The results show that MIMLELM tends to achieve better generalization performance at a higher learning speed.
Multi-Source Multi-Target Dictionary Learning for Prediction of Cognitive Decline.
Zhang, Jie; Li, Qingyang; Caselli, Richard J; Thompson, Paul M; Ye, Jieping; Wang, Yalin
2017-06-01
Alzheimer's Disease (AD) is the most common type of dementia. Identifying correct biomarkers may determine pre-symptomatic AD subjects and enable early intervention. Recently, Multi-task sparse feature learning has been successfully applied to many computer vision and biomedical informatics researches. It aims to improve the generalization performance by exploiting the shared features among different tasks. However, most of the existing algorithms are formulated as a supervised learning scheme. Its drawback is with either insufficient feature numbers or missing label information. To address these challenges, we formulate an unsupervised framework for multi-task sparse feature learning based on a novel dictionary learning algorithm. To solve the unsupervised learning problem, we propose a two-stage Multi-Source Multi-Target Dictionary Learning (MMDL) algorithm. In stage 1, we propose a multi-source dictionary learning method to utilize the common and individual sparse features in different time slots. In stage 2, supported by a rigorous theoretical analysis, we develop a multi-task learning method to solve the missing label problem. Empirical studies on an N = 3970 longitudinal brain image data set, which involves 2 sources and 5 targets, demonstrate the improved prediction accuracy and speed efficiency of MMDL in comparison with other state-of-the-art algorithms.
International Nuclear Information System (INIS)
Zhang Yufeng
2005-01-01
A set of multi-component matrix Lie algebra is constructed, which is devote to obtaining a new loop algebra A-bar M-1 . It follows that an isospectral problem is established. By making use of Tu scheme, a Liouville integrable multi-component hierarchy of soliton equations is generated, which possesses the bi-Hamiltonian structures. As its reduction cases, the multi-component AKNS hierarchy and the formalism of the multi-component BPT hierarchy are given, respectively
International Nuclear Information System (INIS)
Egorov, A I; Kashargin, P E; Sushkov, Sergey V
2016-01-01
In 1921 Bach and Weyl derived the method of superposition to construct new axially symmetric vacuum solutions of general relativity. In this paper we extend the Bach–Weyl approach to non-vacuum configurations with massless scalar fields. Considering a phantom scalar field with the negative kinetic energy, we construct a multi-wormhole solution describing an axially symmetric superposition of N wormholes. The solution found is static, everywhere regular and has no event horizons. These features drastically tell the multi-wormhole configuration from other axially symmetric vacuum solutions which inevitably contain gravitationally inert singular structures, such as ‘struts’ and ‘membranes’, that keep the two bodies apart making a stable configuration. However, the multi-wormholes are static without any singular struts. Instead, the stationarity of the multi-wormhole configuration is provided by the phantom scalar field with the negative kinetic energy. Anther unusual property is that the multi-wormhole spacetime has a complicated topological structure. Namely, in the spacetime there exist 2 N asymptotically flat regions connected by throats. (paper)
Multi-color and artistic dithering
Ostromoukhov, Victor; Hersch, Roger D.
1999-01-01
A multi-color dithering algorithm is proposed, which converts a barycentric combination of color intensities into a multi-color non-overlapping surface coverage. Multi-color dithering is a generalization of standard bi-level dithering. Combined with tetrahedral color separation, multi-color dithering makes it possible to print images made of a set of non-standard inks. In contrast to most previous color halftoning methods, multi-color dithering ensures by construction that the different selec...
Egalitarianism in Multi-Choice Games
Brânzei, R.; Llorca, N.; Sánchez-Soriano, J.; Tijs, S.H.
2007-01-01
In this paper we introduce the equal division core for arbitrary multi-choice games and the constrained egalitarian solution for con- vex multi-choice games, using a multi-choice version of the Dutta-Ray algorithm for traditional convex games. These egalitarian solutions for multi-choice games have
Multi parton interactions and multi parton distributions in QCD
International Nuclear Information System (INIS)
Diehl, M.
2012-01-01
After a brief recapitulation of the general interest of parton densities, we discuss multiple hard interactions and multi parton distributions. We report on recent theoretical progress in their QCD description, on outstanding conceptual problems and on possibilities to use multi parton distributions as a laboratory to test and improve our understanding of hadron structure. (author)
Image-Based Multi-Target Tracking through Multi-Bernoulli Filtering with Interactive Likelihoods
Directory of Open Access Journals (Sweden)
Anthony Hoak
2017-03-01
Full Text Available We develop an interactive likelihood (ILH for sequential Monte Carlo (SMC methods for image-based multiple target tracking applications. The purpose of the ILH is to improve tracking accuracy by reducing the need for data association. In addition, we integrate a recently developed deep neural network for pedestrian detection along with the ILH with a multi-Bernoulli filter. We evaluate the performance of the multi-Bernoulli filter with the ILH and the pedestrian detector in a number of publicly available datasets (2003 PETS INMOVE, Australian Rules Football League (AFL and TUD-Stadtmitte using standard, well-known multi-target tracking metrics (optimal sub-pattern assignment (OSPA and classification of events, activities and relationships for multi-object trackers (CLEAR MOT. In all datasets, the ILH term increases the tracking accuracy of the multi-Bernoulli filter.
Multi-criteria appraisal of multi-modal urban public transport systems
Keyvan Ekbatani, M.; Cats, O.
2015-01-01
This study proposes a multi-criteria decision making (MCDM) modelling framework for the appraisal of multi-modal urban public transportation services. MCDM is commonly used to obtain choice alternatives that satisfy a range of performance indicators. The framework embraces both compensatory and
Energy Technology Data Exchange (ETDEWEB)
Dellacherie, St. [CEA Saclay, Dir. de l' Energie Nucleaire DEN/SFNME/LMPE, Lab. de Modelisation Physique et de l' Enrichissement, 91 - Gif sur Yvette (France); Rency, N. [Paris-11 Univ., CNRS UMR 8628, 91 - Orsay (France)
2001-07-01
After having recalled the formal convergence of the semi-classical multi-species Boltzmann equations toward the multi-species Euler system (i.e. mixture of gases having the same velocity), we generalize to this system the closure relations proposed by B. Despres and by F. Lagoutiere for the multi-components Euler system (i.e. mixture of non miscible fluids having the same velocity). Then, we extend the energy relaxation schemes proposed by F. Coquel and by B. Perthame for the numerical resolution of the mono-species Euler system to the multi-species isothermal Euler system and to the multi-components isobar-isothermal Euler system. This allows to obtain a class of entropic schemes under a CFL criteria. In the multi-components case, this class of entropic schemes is perhaps a way for the treatment of interface problems and, then, for the treatment of the numerical mixture area by using a Lagrange + projection scheme. Nevertheless, we have to find a good projection stage in the multi-components case. At last, in the last chapter, we discuss, through the study of a dynamical system, about a system proposed by R. Abgrall and by R. Saurel for the numerical resolution of the multi-components Euler system.
Directory of Open Access Journals (Sweden)
F.P. Lamego
2011-06-01
Full Text Available The continuous use of ALS-inhibiting herbicides has led to the evolution of herbicide-resistant weeds worldwide. Greater beggarticks is one of the most troublesome weeds found in the soybean production system in Brazil. Recently, a greater beggarticks biotype that is resistant (R to ALS inhibitors due to Trp574Leu mutation in the ALS gene was identified. Also, the adaptive traits between susceptible (S and R to ALS inhibitors biotypes of greater beggarticks were compared. Specifically, we aimed to: (1 evaluate and compare the relative growth rates (RGR between the biotypes; (2 analyze the seed germination characteristics of R and S biotypes under different temperature conditions; and (3 evaluate their competitive ability in a replacement series study. The experiments were conducted at the University of Arkansas, USA, in 2007 and at Universidade Federal do Rio Grande do Sul (Federal University of Rio Grande do Sul, Brazil, in 2008. Plant proportions for replacement series studies were respectively 100:0, 75:25, 50:50, 25:75 and 0:100, with a total population of 150 plants m-2. There was no difference in RGR between R and S biotypes. The R-biotype germination rate was lower than that of the S biotype. However, at low temperature conditions (15 ºC, the reverse was observed. In general, there is no difference in the competitive ability between R and S greater beggarticks biotypes.O uso contínuo de herbicidas inibidores da ALS tem levado à evolução de plantas daninhas resistentes mundialmente. Picão-preto é uma das mais importantes plantas daninhas no sistema de produção de soja no Brasil. Recentemente, foi identificado um biótipo de picao-preto resistente (R aos inibidores da ALS devido à mutação Trp574Leu no gene ALS. Também, foram comparadas características adaptativas entre biótipos de picao-preto suscetível (S e R aos inibidores da ALS. Especificamente, os objetivos deste trabalho foram: (1 avaliar e comparar o crescimento
Structural damage detection-oriented multi-type sensor placement with multi-objective optimization
Lin, Jian-Fu; Xu, You-Lin; Law, Siu-Seong
2018-05-01
A structural damage detection-oriented multi-type sensor placement method with multi-objective optimization is developed in this study. The multi-type response covariance sensitivity-based damage detection method is first introduced. Two objective functions for optimal sensor placement are then introduced in terms of the response covariance sensitivity and the response independence. The multi-objective optimization problem is formed by using the two objective functions, and the non-dominated sorting genetic algorithm (NSGA)-II is adopted to find the solution for the optimal multi-type sensor placement to achieve the best structural damage detection. The proposed method is finally applied to a nine-bay three-dimensional frame structure. Numerical results show that the optimal multi-type sensor placement determined by the proposed method can avoid redundant sensors and provide satisfactory results for structural damage detection. The restriction on the number of each type of sensors in the optimization can reduce the searching space in the optimization to make the proposed method more effective. Moreover, how to select a most optimal sensor placement from the Pareto solutions via the utility function and the knee point method is demonstrated in the case study.
Costa, Fabiano José Queiroz
2012-01-01
Desde os primórdios da terapêutica antimicrobiana têm-se relatos de microrganismos resistentes às drogas antimicrobianas clássicas. Com o seu uso indiscriminado, cada vez mais vêm surgindo microrganismos resistentes aos antimicrobianos disponíveis. Por mais dinâmicas que sejam as indústrias farmacêuticas na busca por novas drogas, elas não conseguem acompanhar o espantoso fenômeno da multirresistência apresentada por muitos micror...
Santos Filho Lauro; Santos Isabele Beserra; Assis Alexandro Mangueira Lima de; Xavier Danilo Elias
2002-01-01
Bactérias produtoras de metalo-beta-lactamases (MBLs) são em grande parte resistentes aos betalactâmicos de largo espectro, incluindo oximino-aminotiazol cefalosporinas e também aos carbapenens. O objetivo deste trabalho foi detectar cepas de Pseudomonas aeruginosa resistentes ao imipenem e à ceftazidima, assim como identificar aquelas produtoras de MBLs. Foram estudadas 198 linhagens não-repetitivas isoladas de diversas amostras clínicas, hospitalares e comunitárias, identificadas bioquimica...
Santos Filho,Lauro; Santos,Isabele Beserra; Assis,Alexandro Mangueira Lima de; Xavier,Danilo Elias
2002-01-01
Bactérias produtoras de metalo-beta-lactamases (MBLs) são em grande parte resistentes aos betalactâmicos de largo espectro, incluindo oximino-aminotiazol cefalosporinas e também aos carbapenens. O objetivo deste trabalho foi detectar cepas de Pseudomonas aeruginosa resistentes ao imipenem e à ceftazidima, assim como identificar aquelas produtoras de MBLs. Foram estudadas 198 linhagens não-repetitivas isoladas de diversas amostras clínicas, hospitalares e comunitárias, identificadas bioquimica...
Directory of Open Access Journals (Sweden)
Raimundo L. Bustos
2012-12-01
Full Text Available The South American sea lion, Otaria flavescens (Shaw, 1800 population is steadily expanding along the Patagonian coast of Argentina in the last decades. However, little is known about the feeding ecology of the species in the area. The aim of this study was to analyze the food habits of O. flavescens from 91 scats collected at Río Negro province, during the winter and spring of 2005. Fish occurred in 96% of scats containing prey remains, followed by cephalopods (26%. Raneya brasiliensis (Kaup, 1856 was the most frequent and abundant species occurring in 58.6% of samples and constituting almost 50% of fish predated. Second in importance were Porichthys porosissimus (Cuvier, 1829 and Cynoscion guatucupa (Cuvier, 1830 in terms of occurrence (%FO 20.7 and numbers (29.6% respectively. The squid Loligo gahi (d'Orbigny, 1835 was the most frequent cephalopod prey (42.1%, whereas Octopus tehuelchus (d'Orbigny, 1834 was the most abundant (77%. The higher amount and diversity of prey found in the spring in comparison with the winter season might be related to a higher feeding activity of seals or to a seasonal increase in food availability in the area.La población del lobo marino de un pelo sudamericano Otaria flavescens (Shaw, 1800 ha experimentado un crecimiento continuo en las ultimas décadas en las costas de la Patagonia Argentina. Sin embargo, poco se conoce sobre la ecología trófica de la especie en el área. El objetivo de este estudio fue analizar los hábitos alimentarios de O. flavescens a partir de 91 fecas colectadas en la provincia de Río Negro, durante el invierno y la primavera del 2005. Los peces estuvieron presentes en el 96% de las fecas que contenían remanentes presas, seguidos por los cefalópodos (26%. Raneya brasiliensis (Kaup, 1856 fue la especie mas frecuente y abundante ocurriendo en el 58.6% de las muestras y constituyendo casi el 50% de los peces predados. Le siguieron en importancia Porichthys porosissimus (Cuvier, 1829 y
Perfil dos microrganismos associados à colonização e infecção em Terapia Intensiva
Directory of Open Access Journals (Sweden)
Adriana Cristina Oliveira
2017-06-01
Full Text Available Justificativa e Objetivos: Nas instituições hospitalares, as Unidades de Terapia Intensiva são consideradas o epicentro de resistência bacteriana devido à maior ocorrência de surtos por bactérias multirresistentes. A monitorização do perfil microbiológico dos microrganismos associados a infecções são fundamentais para apoiar o uso racional de antimicrobianos e as medidas de prevenção e controle de infecções. Assim, objetivou-se verificar o perfil de sensibilidade de microrganismos aos antimicrobianos associados à ocorrência de colonização e infecções em uma Unidade de Terapia Intensiva. Métodos: Tratou-se de uma coorte com seguimento de 2.137 pacientes (2005 – 2008 de um hospital universitário de Belo Horizonte. Resultados: Entre os 2.137 pacientes acompanhados foram realizadas 426 (19,9% culturas microbiológicas, 61,7% (263 se referiam a colonização por microrganismos resistentes destacando-se 39% Acinetobacter baumanni resistentes aos carbapenêmicos, 21% Pseudomonas aeruginosa resistentes aos carbapenêmicos e 14% Staphylococcus aureus resistentes à oxacilina seguidos de Klebsiella pneumoniae e Escherichia coli; 282 pacientes foram diagnosticados com infecções hospitalares (13,2% sendo 86 associadas a microrganismos resistentes. Conclusão: Concluiu-se que o perfil dos microrganismos associados a colonização ou infecção de pacientes na unidade de terapia intensiva entre 2005 e 2008, foi similar ao observado em outros estudos no Brasil e América Latina com predominância dos bastonetes Gram negativos. Evidenciou-se a necessidade de monitoramento das condições ambientais de limpeza e sazonais como variação de temperatura e umidade que podem favorecer a replicação de microrganismos, como parte das medidas de controle da disseminação.
Directory of Open Access Journals (Sweden)
Rodríguez Luis Ernesto
2009-12-01
Full Text Available
Se evaluaron nueve clones de papa criolla durante dos semestres consecutivos en cuatro localidades del departamento de Antioquia (Colombia, a través de las siguientes variables agronómicas: potencial de rendimiento del tubérculo, rendimiento en el proceso de enlatado, gravedad específica, respuesta a Phytophthora infestans y estabilidad fenotípica. La estabilidad fenotípica fue medida por el procedimiento de rendimiento-estabilidad. La contribución de cada clon en la interacción genotipo-ambiente fue calculada mediante la varianza de Shukla. El estudio permitió seleccionar tres clones superiores de papa criolla, que fueron registrados como nuevos cultivares en el año 2005. Estos fueron: 'Criolla Latina' (98-68.5, con rendimiento entre 18 y 20 t ha -1, resistencia moderada a P. infestans, y buena aptitud para enlatado o encurtido; 'Criolla Paisa' (98-70-12, rendimiento de 22 a 25 t ha -1, resistencia moderada a P. infestans, y buena aptitud para consumo en fresco; y 'Criolla Colombia' (Clon 1, rendimiento entre 13 y 15 t ha -1, sensible a P. infestans, y adecuada para consumo en fresco y elaboración de papa precocida congelada.
Carrier-interleaved orthogonal multi-electrode multi-carrier resistivity-measurement tool
International Nuclear Information System (INIS)
Cai, Yu; Sha, Shuang
2016-01-01
This paper proposes a new carrier-interleaved orthogonal multi-electrode multi-carrier resistivity-measurement tool used in a cylindrical borehole environment during oil-based mud drilling processes. The new tool is an orthogonal frequency division multiplexing access-based contactless multi-measurand detection tool. The tool can measure formation resistivity in different azimuthal angles and elevational depths. It can measure many more measurands simultaneously in a specified bandwidth than the legacy frequency division multiplexing multi-measurand tool without a channel-select filter while avoiding inter-carrier interference. The paper also shows that formation resistivity is not sensitive to frequency in certain frequency bands. The average resistivity collected from N subcarriers can increase the measurement of the signal-to-noise ratio (SNR) by N times given no amplitude clipping in the current-injection electrode. If the clipping limit is taken into account, with the phase rotation of each single carrier, the amplitude peak-to-average ratio can be reduced by 3 times, and the SNR can achieve a 9/ N times gain over the single-carrier system. The carrier-interleaving technique is also introduced to counter the carrier frequency offset (CFO) effect, where the CFO will cause inter-pad interference. A qualitative analysis and simulations demonstrate that block-interleaving performs better than tone-interleaving when coping with a large CFO. The theoretical analysis also suggests that increasing the subcarrier number can increase the measurement speed or enhance elevational resolution without sacrificing receiver performance. The complex orthogonal multi-pad multi-carrier resistivity logging tool, in which all subcarriers are complex signals, can provide a larger available subcarrier pool than other types of transceivers. (paper)
Directory of Open Access Journals (Sweden)
Silvana Magalhães Salgado
2005-06-01
Full Text Available Considerando a importância das propriedades funcionais do amido resistente para a saúde, o elevado consumo de feijão macassar no Nordeste brasileiro e os efeitos do processo térmico e da estocagem sobre a estrutura do amido, foi realizado este trabalho com o objetivo de avaliar a influência de diferentes tratamentos hidrotérmicos (cocção sob pressão e sem pressão e do armazenamento a 20ºC por 15 e 30 dias, sobre a formação de amido resistente do feijão macassar em dois estádios de maturação (verde e seco. Para analisar os fatores combinados foi realizado um planejamento fatorial do tipo 2³ com três variáveis independentes (fatores e uma variável dependente (resposta. Todas as variáveis exerceram efeitos significativos na produção de AR e a maior formação foi registrada para o feijão seco devido à hidratação prévia a cocção sem pressão, além do tempo de armazenamento congelado de 30 dias. No que diz respeito às analises físicas, após os tratamentos hidrotérmicos, ocorreram transformações nos padrões de cristalinidade e no aspecto morfológico dos feijões.Considering the importance of the functional properties of resistant starch for health, the high consumption of the macassar bean in the northeast of Brazil and the effects of the thermal process and storage on the structure of the starch, this work was implemented to evaluate the influence of different hydrothermal treatments (cooking under pressure and whithout pressure and of storage at 20ºC for 15 and 30 days, on the formation of resistant starch in the macassar bean, in two stages of maturation (green and dryed. To analyse the combined factors, a factorial design type 2³ was realized with three independent variables (factors and one dependent variable (response. All the variables exercised significant effects on the production of the resistant starch and the highest formation was registered for the dried bean due to the previous hydration before
Iordache, Octavian
2011-01-01
This book is devoted to modeling of multi-level complex systems, a challenging domain for engineers, researchers and entrepreneurs, confronted with the transition from learning and adaptability to evolvability and autonomy for technologies, devices and problem solving methods. Chapter 1 introduces the multi-scale and multi-level systems and highlights their presence in different domains of science and technology. Methodologies as, random systems, non-Archimedean analysis, category theory and specific techniques as model categorification and integrative closure, are presented in chapter 2. Chapters 3 and 4 describe polystochastic models, PSM, and their developments. Categorical formulation of integrative closure offers the general PSM framework which serves as a flexible guideline for a large variety of multi-level modeling problems. Focusing on chemical engineering, pharmaceutical and environmental case studies, the chapters 5 to 8 analyze mixing, turbulent dispersion and entropy production for multi-scale sy...
Directory of Open Access Journals (Sweden)
Demóstenes Gómez-Barreto
2002-01-01
neumococo resistentes, determinar los serotipos y el perfil de sensibilidad a varios fármacos antimicrobianos. Material y métodos. Estudio prospectivo de una cohorte de niños de guardería, hecho de septiembre de 1997 a septiembre de 1999 entre 53 niños asistentes a la guardería del Hospital Infantil de México Federico Gómez, atendida por 20 empleados. Todos los participantes fueron seguidos en forma prospectiva, tomándose exudado nasofaríngeo cada cuatro meses. Los S. pneumoniae aislados se tipificaron y sometieron a pruebas de sensibilidad a diversos fármacos. Las razones de momios y la prueba exacta de Fisher o ji cuadrada se efectuaron a través de tablas de contingencia; se utilizaron intervalos de confianza a 95% para las razones de momios. Para el análisis se empleó el programa estadístico EPI INFO, versión 6.04 a. Resultados. S. pneumoniae se recuperó de 45/53 niños en una o más de las tomas. Se aisló un total de 178 cepas. El promedio de portador fue de 47%. Sólo siete adultos adquirieron un neumococo durante el estudio. Los tipos 6, 14, 19 y 23 representaron 77% del total. Se encontró elevada resistencia a la penicilina y eritromicina. Conclusiones. El estado de portador nasofaríngeo de S. pneumoniae, es un proceso dinámico. La colonización ocurre durante los primeros meses de vida y comprende solamente unos cuantos serotipos de neumococo. El estado portador disminuye conforme avanza la edad. Se encontró alta proporción de portadores con cepas resistentes de neumococo. Los niños que recibieron varios cursos de antimicrobianos, fueron los que mostraron mayor riesgo de presentar estado portador.
visPIG--a web tool for producing multi-region, multi-track, multi-scale plots of genetic data.
Directory of Open Access Journals (Sweden)
Matthew Scales
Full Text Available We present VISual Plotting Interface for Genetics (visPIG; http://vispig.icr.ac.uk, a web application to produce multi-track, multi-scale, multi-region plots of genetic data. visPIG has been designed to allow users not well versed with mathematical software packages and/or programming languages such as R, Matlab®, Python, etc., to integrate data from multiple sources for interpretation and to easily create publication-ready figures. While web tools such as the UCSC Genome Browser or the WashU Epigenome Browser allow custom data uploads, such tools are primarily designed for data exploration. This is also true for the desktop-run Integrative Genomics Viewer (IGV. Other locally run data visualisation software such as Circos require significant computer skills of the user. The visPIG web application is a menu-based interface that allows users to upload custom data tracks and set track-specific parameters. Figures can be downloaded as PDF or PNG files. For sensitive data, the underlying R code can also be downloaded and run locally. visPIG is multi-track: it can display many different data types (e.g association, functional annotation, intensity, interaction, heat map data,…. It also allows annotation of genes and other custom features in the plotted region(s. Data tracks can be plotted individually or on a single figure. visPIG is multi-region: it supports plotting multiple regions, be they kilo- or megabases apart or even on different chromosomes. Finally, visPIG is multi-scale: a sub-region of particular interest can be 'zoomed' in. We describe the various features of visPIG and illustrate its utility with examples. visPIG is freely available through http://vispig.icr.ac.uk under a GNU General Public License (GPLv3.
Interconnected Levels of Multi-Stage Marketing
DEFF Research Database (Denmark)
Vedel, Mette; Geersbro, Jens; Ritter, Thomas
2012-01-01
different levels of multi-stage marketing and illustrates these stages with a case study. In addition, a triadic perspective is introduced as an analytical tool for multi-stage marketing research. The results from the case study indicate that multi-stage marketing exists on different levels. Thus, managers...... must not only decide in general on the merits of multi-stage marketing for their firm, but must also decide on which level they will engage in multi-stage marketing. The triadic perspective enables a rich and multi-dimensional understanding of how different business relationships influence each other...... in a multi-stage marketing context. This understanding assists managers in assessing and balancing different aspects of multi- stage marketing. The triadic perspective also offers avenues for further research....
Resistência de plantas daninhas aos herbicidas Weed resistance to herbicides
Directory of Open Access Journals (Sweden)
Pedro J. Christoffoleti
1994-01-01
Full Text Available A resistência de plantas daninhas aos herbicidas ocorre em função de um processo evolutivo. O desenvolvimento de biótipos de plantas daninhas resistentes é imposto pela agricultura moderna, através da pressão de seleção causada pelo uso intensivo dos herbicidas. O conhecimento dos mecanismos e fatores que favorecem o aparecimento de biótipos de plantas daninhas resistentes é fundamental para que técnicas de manejo sejam utilizadas no sentido de evitar ou retardar o aparecimento de plantas resistentes em uma área. São poucos os relatos ou citações de literatura no Brasil. Sendo assim, este trabalho de revisão procura relatar os principais avanços e descobertas na área de plantas daninhas resistentes aos herbicidas.Weed herbicide resistance has evolved from weed evolution. The modern agriculture is responsible for this evolution because of the intensive use of herbicides. The knowledge of mechanisms and factors that influence the weed herbicide resistance play an important role in the weed manegement techniques used to avoid or delay herbicide resistance appearence. There are not many report or scientific papers about herbi cide resistance in Brasil. Therefore, this literature review aims to provide information about the main advances and discoveries in the field of weed herbicide resistance.
Staphylococcus aureus resistente a vancomicina.
Directory of Open Access Journals (Sweden)
Carlos Andrés Rodríguez
2005-12-01
Full Text Available Objetivo. Revisar la evolución y mecanismos moleculares de la resistencia de Staphylococcus aureus a vancomicina. Fuente de los datos. Se consultó la base de datos MEDLINE y se seleccionaron artículos tipo reportes de caso, estudios bioquímicos, de microscopía electrónica y biología molecular pertinentes. Síntesis. Después de casi 40 años de eficacia ininterrumpida de la vancomicina, en 1997 se reportaron los primeros casos de fracaso terapéutico debido a cepas de Staphylococcus aureus con resistencia intermedia, denominadas VISA (concentración inhibitoria mínima, CIM, 8 a 16 ?g/ml, así como a cepas con resistencia heterogénea hVISA (CIM global = 4 ?g/ml, pero con subpoblaciones VISA, en las cuales la resistencia está mediada por engrosamiento de la pared celular y disminución de su entrecruzamiento, lo que afecta la llegada del antibiótico al blanco principal, los monómeros del peptidoglicano en la membrana plasmática. En 2002 se aisló la primera de las 3 cepas reportadas hasta la fecha con resistencia total al antibiótico, denominadas VRSA (CIM>32 ?g/ml, en las que se encontró el transposón Tn1546 proveniente de Enterococcus spp, responsable del reemplazo de la terminación D-Ala-D-Ala por D-Ala-Dlactato en los precursores de la pared celular con pérdida de la afinidad por el glicopéptido. Conclusiones. La resistencia a vancomicina es una realidad en S. aureus, mediada en el caso de VISA por alteraciones en la pared celular que atrapan el antibiótico antes de llegar al sitio de acción, y en el caso de VRSA, por transferencia desde Enterococcus spp. de genes que llevan a la modificación del blanco molecular.
Realization of multi-parameter and multi-state in fault tree computer-aided building software
International Nuclear Information System (INIS)
Guo Xiaoli; Tong Jiejuan; Xue Dazhi
2004-01-01
More than one parameter and more than one failed state of a parameter are often involved in building fault tree, so it is necessary for fault tree computer-aided building software to deal with multi-parameter and multi-state. Fault Tree Expert System (FTES) has the target of aiding the FT-building work of hydraulic systems. This paper expatiates on how to realize multi-parameter and multi-state in FTES with focus on Knowledge Base and Illation Engine. (author)
Kirschner, Denise E; Hunt, C Anthony; Marino, Simeone; Fallahi-Sichani, Mohammad; Linderman, Jennifer J
2014-01-01
The use of multi-scale mathematical and computational models to study complex biological processes is becoming increasingly productive. Multi-scale models span a range of spatial and/or temporal scales and can encompass multi-compartment (e.g., multi-organ) models. Modeling advances are enabling virtual experiments to explore and answer questions that are problematic to address in the wet-lab. Wet-lab experimental technologies now allow scientists to observe, measure, record, and analyze experiments focusing on different system aspects at a variety of biological scales. We need the technical ability to mirror that same flexibility in virtual experiments using multi-scale models. Here we present a new approach, tuneable resolution, which can begin providing that flexibility. Tuneable resolution involves fine- or coarse-graining existing multi-scale models at the user's discretion, allowing adjustment of the level of resolution specific to a question, an experiment, or a scale of interest. Tuneable resolution expands options for revising and validating mechanistic multi-scale models, can extend the longevity of multi-scale models, and may increase computational efficiency. The tuneable resolution approach can be applied to many model types, including differential equation, agent-based, and hybrid models. We demonstrate our tuneable resolution ideas with examples relevant to infectious disease modeling, illustrating key principles at work. © 2014 The Authors. WIREs Systems Biology and Medicine published by Wiley Periodicals, Inc.
Solution Thermodynamics of Lysine Clonixinate in Some Ethanol + Water Mixtures
Delgado, Daniel R.; Martínez, Fleming; Gutiérrez, Rahumir A.
2012-01-01
The solubility of lysine clonixinate (LysClon) in several ethanol + water mixtures was determined at 293.15 to 313.15 K. The thermodynamic functions, Gibbs energy, enthalpy, and entropy of solution and of mixing were obtained from these solubility data by using the van’t Hoff and Gibbs equations. In general this drug exhibit good solubility and the greatest value was obtained in the mixture 0.60 in mass fraction of ethanol. A non-linear enthalpy–entropy relationship was observed from ...
1 ALPHA-Hydroxyvitamin D5 as a Chemotherapeutic and Possibly Chemopreventive Agent
2004-09-01
cancer cells. TTT TG. The primer -for the housekeeping gene G3PDH was purchased from ClonTech. The touchdown 3.2. Induction of differentiation of breast...the housekeeping gene The effects of vitamin D analogues as differentiating G3PDH (C) was identical for all the cDNAs, indicating . agents and...control housekeeping gene. "* G. Lazzaro et al. / European Journal of Cancer 36 (2000) 780-786 785 levels of VDR, do not respond to active vitamin D p53
Multi-objective optimization for generating a weighted multi-model ensemble
Lee, H.
2017-12-01
Many studies have demonstrated that multi-model ensembles generally show better skill than each ensemble member. When generating weighted multi-model ensembles, the first step is measuring the performance of individual model simulations using observations. There is a consensus on the assignment of weighting factors based on a single evaluation metric. When considering only one evaluation metric, the weighting factor for each model is proportional to a performance score or inversely proportional to an error for the model. While this conventional approach can provide appropriate combinations of multiple models, the approach confronts a big challenge when there are multiple metrics under consideration. When considering multiple evaluation metrics, it is obvious that a simple averaging of multiple performance scores or model ranks does not address the trade-off problem between conflicting metrics. So far, there seems to be no best method to generate weighted multi-model ensembles based on multiple performance metrics. The current study applies the multi-objective optimization, a mathematical process that provides a set of optimal trade-off solutions based on a range of evaluation metrics, to combining multiple performance metrics for the global climate models and their dynamically downscaled regional climate simulations over North America and generating a weighted multi-model ensemble. NASA satellite data and the Regional Climate Model Evaluation System (RCMES) software toolkit are used for assessment of the climate simulations. Overall, the performance of each model differs markedly with strong seasonal dependence. Because of the considerable variability across the climate simulations, it is important to evaluate models systematically and make future projections by assigning optimized weighting factors to the models with relatively good performance. Our results indicate that the optimally weighted multi-model ensemble always shows better performance than an arithmetic
Multi-component and multi-array TEM detection in karst tunnels
International Nuclear Information System (INIS)
Sun, Huaifeng; Li, Shucai; Su, Maoxin; Xue, Yiguo; Li, Xiu; Qi, Zhipeng
2012-01-01
Emerging applications of transient electromagnetic methods (TEM) in tunnelling require higher resolution on the distributions and shapes of low resistivity bodies, such as karst water and karst pipes, using multi-component and multi-array receivers. However, there are no apparent resistivity definitions for both vertical and horizontal components with offsets inside the loop. Although the raw field can show the differences of the earth electric structure, it is not straightforward. Apparent resistivity is very convenient and easy for engineers. We have developed a method for multi-component and multi-array TEM which can be applied in tunnelling and defined the expressions of apparent resistivity. This method takes advantage of the difference in resolution among components. A homogeneous half-space model and four typical three-layered models are used to test the effectiveness of the new definition. A field case history is carried out and analysed to demonstrate the viability of this technique. The results suggest that it is feasible to use the technique in tunnelling, especially for identifying the spatial distribution of karst water and karst pipes. (paper)
A New Multi-Sensor Track Fusion Architecture for Multi-Sensor Information Integration
National Research Council Canada - National Science Library
Jean, Buddy H; Younker, John; Hung, Chih-Cheng
2004-01-01
.... This new technology will integrate multi-sensor information and extract integrated multi-sensor information to detect, track and identify multiple targets at any time, in any place under all weather conditions...
Plan estratégico de la Provincia de Caylloma de la Región de Arequipa
Calcina Cateriano, Marjorie Agueda; Chávez Rodríguez, Yhordan Jorge; Herrera Escobedo, Fernando Mauricio; Valdivia Abril, Ornela Gricelda
2016-01-01
El presente trabajo se ha centrado en la elaboración del plan estratégico de la provincia de Caylloma hacia el año 2026. El objetivo es convertirla en una provincia modelo del país fortaleciendo tres aspectos económicos principales: turismo, producción de quinua y camélidos sudamericanos; enfocado en el desarrollo social y económico de sus pobladores. Para ello, la metodología del estudio ha tomado el modelo estratégico del Dr. Fernando D’Alessio. En cuanto a las referencias, éstas incluyeron...
Juan Minetti
2007-01-01
Aprovechando la reconstrucción del índice de posición latitudinal del anticiclón del O.Pacífico Sur sobre la costa de Chile (L) durante el período 1901-2004, se analiza su comportamiento de largo plazo como variable anual o mensual en el período más precipitante del clima mediterráneo sudamericano. Existe una importante evidencia del traslado de L hacia latitudes altas desde mediados del Siglo XX al presente, que podría ser justificado con el actual proceso de calentamiento global, sin embarg...
Campos, Diego; Luna, Carlos Raúl; Bosso, Agustina; Navarro, Néstor; Medel, Ricardo
2014-01-01
Argentina y la mayoría de los países sudamericanos se encuentran en proceso de migración desde el sistema actual de TV analógico hacia el nuevo sistema de TV Digital, el cual permite la transmisión de software que se ejecuta en el aparato receptor bajo comando del usuario/televidente. Esta nueva tecnología propone también nuevos desafíos para el desarrollo y la distribución del software. Dentro del proyecto de I+D en el que indagamos sobre la potencialidad de la TV Digital como plataforma ...
Fiebre amarilla: una enfermedad reemergentes en América del Sur 2000 - 2016.
Lara Torres, Sara Gabriela
2017-01-01
Introducción. La fiebre amarilla selvática es una enfermedad zoonótica viral, reemergente de América del Sur que se ha mantenido durante años, a pesar de que exista una vacuna eficaz hace más de 50 años. Objetivo. Identificar los casos confirmados de fiebre amarilla en el continente Suramericano. Materiales y Métodos. Se realizó un estudio descriptivo, de revisión bibliográfica de los casos confirmados de FA en el Continente Sudamericano desde el 2000 hasta el 2016. Obteniendo la información ...
Lapotre, Vianney; Gogniat, Guy; Baghdadi, Amer; Diguet, Jean-Philippe
2017-12-01
The multiplication of connected devices goes along with a large variety of applications and traffic types needing diverse requirements. Accompanying this connectivity evolution, the last years have seen considerable evolutions of wireless communication standards in the domain of mobile telephone networks, local/wide wireless area networks, and Digital Video Broadcasting (DVB). In this context, intensive research has been conducted to provide flexible turbo decoder targeting high throughput, multi-mode, multi-standard, and power consumption efficiency. However, flexible turbo decoder implementations have not often considered dynamic reconfiguration issues in this context that requires high speed configuration switching. Starting from this assessment, this paper proposes the first solution that allows frame-by-frame run-time configuration management of a multi-processor turbo decoder without compromising the decoding performances.
DEFF Research Database (Denmark)
Vigeant, Michelle; Wang, Lily M.; Rindel, Jens Holger
2008-01-01
a multi-channel multi-source auralization technique, involving individual five-channel anechoic recordings of each instrumental part of two symphonies. In the first study, these auralizations were subjectively compared to orchestra auralizations made using (a) a single omni-directional source, (b......) a surface source, and (c) single-channel multi-source method. Results show that the multi-source auralizations were rated to be more realistic than the surface source ones and to have larger source width than the single omni-directional source auralizations. No significant differences were found between......Room acoustics computer modeling is a tool for generating impulse responses and auralizations from modeled spaces. The auralizations are commonly made from a single-channel anechoic recording of solo instruments. For this investigation, auralizations of an entire orchestra were created using...
Analysis of a yearly multi-round, multi-period, multi-product transmission rights auction
International Nuclear Information System (INIS)
Ziogos, N.P.; Bakirtzis, A.G.
2008-01-01
A yearly multi-round, multi-period, multi-product transmission rights (TR) auction issuing both point-to-point Financial Transmission Rights (FTRs) and Flow-Gate Rights (FGRs) is studied in this paper. In each round the TR market participants (buyers or sellers) submit their bid or offer prices based on past energy market performance. A Locational Marginal Pricing (LMP) based energy market is assumed. The TR market participants' bid or offer prices reflect their expectation of the average annual LMP differences between withdrawal and injections points for FTRs and of the transmission link capacity prices for FGRs. The TR auction is performed in four rounds; in each round 25% of the entire system capability is awarded. TRs that are awarded in one round are modeled as fixed injections in subsequent rounds. Market participants that have acquired TRs in one round can sell them in subsequent rounds. A market participant can submit bids or offers for on-peak, off-peak or 24-h TRs. A three-area, nine-bus test system with six TR market participants is used for the analysis of the TR auction. (author)
Multi-Fidelity Multi-Strategy and Multi-Disciplinary Design Optimization Environment, Phase I
National Aeronautics and Space Administration — Multidisciplinary design and optimization (MDO) tools developed to perform multi-disciplinary analysis based on low fidelity computation methods have been used in...
Multi-head Watson-Crick automata
Chatterjee, Kingshuk; Ray, Kumar Sankar
2015-01-01
Inspired by multi-head finite automata and Watson-Crick automata in this paper, we introduce new structure namely multi-head Watson-Crick automata where we replace the single tape of multi-head finite automaton by a DNA double strand. The content of the second tape is determined using a complementarity relation similar to Watson-Crick complementarity relation. We establish the superiority of our model over multi-head finite automata and also show that both the deterministic and non-determinis...
Expresiones conceptuales del insólito en el espacio literario sudamericano
Directory of Open Access Journals (Sweden)
Luciana Mazzutti
2015-07-01
Full Text Available Esta investigación pretende esclarecer el uso indiscriminado de los términos que, a principio, “catalogaban” la obra literaria hispano-americana; y, de cierto modo, corroboraron con el deslizamiento que se instauró en la definición de los conceptos del Realismo Mágico, Realismo Maravilloso y Fantástico. El estudio teórico-literario visa entender especialmente la incidencia de esas dos últimas modalidades narrativas del Insólito en la América del Sur, sin desconsiderar la cultura de ese continente, pero asociándolo al mapeo literario que, no obstante, no niega zonas de contactos y diálogos. Buscamos, así, articular una discusión que, a partir, del enraizamiento en los campos de la crítica y de la historia literaria, no sólo destaca la especial configuración del Insólito en la literatura sudamericana, pero también establece la modalidad que contribuyó/e para con la visualización y la representación de la diversidad cultural. Nos valemos de una pesquisa con metodología de cuño bibliográfico que aspira analizar, caracterizar, definir y consignar diferencias pertinentes a las modalidades insólitas en cuestión.
Shear strength behaviour of geosynthetics
Martínez Bacas, Ana Belén
2010-01-01
RESUMEN: El estudio de los parámetros resistentes de los geosintéticos utilizados en los sistemas de impermeabilización de vertederos es un tema muy importante. Estos sistemas contienen diferentes interfaces (geosintético/geosintético y/o suelo/geosintético), muchas de las cuales tienen baja resistencia al deslizamiento. Esto potencia la existencia de superficies de rotura a lo largo de los taludes de los vertederos. El conocimiento de los parámetros resistentes al corte de los contactos ...
Introducción a la fabricación y normalización del cemento portland
Sanjuán Barbudo, Miguel Ángel; Chinchón Yepes, Servando
2014-01-01
El cemento portland es un conglomerante hidráulico cuya principal propiedad es la de formar masas pétreas resistentes y duraderas cuando se mezcla con áridos y agua. El endurecimiento de la mezcla ocurre transcurrido un cierto tiempo desde el momento en que se realiza el amasado, lo que permite dar forma a la piedra artificial resultante. Estas tres cualidades (moldeable, resistente, duradero) hacen que los productos derivados del cemento tengan una gran aplicación en la construcción de edifi...
Multi-filter spectrophotometry simulations
Callaghan, Kim A. S.; Gibson, Brad K.; Hickson, Paul
1993-01-01
To complement both the multi-filter observations of quasar environments described in these proceedings, as well as the proposed UBC 2.7 m Liquid Mirror Telescope (LMT) redshift survey, we have initiated a program of simulated multi-filter spectrophotometry. The goal of this work, still very much in progress, is a better quantitative assessment of the multiband technique as a viable mechanism for obtaining useful redshift and morphological class information from large scale multi-filter surveys.
Case Study of Multi-Unit Risk: Multi-Unit Station Black-Out
Energy Technology Data Exchange (ETDEWEB)
Oh, Kyemin; Jang, Seung-cheol [KAERI, Daejeon (Korea, Republic of); Heo, Gyunyoung [Kyung Hee University, Yongin (Korea, Republic of)
2015-05-15
After Fukushima Daiichi Accident, importance and public concern for Multi-Unit Risk (MUR) or Probabilistic Safety Assessment (PSA) have been increased. Most of nuclear power plant sites in the world have more than two units. These sites have been facing the problems of MUR or accident such as Fukushima. In case of South Korea, there are generally more than four units on the same site and even more than ten units are also expected. In other words, sites in South Korea also have been facing same problems. Considering number of units on the same site, potential of these problems may be larger than other countries. The purpose of this paper is to perform case study based on another paper submitted in the conference. MUR is depended on various site features such as design, shared systems/structures, layout, environmental condition, and so on. Considering various dependencies, we assessed Multi-Unit Station Black-out (MSBO) accident based on Hanul Unit 3 and 4 model. In this paper, case study for multi-unit risk or PSA had been performed. Our result was incomplete to assess total multi-unit risk because of two challenging issues. First, economic impact had not been evaluated to estimate multi-unit risk. Second, large uncertainties were included in our result because of various assumptions. These issues must be resolved in the future.
Case Study of Multi-Unit Risk: Multi-Unit Station Black-Out
International Nuclear Information System (INIS)
Oh, Kyemin; Jang, Seung-cheol; Heo, Gyunyoung
2015-01-01
After Fukushima Daiichi Accident, importance and public concern for Multi-Unit Risk (MUR) or Probabilistic Safety Assessment (PSA) have been increased. Most of nuclear power plant sites in the world have more than two units. These sites have been facing the problems of MUR or accident such as Fukushima. In case of South Korea, there are generally more than four units on the same site and even more than ten units are also expected. In other words, sites in South Korea also have been facing same problems. Considering number of units on the same site, potential of these problems may be larger than other countries. The purpose of this paper is to perform case study based on another paper submitted in the conference. MUR is depended on various site features such as design, shared systems/structures, layout, environmental condition, and so on. Considering various dependencies, we assessed Multi-Unit Station Black-out (MSBO) accident based on Hanul Unit 3 and 4 model. In this paper, case study for multi-unit risk or PSA had been performed. Our result was incomplete to assess total multi-unit risk because of two challenging issues. First, economic impact had not been evaluated to estimate multi-unit risk. Second, large uncertainties were included in our result because of various assumptions. These issues must be resolved in the future
Problems With Deployment of Multi-Domained, Multi-Homed Mobile Networks
Ivancic, William D.
2008-01-01
This document describes numerous problems associated with deployment of multi-homed mobile platforms consisting of multiple networks and traversing large geographical areas. The purpose of this document is to provide insight to real-world deployment issues and provide information to groups that are addressing many issues related to multi-homing, policy-base routing, route optimization and mobile security - particularly those groups within the Internet Engineering Task Force.
Autonomous transmission power adaptation for multi-radio multi-channel wireless mesh networks
CSIR Research Space (South Africa)
Olwal, TO
2009-09-01
Full Text Available Multi-Radio Multi-Channel (MRMC) systems are key to power control problems in WMNs. Previous studies have emphasized through- put maximization in such systems as the main design challenge and transmission power control treated as a secondary issue...
Autonomous transmission power adaptation for multi-radio multi-channel wireless mesh networks
CSIR Research Space (South Africa)
Olwal, TO
2008-09-01
Full Text Available Multi-Radio Multi-Channel (MRMC) systems are key to power control problems in WMNs. Previous studies have emphasized throughput maximization in such systems as the main design challenge and transmission power control treated as a secondary issue...
CGLXTouch: A multi-user multi-touch approach for ultra-high-resolution collaborative workspaces
Ponto, Kevin
2011-06-01
This paper presents an approach for empowering collaborative workspaces through ultra-high resolution tiled display environments concurrently interfaced with multiple multi-touch devices. Multi-touch table devices are supported along with portable multi-touch tablet and phone devices, which can be added to and removed from the system on the fly. Events from these devices are tagged with a device identifier and are synchronized with the distributed display environment, enabling multi-user support. As many portable devices are not equipped to render content directly, a remotely scene is streamed in. The presented approach scales for large numbers of devices, providing access to a multitude of hands-on techniques for collaborative data analysis. © 2011 Elsevier B.V. All rights reserved.
Multi-Band Multi-Tone Tunable Millimeter-Wave Frequency Synthesizer For Satellite Beacon Transmitter
Simons, Rainee N.; Wintucky, Edwin G.
2016-01-01
This paper presents the design and test results of a multi-band multi-tone tunable millimeter-wave frequency synthesizer, based on a solid-state frequency comb generator. The intended application of the synthesizer is in a satellite beacon transmitter for radio wave propagation studies at K-band (18 to 26.5 GHz), Q-band (37 to 42 GHz), and E-band (71 to 76 GHz). In addition, the architecture for a compact beacon transmitter, which includes the multi-tone synthesizer, polarizer, horn antenna, and power/control electronics, has been investigated for a notional space-to-ground radio wave propagation experiment payload on a small satellite. The above studies would enable the design of robust high throughput multi-Gbps data rate future space-to-ground satellite communication links.
MULTI-PHOTON PHOSPHOR FEASIBILITY RESEARCH
Energy Technology Data Exchange (ETDEWEB)
R. Graham; W. Chow
2003-05-01
Development of multi-photon phosphor materials for discharge lamps represents a goal that would achieve up to a doubling of discharge (fluorescent) lamp efficacy. This report reviews the existing literature on multi-photon phosphors, identifies obstacles in developing such phosphors, and recommends directions for future research to address these obstacles. To critically examine issues involved in developing a multi-photon phosphor, the project brought together a team of experts from universities, national laboratories, and an industrial lamp manufacturer. Results and findings are organized into three categories: (1) Multi-Photon Systems and Processes, (2) Chemistry and Materials Issues, and (3) Concepts and Models. Multi-Photon Systems and Processes: This category focuses on how to use our current understanding of multi-photon phosphor systems to design new phosphor systems for application in fluorescent lamps. The quickest way to develop multi-photon lamp phosphors lies in finding sensitizer ions for Gd{sup 3+} and identifying activator ions to red shift the blue emission from Pr{sup 3+} due to the {sup 1}S{sub 0} {yields} {sup 1}I{sub 6} transition associated with the first cascading step. Success in either of these developments would lead to more efficient fluorescent lamps. Chemistry and Materials Issues: The most promising multi-photon phosphors are found in fluoride hosts. However, stability of fluorides in environments typically found in fluorescent lamps needs to be greatly improved. Experimental investigation of fluorides in actual lamp environments needs to be undertaken while working on oxide and oxyfluoride alternative systems for backup. Concepts and Models: Successful design of a multi-photon phosphor system based on cascading transitions of Gd{sup 3+} and Pr{sup 3+} depends critically on how the former can be sensitized and the latter can sensitize an activator ion. Methods to predict energy level diagrams and Judd-Ofelt parameters of multi
Multi-time, multi-scale correlation functions in turbulence and in turbulent models
Biferale, L.; Boffetta, G.; Celani, A.; Toschi, F.
1999-01-01
A multifractal-like representation for multi-time, multi-scale velocity correlation in turbulence and dynamical turbulent models is proposed. The importance of subleading contributions to time correlations is highlighted. The fulfillment of the dynamical constraints due to the equations of motion is
Potencial de actividad antioxidante de extractos fenólicos de Theobroma cacao L. (cacao)
Quiñones Gálvez, Janet; Trujillo Sánchez, Reinaldo; Capdesuñer Ruiz, Yanelis; Quirós Molina, Yemeys; Hernández de la Torre, Martha
2013-01-01
Introducción: Theobroma cacao L. (cacao), familia Sterculiaceae, es una planta rica en fenoles, los cuales en las plantas son de especial interés por su potente actividad antioxidante, dada esencialmente por sus propiedades redox, que pueden desempeñar un papel importante en la absorción y neutralización de los radicales libres. Objetivos: seleccionar un clon promisorio en la producción de compuestos fenólicos, determinar los órganos con mayor contenido de fenoles, establecer el cultivo in vi...
THE INTEGRATION OF EDUCATION IN MULTI-RACIAL AND MULTI-CULTURAL SOCIETY
Directory of Open Access Journals (Sweden)
Chamisah Chamisah
2017-07-01
Full Text Available This study aims to know the reasons of education ina multi-racial and multi-cultural society demands integration.. The studywhich focuses onMalaysia country typified by three major ethnic groups, namely Malays, Chinese and Indians,foundthat, firstlythe integration of curriculum in creating a holistic education isvital for the society to create a competitive human capital with value laden such as trustworthiness, dedication, creativity, civic awareness and many more. Secondly, integration curriculum emphasizes on the equity and equality of education for all.Through interacting with individuals from a range of religious and ethnic backgrounds, people will learn to understand, accept and embrace differences. Throughsharing experiences and aspirations,a common national identity and ultimately unity can be achieved. Therefore, integrating curriculum is not only to integrate Islamic concepts in the education system but alsoto integrate all the concepts that make one comprehensive curriculum. Thirdly, it is important to integrate the curriculum with a value-laden perspective to encourage solidarity and harmony. Keywords: Multi-racial; Multi-cultural society; Education; Malaysia
First observation of multi-pulse X-ray train via multi-collision laser Compton scattering
International Nuclear Information System (INIS)
Kuroda, R.; Toyokawa, H.; Yasumoto, M.; Ikeura-Sekiguchi, H.; Koike, M.; Yamada, K.; Yanagida, T.; Nakajyo, T.; Sakai, F.
2009-01-01
A compact hard X-ray source via laser Compton scattering (LCS) has been developed for biological and medical applications at the National Institute of Advanced Industrial Science and Technology (AIST) in Japan. The multi-collision LCS has been investigated in order to enhance the X-ray yields. The first observation of multi-pulse X-ray train with 6 pulses via the multi-collision LCS has been successfully demonstrated between the multi-bunch electron train with 6 bunches and the multi-pulse Ti:Sa laser train with 6 pulses. The 32 MeV electron train was generated from a Cs 2 Te photocathode rf gun with a multi-pulse UV laser and the S-band linac. The Ti:Sa laser train was obtained with the chirp pulse amplification (CPA) including the modified regenerative amplifier. The X-ray train with 6 pulses with 12.6 ns spacing was observed with the micro-channel plate (MCP). The maximum energy of the X-ray is analytically estimated to be about 24 keV and the total number of generated photons was calculated to be about 1.8x10 6 photons/train.
Partial clonning cytogenetic and linkage mapping of the porcine resistin (RSTN) gene
Czech Academy of Sciences Publication Activity Database
Čepica, Stanislav; Rohrer, G. A.; Masopust, m.; Kubíčková, S.; Musilová, P.; Rubeš, J.
2002-01-01
Roč. 33, - (2002), s. 381-383 ISSN 0268-9146 R&D Projects: GA ČR GA523/99/0842; GA AV ČR KSK5052113 Keywords : cytogenetic and linkage mapping Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.443, year: 2002
Range based power control for multi-radio multi-channel wireless mesh networks
CSIR Research Space (South Africa)
Olwal, TO
2009-08-01
Full Text Available Multi-Radio Multi-Channel (MRMC) systems are key to power control problems in Wireless Mesh Networks (WMNs). In this paper, researchers present a range based dynamic power control for MRMC WMNs. First, WMN is represented as a set of disjoint Unified...
Jie, Biao; Zhang, Daoqiang; Cheng, Bo; Shen, Dinggang
2013-01-01
Accurate diagnosis of Alzheimer's disease (AD), as well as its prodromal stage (i.e., mild cognitive impairment, MCI), is very important for possible delay and early treatment of the disease. Recently, multi-modality methods have been used for fusing information from multiple different and complementary imaging and non-imaging modalities. Although there are a number of existing multi-modality methods, few of them have addressed the problem of joint identification of disease-related brain regions from multi-modality data for classification. In this paper, we proposed a manifold regularized multi-task learning framework to jointly select features from multi-modality data. Specifically, we formulate the multi-modality classification as a multi-task learning framework, where each task focuses on the classification based on each modality. In order to capture the intrinsic relatedness among multiple tasks (i.e., modalities), we adopted a group sparsity regularizer, which ensures only a small number of features to be selected jointly. In addition, we introduced a new manifold based Laplacian regularization term to preserve the geometric distribution of original data from each task, which can lead to the selection of more discriminative features. Furthermore, we extend our method to the semi-supervised setting, which is very important since the acquisition of a large set of labeled data (i.e., diagnosis of disease) is usually expensive and time-consuming, while the collection of unlabeled data is relatively much easier. To validate our method, we have performed extensive evaluations on the baseline Magnetic resonance imaging (MRI) and fluorodeoxyglucose positron emission tomography (FDG-PET) data of Alzheimer's Disease Neuroimaging Initiative (ADNI) database. Our experimental results demonstrate the effectiveness of the proposed method.
Clerckx, Bruno
2013-01-01
This book is unique in presenting channels, techniques and standards for the next generation of MIMO wireless networks. Through a unified framework, it emphasizes how propagation mechanisms impact the system performance under realistic power constraints. Combining a solid mathematical analysis with a physical and intuitive approach to space-time signal processing, the book progressively derives innovative designs for space-time coding and precoding as well as multi-user and multi-cell techniques, taking into consideration that MIMO channels are often far from ideal. Reflecting developments
International Nuclear Information System (INIS)
Levitin, Gregory; Dai Yuanshun; Xie Min; Leng Poh, Kim
2003-01-01
In this paper we consider vulnerable systems which can have different states corresponding to different combinations of available elements composing the system. Each state can be characterized by a performance rate, which is the quantitative measure of a system's ability to perform its task. Both the impact of external factors (stress) and internal causes (failures) affect system survivability, which is determined as probability of meeting a given demand. In order to increase the survivability of the system, a multi-level protection is applied to its subsystems. This means that a subsystem and its inner level of protection are in their turn protected by the protection of an outer level. This double-protected subsystem has its outer protection and so forth. In such systems, the protected subsystems can be destroyed only if all of the levels of their protection are destroyed. Each level of protection can be destroyed only if all of the outer levels of protection are destroyed. We formulate the problem of finding the structure of series-parallel multi-state system (including choice of system elements, choice of structure of multi-level protection and choice of protection methods) in order to achieve a desired level of system survivability by the minimal cost. An algorithm based on the universal generating function method is used for determination of the system survivability. A multi-processor version of genetic algorithm is used as optimization tool in order to solve the structure optimization problem. An application example is presented to illustrate the procedure presented in this paper
Santos Tedim Sousa Pedrosa, Ana Sofía
2016-01-01
La prevalencia de infecciones hospitalarias causadas por especies del género Enterococcus ha sido baja desde su descripción como patógenos oportunistas al inicio del siglo XX, hasta finales de los años 70s, coincidiendo con la aparición de las primeras cepas resistentes a antibióticos. La especie Enterococcus faecium es actualmente uno de los principales patógenos nosocomiales debido en parte a la alta prevalencia de cepas resistentes a ampicilina y vancomicina. La estructura poblacional de E...
Iterative equalization for OFDM systems over wideband Multi-Scale Multi-Lag channels
Xu, T.; Tang, Z.; Remis, R.; Leus, G.
2012-01-01
OFDM suffers from inter-carrier interference (ICI) when the channel is time varying. This article seeks to quantify the amount of interference resulting from wideband OFDM channels, which are assumed to follow the multi-scale multi-lag (MSML) model. The MSML channel model results in full channel
Correlations of stock price fluctuations under multi-scale and multi-threshold scenarios
Sui, Guo; Li, Huajiao; Feng, Sida; Liu, Xueyong; Jiang, Meihui
2018-01-01
The multi-scale method is widely used in analyzing time series of financial markets and it can provide market information for different economic entities who focus on different periods. Through constructing multi-scale networks of price fluctuation correlation in the stock market, we can detect the topological relationship between each time series. Previous research has not addressed the problem that the original fluctuation correlation networks are fully connected networks and more information exists within these networks that is currently being utilized. Here we use listed coal companies as a case study. First, we decompose the original stock price fluctuation series into different time scales. Second, we construct the stock price fluctuation correlation networks at different time scales. Third, we delete the edges of the network based on thresholds and analyze the network indicators. Through combining the multi-scale method with the multi-threshold method, we bring to light the implicit information of fully connected networks.
Non-convex multi-objective optimization
Pardalos, Panos M; Žilinskas, Julius
2017-01-01
Recent results on non-convex multi-objective optimization problems and methods are presented in this book, with particular attention to expensive black-box objective functions. Multi-objective optimization methods facilitate designers, engineers, and researchers to make decisions on appropriate trade-offs between various conflicting goals. A variety of deterministic and stochastic multi-objective optimization methods are developed in this book. Beginning with basic concepts and a review of non-convex single-objective optimization problems; this book moves on to cover multi-objective branch and bound algorithms, worst-case optimal algorithms (for Lipschitz functions and bi-objective problems), statistical models based algorithms, and probabilistic branch and bound approach. Detailed descriptions of new algorithms for non-convex multi-objective optimization, their theoretical substantiation, and examples for practical applications to the cell formation problem in manufacturing engineering, the process design in...
Multi-headed comparatives in Portuguese
Directory of Open Access Journals (Sweden)
Rui Marques
2005-06-01
Full Text Available This paper aims at offering a global picture of the subtype of comparative constructions known as ‘multi-headed comparatives’ (from the fact that they exhibit more than one comparative operator in semantic interdependence. As a prerequisite to the fulfilment of his goal, an attempt will be made to clarify the scope of the notion ‘comparative construction’ and to draw a general typology of such constructions. The boundaries of the notion ‘comparative construction’ are defined by contrasting a “genuine” class of comparative constructions with others that hold some syntactic or semantic resemblance to them. Different typologies will be taken into consideration. As for multi-headed comparatives, even though different examples of these constructions have been identified in the scarce literature on the matter, the discussion on their syntactic patterns and meaning is still embryonic. This paper suggests that the expressive power of these comparatives, which seem to provide a particular strategy of information compression, is higher than has been assumed. Four sub-kinds of multi-headed comparatives are identified, based on meaning differences, namely: multi-headed comparatives with a distributive reading, multi-headed comparatives with a cumulative reading, multi-headed comparatives with a comparison of ‘ratios’ reading, and multi-headed comparatives with a comparison of differences reading. While resorting to some classic English examples, the object language will predominantly be Portuguese.
Mainstreaming Multi-Risk Approaches into Policy
Directory of Open Access Journals (Sweden)
Anna Scolobig
2017-12-01
Full Text Available Multi-risk environments are characterized by domino effects that often amplify the overall risk. Those include chains of hazardous events and increasing vulnerability, among other types of correlations within the risk process. The recently developed methods for multi-hazard and risk assessment integrate interactions between different risks by using harmonized procedures based on common metrics. While the products of these assessments, such as multi-hazard and -risk indexes, maps, cascade scenarios, or warning systems provide innovative and effective information, they also pose specific challenges to policy makers and practitioners due to their novel cross-disciplinary aspects. In this paper we discuss the institutional barriers to the adoption of multi-risk approaches, summarizing the results of the fieldwork conducted in Italy and Guadeloupe and of workshops with disaster risk reduction practitioners from eleven European countries. Results show the need for a clear identification of responsibilities for the implementation of multi-risk approaches, as institutional frameworks for risk reduction remain to this day primarily single-risk centered. Authorities are rarely officially responsible for the management of domino effects between e.g., tsunamis and industrial accidents, earthquake and landslides, floods and electricity network failures. Other barriers for the implementation of multi-risk approaches include the limited measures to reduce exposure at the household level, inadequate financial capacities at the local level and limited public-private partnerships, especially in case of interactions between natural and industrial risks. Adapting the scale of institutions to that of multi-risk environments remains a major challenge to better mainstream multi-risk approaches into policy. To address it, we propose a multi-risk governance framework, which includes the phases of observation, social and institutional context analysis, generation of
Multi-chamber and multi-layer thiol-ene microchip for cell culture
DEFF Research Database (Denmark)
Tan, H. Y.; Hemmingsen, Mette; Lafleur, Josiane P.
2014-01-01
We present a multi-layer and multi-chamber microfluidic chip fabricated using two different thiol-ene mixtures. Sandwiched between the thiol-ene chip layers is a commercially available membrane whose morphology has been altered with coatings of thiol-ene mixtures. Experiments have been conducted ...... with the microchip and shown that the fabricated microchip is suitable for long term cell culture....
Directory of Open Access Journals (Sweden)
Cárdenas-Hernández Julián F.
2010-04-01
Full Text Available
Gran parte de los cultivos de cacao en el país son viejos y necesitan ser renovados debido a sus bajos rendimientos. Por esta razón se aborda la producción masiva de plántulas injertadas con materiales de alta productividad, que sin embargo presentan problemas en el prendimiento y desarrollo de las yemas. En el Centro de Investigación Nataima-Corpoica (Espinal, Tolima, plántulas de cacao del clon IMC67 tratadas con desbrote apical fueron injertadas con yemas de los clones CCN51 e ICS95. El ensayo siguió un diseño completamente aleatorizado con siete tratamientos, tres de ellos correspondientes a concentraciones de 5, 10 y 15 mg L-1 de ácido giberélico (AG3, y otros tres aplicando 6-bencilaminopurina (6BAP en las mismas concentraciones, más un testigo sin aplicación de hormonas. Cada 3 días se midieron la altura, el diámetro, la longitud, el número de hojas y el área foliar del injerto, además de su masa fresca y seca al final del experimento, el cual duró 30 días. El AG3 permitió alcanzar los mayores valores en longitud, número de hojas, área foliar y masa fresca y seca del injerto. Para los mismos parámetros, los tratamientos con 6BAP alcanzaron valores similares a los obtenidos con AG3 (con diferencias estadísticas en algunos casos, además de los mayores diámetros del injerto. Dentro de las aplicaciones de AG3, la realizada a una concentración de 10 mg L-1 mostró los mejores resultados en ambos clones. Sin la aplicación de hormonas, las yemas del clon ICS95 desarrollaron una mayor área foliar y alcanzaron mayores valores de masa fresca y seca que las yemas del clon CCN51. Sin embargo, después de aplicar los tratamientos, los dos clones presentaron valores similares.
Directory of Open Access Journals (Sweden)
Glícia Maria Torres Calazans
2007-07-01
Full Text Available Pseudomonas aeruginosa é conhecida por sua versatilidade metabólica e extrema capacidade de adaptação a diferentes ambientes, inclusive aquáticos. Para desinfecção de águas, o cloro e agentes que contêm cloro continuam sendo os mais usados no mundo. O objetivo deste trabalho foi avaliar a resistência ao cloro de linhagens de P. aeruginosa, isoladas de amostras de águas de diversos ambientes. Foram testados diferentes tempos de contato (1, 5, 10, 20, 30 e 40 minutos e soluções aquosas de cloro, com concentrações definidascom base na legislação vigente no país para água potável: 0,5; 1,0 e 2,0 ppm. O teste de resistência ao cloro foi desenvolvido por meio da exposição direta das bactérias às soluções. Os resultados revelaram que P. aeruginosa, isoladas de diferentes fontes de água, têm ahabilidade de sobreviver a diferentes concentrações de cloro. Na concentração de 1 ppm, a maioria das linhagens não foi inibida. As linhagens mais resistentes ao cloro também apresentaram relação de multirresistência à maioria dos antibióticos testados.The nutritional versatility and the adaptability of Pseudomonas aeruginosa to different environments, including water, are well known. Chlorine and other chlorine agents are used as water disinfecting all around the world. The aim of this work was to evaluate the possible chlorine resistance amongst P. aeruginosa strains isolated from different aquatic sources by using different contact time (1, 5, 10, 20, 30 and 40 minutes in solutions with known chlorine concentrations according current legislation in the country to potable water: 0.5; 1.0 and 2.0 ppm. The chlorine resistance test was done by direct exposure of P. aeruginosa under a solution with known chlorine concentration. Results showed that P. aeruginosa strains isolated from different aquatic sources are able tosurvive in different chlorine concentrations. At 1 ppm, most of them were not inhibited. It was also observed
Directory of Open Access Journals (Sweden)
Ronald Guillermo Peláez
2012-05-01
Full Text Available Introducción. Los mecanismos de resistencia al antimonio pentavalente conocidos hasta el momento,se han descrito ampliamente en cepas del subgénero Leishmania, pero poco se sabe sobre lasproteínas involucradas en los mecanismos de resistencia presentes en cepas del subgénero Viannia,como Leishmania panamensis. Objetivo. Identificar proteínas diferencialmente expresadas entre las cepas de L. panamensis(UA140, sensible y resistente al antimonio pentavalente, y analizar el posible papel de estas proteínasen mecanismos de resistencia. Materiales y métodos. Las proteínas de las cepas, sensible y resistente al antimonio pentavalente, secompararon usando electroforesis bidimensional. Las proteínas con aumento de la expresión fueronaisladas e identificadas por espectrometría de masas mediante MALDI-TOF/TOF (Matrix AssistedLaser Desorption Ionization/Time of Flight. La expresión del ARNm de cinco de estas proteínas secuantificó mediante PCR en tiempo real. Resultados. Los geles bidimensionales de las cepas sensible y resistente detectaron 532±39 y 541±43manchas proteicas. Se encontraron 10 manchas con aumento de la expresión en la cepa resistente,identificadas como proteínas de choque térmico (Hsp60 mitocondrial, Hsp70 mitocondrial y citosólica,isomerasa de disulfuro, proteasa de cisteína, enolasa, factor de elongación 5-α, la subunidad 5-α delproteasoma y dos proteínas hipotéticas nombradas como Sp(2 y Sp(25. Conclusión. Este es el primer estudio llevado a cabo con una cepa resistente al antimonio pentavalenteen L. panamensis, en el cual se han identificado proteínas que están relacionadas con el mecanismode resistencia del parásito frente al medicamento, abriendo el camino para futuros estudios de estasproteínas como blancos terapéuticos. doi: http://dx.doi.org/10.7705/biomedica.v32i3.392
Exploring Hardware Support For Scaling Irregular Applications on Multi-node Multi-core Architectures
Energy Technology Data Exchange (ETDEWEB)
Secchi, Simone; Ceriani, Marco; Tumeo, Antonino; Villa, Oreste; Palermo, Gianluca; Raffo, Luigi
2013-06-05
With the recent emergence of large-scale knowledge dis- covery, data mining and social network analysis, irregular applications have gained renewed interest. Classic cache-based high-performance architectures do not provide optimal performances with such kind of workloads, mainly due to the very low spatial and temporal locality of the irregular control and memory access patterns. In this paper, we present a multi-node, multi-core, fine-grained multi-threaded shared-memory system architecture specifically designed for the execution of large-scale irregular applications, and built on top of three pillars, that we believe are fundamental to support these workloads. First, we offer transparent hardware support for Partitioned Global Address Space (PGAS) to provide a large globally-shared address space with no software library overhead. Second, we employ multi-threaded multi-core processing nodes to achieve the necessary latency tolerance required by accessing global memory, which potentially resides in a remote node. Finally, we devise hardware support for inter-thread synchronization on the whole global address space. We first model the performances by using an analytical model that takes into account the main architecture and application characteristics. We describe the hardware design of the proposed cus- tom architectural building blocks that provide support for the above- mentioned three pillars. Finally, we present a limited-scale evaluation of the system on a multi-board FPGA prototype with typical irregular kernels and benchmarks. The experimental evaluation demonstrates the architecture performance scalability for different configurations of the whole system.
Mutagénesis inducida en microbulbos de Allium sativum L.
Directory of Open Access Journals (Sweden)
Adriana Pardo Roldán
2015-07-01
Full Text Available Se estableció un protocolo de mutagénesis en microbulbos de ajo (Allium sativum L. clon Boconó cultivado in vitro. Para el efecto se realizaron dos ensayos, uno de radiosensibilidad para establecer la dosimetría apropiada de radiación gamma y otro de mutagénesis para determinar el comportamiento de los materiales hasta la etapa de almacenamiento. En el primero los microbulbos fueron tratados con cuatros dosis de radiación gamma (6, 8, 10 y 12 Krad, más un control. Para establecer la dosis óptima se consideró la sobrevivencia del 50% de los microbulbos (DL50. Se empleó un diseño de bloques al azar con cinco tratamientos y 20 repeticiones por tratamiento. En el ensayo mutagénico los microbulbos fueron irradiados con 8 y 10 Krad y almacenados durante 45 días a 10 °C en condiciones de oscuridad En este caso se utilizó un diseño de bloques al azar con tres tratamientos (0, 8 y 10 Krad y 20 repeticiones por tratamiento. En ambos ensayos, los microbulbos irradiados con 8 y 10 Krad registraron los mayores promedios para peso y diámetro, lo cual permite concluir que estas dosis son adecuadas para favorecer la producción de mutantes con características agronómicas deseables en el clon Boconó
TeraSCREEN: multi-frequency multi-mode Terahertz screening for border checks
Alexander, Naomi E.; Alderman, Byron; Allona, Fernando; Frijlink, Peter; Gonzalo, Ramón; Hägelen, Manfred; Ibáñez, Asier; Krozer, Viktor; Langford, Marian L.; Limiti, Ernesto; Platt, Duncan; Schikora, Marek; Wang, Hui; Weber, Marc Andree
2014-06-01
The challenge for any security screening system is to identify potentially harmful objects such as weapons and explosives concealed under clothing. Classical border and security checkpoints are no longer capable of fulfilling the demands of today's ever growing security requirements, especially with respect to the high throughput generally required which entails a high detection rate of threat material and a low false alarm rate. TeraSCREEN proposes to develop an innovative concept of multi-frequency multi-mode Terahertz and millimeter-wave detection with new automatic detection and classification functionalities. The system developed will demonstrate, at a live control point, the safe automatic detection and classification of objects concealed under clothing, whilst respecting privacy and increasing current throughput rates. This innovative screening system will combine multi-frequency, multi-mode images taken by passive and active subsystems which will scan the subjects and obtain complementary spatial and spectral information, thus allowing for automatic threat recognition. The TeraSCREEN project, which will run from 2013 to 2016, has received funding from the European Union's Seventh Framework Programme under the Security Call. This paper will describe the project objectives and approach.
Multi-monopoles and magnetic bags
International Nuclear Information System (INIS)
Bolognesi, Stefano
2006-01-01
By analogy with the multi-vortices, we show that also multi-monopoles become magnetic bags in the large n limit. This simplification allows us to compute the spectrum and the profile functions by requiring the minimization of the energy of the bag. We consider in detail the case of the magnetic bag in the limit of vanishing potential and we find that it saturates the Bogomol'nyi bound and there is an infinite set of different shapes of allowed bags. This is consistent with the existence of a moduli space of solutions for the BPS multi-monopoles. We discuss the string theory interpretation of our result and also the relation between the 't Hooft large n limit of certain supersymmetric gauge theories and the large n limit of multi-monopoles. We then consider multi-monopoles in the cosmological context and provide a mechanism that could lead to their production
Mehta, N. C.
1984-01-01
The utility of radar scatterometers for discrimination and characterization of natural vegetation was investigated. Backscatter measurements were acquired with airborne multi-frequency, multi-polarization, multi-angle radar scatterometers over a test site in a southern temperate forest. Separability between ground cover classes was studied using a two-class separability measure. Very good separability is achieved between most classes. Longer wavelength is useful in separating trees from non-tree classes, while shorter wavelength and cross polarization are helpful for discrimination among tree classes. Using the maximum likelihood classifier, 50% overall classification accuracy is achieved using a single, short-wavelength scatterometer channel. Addition of multiple incidence angles and another radar band improves classification accuracy by 20% and 50%, respectively, over the single channel accuracy. Incorporation of a third radar band seems redundant for vegetation classification. Vertical transmit polarization is critically important for all classes.
CGLXTouch: A multi-user multi-touch approach for ultra-high-resolution collaborative workspaces
Ponto, Kevin; Doerr, Kai; Wypych, Tom; Kooker, John; Kuester, Falko
2011-01-01
multi-touch tablet and phone devices, which can be added to and removed from the system on the fly. Events from these devices are tagged with a device identifier and are synchronized with the distributed display environment, enabling multi-user support
Undergraduate Student Peer Mentoring in a Multi-Faculty, Multi-Campus University Context
Townsend, Robert A.; Delves, Melinda; Kidd, Tracy; Figg, Bev
2011-01-01
This article explores research that utilised a mapping strategy to investigate the elements of peer mentoring and peer tutoring programs across a multi-campus Australian university. Peer mentoring, peer tutoring and peer learning activities at the multi-campus university are occurring in a manner that may be considered ad-hoc which does not…
DEFF Research Database (Denmark)
Petersen, Martin Nordal; Nuijts, Roeland; Bjorn, Lars Lange
2014-01-01
This article presents an advanced optical model for simulation of alien wavelengths in multi-domain and multi-vendor dense wavelength-division multiplexing networks. The model aids optical network planners with a better understanding of the non-linear effects present in dense wavelength-division ......This article presents an advanced optical model for simulation of alien wavelengths in multi-domain and multi-vendor dense wavelength-division multiplexing networks. The model aids optical network planners with a better understanding of the non-linear effects present in dense wavelength......-division multiplexing systems and better utilization of alien wavelengths in future applications. The limiting physical effects for alien wavelengths are investigated in relation to power levels, channel spacing, and other factors. The simulation results are verified through experimental setup in live multi...
Generating Multi-Destination Maps.
Zhang, Junsong; Fan, Jiepeng; Luo, Zhenshan
2017-08-01
Multi-destination maps are a kind of navigation maps aimed to guide visitors to multiple destinations within a region, which can be of great help to urban visitors. However, they have not been developed in the current online map service. To address this issue, we introduce a novel layout model designed especially for generating multi-destination maps, which considers the global and local layout of a multi-destination map. We model the layout problem as a graph drawing that satisfies a set of hard and soft constraints. In the global layout phase, we balance the scale factor between ROIs. In the local layout phase, we make all edges have good visibility and optimize the map layout to preserve the relative length and angle of roads. We also propose a perturbation-based optimization method to find an optimal layout in the complex solution space. The multi-destination maps generated by our system are potential feasible on the modern mobile devices and our result can show an overview and a detail view of the whole map at the same time. In addition, we perform a user study to evaluate the effectiveness of our method, and the results prove that the multi-destination maps achieve our goals well.
Multi Camera Multi Object Tracking using Block Search over Epipolar Geometry
Directory of Open Access Journals (Sweden)
Saman Sargolzaei
2000-01-01
Full Text Available We present strategy for multi-objects tracking in multi camera environment for the surveillance and security application where tracking multitude subjects are of utmost importance in a crowded scene. Our technique assumes partially overlapped multi-camera setup where cameras share common view from different angle to assess positions and activities of subjects under suspicion. To establish spatial correspondence between camera views we employ an epipolar geometry technique. We propose an overlapped block search method to find the interested pattern (target in new frames. Color pattern update scheme has been considered to further optimize the efficiency of the object tracking when object pattern changes due to object motion in the field of views of the cameras. Evaluation of our approach is presented with the results on PETS2007 dataset..
Multiple-state based power control for multi-radio multi-channel wireless mesh networks
CSIR Research Space (South Africa)
Olwal, TO
2009-01-01
Full Text Available Multi-Radio Multi-Channel (MRMC) systems are key to power control problems in wireless mesh networks (WMNs). In this paper, we present asynchronous multiple-state based power control for MRMC WMNs. First, WMN is represented as a set of disjoint...
Dicty_cDB: Contig-U05900-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 39018 ) 1278280 NCCCWA 03RT Oncorhynchus mykiss cDNA clon... 50 0.15 1 ( CN809704 ) 2O5 Suppression subtractive hybridization... (SSH) l... 50 0.15 1 ( CN809695 ) 2E1 Suppression subtractive hybridization... (SSH) l... 50 0.15 1 ( CN809694 ) 2I24 Suppression subtractive hybridization (SSH) ... 50 0.15 ...1 ( CN809693 ) 1B14 Suppression subtractive hybridization (SSH) ... 50 0.15 1 ( CN809692 ) 2D5 Suppression subtractive hybridization... (SSH) l... 50 0.15 1 ( CN809691 ) 2D8 Suppression subtractive hybridization (SSH) l
Clonación animal: avances y perspectivas.
Lilian Chuaire; Magda Carolina Sánchez; María Liliana Franco
2009-01-01
Pocos avances han revolucionado tanto la biología del desarrollo como la clonación animal. A partir del nacimiento de la oveja Dolly en 1996, primer clon derivado de un animal adulto, se inició una nueva era científica caracterizada por una creciente desmitificación de las células diferenciadas como entes inmutables en su organización nuclear y estructura cromatínica, y por una mejor comprensión de los mecanismos que regulan el desarrollo. Este trabajo revisará algunos de los logros y de las ...
Jie, Biao; Cheng, Bo
2014-01-01
Accurate diagnosis of Alzheimer’s disease (AD), as well as its pro-dromal stage (i.e., mild cognitive impairment, MCI), is very important for possible delay and early treatment of the disease. Recently, multi-modality methods have been used for fusing information from multiple different and complementary imaging and non-imaging modalities. Although there are a number of existing multi-modality methods, few of them have addressed the problem of joint identification of disease-related brain regions from multi-modality data for classification. In this paper, we proposed a manifold regularized multi-task learning framework to jointly select features from multi-modality data. Specifically, we formulate the multi-modality classification as a multi-task learning framework, where each task focuses on the classification based on each modality. In order to capture the intrinsic relatedness among multiple tasks (i.e., modalities), we adopted a group sparsity regularizer, which ensures only a small number of features to be selected jointly. In addition, we introduced a new manifold based Laplacian regularization term to preserve the geometric distribution of original data from each task, which can lead to the selection of more discriminative features. Furthermore, we extend our method to the semi-supervised setting, which is very important since the acquisition of a large set of labeled data (i.e., diagnosis of disease) is usually expensive and time-consuming, while the collection of unlabeled data is relatively much easier. To validate our method, we have performed extensive evaluations on the baseline Magnetic resonance imaging (MRI) and fluorodeoxyglucose positron emission tomography (FDG-PET) data of Alzheimer’s Disease Neuroimaging Initiative (ADNI) database. Our experimental results demonstrate the effectiveness of the proposed method. PMID:24505676
The Integration of Education in Multi-racial and Multi-cultural Society
Chamisah, Chamisah; M. Daud, Ridhwan
2016-01-01
This study aims to know the reasons of education ina multi-racial and multi-cultural society demands integration.. The studywhich focuses onMalaysia country typified by three major ethnic groups, namely Malays, Chinese and Indians,foundthat, firstlythe integration of curriculum in creating a holistic education isvital for the society to create a competitive human capital with value laden such as trustworthiness, dedication, creativity, civic awareness and many more. Secondly, integration curr...
Multi-peta-watt laser performances
International Nuclear Information System (INIS)
Reichart, A.; Blanchot, N.; Nicolaizeau, M.; Ribeyre, X.; Bettinger, A.
2000-01-01
A multi-Peta-watt laser inside the 'Ligne d'integration laser' building is studied. We present simulations of the different amplification stages to reach broadband 10 kJ pulses in order to obtain a multi-Peta-watt laser beam. The results for preamplifier and power amplifier are detailed. Challenges of a multi-Peta-watt system are to increase the limit of compressed energy an order of magnitude, to perform a focal spot around 100 μm for Fast Ignitor applications, and to provide a temporal contrast better than 10 10 , for X-ray laser and plasma interaction applications. These first 1-D calculations are helpful for the design of a multi-Peta-watt laser. (authors)
Directory of Open Access Journals (Sweden)
Mayra Alejandra Machuca
2014-04-01
Full Text Available Introducción. Staphylococcus aureus resistente a la meticilina (SARM es un agente frecuente de infección en la población pediátrica. Aunque inicialmente las cepas de SARM estaban restringidas a los hospitales, se han reportado a nivel mundial brotes de infección por SARM en individuos sin factores de riesgo y, actualmente, SARM es una causa frecuente de infecciones hospitalarias y comunitarias. Objetivo. Describir la relación entre las características moleculares de aislamientos de SARM (casete cromosómico estafilocócico mec SCCmec y leucocidina Panton-Valentine y el origen de la infección y su presentación clínica en pacientes pediátricos del Hospital Universitario de Santander en Bucaramanga, Colombia. Materiales y métodos. Se incluyeron 43 aislamientos de SARM obtenidos de niños hospitalizados. La clasificación del SCCmec (I-V y la subclasificación del SCCmec-IV se realizaron en todos los aislamientos. Además, los genes de la leucocidina Panton-Valentine se detectaron mediante amplificación por PCR. Las características moleculares fueron asociadas con las características clínicas de cada paciente. Resultados. Entre los 43 SARM tipificados, el SCCmec-IVc fue el más frecuente con 77 %, seguido por el SCCmec-I con 16 % y el SCCmec-IVa con 2 %. Tres aislamientos no pudieron ser tipificados. Los genes de la leucocidina Panton Valentine se detectaron en 88 % de los SARM en aislamientos portadores del SCCmec-IVc/IVa y el SCCmec-I. Los SARM SCCmec-IV positivos para la leucocidina Panton-Valentine se asociaron con infecciones adquiridas en la comunidad (47 % y en el hospital (53 % con compromiso de piel y tejidos blandos, y en los casos más graves, con compromiso osteoarticular. Conclusiones. Estos resultados sugieren la presencia de cepas SARM-CO (SCCmec-IV positiva para PVL causantes de infecciones adquiridas en la comunidad y en el medio hospitalario en pacientes pediátricos en Colombia.
The Adaptive Multi-scale Simulation Infrastructure
Energy Technology Data Exchange (ETDEWEB)
Tobin, William R. [Rensselaer Polytechnic Inst., Troy, NY (United States)
2015-09-01
The Adaptive Multi-scale Simulation Infrastructure (AMSI) is a set of libraries and tools developed to support the development, implementation, and execution of general multimodel simulations. Using a minimal set of simulation meta-data AMSI allows for minimally intrusive work to adapt existent single-scale simulations for use in multi-scale simulations. Support for dynamic runtime operations such as single- and multi-scale adaptive properties is a key focus of AMSI. Particular focus has been spent on the development on scale-sensitive load balancing operations to allow single-scale simulations incorporated into a multi-scale simulation using AMSI to use standard load-balancing operations without affecting the integrity of the overall multi-scale simulation.
Variabilidad del peso de los recién nacidos según el país de origen materno
García Andrés, R; Valerio Rodríguez, FT; Casuscelli, L; Barón Mizzi, I; García Moreno, M
2016-01-01
Resumen: Objetivo: establecer las diferencias de peso al nacer en recién nacidos a término de mujeres españolas, sudamericanas y magrebíes en el Hospital Universitario Rafael Méndez, en Lorca (Murcia), España. Material y métodos: el estudio incluye a recién nacidos de gestación única y controlada a término, en madres sanas, sin hábitos tóxicos y origen español, magrebí o sudamericano, con una muestra de 240 mujeres, 80 en cada grupo. Se excluyen los recién nacidos pretérmino, gestación mú...
Directory of Open Access Journals (Sweden)
Ana Sofia Vilariça
2008-11-01
Full Text Available Resumo: Introdução: A tuberculose extensivamente resistente (TBXDR define-se como uma forma de tuberculose multirresistente (TBMR com resistências adicionais à s fluoroquinolonas e, pelo menos, a um dos antibacilares injectáveis seguintes: amicacina, canamicina e capreomicina. Foi classificada pela OMS como uma ameaça séria ao controlo da tuberculose, com consequências à escala mundial, assumindo os contornos de uma autêntica pandemia em algumas regiões do globo.Objectivo: Comparar os doentes com TBXDR versus outros perfis de TBMR no que diz respeito à s caracterÃsticas demográficas e epidemiológicas, factores etiopatogénicos e evolução no internamento.Material e métodos: Doentes internados no Serviço de Pneumologia III do Hospital de Pulido Valente no perÃodo compreendido entre Abril de 1999 e Junho de 2007, com o diagnóstico de TBMR microbiologicamente confirmado. Foram analisadas as seguintes variáveis: sexo, distribuição etária, raça, formas de apresentação da TB, grupos de tratamento, perfil de resistência aos antibacilares, estatuto de imigrante, número e duração de tratamentos anteriores, classificação OMS, co-infecção VIH, alcoolismo e/ou toxicodependência, demora média do internamento e mortalidade intra-hospitalar. A análise estatÃstica realizou-se no programa SPSS (Statistical Package for the Social Sciences, versão 15.0. Nas variáveis categoriais, as diferenças estatÃsticas entre os grupos foram avaliadas através do teste qui-quadrado e as variáveis numéricas através do teste t. Para a construção do modelo preditivo da presença de TBXDR (variável dependente foi utilizada a análise de regressão logÃstica, tendo sido incluÃdas as seguintes variáveis independentes: classificação OMS, coinfecção VIH, estatuto de imigrante, alcoolismo e/ou toxicodepend
The Role of Attention in Somatosensory Processing: A Multi-Trait, Multi-Method Analysis
Wodka, Ericka L.; Puts, Nicolaas A. J.; Mahone, E. Mark; Edden, Richard A. E.; Tommerdahl, Mark; Mostofsky, Stewart H.
2016-01-01
Sensory processing abnormalities in autism have largely been described by parent report. This study used a multi-method (parent-report and measurement), multi-trait (tactile sensitivity and attention) design to evaluate somatosensory processing in ASD. Results showed multiple significant within-method (e.g., parent report of different…
Computational modelling of multi-cell migration in a multi-signalling substrate
International Nuclear Information System (INIS)
Mousavi, Seyed Jamaleddin; Doblaré, Manuel; Doweidar, Mohamed Hamdy
2014-01-01
Cell migration is a vital process in many biological phenomena ranging from wound healing to tissue regeneration. Over the past few years, it has been proven that in addition to cell–cell and cell-substrate mechanical interactions (mechanotaxis), cells can be driven by thermal, chemical and/or electrical stimuli. A numerical model was recently presented by the authors to analyse single cell migration in a multi-signalling substrate. That work is here extended to include multi-cell migration due to cell–cell interaction in a multi-signalling substrate under different conditions. This model is based on balancing the forces that act on the cell population in the presence of different guiding cues. Several numerical experiments are presented to illustrate the effect of different stimuli on the trajectory and final location of the cell population within a 3D heterogeneous multi-signalling substrate. Our findings indicate that although multi-cell migration is relatively similar to single cell migration in some aspects, the associated behaviour is very different. For instance, cell–cell interaction may delay single cell migration towards effective cues while increasing the magnitude of the average net cell traction force as well as the local velocity. Besides, the random movement of a cell within a cell population is slightly greater than that of single cell migration. Moreover, higher electrical field strength causes the cell slug to flatten near the cathode. On the other hand, as with single cell migration, the existence of electrotaxis dominates mechanotaxis, moving the cells to the cathode or anode pole located at the free surface. The numerical results here obtained are qualitatively consistent with related experimental works. (paper)
Energy-aware Thread and Data Management in Heterogeneous Multi-core, Multi-memory Systems
Energy Technology Data Exchange (ETDEWEB)
Su, Chun-Yi [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States)
2014-12-16
By 2004, microprocessor design focused on multicore scaling—increasing the number of cores per die in each generation—as the primary strategy for improving performance. These multicore processors typically equip multiple memory subsystems to improve data throughput. In addition, these systems employ heterogeneous processors such as GPUs and heterogeneous memories like non-volatile memory to improve performance, capacity, and energy efficiency. With the increasing volume of hardware resources and system complexity caused by heterogeneity, future systems will require intelligent ways to manage hardware resources. Early research to improve performance and energy efficiency on heterogeneous, multi-core, multi-memory systems focused on tuning a single primitive or at best a few primitives in the systems. The key limitation of past efforts is their lack of a holistic approach to resource management that balances the tradeoff between performance and energy consumption. In addition, the shift from simple, homogeneous systems to these heterogeneous, multicore, multi-memory systems requires in-depth understanding of efficient resource management for scalable execution, including new models that capture the interchange between performance and energy, smarter resource management strategies, and novel low-level performance/energy tuning primitives and runtime systems. Tuning an application to control available resources efficiently has become a daunting challenge; managing resources in automation is still a dark art since the tradeoffs among programming, energy, and performance remain insufficiently understood. In this dissertation, I have developed theories, models, and resource management techniques to enable energy-efficient execution of parallel applications through thread and data management in these heterogeneous multi-core, multi-memory systems. I study the effect of dynamic concurrent throttling on the performance and energy of multi-core, non-uniform memory access
Generic Automated Multi-function Finger Design
Honarpardaz, M.; Tarkian, M.; Sirkett, D.; Ölvander, J.; Feng, X.; Elf, J.; Sjögren, R.
2016-11-01
Multi-function fingers that are able to handle multiple workpieces are crucial in improvement of a robot workcell. Design automation of multi-function fingers is highly demanded by robot industries to overcome the current iterative, time consuming and complex manual design process. However, the existing approaches for the multi-function finger design automation are unable to entirely meet the robot industries’ need. This paper proposes a generic approach for design automation of multi-function fingers. The proposed approach completely automates the design process and requires no expert skill. In addition, this approach executes the design process much faster than the current manual process. To validate the approach, multi-function fingers are successfully designed for two case studies. Further, the results are discussed and benchmarked with existing approaches.
Multi-Resonant-Activation for a System Only Driven by Multi-State Noise
International Nuclear Information System (INIS)
Li Jinghui
2010-01-01
We consider the escape of the particles over fluctuating potential barrier for a system only driven by a multi-state noise. It is shown that, the noise can make the particles escape over the fluctuating potential barrier in some circumstances; but in other circumstances, it can not. If the noise can make the particle escape over the fluctuating potential barrier, the mean first passage time (MFPT) can display the phenomenon of multi-resonant-activation. For this phenomenon, there are two kinds of resonant activation to appear. One is resonant activation for the MFPTs as the function of the flipping rates of the fluctuating potential barrier; the other is that for the MFPTs as the functions of the transition rates of the multi-state noise. (general)
Multi-component optical solitary waves
DEFF Research Database (Denmark)
Kivshar, Y. S.; Sukhorukov, A. A.; Ostrovskaya, E. A.
2000-01-01
We discuss several novel types of multi-component (temporal and spatial) envelope solitary waves that appear in fiber and waveguide nonlinear optics. In particular, we describe multi-channel solitary waves in bit-parallel-wavelength fiber transmission systems for highperformance computer networks......, multi-color parametric spatial solitary waves due to cascaded nonlinearities of quadratic materials, and quasiperiodic envelope solitons due to quasi-phase-matching in Fibonacci optical superlattices. (C) 2000 Elsevier Science B.V. All rights reserved....
Directory of Open Access Journals (Sweden)
Ronghui ZHENG
2017-12-01
Full Text Available A control method for Multi-Input Multi-Output (MIMO non-Gaussian random vibration test with cross spectra consideration is proposed in the paper. The aim of the proposed control method is to replicate the specified references composed of auto spectral densities, cross spectral densities and kurtoses on the test article in the laboratory. It is found that the cross spectral densities will bring intractable coupling problems and induce difficulty for the control of the multi-output kurtoses. Hence, a sequential phase modification method is put forward to solve the coupling problems in multi-input multi-output non-Gaussian random vibration test. To achieve the specified responses, an improved zero memory nonlinear transformation is utilized first to modify the Fourier phases of the signals with sequential phase modification method to obtain one frame reference response signals which satisfy the reference spectra and reference kurtoses. Then, an inverse system method is used in frequency domain to obtain the continuous stationary drive signals. At the same time, the matrix power control algorithm is utilized to control the spectra and kurtoses of the response signals further. At the end of the paper, a simulation example with a cantilever beam and a vibration shaker test are implemented and the results support the proposed method very well. Keywords: Cross spectra, Kurtosis control, Multi-input multi-output, Non-Gaussian, Random vibration test
Energy Technology Data Exchange (ETDEWEB)
Schmidt, C. [LBD-Beratungsgesellschaft mbH, Berlin (Germany)
2003-06-02
Multi-utility is seen as the most promising marketing strategy for energy companies. In the future, experts say, only the combined supply of electricity, natural gas, water, waste management and services will allow companies to grow. But are today's multi-utility-products answering the needs of the customers? The author goes further into this question and finds the answer: Multi-utility needs to be further developed. Only products from growth and competition markets can generate additional margins. (orig.) [German] Multi-Utility gilt als die Marketingstrategie fuer Energieversorger. Nur wer zukuenftig Strom, Gas, Wasser, Entsorgung und Service aus einer Hand anbietet, heisst es in der Branche, kann im Markt wachsen. Doch inwieweit entspricht das heutige Multi-Utility-Angebot wirklich dem Kundenbeduerfnis? Die Verfasserin geht dieser Frage nach und kommt zu dem Schluss: Die Multi-Utility-Palette muss weiterentwickelt werden. Nur mit Produkten aus Wachstums- und Wettbewerbsmaerkten kann zusaetzliche Marge generiert werden. (orig.)
A Single Rod Multi-modality Multi-interface Level Sensor Using an AC Current Source
Directory of Open Access Journals (Sweden)
Abdulgader Hwili
2008-05-01
Full Text Available Crude oil separation is an important process in the oil industry. To make efficient use of the separators, it is important to know their internal behaviour, and to measure the levels of multi-interfaces between different materials, such as gas-foam, foam-oil, oil-emulsion, emulsion-water and water-solids. A single-rod multi-modality multi-interface level sensor is presented, which has a current source, and electromagnetic modalities. Some key issues have been addressed, including the effect of salt content and temperature i.e. conductivity on the measurement.
Developing Multi-Agency Leadership in Education
Close, Paul
2012-01-01
This article contributes to the growing debate around how we understand and develop multi-agency leadership in children and young people's services. Bringing together a range of inter-disciplinary research, it presents a framework for multi-agency leadership development, which, it argues, is well theorised, multi-level and versed in key field…
Multi-Directional Environmental Sensors
Manohara, Harish (Inventor); Del Castillo, Linda Y. (Inventor); Mojarradi, Mohammed M. (Inventor)
2016-01-01
Systems and methods in accordance with embodiments of the invention implement multi-directional environmental sensors. In one embodiment, a multi-directional environmental sensor includes: an inner conductive element that is substantially symmetrical about three orthogonal planes; an outer conductive element that is substantially symmetrical about three orthogonal planes; and a device that measures the electrical characteristics of the multi-directional environmental sensor, the device having a first terminal and a second terminal; where the inner conductive element is substantially enclosed within the outer conductive element; where the inner conductive element is electrically coupled to the first terminal of the device; and where the outer conductive element is electrically coupled to the second terminal of the device.
Rupley, William H.; Paige, David D.; Rasinski, Timothy V.; Slough, Scott W.
2015-01-01
Pavio's Dual-Coding Theory (1991) and Mayer's Multimedia Principal (2000) form the foundation for proposing a multi-coding theory centered around Multi-Touch Tablets and the newest generation of e-textbooks to scaffold struggling readers in reading and learning from science textbooks. Using E. O. Wilson's "Life on Earth: An Introduction"…
Teamwork Reasoning and Multi-Satellite Missions
Marsella, Stacy C.; Plaunt, Christian (Technical Monitor)
2002-01-01
NASA is rapidly moving towards the use of spatially distributed multiple satellites operating in near Earth orbit and Deep Space. Effective operation of such multi-satellite constellations raises many key research issues. In particular, the satellites will be required to cooperate with each other as a team that must achieve common objectives with a high degree of autonomy from ground based operations. The multi-agent research community has made considerable progress in investigating the challenges of realizing such teamwork. In this report, we discuss some of the teamwork issues that will be faced by multi-satellite operations. The basis of the discussion is a particular proposed mission, the Magnetospheric MultiScale mission to explore Earth's magnetosphere. We describe this mission and then consider how multi-agent technologies might be applied in the design and operation of these missions. We consider the potential benefits of these technologies as well as the research challenges that will be raised in applying them to NASA multi-satellite missions. We conclude with some recommendations for future work.
Interaction Control Protocols for Distributed Multi-user Multi-camera Environments
Directory of Open Access Journals (Sweden)
Gareth W Daniel
2003-10-01
Full Text Available Video-centred communication (e.g., video conferencing, multimedia online learning, traffic monitoring, and surveillance is becoming a customary activity in our lives. The management of interactions in such an environment is a complicated HCI issue. In this paper, we present our study on a collection of interaction control protocols for distributed multiuser multi-camera environments. These protocols facilitate different approaches to managing a user's entitlement for controlling a particular camera. We describe a web-based system that allows multiple users to manipulate multiple cameras in varying remote locations. The system was developed using the Java framework, and all protocols discussed have been incorporated into the system. Experiments were designed and conducted to evaluate the effectiveness of these protocols, and to enable the identification of various human factors in a distributed multi-user and multi-camera environment. This work provides an insight into the complexity associated with the interaction management in video-centred communication. It can also serve as a conceptual and experimental framework for further research in this area.
Macrostructural Treatment of Multi-word Lexical Items
Directory of Open Access Journals (Sweden)
Alenka Vrbinc
2011-05-01
Full Text Available The paper discusses the macrostructural treatment of multi-word lexical items in mono- and bilingual dictionaries. First, the classification of multi-word lexical items is presented, and special attention is paid to the discussion of compounds – a specific group of multi-word lexical items that is most commonly afforded headword status but whose inclusion in the headword list may also depend on spelling. Then the inclusion of multi-word lexical items in monolingual dictionaries is dealt with in greater detail, while the results of a short survey on the inclusion of five randomly chosen multi-word lexical items in seven English monolingual dictionaries are presented. The proposals as to how to treat these five multi-word lexical items in bilingual dictionaries are presented in the section about the inclusion of multi-word lexical items in bilingual dictionaries. The conclusion is that it is most important to take the users’ needs into consideration and to make any dictionary as user friendly as possible.
Ravi, Koustuban; Wang, Qian; Ho, Seng-Tiong
2015-08-01
We report a new computational model for simulations of electromagnetic interactions with semiconductor quantum well(s) (SQW) in complex electromagnetic geometries using the finite-difference time-domain method. The presented model is based on an approach of spanning a large number of electron transverse momentum states in each SQW sub-band (multi-band) with a small number of discrete multi-electron states (multi-level, multi-electron). This enables accurate and efficient two-dimensional (2-D) and three-dimensional (3-D) simulations of nanophotonic devices with SQW active media. The model includes the following features: (1) Optically induced interband transitions between various SQW conduction and heavy-hole or light-hole sub-bands are considered. (2) Novel intra sub-band and inter sub-band transition terms are derived to thermalize the electron and hole occupational distributions to the correct Fermi-Dirac distributions. (3) The terms in (2) result in an explicit update scheme which circumvents numerically cumbersome iterative procedures. This significantly augments computational efficiency. (4) Explicit update terms to account for carrier leakage to unconfined states are derived, which thermalize the bulk and SQW populations to a common quasi-equilibrium Fermi-Dirac distribution. (5) Auger recombination and intervalence band absorption are included. The model is validated by comparisons to analytic band-filling calculations, simulations of SQW optical gain spectra, and photonic crystal lasers.
Multi-antenna synthetic aperture radar
Wang, Wen-Qin
2013-01-01
Synthetic aperture radar (SAR) is a well-known remote sensing technique, but conventional single-antenna SAR is inherently limited by the minimum antenna area constraint. Although there are still technical issues to overcome, multi-antenna SAR offers many benefits, from improved system gain to increased degrees-of-freedom and system flexibility. Multi-Antenna Synthetic Aperture Radar explores the potential and challenges of using multi-antenna SAR in microwave remote sensing applications. These applications include high-resolution imaging, wide-swath remote sensing, ground moving target indica
DEFF Research Database (Denmark)
Butenuth, Matthias; Frey, Daniel; Nielsen, Allan Aasbjerg
2011-01-01
In this paper, a new assessment system is presented to evaluate infrastructure objects such as roads after natural disasters in near-realtime. A particular aim is the exploitation of multi-sensorial and multi-temporal imagery together with further {GIS-}data in a comprehensive assessment framewor...
International Nuclear Information System (INIS)
Khaksar, A; Fatemi, H
2012-01-01
To model the filtering behavior of a multi-tooth plasmonic nano-filter (multi-TPNF), an equivalent circuitry composed of a set of serried impedances is considered. The changes caused in its filtering behavior are proposed as a measuring tool to investigate the effect of the geometrical imperfections occurring during the manufacture of the device. Consequently, the effects of changes in the nominal size of each of the geometrical parameters of a multi-TPNF sample, such as its tooth height, d, its tooth width, w, and the separation between two successive teeth, Δ, on its transmittance are investigated. It is observed that each single tooth of the multi-TPNF and also the waveguide between any of its two successive teeth exhibit a very Fabry–Perot interferometer like behavior. The variation of the transmission spectra of a multi-TPNF whose geometrical parameters are imperfect is compared with the desired filter, and also the effect of the number of geometrically imperfect teeth of the multi-TPNF on the filtering spectra is examined. (paper)
Fulminante, rituximab-resistente, mucocutane pemphigus vulgaris
Gostyński, A.; Ammatuna, E.; Huls, G.; Wouthuyzen-Bakker, M.; Jonkman, M. F.; Horváth, B.
2017-01-01
Pemphigus vulgaris is an autoimmune disease mediated by auto-antibodies against desmoglein 1 and 3. First line treatment for pemphigus consists of systemic corticosteroids and anti-CD20 therapy (rituximab) to eliminate B-cells. Since 2005, more than 100 patients with pemphigus have been treated with
Wen, Xian-Huan; Gómez-Hernández, J. Jaime
1998-03-01
The macrodispersion of an inert solute in a 2-D heterogeneous porous media is estimated numerically in a series of fields of varying heterogeneity. Four different random function (RF) models are used to model log-transmissivity (ln T) spatial variability, and for each of these models, ln T variance is varied from 0.1 to 2.0. The four RF models share the same univariate Gaussian histogram and the same isotropic covariance, but differ from one another in terms of the spatial connectivity patterns at extreme transmissivity values. More specifically, model A is a multivariate Gaussian model for which, by definition, extreme values (both high and low) are spatially uncorrelated. The other three models are non-multi-Gaussian: model B with high connectivity of high extreme values, model C with high connectivity of low extreme values, and model D with high connectivities of both high and low extreme values. Residence time distributions (RTDs) and macrodispersivities (longitudinal and transverse) are computed on ln T fields corresponding to the different RF models, for two different flow directions and at several scales. They are compared with each other, as well as with predicted values based on first-order analytical results. Numerically derived RTDs and macrodispersivities for the multi-Gaussian model are in good agreement with analytically derived values using first-order theories for log-transmissivity variance up to 2.0. The results from the non-multi-Gaussian models differ from each other and deviate largely from the multi-Gaussian results even when ln T variance is small. RTDs in non-multi-Gaussian realizations with high connectivity at high extreme values display earlier breakthrough than in multi-Gaussian realizations, whereas later breakthrough and longer tails are observed for RTDs from non-multi-Gaussian realizations with high connectivity at low extreme values. Longitudinal macrodispersivities in the non-multi-Gaussian realizations are, in general, larger than
Editorial: invitación al segundo congreso sudamericano de neurología
Revista, Facultad de Medicina
2011-01-01
Estimado colega: tenemos el agrado de invitarlo al Segundo Congreso Latino Americano de Neurocirugía que se celebrará en Santiago de Chile, en abril de 1947.Los temas oficiales han sido distribuidos a los diferentes servicios de Neurocirugía de Argentina, Brasil, Chile, Perú y Uruguay.
Tateyama, Yukina; Oyama, Kei; Shiraishi, Masaru; Iijima, Toshio; Tsutsui, Ken-Ichiro
2017-12-01
Multi-unit recording has been one of the most widely used techniques to investigate the correlation between multiple neuronal activities and behavior. However, a common problem of currently used multi-channel electrodes is their physical weakness. In this study, we developed a novel multi-channel electrode with sufficient physical strength to penetrate a thickened dura mater. This electrode consists of low-cost materials and is easily fabricated, and it enables recording without removing dura mater, thereby reducing the risk of inflammation, infection, or brain herniation. The low-cost multi-channel electrode developed in this study would be a useful tool for chronic recording in behaving animals. Copyright © 2017. Published by Elsevier B.V.
Biferale, L.; Mantovani, F.; Pivanti, M.; Pozzati, F.; Sbragaglia, M.; Schifano, S.F.; Toschi, F.; Tripiccione, R.
2011-01-01
We develop a Lattice Boltzmann code for computational fluid-dynamics and optimize it for massively parallel systems based on multi-core processors. Our code describes 2D multi-phase compressible flows. We analyze the performance bottlenecks that we find as we gradually expose a larger fraction of
Multi level configuration of ETO products
DEFF Research Database (Denmark)
Petersen, Thomas Ditlev; Jørgensen, Kaj Asbjørn; Hvolby, Hans-Henrik
2007-01-01
The paper introduces and defines central concepts related to multi level configuration and analyzes which challenges an engineer to order company must deal with to be able to realize a multi level configuration system. It is argued that high flexibility can be achieved and focus can be directed...... in certain business processes if a multi level configuration system is realized....
The Multi-perspective Process Explorer
Mannhardt, Felix; De Leoni, Massimiliano; Reijers, Hajo A.
2015-01-01
Organizations use process mining techniques to analyze event data recorded by their information systems. Multi-perspective process mining techniques make use of data attributes attached to events to analyze processes from multiple perspectives. Applying those multi-perspective process mining
Wang, Xiao; Zhang, Jun; Li, Guo-Zheng
2015-01-01
It has become a very important and full of challenge task to predict bacterial protein subcellular locations using computational methods. Although there exist a lot of prediction methods for bacterial proteins, the majority of these methods can only deal with single-location proteins. But unfortunately many multi-location proteins are located in the bacterial cells. Moreover, multi-location proteins have special biological functions capable of helping the development of new drugs. So it is necessary to develop new computational methods for accurately predicting subcellular locations of multi-location bacterial proteins. In this article, two efficient multi-label predictors, Gpos-ECC-mPLoc and Gneg-ECC-mPLoc, are developed to predict the subcellular locations of multi-label gram-positive and gram-negative bacterial proteins respectively. The two multi-label predictors construct the GO vectors by using the GO terms of homologous proteins of query proteins and then adopt a powerful multi-label ensemble classifier to make the final multi-label prediction. The two multi-label predictors have the following advantages: (1) they improve the prediction performance of multi-label proteins by taking the correlations among different labels into account; (2) they ensemble multiple CC classifiers and further generate better prediction results by ensemble learning; and (3) they construct the GO vectors by using the frequency of occurrences of GO terms in the typical homologous set instead of using 0/1 values. Experimental results show that Gpos-ECC-mPLoc and Gneg-ECC-mPLoc can efficiently predict the subcellular locations of multi-label gram-positive and gram-negative bacterial proteins respectively. Gpos-ECC-mPLoc and Gneg-ECC-mPLoc can efficiently improve prediction accuracy of subcellular localization of multi-location gram-positive and gram-negative bacterial proteins respectively. The online web servers for Gpos-ECC-mPLoc and Gneg-ECC-mPLoc predictors are freely accessible
Rico, Antonio; Noguera, Manuel; Garrido, José Luis; Benghazi, Kawtar; Barjis, Joseph
2016-05-01
Multi-tenant architectures (MTAs) are considered a cornerstone in the success of Software as a Service as a new application distribution formula. Multi-tenancy allows multiple customers (i.e. tenants) to be consolidated into the same operational system. This way, tenants run and share the same application instance as well as costs, which are significantly reduced. Functional needs vary from one tenant to another; either companies from different sectors run different types of applications or, although deploying the same functionality, they do differ in the extent of their complexity. In any case, MTA leaves one major concern regarding the companies' data, their privacy and security, which requires special attention to the data layer. In this article, we propose an extended data model that enhances traditional MTAs in respect of this concern. This extension - called multi-target - allows MT applications to host, manage and serve multiple functionalities within the same multi-tenant (MT) environment. The practical deployment of this approach will allow SaaS vendors to target multiple markets or address different levels of functional complexity and yet commercialise just one single MT application. The applicability of the approach is demonstrated via a case study of a real multi-tenancy multi-target (MT2) implementation, called Globalgest.
Selkowitz, D.J.
2010-01-01
Shrub cover appears to be increasing across many areas of the Arctic tundra biome, and increasing shrub cover in the Arctic has the potential to significantly impact global carbon budgets and the global climate system. For most of the Arctic, however, there is no existing baseline inventory of shrub canopy cover, as existing maps of Arctic vegetation provide little information about the density of shrub cover at a moderate spatial resolution across the region. Remotely-sensed fractional shrub canopy maps can provide this necessary baseline inventory of shrub cover. In this study, we compare the accuracy of fractional shrub canopy (> 0.5 m tall) maps derived from multi-spectral, multi-angular, and multi-temporal datasets from Landsat imagery at 30 m spatial resolution, Moderate Resolution Imaging SpectroRadiometer (MODIS) imagery at 250 m and 500 m spatial resolution, and MultiAngle Imaging Spectroradiometer (MISR) imagery at 275 m spatial resolution for a 1067 km2 study area in Arctic Alaska. The study area is centered at 69 ??N, ranges in elevation from 130 to 770 m, is composed primarily of rolling topography with gentle slopes less than 10??, and is free of glaciers and perennial snow cover. Shrubs > 0.5 m in height cover 2.9% of the study area and are primarily confined to patches associated with specific landscape features. Reference fractional shrub canopy is determined from in situ shrub canopy measurements and a high spatial resolution IKONOS image swath. Regression tree models are constructed to estimate fractional canopy cover at 250 m using different combinations of input data from Landsat, MODIS, and MISR. Results indicate that multi-spectral data provide substantially more accurate estimates of fractional shrub canopy cover than multi-angular or multi-temporal data. Higher spatial resolution datasets also provide more accurate estimates of fractional shrub canopy cover (aggregated to moderate spatial resolutions) than lower spatial resolution datasets
... Releases Speeches and Testimony Major Operations Multi-Media Library Micrograms Legislative & Legal Resources Events Social Media Directory ... Envío de información confidencial Press Room » Multi-Media Library IMAGE GALLERY Drug Photos Amphetamines/Stimulants K2/Spice ...
Javidi, Bahram; Andres, Pedro
2014-01-01
Provides a broad overview of advanced multidimensional imaging systems with contributions from leading researchers in the field Multi-dimensional Imaging takes the reader from the introductory concepts through to the latest applications of these techniques. Split into 3 parts covering 3D image capture, processing, visualization and display, using 1) a Multi-View Approach and 2.) a Holographic Approach, followed by a 3rd part addressing other 3D systems approaches, applications and signal processing for advanced 3D imaging. This book describes recent developments, as well as the prospects and
Directory of Open Access Journals (Sweden)
Mercedes Cáceres
2011-12-01
Full Text Available OBJETIVO: Conocer la frecuencia de portadores nasales de cepas de Staphylococcus aureus resistentes a meticilina (SARM y el patrón de resistencia antimicrobiana de esas cepas obtenidas de trabajadores de la salud de cuatro hospitales de Nicaragua. MÉTODOS: Se realizó un estudio descriptivo, transversal, en el período del 1 de junio de 2009 al 30 de septiembre de 2010. Los hisopados nasales de los trabajadores de la salud que aceptaron voluntariamente participar en el estudio fueron cultivados en medio agar base de detección de resistencia a oxacilina (ORSAB. La identificación de los aislados de S. aureus se realizó por métodos cotidianos y la resistencia a meticilina se determinó por la presencia del gen mecA con la técnica de reacción en cadena de polimerasa. El patrón de resistencia antimicrobiana se detectó por difusión en disco. Cada participante firmó un consentimiento informado con anterioridad a la toma de la muestra. RESULTADOS: Participaron en el estudio 569 trabajadores de la salud, de los cuales 208 eran del hospital de León, 155 de dos hospitales de Chinandega y 206 del de Managua. La frecuencia de portadores nasales de SARM fue de 9,6% en León, 11,6% en Chinandega y 6,7% en Managua. El perfil de resistencia de las cepas SARM fue similar en los cuatro hospitales y todas las cepas fueron sensibles a vancomicina. Del total de cepas SARM aisladas, 15% fueron multirre-sistentes. El porcentaje de resistencia a eritromicina fue el más alto, seguido del de clindamicina. CONCLUSIONES: Los resultados del estudio se pueden considerar una advertencia sobre la circulación de cepas SARM entre el personal de salud de los hospitales participantes y aportan información relevante en relación al perfil de resistencia de las cepas SARM.OBJECTIVE: To determine the frequency of nasal carriers of strains of methicillin-resistant Staphylococcus aureus (MRSA and the antimicrobial resistance pattern of these strains, obtained from health
Interference-aware power control for multi-radio multi-channel wireless mesh networks
CSIR Research Space (South Africa)
Olwal, TO
2009-09-01
Full Text Available are well known in [9], [6]. The operation of multi-radio multi-channel (MRMC) WMNs generally requires sustainable energy supply. Substantial deployments of WMNs have recently been witnessed in rural and remote communities [4]. In such applications...]. Power resources are dynamically adjusted by each NIC using intra and inter-subsystem (channel) states. Due to the decentralized nature, each MP assumes imperfect knowledge about the global network. Further we assume that there exists...
Multi-band transmission color filters for multi-color white LEDs based visible light communication
Wang, Qixia; Zhu, Zhendong; Gu, Huarong; Chen, Mengzhu; Tan, Qiaofeng
2017-11-01
Light-emitting diodes (LEDs) based visible light communication (VLC) can provide license-free bands, high data rates, and high security levels, which is a promising technique that will be extensively applied in future. Multi-band transmission color filters with enough peak transmittance and suitable bandwidth play a pivotal role for boosting signal-noise-ratio in VLC systems. In this paper, multi-band transmission color filters with bandwidth of dozens nanometers are designed by a simple analytical method. Experiment results of one-dimensional (1D) and two-dimensional (2D) tri-band color filters demonstrate the effectiveness of the multi-band transmission color filters and the corresponding analytical method.
Multi-Layer E-Textile Circuits
Dunne, Lucy E.; Bibeau, Kaila; Mulligan, Lucie; Frith, Ashton; Simon, Cory
2012-01-01
Stitched e-textile circuits facilitate wearable, flexible, comfortable wearable technology. However, while stitched methods of e-textile circuits are common, multi-layer circuit creation remains a challenge. Here, we present methods of stitched multi-layer circuit creation using accessible tools and techniques.
Directory of Open Access Journals (Sweden)
H. Shayeghi
2017-12-01
Full Text Available This paper presents an online two-stage Q-learning based multi-agent (MA controller for load frequency control (LFC in an interconnected multi-area multi-source power system integrated with distributed energy resources (DERs. The proposed control strategy consists of two stages. The first stage is employed a PID controller which its parameters are designed using sine cosine optimization (SCO algorithm and are fixed. The second one is a reinforcement learning (RL based supplementary controller that has a flexible structure and improves the output of the first stage adaptively based on the system dynamical behavior. Due to the use of RL paradigm integrated with PID controller in this strategy, it is called RL-PID controller. The primary motivation for the integration of RL technique with PID controller is to make the existing local controllers in the industry compatible to reduce the control efforts and system costs. This novel control strategy combines the advantages of the PID controller with adaptive behavior of MA to achieve the desired level of robust performance under different kind of uncertainties caused by stochastically power generation of DERs, plant operational condition changes, and physical nonlinearities of the system. The suggested decentralized controller is composed of the autonomous intelligent agents, who learn the optimal control policy from interaction with the system. These agents update their knowledge about the system dynamics continuously to achieve a good frequency oscillation damping under various severe disturbances without any knowledge of them. It leads to an adaptive control structure to solve LFC problem in the multi-source power system with stochastic DERs. The results of RL-PID controller in comparison to the traditional PID and fuzzy-PID controllers is verified in a multi-area power system integrated with DERs through some performance indices.
Romeny, Bart M Haar
2008-01-01
Front-End Vision and Multi-Scale Image Analysis is a tutorial in multi-scale methods for computer vision and image processing. It builds on the cross fertilization between human visual perception and multi-scale computer vision (`scale-space') theory and applications. The multi-scale strategies recognized in the first stages of the human visual system are carefully examined, and taken as inspiration for the many geometric methods discussed. All chapters are written in Mathematica, a spectacular high-level language for symbolic and numerical manipulations. The book presents a new and effective
INFLUENCIA DE LA ÉPOCA DE COSECHA EN LA CALIDAD DEL LICOR DE CACAO TIPO NACIONAL
Directory of Open Access Journals (Sweden)
Milton Alexis Ruíz Pinargote
2014-12-01
Full Text Available El objetivo de esta investigación fue evaluar la influencia de las épocas de cosecha (invierno y verano sobre las características físicas, sensoriales y bromatológicas del cacao nacional perteneciente al jardín clonal de la ESPAM MFL. Los análisis se efectuaron a partir de muestras de almendras secas evaluándose porcentaje de fermentación, almendras violetas, peso de semillas y testa, sabores básicos y específicos, pH, acidez, ceniza y grasa. Los datos fueron procesados mediante la prueba de T para encontrar diferencias entre épocas usando el programa estadístico INFOSTAT versión 2008. Los resultados muestran significación estadística para la fermentación entre las épocas del año, el mayor porcentaje de fermentación obtenido fue de 96.5 % del clon EET-19 en verano, mientras que en invierno sobresalió el clon EET-103. El perfil sensorial de los sabores específicos obtuvo mayores diferencias en el sabor floral con respecto al frutal y nuez, además de los sabores básicos con niveles medios y altos entre épocas; las propiedades bromatológicas acidez y ceniza fueron parecidas entre invierno y verano; contrario al pH y grasa que varían significativamente entre épocas. Se concluye que las épocas del año influyen sobre las propiedades físicas, sensoriales y bromatológicas del cacao nacional.
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available El análisis ultraestructural de los clones taiwanés y tailandés de Dendrocalamus asper, realizado al microscopio electrónico de barrido, mostró que el clon de Taiwán tiene estomas de bajo domo en la lámina foliar, mientras que el de Tailandia tiene estomas de alto domo; las acumulaciones de cera cuticular en el clon de Taiwán son de dos formas (cuatro en el de Tailandia. La distribución de los tejidos vasculares es igual en ambos, así como los tejidos que los rodean. Sería difícil identificar estos clones por la observación macroscópica o microscópica de las brácteas del culmo, pues no presentan diferencias significativas: una identificación fiable requiere considerar la ultraestructura de los estomas y las acumulaciones de cera cuticular.An ultraestructural analysis of the Taiwan and Thailand clones of Dendrocalamus asper made with the scanning electron microscope showed that the Taiwan clone had low dome stomata while the Thailand clone has high dome stomata in the leaf lamina. Cuticular wax accumulations in the Taiwan clone has two shapes, against four in the Thailand clone. Both have the same distribution of vascular and surrounding tissues. Macroscopic or microscopic observation of culm bracts are not recommended to differentiate these clones: a reliable identification requires observation of the ultrastructure of stomata and cuticular wax accumulations. Rev. Biol. Trop. 54(Suppl. 2: 65-75. Epub 2006 Dec. 01.
About Multi-Heston SDE Discretization
Directory of Open Access Journals (Sweden)
Tiberiu Socaciu
2013-07-01
Full Text Available Abstract: in this paper we show how can estimate a financial derivative based on a support if assume for the support a Multi-Heston model.Keywords: Euler Maruyama discretization method, Monte Carlo simulation, Heston model, Double-Heston model, Multi-Heston model.
Multi-channel polarized thermal emitter
Lee, Jae-Hwang; Ho, Kai-Ming; Constant, Kristen P
2013-07-16
A multi-channel polarized thermal emitter (PTE) is presented. The multi-channel PTE can emit polarized thermal radiation without using a polarizer at normal emergence. The multi-channel PTE consists of two layers of metallic gratings on a monolithic and homogeneous metallic plate. It can be fabricated by a low-cost soft lithography technique called two-polymer microtransfer molding. The spectral positions of the mid-infrared (MIR) radiation peaks can be tuned by changing the periodicity of the gratings and the spectral separation between peaks are tuned by changing the mutual angle between the orientations of the two gratings.
Multi-agent and complex systems
Ren, Fenghui; Fujita, Katsuhide; Zhang, Minjie; Ito, Takayuki
2017-01-01
This book provides a description of advanced multi-agent and artificial intelligence technologies for the modeling and simulation of complex systems, as well as an overview of the latest scientific efforts in this field. A complex system features a large number of interacting components, whose aggregate activities are nonlinear and self-organized. A multi-agent system is a group or society of agents which interact with others cooperatively and/or competitively in order to reach their individual or common goals. Multi-agent systems are suitable for modeling and simulation of complex systems, which is difficult to accomplish using traditional computational approaches.
Herencia de la resistencia al virus del mosaico deformante del pimentón PepDMV en Capsicum
Directory of Open Access Journals (Sweden)
Mario Augusto García Dávila
2009-10-01
Full Text Available En busca de determinar el modo de herencia de la resistencia en tres materiales resistentes, se hicieron cruzamientos hacia tres líneas susceptibles. Se siguió el método del retrocruzamiento propuesto por Warner (1952 fundamentado en el modelo matemático de Fisher Immer y Tedin (1932 descrito con detalle por Mater (1949 y Jenkins (1982, 1984 en el cual se descompone la varianza genética en tres componentes: aditiva, dominancia y epistática. El modelo del retrocruzamiento incluye los dos parentales, el hibrido de la primera generación y la autofecunfación de la F1 para formar la población F2 y las retrocruzas hacia ambos padres. Las poblaciones fueron evaluadas a resistencia al virus del mosaico del pimentón PepDMV en condiciones de invernadero. Los resultados mostraron que el modelo aditivodominancia explicó la resistencia en los híbridos formados entre materiales resistentes y susceptibles. Los genes con acción heredable transmiten a la descendencia el efecto de resistencia. La ganancia de la resistencia viral se da por la presencia de parentales resistentes.
Directory of Open Access Journals (Sweden)
Samuel Mazzinghy Alvarenga
2011-08-01
Full Text Available O objetivo deste trabalho foi identificar marcadores moleculares relacionados à resistência do cafeeiro (Coffea arabica à ferrugem (Hemileia vastatrix. Foram identificadas sequências de DNA potencialmente envolvidas na resistência do cafeeiro a doenças, por meio de análise "in silico", a partir das informações geradas pelo Projeto Brasileiro do Genoma Café. A partir das sequências mineradas, foram desenhados 59 pares de iniciadores para amplificá-las. Os 59 iniciadores foram testados em 12 cafeeiros resistentes e 12 susceptíveis a H. vastatrix. Vinte e sete iniciadores resultaram em bandas únicas e bem definidas, enquanto um deles amplificou fragmento de DNA em todos os cafeeiros resistentes, mas não nos suscetíveis. Esse marcador molecular polimórfico amplificou uma região do DNA que corresponde a uma janela aberta de leitura parcial do genoma de C. arabica que codifica uma proteína de resistência a doenças. O marcador CARF 005 é capaz de diferenciar os cafeeiros analisados em resistentes e susceptíveis a H. vastatrix.
Energy Technology Data Exchange (ETDEWEB)
Chen, Li; He, Ya-Ling [Key Laboratory of Thermo-Fluid Science and Engineering of MOE, School of Energy and Power Engineering, Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Kang, Qinjun [Computational Earth Science Group (EES-16), Los Alamos National Laboratory, Los Alamos, NM (United States); Tao, Wen-Quan, E-mail: wqtao@mail.xjtu.edu.cn [Key Laboratory of Thermo-Fluid Science and Engineering of MOE, School of Energy and Power Engineering, Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China)
2013-12-15
A coupled (hybrid) simulation strategy spatially combining the finite volume method (FVM) and the lattice Boltzmann method (LBM), called CFVLBM, is developed to simulate coupled multi-scale multi-physicochemical processes. In the CFVLBM, computational domain of multi-scale problems is divided into two sub-domains, i.e., an open, free fluid region and a region filled with porous materials. The FVM and LBM are used for these two regions, respectively, with information exchanged at the interface between the two sub-domains. A general reconstruction operator (RO) is proposed to derive the distribution functions in the LBM from the corresponding macro scalar, the governing equation of which obeys the convection–diffusion equation. The CFVLBM and the RO are validated in several typical physicochemical problems and then are applied to simulate complex multi-scale coupled fluid flow, heat transfer, mass transport, and chemical reaction in a wall-coated micro reactor. The maximum ratio of the grid size between the FVM and LBM regions is explored and discussed. -- Highlights: •A coupled simulation strategy for simulating multi-scale phenomena is developed. •Finite volume method and lattice Boltzmann method are coupled. •A reconstruction operator is derived to transfer information at the sub-domains interface. •Coupled multi-scale multiple physicochemical processes in micro reactor are simulated. •Techniques to save computational resources and improve the efficiency are discussed.
Multi-symplectic Birkhoffian structure for PDEs with dissipation terms
International Nuclear Information System (INIS)
Su Hongling; Qin Mengzhao; Wang Yushun; Scherer, Rudolf
2010-01-01
A generalization of the multi-symplectic form for Hamiltonian systems to self-adjoint systems with dissipation terms is studied. These systems can be expressed as multi-symplectic Birkhoffian equations, which leads to a natural definition of Birkhoffian multi-symplectic structure. The concept of Birkhoffian multi-symplectic integrators for Birkhoffian PDEs is investigated. The Birkhoffian multi-symplectic structure is constructed by the continuous variational principle, and the Birkhoffian multi-symplectic integrator by the discrete variational principle. As an example, two Birkhoffian multi-symplectic integrators for the equation describing a linear damped string are given.
Multi-Quarks and Two-Baryon Interaction in Lattice QCD
International Nuclear Information System (INIS)
Okiharu, F.; Suganuma, H.; Takahashi, T. T.; Doi, T.
2006-01-01
We study multi-quark (3Q,4Q,5Q) systems in lattice QCD. We perform the detailed studies of multi-quark potentials in lattice QCD to clarify the inter-quark interaction in multi-quark systems. We find that all the multi-quark potentials are well described by the OGE Coulomb plus multi-Y-type linear potential, i.e., the multi-Y Ansatz. For multi-quark systems, we observe lattice QCD evidences of 'flip-flop', i.e., flux-tube recombination. These lattice QCD studies give an important bridge between elementary particle physics and nuclear physics
Multi-Photon Entanglement and Quantum Teleportation
National Research Council Canada - National Science Library
Shih, Yanhua
1999-01-01
The project 'Multi-Photon Entanglement and Quantum Teleportation' concerns a series of experimental and theoretical investigations on multi-photon entangled states and the applications, for example...
Euclidean supergravity and multi-centered solutions
Directory of Open Access Journals (Sweden)
W.A. Sabra
2017-04-01
Full Text Available In ungauged supergravity theories, the no-force condition for BPS states implies the existence of stable static multi-centered solutions. The first solutions to Einstein–Maxwell theory with a positive cosmological constant describing an arbitrary number of charged black holes were found by Kastor and Traschen. Generalisations to five and higher dimensional theories were obtained by London. Multi-centered solutions in gauged supergravity, even with time-dependence allowed, have yet to be constructed. In this letter we construct supersymmetry-preserving multi-centered solutions for the case of D=5, N=2 Euclidean gauged supergravity coupled to an arbitrary number of vector multiplets. Higher dimensional Einstein–Maxwell multi-centered solutions are also presented.
Multi-fuel multi-product operation of IGCC power plants with carbon capture and storage (CCS)
International Nuclear Information System (INIS)
Cormos, Ana-Maria; Dinca, Cristian; Cormos, Calin-Cristian
2015-01-01
This paper investigates multi-fuel multi-product operation of IGCC plants with carbon capture and storage (CCS). The investigated plant designs co-process coal with different sorts of biomass (e.g. sawdust) and solid wastes, through gasification, leading to different decarbonised energy vectors (power, hydrogen, heat, substitute natural gas etc.) simultaneous with carbon capture. Co-gasification of coal with different renewable energy sources coupled with carbon capture will pave the way towards zero emissions power plants. The energy conversions investigated in the paper were simulated using commercial process flow modelling package (ChemCAD) in order to produce mass and energy balances necessary for the proposed evaluation. As illustrative cases, hydrogen and power co-generation and Fischer–Tropsch fuel synthesis (both with carbon capture), were presented. The case studies investigated in the paper produce a flexible ratio between power and hydrogen (in the range of 400–600 MW net electricity and 0–200 MW th hydrogen considering the lower heating value) with at least 90% carbon capture rate. Special emphasis were given to fuel selection criteria for optimisation of gasification performances (fuel blending), to the selection criteria for gasification reactor in a multi-fuel multi-product operation scenario, modelling and simulation of whole process, to thermal and power integration of processes, flexibility analysis of the energy conversion processes, in-depth techno-economic and environmental assessment etc. - Highlights: • Assessment of IGCC-based energy vectors poly-generation systems with CCS. • Optimisation of gasification performances and CO 2 emissions by fuel blending. • Multi-fuel multi-product operation of gasification plants
Energy Technology Data Exchange (ETDEWEB)
Mihelj, Tea, E-mail: tmihelj@irb.hr [Ruđer Bošković Institute, Department of Physical Chemistry, Laboratory for Synthesis and Processes of Self-assembling of Organic Molecules, Bijenička c. 54, P.O. Box 180, HR-10002 Zagreb (Croatia); Popović, Jasminka [Division for Materials Physics, Ruđer Bošković Institute, POB 180, HR-10002 Zagreb (Croatia); Skoko, Željko [Department of Physics, Faculty of Science, University of Zagreb, Bijenička cesta 32, HR-10000 Zagreb (Croatia); Tomašić, Vlasta, E-mail: vlastom@irb.hr [Ruđer Bošković Institute, Department of Physical Chemistry, Laboratory for Synthesis and Processes of Self-assembling of Organic Molecules, Bijenička c. 54, P.O. Box 180, HR-10002 Zagreb (Croatia)
2014-09-10
Highlights: • Thermal behavior of quaternary ammonium n-dodecylsulfates is characterized. • Typical layered structure dominates in all examined compounds at room temperature. • The dimeric didodecylsulfate crystallizes in monoclinic space group P21/m. • Thermotropic phases formation characteristic for multi-tailed n-dodecylsulfates. • Multi-charged n-dodecylsulfates are soft crystals at higher temperatures. - Abstract: Five novel anhydrous catanionic dodecylsulfates containing multi-charged and multi-tailed quaternary ammonium centers were synthesized and examined with light microscopy, differential scanning calorimetry and X-ray powder diffraction. This study is an attempt to explain the relationship between chemical structure, molecular architecture, phase transition characteristics and thermodynamics and the nature of intermolecular interactions of the individual amphiphiles that ultimately lead to different mesomorphic product. All examined compounds are of typical layered structure at room temperature. The long spacing decreases linearly with the increase of either ionic head or n-dodecyl chain number. The thermal analysis of the examined multi-charged catanionics indicates thermotropic mesomorphism, whereas multi-tailed dodecylsulfates show only properties of soft crystals. Maltese crosses, oily streaks textures, stepped drops and fan-shaped textures affirmed the existence of various smectic mesophases at room and higher temperatures. Thermodynamically the most ordered compound is dimeric didodecylsulfate, and the most disordered is three-tailed dodecylsulfate. The addition of the new quaternary ammonium center or alkyl chain causes the increment of the lattice energy first, and it decreases by further changes in the structure. The temperatures of crystallization decrease by any mentioned addition.
Approximating multi-objective scheduling problems
Dabia, S.; Talbi, El-Ghazali; Woensel, van T.; Kok, de A.G.
2013-01-01
In many practical situations, decisions are multi-objective by nature. In this paper, we propose a generic approach to deal with multi-objective scheduling problems (MOSPs). The aim is to determine the set of Pareto solutions that represent the interactions between the different objectives. Due to
Multi codes and multi-scale analysis for void fraction prediction in hot channel for VVER-1000/V392
International Nuclear Information System (INIS)
Hoang Minh Giang; Hoang Tan Hung; Nguyen Huu Tiep
2015-01-01
Recently, an approach of multi codes and multi-scale analysis is widely applied to study core thermal hydraulic behavior such as void fraction prediction. Better results are achieved by using multi codes or coupling codes such as PARCS and RELAP5. The advantage of multi-scale analysis is zooming of the interested part in the simulated domain for detail investigation. Therefore, in this study, the multi codes between MCNP5, RELAP5, CTF and also the multi-scale analysis based RELAP5 and CTF are applied to investigate void fraction in hot channel of VVER-1000/V392 reactor. Since VVER-1000/V392 reactor is a typical advanced reactor that can be considered as the base to develop later VVER-1200 reactor, then understanding core behavior in transient conditions is necessary in order to investigate VVER technology. It is shown that the item of near wall boiling, Γ w in RELAP5 proposed by Lahey mechanistic method may not give enough accuracy of void fraction prediction as smaller scale code as CTF. (author)
Directory of Open Access Journals (Sweden)
Micheli Satomi Yamauti
2010-09-01
Full Text Available Estudos foram conduzidos na Estação Experimental de Citricultura de Bebedouro, SP para avaliar a resposta de biótipos de buva resistentes aos herbicidas glyphosate, bromacil + diuron, diuron e paraquat isolados e em mistura, e o efeito de uma aplicação seqüencial com glyphosate. O delineamento foi o de blocos casualizados com quatro repetições e sete tratamentos.. Os herbicidas foram aplicados com pulverizador costal, à pressão constante (mantido por CO2 comprimido, munido com barra com três bicos do tipo TT110015 com um consumo de calda equivalente a 150 L ha-1. O controle foi avaliado visualmente, através de escala percentual de notas. Para o controle geral das plantas daninhas os melhores resultados foram obtidos com diuron isolado e com glyphosate em mistura com bromacil + diuron, enquanto para o controle da buva não houve diferença entre os tratamentos. Depois da aplicação seqüencial, o melhor tratamento para o controle de buva foi com diuron e bromacil+diuron.Studies were conducted at Estação Experimental de Citricultura de Bebedouro, SP to evaluate the response of glyphosate-resistant horseweed and hairy fleabane biotypes to herbicides glyphosate, bromacil + diuron, diuron e paraquat isolated and in mixture and effect of a sequential application of glyphosate. The experimental design was of complete randomized blocks with four replication and seven treatments. The herbicides were applied with costal sprayer, constant pressure with three nozzles TT110015, the equivalent spray volume was 150 L ha-1. The control was visually evaluated, trough percentile note scale. The best results were obtained to general control of weed with diuron isolated and glyphosate in mixture with bromacil + diuron while to glyphosate-resistant horseweed and hairy fleabane there was no difference between the treatments. After sequential application to Conyza sp control, the best treatment was obtained associated with diuron and bromacil+diuron.
Subagadis, Y. H.; Schütze, N.; Grundmann, J.
2014-09-01
The conventional methods used to solve multi-criteria multi-stakeholder problems are less strongly formulated, as they normally incorporate only homogeneous information at a time and suggest aggregating objectives of different decision-makers avoiding water-society interactions. In this contribution, Multi-Criteria Group Decision Analysis (MCGDA) using a fuzzy-stochastic approach has been proposed to rank a set of alternatives in water management decisions incorporating heterogeneous information under uncertainty. The decision making framework takes hydrologically, environmentally, and socio-economically motivated conflicting objectives into consideration. The criteria related to the performance of the physical system are optimized using multi-criteria simulation-based optimization, and fuzzy linguistic quantifiers have been used to evaluate subjective criteria and to assess stakeholders' degree of optimism. The proposed methodology is applied to find effective and robust intervention strategies for the management of a coastal hydrosystem affected by saltwater intrusion due to excessive groundwater extraction for irrigated agriculture and municipal use. Preliminary results show that the MCGDA based on a fuzzy-stochastic approach gives useful support for robust decision-making and is sensitive to the decision makers' degree of optimism.
Derivation of optimal joint operating rules for multi-purpose multi-reservoir water-supply system
Tan, Qiao-feng; Wang, Xu; Wang, Hao; Wang, Chao; Lei, Xiao-hui; Xiong, Yi-song; Zhang, Wei
2017-08-01
The derivation of joint operating policy is a challenging task for a multi-purpose multi-reservoir system. This study proposed an aggregation-decomposition model to guide the joint operation of multi-purpose multi-reservoir system, including: (1) an aggregated model based on the improved hedging rule to ensure the long-term water-supply operating benefit; (2) a decomposed model to allocate the limited release to individual reservoirs for the purpose of maximizing the total profit of the facing period; and (3) a double-layer simulation-based optimization model to obtain the optimal time-varying hedging rules using the non-dominated sorting genetic algorithm II, whose objectives were to minimize maximum water deficit and maximize water supply reliability. The water-supply system of Li River in Guangxi Province, China, was selected for the case study. The results show that the operating policy proposed in this study is better than conventional operating rules and aggregated standard operating policy for both water supply and hydropower generation due to the use of hedging mechanism and effective coordination among multiple objectives.
Griffin, Brian Joseph; Burken, John J.; Xargay, Enric
2010-01-01
This paper presents an L(sub 1) adaptive control augmentation system design for multi-input multi-output nonlinear systems in the presence of unmatched uncertainties which may exhibit significant cross-coupling effects. A piecewise continuous adaptive law is adopted and extended for applicability to multi-input multi-output systems that explicitly compensates for dynamic cross-coupling. In addition, explicit use of high-fidelity actuator models are added to the L1 architecture to reduce uncertainties in the system. The L(sub 1) multi-input multi-output adaptive control architecture is applied to the X-29 lateral/directional dynamics and results are evaluated against a similar single-input single-output design approach.
Unified Multi-Layer among Software Defined Multi-Domain Optical Networks (Invited
Directory of Open Access Journals (Sweden)
Hui Yang
2015-06-01
Full Text Available The software defined networking (SDN enabled by OpenFlow protocol has gained popularity which can enable the network to be programmable and accommodate both fixed and flexible bandwidth services. In this paper, we present a unified multi-layer (UML architecture with multiple controllers and a dynamic orchestra plane (DOP for software defined multi-domain optical networks. The proposed architecture can shield the differences among various optical devices from multi-vendors and the details of connecting heterogeneous networks. The cross-domain services with on-demand bandwidth can be deployed via unified interfaces provided by the dynamic orchestra plane. Additionally, the globalization strategy and practical capture of signal processing are presented based on the architecture. The overall feasibility and efficiency of the proposed architecture is experimentally verified on the control plane of our OpenFlow-based testbed. The performance of globalization strategy under heavy traffic load scenario is also quantitatively evaluated based on UML architecture compared with other strategies in terms of blocking probability, average hops, and average resource consumption.
Directory of Open Access Journals (Sweden)
Robert Eckardt
2013-06-01
Full Text Available This study presents a method for the reconstruction of pixels contaminated by optical thick clouds in multi-spectral Landsat images using multi-frequency SAR data. A number of reconstruction techniques have already been proposed in the scientific literature. However, all of the existing techniques have certain limitations. In order to overcome these limitations, we expose the Closest Spectral Fit (CSF method proposed by Meng et al. to a new, synergistic approach using optical and SAR data. Therefore, the term Closest Feature Vector (CFV is introduced. The technique facilitates an elegant way to avoid radiometric distortions in the course of image reconstruction. Furthermore the cloud cover removal is independent from underlying land cover types and assumptions on seasonality, etc. The methodology is applied to mono-temporal, multi-frequency SAR data from TerraSAR-X (X-Band, ERS (C-Band and ALOS Palsar (L-Band. This represents a way of thinking about Radar data not as foreign, but as additional data source in multi-spectral remote sensing. For the assessment of the image restoration performance, an experimental framework is established and a statistical evaluation protocol is designed. The results show the potential of a synergistic usage of multi-spectral and SAR data to overcome the loss of data due to cloud cover.
Multi-Agent Systems for E-Commerce
Solodukha, T. V.; Sosnovskiy, O. A.; Zhelezko, B. A.
2009-01-01
The article focuses on multi-agent systems (MAS) and domains that can benefit from multi-agent technology. In the last few years, the agent based modeling (ABM) community has developed several practical agent based modeling toolkits that enable individuals to develop agent-based applications. The comparison of agent-based modeling toolkits is given. Multi-agent systems are designed to handle changing and dynamic business processes. Any organization with complex and distributed business pro...
MTCB: A Multi-Tenant Customizable database Benchmark
van der Zijden, WIm; Hiemstra, Djoerd; van Keulen, Maurice
2017-01-01
We argue that there is a need for Multi-Tenant Customizable OLTP systems. Such systems need a Multi-Tenant Customizable Database (MTC-DB) as a backing. To stimulate the development of such databases, we propose the benchmark MTCB. Benchmarks for OLTP exist and multi-tenant benchmarks exist, but no
Fairness in multi-agent systems
Jong, de S.; Tuyls, K.P.; Verbeeck, K.
2008-01-01
Multi-agent systems are complex systems in which multiple autonomous entities, called agents, cooperate in order to achieve a common or personal goal. These entities may be computer software, robots, and also humans. In fact, many multi-agent systems are intended to operate in cooperation with or as
Zhang, Yanpeng
2009-01-01
"Multi-Wave Mixing Processes - From Ultrafast Polarization Beats to Electromagnetically Induced Transparency" discusses the interactions of efficient multi-wave mixing (MWM) processes enhanced by atomic coherence in multilevel atomic systems. It covers topics in five major areas: attosecond and femtosecond polarization beats of four-wave mixing (FWM) processes; heterodyne detection of FWM, six-wave mixing (SWM) and eight-wave mixing (EWM) processes; Raman and Rayleigh enhanced polarization beats; coexistence and interactions of MWM processes via electromagnetically induced transparency(EIT); multi-dressing MWM processes. The book is intended for researchers, advanced undergraduate and graduate students in Nonlinear Optics. Dr. Yanpeng Zhang is a professor at the Key Laboratory for Physical Electronics and Devices of the Ministry of Education, Xi'an Jiaotong University. Dr. Min Xiao is a professor of Physics at University of Arkansas, Fayetteville, U.S.A.
Brutti, Cristina B.; Sánchez, Marcela I.; Caso, Osvaldo H.
1984-01-01
p.65-70 Se estudió la respuesta de Fragaria x ananassa (2n igual a 8x) cv. Brighton, de día netro (refloreciente) y cv. Douglas, de día corto, y de F. virginiana clon UC11 (2n igual 8x), de día corto, a distintas citocininas: 6- (4 - hidroxi - 3 metilbuí - 2 - txans - enilamino) purina (Z), 6 - (? -? - dimetil - alil - amimo) purina (2ip), 6 - bencilaminopurina (BAP) y 6 - furfurilaminopurina (Kin), mediante el cultivo in vitro de ápices caulinares. Se empleó el medio básico de Boxus (1974...
El sistema de señalización de la reelina en la homeostasis y en la inflamación del colon
Carvajal Vázquez, Ana Eloisa
2016-01-01
En 1951, Falconer describió por primera vez un tipo de ratones mutantes espontáneos a los que denominó reeler, los cuales presentaban una mutación autosómica recesiva que les provocaba anormalidades arquitectónicas severas en la corteza cerebral. En 1995 se clonó el gen que codifica la Reelina y se descubrió que el ratón “reeler” no expresaba Reelina (D’Arcangelo y cols., 1995). La Reelina es una glicoproteína de la matriz extracelular de gran tamaño (420 KDalton) fundamental para la regul...
Dicty_cDB: Contig-U14355-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available lkiii*iwl *ly*iiivk*ipmklipliqkvihhyimpyslnvlikfsciy*ikrkyvlenviwmvihh fiisvknsnhqnvre*fkp*lkkvqiltnkiim...AQ046505 ) RPCI11-42E14.TJ RPCI-11 Homo sapiens genomic clon... 46 1.5 1 ( EJ349319 ) 1092963571972 Global-Ocean-Sampli...655( CP000236 |pid:none) Ehrlichia chaffeensis str. Arkan... 46 0.001 DQ058898_1( DQ058898 |pid:none) Nasutitermes graveolus reli...041156664 Global-Ocean-Sampling_GS-34-01-01-1... 48 0.37 1 ( EJ247332 ) 1095337027578 Global-Ocean-Sampling_...ry Neovison vison ... 46 1.5 1 ( ER388657 ) 1094428746559 Global-Ocean-Sampling_GS-34-01-01-1... 46 1.5 1 (
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven
Garcia, Emilia; Botti, Vicente
2015-01-01
Addressing the open problem of engineering normative open systems using the multi-agent paradigm, normative open systems are explained as systems in which heterogeneous and autonomous entities and institutions coexist in a complex social and legal framework that can evolve to address the different and often conflicting objectives of the many stakeholders involved. Presenting a software engineering approach which covers both the analysis and design of these kinds of systems, and which deals with the open issues in the area, ROMAS (Regulated Open Multi-Agent Systems) defines a specific multi-agent architecture, meta-model, methodology and CASE tool. This CASE tool is based on Model-Driven technology and integrates the graphical design with the formal verification of some properties of these systems by means of model checking techniques. Utilizing tables to enhance reader insights into the most important requirements for designing normative open multi-agent systems, the book also provides a detailed and easy t...
A Container-based Trusted Multi-level Security Mechanism
Directory of Open Access Journals (Sweden)
Li Xiao-Yong
2017-01-01
Full Text Available Multi-level security mechanism has been widely applied in the military, government, defense and other domains in which information is required to be divided by security-level. Through this type of security mechanism, users at different security levels are provided with information at corresponding security levels. Traditional multi-level security mechanism which depends on the safety of operating system finally proved to be not practical. We propose a container-based trusted multi-level security mechanism in this paper to improve the applicability of the multi-level mechanism. It guarantees multi-level security of the system through a set of multi-level security policy rules and trusted techniques. The technical feasibility and application scenarios are also discussed. The ease of realization, strong practical significance and low cost of our method will largely expand the application of multi-level security mechanism in real life.
Multi-level predictive maintenance for multi-component systems
International Nuclear Information System (INIS)
Nguyen, Kim-Anh; Do, Phuc; Grall, Antoine
2015-01-01
In this paper, a novel predictive maintenance policy with multi-level decision-making is proposed for multi-component system with complex structure. The main idea is to propose a decision-making process considered on two levels: system level and component one. The goal of the decision rules at the system level is to address if preventive maintenance actions are needed regarding the predictive reliability of the system. At component level the decision rules aim at identifying optimally a group of several components to be preventively maintained when preventive maintenance is trigged due to the system level decision. Selecting optimal components is based on a cost-based group improvement factor taking into account the predictive reliability of the components, the economic dependencies as well as the location of the components in the system. Moreover, a cost model is developed to find the optimal maintenance decision variables. A 14-component system is finally introduced to illustrate the use and the performance of the proposed predictive maintenance policy. Different sensitivity analysis are also investigated and discussed. Indeed, the proposed policy provides more flexibility in maintenance decision-making for complex structure systems, hence leading to significant profits in terms of maintenance cost when compared with existing policies. - Highlights: • A predictive maintenance policy for complex structure systems is proposed. • Multi-level decision process based on prognostic results is proposed. • A cost-based group importance measure is introduced for decision-making. • Both positive and negative dependencies between components are investigated. • A cost model and Monte Carlo simulation are developed for optimization process.
Project Management – Multi-perspective Leadership
DEFF Research Database (Denmark)
Riis, Eva
2014-01-01
”Project Management – Multi-perspective Leadership” af Hans Mikkelsen og Jens Ove Riis - anmeldelse......”Project Management – Multi-perspective Leadership” af Hans Mikkelsen og Jens Ove Riis - anmeldelse...
Then Fandango Complex in the Spanish Atlantic: a Panoramic View
Directory of Open Access Journals (Sweden)
Peter Manuel
2015-01-01
Full Text Available Así como las formas andaluzas más conocidas del fandango muestran ciertos rasgos musicales distintivos, que pueden servir para vincular estos subgéneros, histórica y estructuralmente, a grupos mucho más amplios de las familias musicales transatlánticas, como el fandango popular y el semiclásico del siglo XVIII, géneros anteriores como la zarabanda y la chacona, la amplia familia de patrón ternario de la cuenca del Caribe, además de otros géneros andinos y sudamericanos. Mientras tanto, existen diferencias claras entre el complejo del fandango y otras familias importantes en el Atlántico español.
Nuevos inmigrantes en Chile: Los determinantes de su actividad emprendedora
Directory of Open Access Journals (Sweden)
Claudio MANCILLA
2014-01-01
Full Text Available En Chile es poca la literatura que estudia a los inmigrantes desde una perspectiva económica, y menos la que aborda su actitud emprendedora (a pesar de que son proporcionalmente más emprendedores que los habitantes locales. El objetivo de este trabajo es estudiar los factores que influyen en el emprendimiento de los in - migrantes sudamericanos en Chile. Se utilizó un modelo logit ajustado para even - tos extraños para determinar el impacto sobre la probabilidad de emprendimiento individual. Algunos resultados indican que el tiempo de residencia, forma legal de ingreso al país, nivel educacional y experiencia previa de emprendimiento, influyen en la probabilidad de crear una actividad empresarial.
Directory of Open Access Journals (Sweden)
Valmir Luiz de Souza
2006-09-01
Full Text Available Curtobacterium flaccumfaciens pv. flaccumfaciens (Cff agente causal da murcha-de-curtobacterium em feijoeiro (Phaseolus vulgaris, é um patógeno vascular de difícil controle. A doença foi detectada pela primeira vez no Brasil na safra das águas de 1995, no Estado de São Paulo. Por se tratar de uma doença de difícil controle, a resistência genética tem sido a melhor opção. O objetivo deste trabalho foi avaliar a reação de genótipos de feijoeiro à murcha-de-curtobacterium, frente a 333 acessos pertencentes ao banco de germoplasma de feijoeiro do Instituto Agronômico de Campinas (IAC. Oportunamente, foram selecionados genótipos de feijoeiro altamente resistentes e suscetíveis, com a finalidade de comparar a colonização de Cff no vaso do xilema a partir da visualização sob microscopia eletrônica de varredura. Os resultados da triagem da resistência genética em genótipos de feijoeiro indicaram a existência de variabilidade genética nas amostras dos 333 genótipos avaliados, ao isolado de Cff Feij 2634. Os materiais foram classificados em 4 grupos de resistência: 29 genótipos (8,7% comportaram-se como altamente resistentes, 13 genótipos (3,9% como resistentes, 18 genótipos (5% como moderadamente resistentes e 273 genótipos (81% suscetíveis. A partir dos resultados obtidos, cerca de 18% dos genótipos de feijoeiros, desde altamente resistentes à moderadamente resistentes, poderão ser úteis para o programa de melhoramento genético como fonte de genes para resistência a Cff. Através da microscopia eletrônica de varredura, foram observadas em genótipos altamente resistentes, várias aglutinações da bactéria envolvidas por filamentos e estruturas rendilhadas sob pontuações da parede do vaso do xilema, não verificados em genótipos suscetíveis, o que sugere a ativação de mecanismos de defesa estruturais e bioquímicos nas plantas resistentes.Curtobacterium flaccumfaciens pv. flaccumfaciens (Cff, the causal
Multi-Level Secure Local Area Network
Naval Postgraduate School (U.S.); Center for Information Systems Studies Security and Research (CISR)
2011-01-01
Multi-Level Secure Local Area Network is a cost effective, multi-level, easy to use office environment leveraging existing high assurance technology. The Department of Defense and U.S. Government have an identified need to securely share information classified at differing security levels. Because there exist no commercial solutions to this problem, NPS is developing a MLS LAN. The MLS LAN extends high assurance capabilities of an evaluated multi-level secure system to commercial personal com...
Directory of Open Access Journals (Sweden)
Ildeu de Souza
2010-03-01
Full Text Available Com o objetivo de avaliar o plantio irrigado de bananeiras resistentes à Sigatoka-negra consorciado com cultura anuais, na região norte de Minas Gerais, um experimento foi instalado na Fazenda Experimental do Departamento de Ciências Agrárias da Universidade Estadual de Montes Claros, Câmpus de Janaúba-MG. O experimento foi conduzido no período de abril de 2006 a julho de 2007, delineado em blocos casualizados, segundo um esquema de parcelas subdivididas 3 x 5, tendo na parcela as três variedades de bananeiras: Pacovan Ken, Caipira e Thap Maeo, e na subparcela quatro culturas intercalares: Feijão-Pérola, Quiabo-Dardo, Melancia-Crimson-Sweet e Feijão-Caupi, e a testemunha (sem cultura intercalar, com três repetições. Ao todo, foram 756 bananeiras, em 45 parcelas, com 6 plantas úteis cada, constituindo a cultura principal. As culturas intercalares ocuparam as entrelinhas da bananeira, tanto aquelas com as linhas de irrigação como sem linha de irrigação. O plantio da bananeira e das culturas intercalares foi feito no mesmo período, utilizando-se do espaçamento de 3,0 m entre as linhas e 2,0 m entre as covas de bananeira, com microaspersores espaçados de 6 m. Avaliaram-se as características vegetativas e reprodutivas das variedades de bananeiras, no primeiro ciclo. Não foi observado efeito significativo dos cultivos intercalares sobre as variedades de bananeiras, com exceção do número de dias do plantio ao florescimento e do número de dias do plantio à colheita das variedades de bananeiras. O uso do feijão-caupi promoveu atraso no ciclo de produção das três variedades de bananeiras Pacovan Ken, Caipira e Thap Maeo.To assess the irrigated cultivation of banana resistant to black Sigatoka, intercropped with annual crops in the northern region of Minas Gerais, a trial was conducted on an experimental farm of the Universidade Estadual de Montes Claros, in Janaúba-MG. The experiment was carried out from April 2006 to
Directory of Open Access Journals (Sweden)
Aleksandras Chlebnikovas
2015-10-01
Full Text Available Multi-level multi-channel cyclone – the lately designed air cleaning device that can remove ultra-fine 20 μm particulatematter (PM from dusted air and reach over 95% of the overall cleaning efficiency. Multi-channel cyclone technology is based on centrifugal forces and has the resulting additional filtering process operation. Multi-level structure of cyclone allows to achieve higher air flow cleaning capacity at the same dimensions of the device, thus saving installation space required for the job, production and operating costs. Studies have examined the air flow parameters change in one–, two– and three–levels multichannel cyclone. These constructions differ according to the productivity of cleaned air under the constant peripheral and transitional (50/50 case air flow relations. Accordance with the results of air flow dynamics – velocity distribution of multi-channel cyclone, aerodynamic resistance and efficiency can be judged on the flow turbulence, the flow channel cross-section and select the most appropriate application. Cleaning efficiency studies were carried out using fine granite and wood ashes PM. The maximum cleaning efficiency was 93.3%, at an average of 4.5 g/m3, the aerodynamic resistance was equal to 1525 Pa.
Development of MARS for multi-dimensional and multi-purpose thermal-hydraulic system analysis
Energy Technology Data Exchange (ETDEWEB)
Lee, Won Jae; Chung, Bub Dong; Kim, Kyung Doo; Hwang, Moon Kyu; Jeong, Jae Jun; Ha, Kwi Seok; Joo, Han Gyu [Korea Atomic Energy Research Institute, T/H Safety Research Team, Yusung, Daejeon (Korea)
2000-10-01
MARS (Multi-dimensional Analysis of Reactor Safety) code is being developed by KAERI for the realistic thermal-hydraulic simulation of light water reactor system transients. MARS 1.4 has been developed as a final version of basic code frame for the multi-dimensional analysis of system thermal-hydraulics. Since MARS 1.3, MARS 1.4 has been improved to have the enhanced code capability and user friendliness through the unification of input/output features, code models and code functions, and through the code modernization. Further improvements of thermal-hydraulic models, numerical method and user friendliness are being carried out for the enhanced code accuracy. As a multi-purpose safety analysis code system, a coupled analysis system, MARS/MASTER/CONTEMPT, has been developed using multiple DLL (Dynamic Link Library) techniques of Windows system. This code system enables the coupled, that is, more realistic analysis of multi-dimensional thermal-hydraulics (MARS 2.0), three-dimensional core kinetics (MASTER) and containment thermal-hydraulics (CONTEMPT). This paper discusses the MARS development program, and the developmental progress of the MARS 1.4 and the MARS/MASTER/CONTEMPT focusing on major features of the codes and their verification. It also discusses thermal hydraulic models and new code features under development. (author)
Development of MARS for multi-dimensional and multi-purpose thermal-hydraulic system analysis
International Nuclear Information System (INIS)
Lee, Won Jae; Chung, Bub Dong; Kim, Kyung Doo; Hwang, Moon Kyu; Jeong, Jae Jun; Ha, Kwi Seok; Joo, Han Gyu
2000-01-01
MARS (Multi-dimensional Analysis of Reactor Safety) code is being developed by KAERI for the realistic thermal-hydraulic simulation of light water reactor system transients. MARS 1.4 has been developed as a final version of basic code frame for the multi-dimensional analysis of system thermal-hydraulics. Since MARS 1.3, MARS 1.4 has been improved to have the enhanced code capability and user friendliness through the unification of input/output features, code models and code functions, and through the code modernization. Further improvements of thermal-hydraulic models, numerical method and user friendliness are being carried out for the enhanced code accuracy. As a multi-purpose safety analysis code system, a coupled analysis system, MARS/MASTER/CONTEMPT, has been developed using multiple DLL (Dynamic Link Library) techniques of Windows system. This code system enables the coupled, that is, more realistic analysis of multi-dimensional thermal-hydraulics (MARS 2.0), three-dimensional core kinetics (MASTER) and containment thermal-hydraulics (CONTEMPT). This paper discusses the MARS development program, and the developmental progress of the MARS 1.4 and the MARS/MASTER/CONTEMPT focusing on major features of the codes and their verification. It also discusses thermal hydraulic models and new code features under development. (author)
Multi-Device to Multi-Device (MD2MD Content-Centric Networking Based on Multi-RAT Device
Directory of Open Access Journals (Sweden)
Cheolhoon Kim
2017-11-01
Full Text Available This paper proposes a method whereby a device can transmit and receive information using a beacon, and also describes application scenarios for the proposed method. In a multi-device to multi-device (MD2MD content-centric networking (CCN environment, the main issue involves searching for and connecting to nearby devices. However, if a device can’t find another device that satisfies its requirements, the connection is delayed due to the repetition of processes. It is possible to rapidly connect to a device without repetition through the selection of the optimal device using the proposed method. Consequently, the proposed method and scenarios are advantageous in that they enable efficient content identification and delivery in a content-centric Internet of Things (IoT environment, in which multiple mobile devices coexist.
Dong, Yingying; Luo, Ruisen; Feng, Haikuan; Wang, Jihua; Zhao, Jinling; Zhu, Yining; Yang, Guijun
2014-01-01
Differences exist among analysis results of agriculture monitoring and crop production based on remote sensing observations, which are obtained at different spatial scales from multiple remote sensors in same time period, and processed by same algorithms, models or methods. These differences can be mainly quantitatively described from three aspects, i.e. multiple remote sensing observations, crop parameters estimation models, and spatial scale effects of surface parameters. Our research proposed a new method to analyse and correct the differences between multi-source and multi-scale spatial remote sensing surface reflectance datasets, aiming to provide references for further studies in agricultural application with multiple remotely sensed observations from different sources. The new method was constructed on the basis of physical and mathematical properties of multi-source and multi-scale reflectance datasets. Theories of statistics were involved to extract statistical characteristics of multiple surface reflectance datasets, and further quantitatively analyse spatial variations of these characteristics at multiple spatial scales. Then, taking the surface reflectance at small spatial scale as the baseline data, theories of Gaussian distribution were selected for multiple surface reflectance datasets correction based on the above obtained physical characteristics and mathematical distribution properties, and their spatial variations. This proposed method was verified by two sets of multiple satellite images, which were obtained in two experimental fields located in Inner Mongolia and Beijing, China with different degrees of homogeneity of underlying surfaces. Experimental results indicate that differences of surface reflectance datasets at multiple spatial scales could be effectively corrected over non-homogeneous underlying surfaces, which provide database for further multi-source and multi-scale crop growth monitoring and yield prediction, and their corresponding
Wei, Y.; Barradas Berglind, J.J; van Rooij, M.; Prins, WA; Jayawardhana, B.; Vakis, A. I.
2017-01-01
In this work, a numerical model is developed in order to investigate the adaptability of the multi-pump multi-piston power take-off ((MPPTO)-P-2) system of a novel wave energy converter (WEC). This model is realized in the MATLAB/SIMULINK environment, using the multi-body dynamics solver Multibody
Directory of Open Access Journals (Sweden)
Elaine Drehmer de Almeida Cruz
2011-02-01
Full Text Available This study assessed the prevalence of colonization by Staphylococcus aureus in hospital housekeepers, and their knowledge and beliefs regarding this problem. Three saliva samples were collected and a questionnaire regarding knowledge and beliefs was applied. Of the 92 workers, 63 (68.5% participated in the study; 20 were not and 43 were colonized; 13 by methicillin resistant Staphylococcus aureus and 30 by methicillin sensitive Staphylococcus aureus. Persistent carrier status of methicillin resistant Staphylococcus aureus was detected in 15.4% of cases. Low knowledge and perception of occupational risk were observed. The mouth was identified as an important reservoir of methicillin resistant Staphylococcus aureus. Analyzing knowledge and beliefs, as well as the state of carrier, is an important strategy to be added to educational actions for the prevention of workers' colonization.Este estudio evaluó la prevalencia de la colonización por Staphylococcus aureus en trabajadores de limpieza hospitalaria, y su conocimiento y creencias acerca de la problemática. Fueron recolectadas tres muestras de saliva y aplicado un cuestionario referente al conocimiento y creencias. De 92 trabajadores, 63 (68,5% participaron del estudio; 20 se presentaron no colonizados y 43 colonizados; 13 para Staphylococcus aureus resistente a la meticilina y 30 para Staphylococcus aureus sensibles a la meticilina. El estado de portador persistente por Staphylococcus aureus resistente a la meticilina fue detectado en 15,4% de los casos. Bajo conocimiento y percepción del riesgo ocupacional fueron observados. La boca fue identificada como importante reservatorio de Staphylococcus aureus resistente a la meticilina. Analizar el conocimiento y creencias juntamente con la investigación del estado de portador es una importante estrategia a ser agregada a las acciones educativas para la prevención de la colonización de trabajadores.Este estudo avaliou a prevalência da coloniza
Kouramas, K.I.
2011-08-01
This work presents a new algorithm for solving the explicit/multi- parametric model predictive control (or mp-MPC) problem for linear, time-invariant discrete-time systems, based on dynamic programming and multi-parametric programming techniques. The algorithm features two key steps: (i) a dynamic programming step, in which the mp-MPC problem is decomposed into a set of smaller subproblems in which only the current control, state variables, and constraints are considered, and (ii) a multi-parametric programming step, in which each subproblem is solved as a convex multi-parametric programming problem, to derive the control variables as an explicit function of the states. The key feature of the proposed method is that it overcomes potential limitations of previous methods for solving multi-parametric programming problems with dynamic programming, such as the need for global optimization for each subproblem of the dynamic programming step. © 2011 Elsevier Ltd. All rights reserved.
Multi-disciplinary decision making in general practice.
Kirby, Ann; Murphy, Aileen; Bradley, Colin
2018-04-09
Purpose Internationally, healthcare systems are moving towards delivering care in an integrated manner which advocates a multi-disciplinary approach to decision making. Such an approach is formally encouraged in the management of Atrial Fibrillation patients through the European Society of Cardiology guidelines. Since the emergence of new oral anticoagulants switching between oral anticoagulants (OACs) has become prevalent. This case study considers the role of multi-disciplinary decision making, given the complex nature of the agents. The purpose of this paper is to explore Irish General Practitioners' (GPs) experience of switching between all OACs for Arial Fibrillation (AF) patients; prevalence of multi-disciplinary decision making in OAC switching decisions and seeks to determine the GP characteristics that appear to influence the likelihood of multi-disciplinary decision making. Design/methodology/approach A probit model is used to determine the factors influencing multi-disciplinary decision making and a multinomial logit is used to examine the factors influencing who is involved in the multi-disciplinary decisions. Findings Results reveal that while some multi-disciplinary decision-making is occurring (64 per cent), it is not standard practice despite international guidelines on integrated care. Moreover, there is a lack of patient participation in the decision-making process. Female GPs and GPs who have initiated prescriptions for OACs are more likely to engage in multi-disciplinary decision-making surrounding switching OACs amongst AF patients. GPs with training practices were less likely to engage with cardiac consultants and those in urban areas were more likely to engage with other (non-cardiac) consultants. Originality/value For optimal decision making under uncertainty multi-disciplinary decision-making is needed to make a more informed judgement and to improve treatment decisions and reduce the opportunity cost of making the wrong decision.
Directory of Open Access Journals (Sweden)
Juan E. Valencia
2014-06-01
Full Text Available Objetivo: Mediante la adaptación a Colombia del modelo realizado por BresMed y previo análisis de transferibilidad, se realizó un análisis de costo-efectividad del tratamiento de denervación renal vs. mejor tratamiento estándar en el control de la hipertensión resistente y los eventos cardiovasculares relacionados. Métodos: Se construyó un modelo de Markov con 32 estados de salud y siete resultados finales: accidente cerebrovascular, infarto del miocardio, enfermedad coronaria, falla cardiaca, enfermedad renal crónica terminal, mortalidad cardiovascular y muerte. Se consideró un horizonte de toda la vida, la perspectiva desde el pagador y una tasa de descuento del 3%. Para el cálculo de las probabilidades de sufrir eventos se utilizaron las ecuaciones de riesgo de Framingham y las efectividades se tomaron del estudio clínico SYMPLICITY HTN-2. Los costos se extrajeron del entorno local y las tasas de mortalidad del Observatorio global de salud de la Organización Mundial de la Salud. Los resultados incluyeron los costos de cada alternativa de tratamiento, así como los años de vida ajustados a calidad ganados. Se realizaron análisis determinístico y probabilístico. Resultados: El tratamiento de denervación renal produjo 12,48 años de vida ajustados a calidad ganados a un costo de US $46.509 vs. 11,68 años de vida ajustados a calidad ganados del mejor tratamiento estándar a un costo de US $41.199, con un costo incremental por años de vida ajustados a calidad ganados de US $6.612. Tanto el análisis de sensibilidad univariado como el probabilístico, mostraron la robustez de los resultados. Conclusiones: El tratamiento de denervación renal, con un costo incremental por años de vida ajustados a calidad ganados de $6.612, muy por debajo de 1 PIB per cápita de Colombia, mostró ser altamente costo-efectivo.
International Nuclear Information System (INIS)
Si, S.
2012-01-01
The Universal Algorithm of Stiffness Confinement Method (UASCM) for neutron kinetics model of multi-dimensional and multi-group transport equations or diffusion equations has been developed. The numerical experiments based on transport theory code MGSNM and diffusion theory code MGNEM have demonstrated that the algorithm has sufficient accuracy and stability. (authors)
International Nuclear Information System (INIS)
Longo, R; Vanlanduit, S; Guillaume, P
2013-01-01
In this paper a multi-input multi-output approach able to determine the material properties of homogeneous materials is presented. To do so, an experimental set-up which combines the use of multi harmonic signals with interleaved frequencies and laser Doppler vibrometer measurements has been developed. A modeling technique, based on transmission and reflection measurements, allowed the simultaneous determination of longitudinal wave velocity, density and thickness of the materials under test with high levels of precision and accuracy. (paper)
Digital fabrication of multi-material biomedical objects
Energy Technology Data Exchange (ETDEWEB)
Cheung, H H; Choi, S H, E-mail: shchoi@hku.h [Department of Industrial and Manufacturing Systems Engineering, University of Hong Kong, Pokfulam Road (Hong Kong)
2009-12-15
This paper describes a multi-material virtual prototyping (MMVP) system for modelling and digital fabrication of discrete and functionally graded multi-material objects for biomedical applications. The MMVP system consists of a DMMVP module, an FGMVP module and a virtual reality (VR) simulation module. The DMMVP module is used to model discrete multi-material (DMM) objects, while the FGMVP module is for functionally graded multi-material (FGM) objects. The VR simulation module integrates these two modules to perform digital fabrication of multi-material objects, which can be subsequently visualized and analysed in a virtual environment to optimize MMLM processes for fabrication of product prototypes. Using the MMVP system, two biomedical objects, including a DMM human spine and an FGM intervertebral disc spacer are modelled and digitally fabricated for visualization and analysis in a VR environment. These studies show that the MMVP system is a practical tool for modelling, visualization, and subsequent fabrication of biomedical objects of discrete and functionally graded multi-materials for biomedical applications. The system may be adapted to control MMLM machines with appropriate hardware for physical fabrication of biomedical objects.
Digital fabrication of multi-material biomedical objects
International Nuclear Information System (INIS)
Cheung, H H; Choi, S H
2009-01-01
This paper describes a multi-material virtual prototyping (MMVP) system for modelling and digital fabrication of discrete and functionally graded multi-material objects for biomedical applications. The MMVP system consists of a DMMVP module, an FGMVP module and a virtual reality (VR) simulation module. The DMMVP module is used to model discrete multi-material (DMM) objects, while the FGMVP module is for functionally graded multi-material (FGM) objects. The VR simulation module integrates these two modules to perform digital fabrication of multi-material objects, which can be subsequently visualized and analysed in a virtual environment to optimize MMLM processes for fabrication of product prototypes. Using the MMVP system, two biomedical objects, including a DMM human spine and an FGM intervertebral disc spacer are modelled and digitally fabricated for visualization and analysis in a VR environment. These studies show that the MMVP system is a practical tool for modelling, visualization, and subsequent fabrication of biomedical objects of discrete and functionally graded multi-materials for biomedical applications. The system may be adapted to control MMLM machines with appropriate hardware for physical fabrication of biomedical objects.
Multi-valued LSI/VLSI logic design
Santrakul, K.
A procedure for synthesizing any large complex logic system, such as LSI and VLSI integrated circuits is described. This scheme uses Multi-Valued Multi-plexers (MVMUX) as the basic building blocks and the tree as the structure of the circuit realization. Simple built-in test circuits included in the network (the main current), provide a thorough functional checking of the network at any time. In brief, four major contributions are made: (1) multi-valued Algorithmic State Machine (ASM) chart for describing an LSI/VLSI behavior; (2) a tree-structured multi-valued multiplexer network which can be obtained directly from an ASM chart; (3) a heuristic tree-structured synthesis method for realizing any combinational logic with minimal or nearly-minimal MVMUX; and (4) a hierarchical design of LSI/VLSI with built-in parallel testing capability.
Multi-Domain Modeling Based on Modelica
Directory of Open Access Journals (Sweden)
Liu Jun
2016-01-01
Full Text Available With the application of simulation technology in large-scale and multi-field problems, multi-domain unified modeling become an effective way to solve these problems. This paper introduces several basic methods and advantages of the multidisciplinary model, and focuses on the simulation based on Modelica language. The Modelica/Mworks is a newly developed simulation software with features of an object-oriented and non-casual language for modeling of the large, multi-domain system, which makes the model easier to grasp, develop and maintain.It This article shows the single degree of freedom mechanical vibration system based on Modelica language special connection mechanism in Mworks. This method that multi-domain modeling has simple and feasible, high reusability. it closer to the physical system, and many other advantages.
Actuator with Multi Degrees of Freedom(Actuator)
矢野, 智昭; Tomoaki, YANO; 産業技術総合研究所
2006-01-01
The advantages, problems and the recent developments of the actuator with multi degrees of freedom are presented. At first, the advantages of the actuator with multi degrees of freedom are described. Next, the problems needed to solve for practical use are presented. The recent applications of the actuator with multi degrees of freedom are also reviewed.
Directory of Open Access Journals (Sweden)
Y. H. Subagadis
2014-09-01
Full Text Available The conventional methods used to solve multi-criteria multi-stakeholder problems are less strongly formulated, as they normally incorporate only homogeneous information at a time and suggest aggregating objectives of different decision-makers avoiding water–society interactions. In this contribution, Multi-Criteria Group Decision Analysis (MCGDA using a fuzzy-stochastic approach has been proposed to rank a set of alternatives in water management decisions incorporating heterogeneous information under uncertainty. The decision making framework takes hydrologically, environmentally, and socio-economically motivated conflicting objectives into consideration. The criteria related to the performance of the physical system are optimized using multi-criteria simulation-based optimization, and fuzzy linguistic quantifiers have been used to evaluate subjective criteria and to assess stakeholders' degree of optimism. The proposed methodology is applied to find effective and robust intervention strategies for the management of a coastal hydrosystem affected by saltwater intrusion due to excessive groundwater extraction for irrigated agriculture and municipal use. Preliminary results show that the MCGDA based on a fuzzy-stochastic approach gives useful support for robust decision-making and is sensitive to the decision makers' degree of optimism.
Multi-strangeness dynamics at PANDA
Energy Technology Data Exchange (ETDEWEB)
Gaitanos, Theodoros; Lenske, Horst; Mosel, Ulrich [Institut fuer Theoretische Physik, Universitaet Giessen (Germany)
2014-07-01
Multi-strange bound hadron systems are excellent candidates for studying in-medium hyperon-hyperon (YY) interactions. A better understanding of the strangeness sector of the hadronic equation of state is crucial for our understanding of astrophysical objects like neutron stars. Furthermore, these studies are being motivated by actual and planed experimental activities on hypernuclear physics (HypHI and PANDA Collaborations). In fact, HypHI has already studied single-strange hypernuclei in heavy-ion collisions, whereas studies on double- and multi-strange nuclear systems are being planed by PANDA. We have reported in the past first studies on single- and double-Λ hypernuclei production in reactions induced by heavy-ions and antiprotons, respectively. The YY-interaction is still little known and many controversial theoretical predictions exist in the literature. We therefore extend our previous works by investigating the influence of various hyperon-hyperon interactions on the production dynamics of multi-Λ hypernuclei in reactions relevant for FAIR. Particular attention is paid to the heavy Ω-baryon (S=-3) and its role to the formation of multi-Λ hypernuclei in reactions induced by antiprotons.
Optical network control plane for multi-domain networking
DEFF Research Database (Denmark)
Manolova, Anna Vasileva
This thesis focuses on multi-domain routing for traffice engineering and survivability support in optical transport networks under the Generalized Multi-Protocol Label Switching (GMPLS) control framework. First, different extensions to the Border Gateway Protocol for multi-domain Traffic...... process are not enough for efficient TE in mesh multi-domain networks. Enhancing the protocol with multi-path dissemination capability, combined with the employment of an end-to-end TE metric proves to be a highly efficient solution. Simulation results show good performance characteristics of the proposed...... is not as essential for improved network performance as the length of the provided paths. Second, the issue of multi-domain survivability support is analyzed. An AS-disjoint paths is beneficial not only for resilience support, but also for facilitating adequate network reactions to changes in the network, which...
International Nuclear Information System (INIS)
Mitsuda, Minoru; Yamaguchi, Masayuki; Nakagami, Ryutaro; Furuta, Toshihiro; Fujii, Hirofumi; Sekine, Norio; Niitsu, Mamoru; Moriyama, Noriyuki
2013-01-01
Simultaneous magnetic resonance (MR) imaging of multiple small animals in a single session increases throughput of preclinical imaging experiments. Such imaging using a 3-tesla clinical scanner with multi-array coil requires correction of intensity variation caused by the inhomogeneous sensitivity profile of the coil. We explored a method for correcting intensity that we customized for multi-animal MR imaging, especially abdominal imaging. Our institutional committee for animal experimentation approved the protocol. We acquired high resolution T 1 -, T 2 -, and T 2 * -weighted images and low resolution proton density-weighted images (PDWIs) of 4 rat abdomens simultaneously using a 3T clinical scanner and custom-made multi-array coil. For comparison, we also acquired T 1 -, T 2 -, and T 2 * -weighted volume coil images in the same rats in 4 separate sessions. We used software created in-house to correct intensity variation. We applied thresholding to the PDWIs to produce binary images that displayed only a signal-producing area, calculated multi-array coil sensitivity maps by dividing low-pass filtered PDWIs by low-pass filtered binary images pixel by pixel, and divided uncorrected T 1 -, T 2 -, or T 2 * -weighted images by those maps to obtain intensity-corrected images. We compared tissue contrast among the liver, spinal canal, and muscle between intensity-corrected multi-array coil images and volume coil images. Our intensity correction method performed well for all pulse sequences studied and corrected variation in original multi-array coil images without deteriorating the throughput of animal experiments. Tissue contrasts were comparable between intensity-corrected multi-array coil images and volume coil images. Our intensity correction method customized for multi-animal abdominal MR imaging using a 3T clinical scanner and dedicated multi-array coil could facilitate image interpretation. (author)
High performance pseudo-analytical simulation of multi-object adaptive optics over multi-GPU systems
Abdelfattah, Ahmad; Gendron, É ric; Gratadour, Damien; Keyes, David E.; Ltaief, Hatem; Sevin, Arnaud; Vidal, Fabrice
2014-01-01
Multi-object adaptive optics (MOAO) is a novel adaptive optics (AO) technique dedicated to the special case of wide-field multi-object spectrographs (MOS). It applies dedicated wavefront corrections to numerous independent tiny patches spread over a large field of view (FOV). The control of each deformable mirror (DM) is done individually using a tomographic reconstruction of the phase based on measurements from a number of wavefront sensors (WFS) pointing at natural and artificial guide stars in the field. The output of this study helps the design of a new instrument called MOSAIC, a multi-object spectrograph proposed for the European Extremely Large Telescope (E-ELT). We have developed a novel hybrid pseudo-analytical simulation scheme that allows us to accurately simulate in detail the tomographic problem. The main challenge resides in the computation of the tomographic reconstructor, which involves pseudo-inversion of a large dense symmetric matrix. The pseudo-inverse is computed using an eigenvalue decomposition, based on the divide and conquer algorithm, on multicore systems with multi-GPUs. Thanks to a new symmetric matrix-vector product (SYMV) multi-GPU kernel, our overall implementation scores significant speedups over standard numerical libraries on multicore, like Intel MKL, and up to 60% speedups over the standard MAGMA implementation on 8 Kepler K20c GPUs. At 40,000 unknowns, this appears to be the largest-scale tomographic AO matrix solver submitted to computation, to date, to our knowledge and opens new research directions for extreme scale AO simulations. © 2014 Springer International Publishing Switzerland.
Multi-Model Ensemble Wake Vortex Prediction
Koerner, Stephan; Holzaepfel, Frank; Ahmad, Nash'at N.
2015-01-01
Several multi-model ensemble methods are investigated for predicting wake vortex transport and decay. This study is a joint effort between National Aeronautics and Space Administration and Deutsches Zentrum fuer Luft- und Raumfahrt to develop a multi-model ensemble capability using their wake models. An overview of different multi-model ensemble methods and their feasibility for wake applications is presented. The methods include Reliability Ensemble Averaging, Bayesian Model Averaging, and Monte Carlo Simulations. The methodologies are evaluated using data from wake vortex field experiments.
Multi-Unit Considerations for Human Reliability Analysis
Energy Technology Data Exchange (ETDEWEB)
St. Germain, S.; Boring, R.; Banaseanu, G.; Akl, Y.; Chatri, H.
2017-03-01
This paper uses the insights from the Standardized Plant Analysis Risk-Human Reliability Analysis (SPAR-H) methodology to help identify human actions currently modeled in the single unit PSA that may need to be modified to account for additional challenges imposed by a multi-unit accident as well as identify possible new human actions that might be modeled to more accurately characterize multi-unit risk. In identifying these potential human action impacts, the use of the SPAR-H strategy to include both errors in diagnosis and errors in action is considered as well as identifying characteristics of a multi-unit accident scenario that may impact the selection of the performance shaping factors (PSFs) used in SPAR-H. The lessons learned from the Fukushima Daiichi reactor accident will be addressed to further help identify areas where improved modeling may be required. While these multi-unit impacts may require modifications to a Level 1 PSA model, it is expected to have much more importance for Level 2 modeling. There is little currently written specifically about multi-unit HRA issues. A review of related published research will be presented. While this paper cannot answer all issues related to multi-unit HRA, it will hopefully serve as a starting point to generate discussion and spark additional ideas towards the proper treatment of HRA in a multi-unit PSA.
Benchmarks for dynamic multi-objective optimisation
CSIR Research Space (South Africa)
Helbig, M
2013-06-01
Full Text Available When algorithms solve dynamic multi-objective optimisation problems (DMOOPs), benchmark functions should be used to determine whether the algorithm can overcome specific difficulties that can occur in real-world problems. However, for dynamic multi...
A package of Linux scripts for the parallelization of Monte Carlo simulations
Badal, Andreu; Sempau, Josep
2006-09-01
Despite the fact that fast computers are nowadays available at low cost, there are many situations where obtaining a reasonably low statistical uncertainty in a Monte Carlo (MC) simulation involves a prohibitively large amount of time. This limitation can be overcome by having recourse to parallel computing. Most tools designed to facilitate this approach require modification of the source code and the installation of additional software, which may be inconvenient for some users. We present a set of tools, named clonEasy, that implement a parallelization scheme of a MC simulation that is free from these drawbacks. In clonEasy, which is designed to run under Linux, a set of "clone" CPUs is governed by a "master" computer by taking advantage of the capabilities of the Secure Shell (ssh) protocol. Any Linux computer on the Internet that can be ssh-accessed by the user can be used as a clone. A key ingredient for the parallel calculation to be reliable is the availability of an independent string of random numbers for each CPU. Many generators—such as RANLUX, RANECU or the Mersenne Twister—can readily produce these strings by initializing them appropriately and, hence, they are suitable to be used with clonEasy. This work was primarily motivated by the need to find a straightforward way to parallelize PENELOPE, a code for MC simulation of radiation transport that (in its current 2005 version) employs the generator RANECU, which uses a combination of two multiplicative linear congruential generators (MLCGs). Thus, this paper is focused on this class of generators and, in particular, we briefly present an extension of RANECU that increases its period up to ˜5×10 and we introduce seedsMLCG, a tool that provides the information necessary to initialize disjoint sequences of an MLCG to feed different CPUs. This program, in combination with clonEasy, allows to run PENELOPE in parallel easily, without requiring specific libraries or significant alterations of the
Modified Multi Prime RSA Cryptosystem
Ghazali Kamardan, M.; Aminudin, N.; Che-Him, Norziha; Sufahani, Suliadi; Khalid, Kamil; Roslan, Rozaini
2018-04-01
RSA [1] is one of the mostly used cryptosystem in securing data and information. Though, it has been recently discovered that RSA has some weaknesses and in advance technology, RSA is believed to be inefficient especially when it comes to decryption. Thus, a new algorithm called Multi prime RSA, an extended version of the standard RSA is studied. Then, a modification is made to the Multi prime RSA where another keys is shared secretly between the receiver and the sender to increase the securerity. As in RSA, the methodology used for modified Multi-prime RSA also consists of three phases; 1. Key Generation in which the secret and public keys are generated and published. In this phase, the secrecy is improved by adding more prime numbers and addition of secret keys. 2. Encryption of the message using the public and secret keys given. 3. Decryption of the secret message using the secret key generated. For the decryption phase, a method called Chinese Remainder Theorem is used which helps to fasten the computation. Since Multi prime RSA use more than two prime numbers, the algorithm is more efficient and secure when compared to the standard RSA. Furthermore, in modified Multi prime RSA another secret key is introduced to increase the obstacle to the attacker. Therefore, it is strongly believed that this new algorithm is better and can be an alternative to the RSA.
Incorporating time dependent link costs in multi-state supernetworks
Liao, F.
2011-01-01
Multi-state supernetwork represents a promising approach to model multi-modal and multi-activity travel behaviour. A derived feature of this approach is that a point-to-point path through the supernetwork represents a specific activity-travel pattern. A limitation of current multi-state
Integrated multi-scale modelling and simulation of nuclear fuels
International Nuclear Information System (INIS)
Valot, C.; Bertolus, M.; Masson, R.; Malerba, L.; Rachid, J.; Besmann, T.; Phillpot, S.; Stan, M.
2015-01-01
This chapter aims at discussing the objectives, implementation and integration of multi-scale modelling approaches applied to nuclear fuel materials. We will first show why the multi-scale modelling approach is required, due to the nature of the materials and by the phenomena involved under irradiation. We will then present the multiple facets of multi-scale modelling approach, while giving some recommendations with regard to its application. We will also show that multi-scale modelling must be coupled with appropriate multi-scale experiments and characterisation. Finally, we will demonstrate how multi-scale modelling can contribute to solving technology issues. (authors)
Uncertain multi-attribute decision making methods and applications
Xu, Zeshui
2015-01-01
This book introduces methods for uncertain multi-attribute decision making including uncertain multi-attribute group decision making and their applications to supply chain management, investment decision making, personnel assessment, redesigning products, maintenance services, military system efficiency evaluation. Multi-attribute decision making, also known as multi-objective decision making with finite alternatives, is an important component of modern decision science. The theory and methods of multi-attribute decision making have been extensively applied in engineering, economics, management and military contexts, such as venture capital project evaluation, facility location, bidding, development ranking of industrial sectors and so on. Over the last few decades, great attention has been paid to research on multi-attribute decision making in uncertain settings, due to the increasing complexity and uncertainty of supposedly objective aspects and the fuzziness of human thought. This book can be used as a ref...
Multi-periodic nanostructures for photon control
DEFF Research Database (Denmark)
Kluge, Christian; Adam, Jost; Barié, Nicole
2014-01-01
We propose multi-periodic nanostructures yielded by superposition of multiple binary gratings for wide control over photon emission in thin-film devices. We present wavelength- and angle-resolved photoluminescence measurements of multi-periodically nanostructured organic light-emitting layers...
Innovative multi rotor wind turbine designs
Energy Technology Data Exchange (ETDEWEB)
Kale, S.A.; Sapali, S.N. [College of Engineering. Mechanical Engineering Dept, Pune (India)
2012-07-01
Among the renewable energy sources, today wind energy is the most recognized and cost effective. Developers and researchers in this sector are optimistic and continuously working innovatively to improve the technology. The wind power obtained is proportional to the swept area of wind turbine. The swept area is increased by using a single rotor of large diameter or multi rotors in array. The rotor size is growing continuously with mature technology. Multi rotor technology has a long history and the multi rotor concept persists in a variety of modern innovative systems but the concept has fallen out of consideration in mainstream design from the perception that is complex and unnecessary as very large single rotor units are now technically feasible. This work addresses the evaluation of different multi rotor wind turbine systems. These innovative wind turbines are evaluated on the basis of feasibility, technological advantages, security of expected power performance, cost, reliability, impact of innovative system, comparison with existing wind turbine design. The findings of this work will provide guidelines for the practical and economical ways for further research on the multi rotor wind turbines. (Author)
Multi-Label Learning via Random Label Selection for Protein Subcellular Multi-Locations Prediction.
Wang, Xiao; Li, Guo-Zheng
2013-03-12
Prediction of protein subcellular localization is an important but challenging problem, particularly when proteins may simultaneously exist at, or move between, two or more different subcellular location sites. Most of the existing protein subcellular localization methods are only used to deal with the single-location proteins. In the past few years, only a few methods have been proposed to tackle proteins with multiple locations. However, they only adopt a simple strategy, that is, transforming the multi-location proteins to multiple proteins with single location, which doesn't take correlations among different subcellular locations into account. In this paper, a novel method named RALS (multi-label learning via RAndom Label Selection), is proposed to learn from multi-location proteins in an effective and efficient way. Through five-fold cross validation test on a benchmark dataset, we demonstrate our proposed method with consideration of label correlations obviously outperforms the baseline BR method without consideration of label correlations, indicating correlations among different subcellular locations really exist and contribute to improvement of prediction performance. Experimental results on two benchmark datasets also show that our proposed methods achieve significantly higher performance than some other state-of-the-art methods in predicting subcellular multi-locations of proteins. The prediction web server is available at http://levis.tongji.edu.cn:8080/bioinfo/MLPred-Euk/ for the public usage.
Directory of Open Access Journals (Sweden)
Cuevas P. Federico
1996-12-01
Full Text Available
In Colombia all rice varieties developed are reported as resistant to Tagosodes orizicolus. Given the narrow genetic base of the resistant sources, this study was undertaken to identify the resistant parents or donors more oftenly used in Latin America. The materials were characterized as resistant (Mudgo, Amistad 82, IRAT 120, IRAT 124, Makalioka or susceptible based on the free chosen test and non chosen test and on the survival and oviposition of the insect (Chianan 8, Colombia 1, Bluebonnet 50, IR 8 (lCA, IR 8 (IRRI, Tetep and Cica 8. The damage was associated with insect survival, oviposition and eggs eclotion. To determine heritability two parents (Makalioka and Mudgo, were crossed with IR 8 F1 and F3 populations were also evaluated based on the free chosen test.
En Colombia las variedades de arroz desarrolladas se consideran como resistentes a Tagosodes orizicolus. Dada la estrechez genética de las fuentes de resistencia, se inició este estudio para identificar los progenitores donantes de resistencia usados con mayor frecuencia en América Latina. Los materiales se caracterizaron como resistentes (Mudgo, Amistad 82, IRAT, 120, IRAT 124 Y Makalioka o susceptibles (Chianan 8, Colombia 1, Bluebonnet 50, IR 8 (lCA, IR (IRRI, Tetep y Cica 8, con base en las pruebas de libre escogencia, no escogencia, sobre vivencia y oviposición. El daño estuvo asociado con la supervivencia, oviposición y eclosión de huevos del insecto. Para la determinación de la herencia se cruzaron los progenitores Makalioka y Mudgo con IR8. En la Progenie F1 del cruzamiento resistente x resistente el 111% de las plantas fueron susceptibles; Mudgo y Makalioka segregaron 23 y 41% de plantas susceptibles.
Directory of Open Access Journals (Sweden)
P. M. Bermúdez
2016-01-01
Full Text Available La diseminación de Salmonella spp. resistente a antimicrobianos en las cadenas productivas de alimentos de origen animal es una preocupación de salud pública de carácter mundial. Este estudio describe los patrones de resistencia antimicrobiana de 283 aislamientos de Salmonella enterica procedentes de plantas de beneficio porcino en Colombia. Se evaluó la susceptibilidad antimicrobiana frente a diez antimicrobianos mediante el método de difusión en disco: amoxacilina-ácido clavulánico (30 ug, ampicilina (10 ug, ceftiofur (30 ug, ciprofloxacina (5 ug, cloranfenicol (30 ug, florfenicol (30 ug, gentamicina (10 ug, sulfadiazina/trimetroprim (25 ug, tetraciclina (30 ug y tilmicosina (15 ug. Los resultados evidenciaron la presencia de 279 aislamientos multirresistentes de Salmonella enterica de origen porcino provenientes del ambiente y del producto terminado en las plantas de beneficio evaluadas (46,64% n: 132. Se detectaron 52 patrones de multiresistencia: el más común fue ceftiofur-tetraciclina-tilmicosina en el 9,89% (n: 28 de los aislamientos. Con referencia a estos antimicrobianos, 96,82% (n: 274 de los aislamientos fueron resistentes a tetraciclina, 73,14% (n: 207 a tilmicosina y 28,27% (n: 80 a ceftiofur. De especial interés fue la alta proporción de aislamientos resistentes a ceftiofur, debido a una posible resistencia cruzada con ceftriaxona. Los resultados obtenidos demuestran la necesidad de promover el diseño e implementación de un Programa oficial Integrado de Vigilancia de la Resistencia Antimicrobiana, además de sistemas de monitoreo voluntario en cada eslabón de la cadena productiva porcina, para contribuir a la prevención y control de la transmisión de microorganismos resistentes de origen alimentario en el marco del sistema de gestión de inocuidad alimentaria en Colombia.
Directory of Open Access Journals (Sweden)
Edgar Diaz R.
2013-10-01
Full Text Available Objetivo. Mediante procedimientos de PCR-RFLP, detectar un polimorfismo en el gen Est9 de garrapatas Rhipicephalus (Boophilus microplus resistentes a piretroides en Ibagué, Colombia, determinando el grado de asociación entre los fenotipos y los genotipos resultantes. Materiales y métodos. El ADN de 30 teleoginas R. (Boophilus microplus fenotípicamente susceptibles, resistentes o medianamente resistentes a piretroides en una prueba de Drummond modificada, fue amplificado por PCR con cebadores específicos para obtener un fragmento de 372 pb del gen Est9, que fue sometido a digestión con la enzima EcoRI para estudiar los RFLPs generados y poder diferenciar los respectivos genotipos. El grado de asociación entre los fenotipos y los genotipos resultantes se determinó mediante la prueba exacta de Fisher. Resultados. Luego de digerir el fragmento con la endonucleasa, se generaron dos segmentos en teleoginas con algún nivel de resistencia, mientras en las teleoginas susceptibles no hubo división del fragmento de 372 pb, demostrándose así la presencia de una mutación puntual y los genotipos homocigoto natural, homocigoto mutante y heterocigoto. Las diferencias altamente significativas (p<0.01 entre teleoginas susceptibles y aquellas con algún nivel de resistencia, mostraron una relación directa entre el genotipo y el fenotipo con un nivel de confianza de p=0.0009852. Conclusiones. Se comprobó, por primera vez en Colombia, la presencia de una mutación puntual en el gen Est9 de garrapatas R. (Boophilus microplus resistentes a piretroides, sugiriendo la necesidad de realizar estudios para detectar alteraciones moleculares en otros genes relacionados con quimioresistencia.
Statistical Projections for Multi-resolution, Multi-dimensional Visual Data Exploration and Analysis
Energy Technology Data Exchange (ETDEWEB)
Nguyen, Hoa T. [Univ. of Utah, Salt Lake City, UT (United States); Stone, Daithi [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Bethel, E. Wes [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2016-01-01
An ongoing challenge in visual exploration and analysis of large, multi-dimensional datasets is how to present useful, concise information to a user for some specific visualization tasks. Typical approaches to this problem have proposed either reduced-resolution versions of data, or projections of data, or both. These approaches still have some limitations such as consuming high computation or suffering from errors. In this work, we explore the use of a statistical metric as the basis for both projections and reduced-resolution versions of data, with a particular focus on preserving one key trait in data, namely variation. We use two different case studies to explore this idea, one that uses a synthetic dataset, and another that uses a large ensemble collection produced by an atmospheric modeling code to study long-term changes in global precipitation. The primary findings of our work are that in terms of preserving the variation signal inherent in data, that using a statistical measure more faithfully preserves this key characteristic across both multi-dimensional projections and multi-resolution representations than a methodology based upon averaging.
Directory of Open Access Journals (Sweden)
A. Pontoriero
2008-09-01
Full Text Available A dramatic rise in the frequency of resistance to adamantane drugs by influenza A H3 viruses, associated with a single amino acid replacement in the viral matrix M2 protein, has occurred in multiple countries worldwide in recent years. We investigated the frequency of adamantane-resistant influenza A H3 viruses in Argentina during the period 2001- 2007. We used reverse transcription followed by polymerase chain reaction. The obtained products were sequenced for the detection of mutations of the M2 gene relevant to the resistance phenotypes. The HA1 sequences of the sensitive and resistant strains were also analyzed to clarify whether they had any relevance to the resistant mutations. Twenty out of 55 (36% strains were identified with the resistance-conferring substitution at amino acid 31 (Serine 31 Asparagine. No resistant viruses were detected between 2001 and 2005. All strains isolated in 2006 and four out of five isolates from 2007 were resistant. None of the patients had received previous treatment with amantadine and/or rimantadine. The HA1 analysis showed that there were only two changes (Serine193 Phenylalanine and Aspartic acid 225 Asparagine present in the strains with the M2 substitution at position 31. Our data indicate that since 2006 there has been a significant increase of adamantane-resistant influenza A H3 viruses, which raises concern over the spread of these viruses in Argentina.En los últimos años, se ha detectado un aumento de virus influenza A H3 resistentes a los adamantanos en distintos países, asociados mayoritariamente con el reemplazo de un único aminoácido de la proteína matriz M2. Se investigó la frecuencia de virus influenza A H3 resistentes a los adamantanos en Argentina entre 2001 y 2007. Se utilizó la transcripción reversa seguida de la reacción en cadena de la polimerasa y de la técnica de secuencia directa para la detección de mutaciones en el gen que codifica para la proteína M2, relevantes para
Theoretical and algorithmic advances in multi-parametric programming and control
Pistikopoulos, Efstratios N.; Dominguez, Luis; Panos, Christos; Kouramas, Konstantinos; Chinchuluun, Altannar
2012-01-01
This paper presents an overview of recent theoretical and algorithmic advances, and applications in the areas of multi-parametric programming and explicit/multi-parametric model predictive control (mp-MPC). In multi-parametric programming, advances include areas such as nonlinear multi-parametric programming (mp-NLP), bi-level programming, dynamic programming and global optimization for multi-parametric mixed-integer linear programming problems (mp-MILPs). In multi-parametric/explicit MPC (mp-MPC), advances include areas such as robust multi-parametric control, multi-parametric nonlinear MPC (mp-NMPC) and model reduction in mp-MPC. A comprehensive framework for multi-parametric programming and control is also presented. Recent applications include a hydrogen storage device, a fuel cell power generation system, an unmanned autonomous vehicle (UAV) and a hybrid pressure swing adsorption (PSA) system. © 2012 Springer-Verlag.
Theoretical and algorithmic advances in multi-parametric programming and control
Pistikopoulos, Efstratios N.
2012-04-21
This paper presents an overview of recent theoretical and algorithmic advances, and applications in the areas of multi-parametric programming and explicit/multi-parametric model predictive control (mp-MPC). In multi-parametric programming, advances include areas such as nonlinear multi-parametric programming (mp-NLP), bi-level programming, dynamic programming and global optimization for multi-parametric mixed-integer linear programming problems (mp-MILPs). In multi-parametric/explicit MPC (mp-MPC), advances include areas such as robust multi-parametric control, multi-parametric nonlinear MPC (mp-NMPC) and model reduction in mp-MPC. A comprehensive framework for multi-parametric programming and control is also presented. Recent applications include a hydrogen storage device, a fuel cell power generation system, an unmanned autonomous vehicle (UAV) and a hybrid pressure swing adsorption (PSA) system. © 2012 Springer-Verlag.
Directory of Open Access Journals (Sweden)
Iman F. Abou-El-Naga
2012-09-01
miracidial destruction soon after parasite penetration. The other type occurs in less resistant snails where a delayed resistance development occurs after the dissemination of the sporocysts in the snail tissues. It seems that B. alexandrina snails respond more or less similar to B. glabrata. The results also proved that the immune response of the internal defense system increased with increasing the number of the inherited resistant genes.En Egipto, Biomphalaria alexandrina es el huésped intermediario de Schistosoma mansoni. La supervivencia de los miracidios de Schistosoma en los caracoles varía entre las especies de Biomphalaria. El sistema de defensa interno es uno de los factores que influyen en el patrón de susceptibilidad de los caracoles. La interacción entre los caracoles Biomphalaria y S. mansoni requiere ser identificada para cada especie e incluso, entre los miembros de la misma especie con diferente grado de susceptibilidad. En el presente estudio, la primera generación de padres susceptibles y resistentes de B. alejandrina fue examinada histológicamente al día 30, después de la exposición. El trabajo fue realizado tanto para caracterizar la respuesta inmune, según las reacciones de los tejidos, de los caracoles susceptibles y resistentes de B. alejandrina contra S. mansoni. También, el estudio se diseñó para determinar el impacto en el aumento de la resistencia en los caracoles padres, en los mecanismos de interacción de sus crías contra la infección. Los resultados mostraron que la tasa de infección para las crías, de padres susceptibles, fue del 92%. No se originaron crías susceptibles de los padres resistentes. Cuando los padres incluían un número igual de caracoles susceptibles y resistentes, dieron como resultado crías con una tasa de infección del 20%. Los caracoles susceptibles que tuvieron padres susceptibles mostraron un mayor grado de susceptibilidad que los que tenían tanto padres sensibles como resistentes. Una caracter
Multi-party Quantum Computation
Smith, Adam
2001-01-01
We investigate definitions of and protocols for multi-party quantum computing in the scenario where the secret data are quantum systems. We work in the quantum information-theoretic model, where no assumptions are made on the computational power of the adversary. For the slightly weaker task of verifiable quantum secret sharing, we give a protocol which tolerates any t < n/4 cheating parties (out of n). This is shown to be optimal. We use this new tool to establish that any multi-party quantu...
Meijs, M.; Debats, O.; Huisman, H.
2015-03-01
In prostate cancer, the detection of metastatic lymph nodes indicates progression from localized disease to metastasized cancer. The detection of positive lymph nodes is, however, a complex and time consuming task for experienced radiologists. Assistance of a two-stage Computer-Aided Detection (CAD) system in MR Lymphography (MRL) is not yet feasible due to the large number of false positives in the first stage of the system. By introducing a multi-structure, multi-atlas segmentation, using an affine transformation followed by a B-spline transformation for registration, the organ location is given by a mean density probability map. The atlas segmentation is semi-automatically drawn with ITK-SNAP, using Active Contour Segmentation. Each anatomic structure is identified by a label number. Registration is performed using Elastix, using Mutual Information and an Adaptive Stochastic Gradient optimization. The dataset consists of the MRL scans of ten patients, with lymph nodes manually annotated in consensus by two expert readers. The feature map of the CAD system consists of the Multi-Atlas and various other features (e.g. Normalized Intensity and multi-scale Blobness). The voxel-based Gentleboost classifier is evaluated using ROC analysis with cross validation. We show in a set of 10 studies that adding multi-structure, multi-atlas anatomical structure likelihood features improves the quality of the lymph node voxel likelihood map. Multiple structure anatomy maps may thus make MRL CAD more feasible.
Charara, Ali; Ltaief, Hatem; Gratadour, Damien; Keyes, David E.; Sevin, Arnaud; Abdelfattah, Ahmad; Gendron, Eric; Morel, Carine; Vidal, Fabrice
2014-01-01
called MOSAIC has been proposed to perform multi-object spectroscopy using the Multi-Object Adaptive Optics (MOAO) technique. The core implementation of the simulation lies in the intensive computation of a tomographic reconstruct or (TR), which is used
Modelling customer behaviour in multi-channel service distribution
Heinhuis, D.; de Vries, E.J.; Kundisch, D.; Veit, D.J.; Weitzel, T.; Weinhardt, C.
2009-01-01
Financial service providers are innovating their distribution strategy into multi-channel strategies. The success of a multi-channel approach and the high investments made in information systems and enterprise architectures depends on the adoption and multi-channel usage behaviour of consumers. We
Co-Labeling for Multi-View Weakly Labeled Learning.
Xu, Xinxing; Li, Wen; Xu, Dong; Tsang, Ivor W
2016-06-01
It is often expensive and time consuming to collect labeled training samples in many real-world applications. To reduce human effort on annotating training samples, many machine learning techniques (e.g., semi-supervised learning (SSL), multi-instance learning (MIL), etc.) have been studied to exploit weakly labeled training samples. Meanwhile, when the training data is represented with multiple types of features, many multi-view learning methods have shown that classifiers trained on different views can help each other to better utilize the unlabeled training samples for the SSL task. In this paper, we study a new learning problem called multi-view weakly labeled learning, in which we aim to develop a unified approach to learn robust classifiers by effectively utilizing different types of weakly labeled multi-view data from a broad range of tasks including SSL, MIL and relative outlier detection (ROD). We propose an effective approach called co-labeling to solve the multi-view weakly labeled learning problem. Specifically, we model the learning problem on each view as a weakly labeled learning problem, which aims to learn an optimal classifier from a set of pseudo-label vectors generated by using the classifiers trained from other views. Unlike traditional co-training approaches using a single pseudo-label vector for training each classifier, our co-labeling approach explores different strategies to utilize the predictions from different views, biases and iterations for generating the pseudo-label vectors, making our approach more robust for real-world applications. Moreover, to further improve the weakly labeled learning on each view, we also exploit the inherent group structure in the pseudo-label vectors generated from different strategies, which leads to a new multi-layer multiple kernel learning problem. Promising results for text-based image retrieval on the NUS-WIDE dataset as well as news classification and text categorization on several real-world multi
Multi-level decision making models, methods and applications
Zhang, Guangquan; Gao, Ya
2015-01-01
This monograph presents new developments in multi-level decision-making theory, technique and method in both modeling and solution issues. It especially presents how a decision support system can support managers in reaching a solution to a multi-level decision problem in practice. This monograph combines decision theories, methods, algorithms and applications effectively. It discusses in detail the models and solution algorithms of each issue of bi-level and tri-level decision-making, such as multi-leaders, multi-followers, multi-objectives, rule-set-based, and fuzzy parameters. Potential readers include organizational managers and practicing professionals, who can use the methods and software provided to solve their real decision problems; PhD students and researchers in the areas of bi-level and multi-level decision-making and decision support systems; students at an advanced undergraduate, master’s level in information systems, business administration, or the application of computer science.
Statistical theory of multi-step compound and direct reactions
International Nuclear Information System (INIS)
Feshbach, H.; Kerman, A.; Koonin, S.
1980-01-01
The theory of nuclear reactions is extended so as to include a statistical treatment of multi-step processes. Two types are distinguished, the multi-step compound and the multi-step direct. The wave functions for the system are grouped according to their complexity. The multi-step direct process involves explicitly those states which are open, while the multi-step compound involves those which are bound. In addition to the random phase assumption which is applied differently to the multi-step direct and to the multi-step compound cross-sections, it is assumed that the residual interaction will have non-vanishing matrix elements between states whose complexities differ by at most one unit. This is referred to as the chaining hypothesis. Explicit expressions for the double differential cross-section giving the angular distribution and energy spectrum are obtained for both reaction types. The statistical multi-step compound cross-sections are symmetric about 90 0 . The classical statistical theory of nuclear reactions is a special limiting case. The cross-section for the statistical multi-step direct reaction consists of a set of convolutions of single-step direct cross-sections. For the many step case it is possible to derive a diffusion equation in momentum space. Application is made to the reaction 181 Ta(p,n) 181 W using the statistical multi-step compound formalism
Simons, Rainee N.; Wintucky, Edwin G.
2014-01-01
This paper presents the design and test results of a multi-band multi-tone millimeter-wave frequency synthesizer, based on a solid-state frequency comb generator. The intended application of the synthesizer is in a space-borne transmitter for radio wave atmospheric studies at K-band (18 to 26.5 GHz), Q-band (37 to 42 GHz), and E-band (71 to 76 GHz). These studies would enable the design of robust multi-Gbps data rate space-to-ground satellite communication links. Lastly, the architecture for a compact multi-tone beacon transmitter, which includes a high frequency synthesizer, a polarizer, and a conical horn antenna, has been investigated for a notional CubeSat based space-to-ground radio wave propagation experiment.
Design, simulation and testing of a novel radial multi-pole multi-layer magnetorheological brake
Wu, Jie; Li, Hua; Jiang, Xuezheng; Yao, Jin
2018-02-01
This paper deals with design, simulation and experimental testing of a novel radial multi-pole multi-layer magnetorheological (MR) brake. This MR brake has an innovative structural design with superposition principle of two magnetic fields generated by the inner coils and the outer coils. The MR brake has several media layers of magnetorheological (MR) fluid located between the inner coils and the outer coils, and it can provide higher torque and higher torque density than conventional single-disk or multi-disk or multi-pole single-layer MR brakes can. In this paper, a brief introduction to the structure of the proposed MR brake was given first. Then, theoretical analysis of the magnetic circuit and the braking torque was conducted. In addition, a 3D electromagnetic model of the MR brake was developed to simulate and examine the magnetic flux intensity and corresponding braking torque. A prototype of the brake was fabricated and several tests were carried out to validate its torque capacity. The results show that the proposed MR brake can produce a maximum braking torque of 133 N m and achieve a high torque density of 25.0 kN m-2, a high torque range of 42 and a high torque-to-power ratio of 0.95 N m W-1.
Multi-level Bayesian analyses for single- and multi-vehicle freeway crashes.
Yu, Rongjie; Abdel-Aty, Mohamed
2013-09-01
This study presents multi-level analyses for single- and multi-vehicle crashes on a mountainous freeway. Data from a 15-mile mountainous freeway section on I-70 were investigated. Both aggregate and disaggregate models for the two crash conditions were developed. Five years of crash data were used in the aggregate investigation, while the disaggregate models utilized one year of crash data along with real-time traffic and weather data. For the aggregate analyses, safety performance functions were developed for the purpose of revealing the contributing factors for each crash type. Two methodologies, a Bayesian bivariate Poisson-lognormal model and a Bayesian hierarchical Poisson model with correlated random effects, were estimated to simultaneously analyze the two crash conditions with consideration of possible correlations. Except for the factors related to geometric characteristics, two exposure parameters (annual average daily traffic and segment length) were included. Two different sets of significant explanatory and exposure variables were identified for the single-vehicle (SV) and multi-vehicle (MV) crashes. It was found that the Bayesian bivariate Poisson-lognormal model is superior to the Bayesian hierarchical Poisson model, the former with a substantially lower DIC and more significant variables. In addition to the aggregate analyses, microscopic real-time crash risk evaluation models were developed for the two crash conditions. Multi-level Bayesian logistic regression models were estimated with the random parameters accounting for seasonal variations, crash-unit-level diversity and segment-level random effects capturing unobserved heterogeneity caused by the geometric characteristics. The model results indicate that the effects of the selected variables on crash occurrence vary across seasons and crash units; and that geometric characteristic variables contribute to the segment variations: the more unobserved heterogeneity have been accounted, the better
Switching dynamics of multi-agent learning
Vrancx, P.; Tuyls, K.P.; Westra, R.
2008-01-01
This paper presents the dynamics of multi-agent reinforcement learning in multiple state problems. We extend previous work that formally modelled the relation between reinforcement learning agents and replicator dynamics in stateless multi-agent games. More precisely, in this work we use a
A multi-species multi-fleet bioeconomic simulation model for the English Channel artisanal fisheries
DEFF Research Database (Denmark)
Ulrich, Clara; Le Gallic, B.; Dunn, M.R.
2002-01-01
Considering the large number of technical interactions between various fishing activities, the English Channel (ICES divisions VIId and VIIe) fisheries may be regarded as one large and diverse multi-country, multi-gear and multi-species artisanal fishery, although rarely studied as such. A whole...... of the model is to study the long-term consequences of various management alternatives on the economic situation of the English and French fleets fishing in the area and on exploited resources. The model describes this feature through the links between three entities on the one hand (stocks, fleets...... and "metiers", i.e. gear x target species x fishing area), and three modules on the other hand (activity, biological production and economics). The model is described and some simulation results are presented. An example simulating a decrease of one fleet segment effort illustrates these technical interactions...
Dense Clustered Multi-Channel Wireless Sensor Cloud
Directory of Open Access Journals (Sweden)
Sivaramakrishnan Sivakumar
2015-08-01
Full Text Available Dense Wireless Sensor Network Clouds have an inherent issue of latency and packet drops with regards to data collection. Though there is extensive literature that tries to address these issues through either scheduling, channel contention or a combination of the two, the problem still largely exists. In this paper, a Clustered Multi-Channel Scheduling Protocol (CMSP is designed that creates a Voronoi partition of a dense network. Each partition is assigned a channel, and a scheduling scheme is adopted to collect data within the Voronoi partitions. This scheme collects data from the partitions concurrently and then passes it to the base station. CMSP is compared using simulation with other multi-channel protocols like Tree-based Multi-Channel, Multi-Channel MAC and Multi-frequency Media Access Control for wireless sensor networks. Results indicate CMSP has higher throughput and data delivery ratio at a lower power consumption due to network partitioning and hierarchical scheduling that minimizes load on the network.
Multi-Dimensional Path Queries
DEFF Research Database (Denmark)
Bækgaard, Lars
1998-01-01
to create nested path structures. We present an SQL-like query language that is based on path expressions and we show how to use it to express multi-dimensional path queries that are suited for advanced data analysis in decision support environments like data warehousing environments......We present the path-relationship model that supports multi-dimensional data modeling and querying. A path-relationship database is composed of sets of paths and sets of relationships. A path is a sequence of related elements (atoms, paths, and sets of paths). A relationship is a binary path...
Directory of Open Access Journals (Sweden)
Katia Vergetti Bloch
2008-12-01
Full Text Available O estudo estimou a adesão ao tratamento anti-hipertensivo farmacológico utilizando-se três métodos indiretos em uma coorte de hipertensos resistentes no Rio de Janeiro, Brasil, 2005. Os métodos foram: avaliação pelo paciente; avaliação do médico; teste de Morisky-Green (TMG adaptado para a língua portuguesa. Foi realizada validação preditiva comparando-se a diferença tanto de pressões de consultório como de monitorização de 24 horas (MAPA, em duas ocasiões, de pacientes com e sem adesão. As médias de pressões entre os grupos foram comparadas usando-se testes não-paramétricos. Foram entrevistados 200 pacientes com idade média de 63 anos (DP = 10,3, 73,5% do sexo feminino. A prevalência de adesão foi de 51% pelo TMG, 52% pelo médico e 80,5% pelo paciente. Ocorreram reduções das pressões arteriais de consultório e na MAPA dos pacientes com adesão por todos os métodos, mas não para os não-aderentes. O emprego de mais de um método para avaliação da adesão mostrou que indivíduos não-aderentes pelos três métodos (11,9% tiveram pior evolução dos níveis tensionais. Esse achado sugere que a hipertensão resistente não pode ser atribuída unicamente à baixa adesão.This study estimated adherence to anti-hypertensive medication using three indirect methods and their combinations in a cohort of patients with resistant hypertension in Rio de Janeiro, Brazil, 2005. The methods used were: self-reported adherence; physicians' adherence evaluation; and the Morisky-Green test (MGT translated into Portuguese. The predictive validation was performed comparing office blood pressure and ambulatory blood pressure monitoring, measured on two different occasions, from patients classified as adherent or not. The means were compared using non-parametric tests. Two hundred patients were interviewed. Mean age was 63 years (SD = 10.3, and 73.5% were female. Adherence prevalence was 51% using MGT, 52% according to the physician
Unlearning in feed-forward multi-nets
Spaanenburg, L; Kurkova,; Steele, NC; Neruda, R; Karny, M
2001-01-01
Multi-nets promise an improved performance over monolithic neural networks by virtue of their distributed implementation. Modular neural networks are multi-nets based on an judicious assembly of functionally different parts. This can be viewed as again a monolithic network, but with more complex
RNF4 interacts with multiSUMOylated ETV4.
Aguilar-Martinez, Elisa; Guo, Baoqiang; Sharrocks, Andrew D
2016-01-01
Protein SUMOylation represents an important regulatory event that changes the activities of numerous proteins. Recent evidence demonstrates that polySUMO chains can act as a trigger to direct the ubiquitin ligase RNF4 to substrates to cause their turnover through the ubiquitin pathway. RNF4 uses multiple SUMO interaction motifs (SIMs) to bind to these chains. However, in addition to polySUMO chains, a multimeric binding surface created by the simultaneous SUMOylation of multiple residues on a protein or complex could also provide a platform for the recruitment of multi-SIM proteins like RNF4. Here we demonstrate that multiSUMOylated ETV4 can bind to RNF4 and that a unique combination of SIMs is required for RNF4 to interact with this multiSUMOylated platform. Thus RNF4 can bind to proteins that are either polySUMOylated through a single site or multiSUMOylated on several sites and raises the possibility that such multiSIM-multiSUMO interactions might be more widespread.
Building Multi-Agent Systems Using Jason
DEFF Research Database (Denmark)
Boss, Niklas Skamriis; Jensen, Andreas Schmidt; Villadsen, Jørgen
2010-01-01
We provide a detailed description of the Jason-DTU system, including the used methodology, tools as well as team strategy. We also discuss the experience gathered in the contest. In spring 2009 the course “Artificial Intelligence and Multi- Agent Systems” was held for the first time...... on the Technical University of Denmark (DTU). A part of this course was a short introduction to the multi-agent framework Jason, which is an interpreter for AgentSpeak, an agent-oriented programming language. As the final project in this course a solution to the Multi-Agent Programming Contest from 2007, the Gold...
Sleptchenko, Andrei; van Harten, Aart; van der Heijden, Matthijs C.
2005-01-01
We consider a multi-class, multi-server queueing system with preemptive priorities. We distinguish two groups of priority classes that consist of multiple customer types, each having their own arrival and service rate. We assume Poisson arrival processes and exponentially distributed service times.
Ontology-based multi-agent systems
Energy Technology Data Exchange (ETDEWEB)
Hadzic, Maja; Wongthongtham, Pornpit; Dillon, Tharam; Chang, Elizabeth [Digital Ecosystems and Business Intelligence Institute, Perth, WA (Australia)
2009-07-01
The Semantic web has given a great deal of impetus to the development of ontologies and multi-agent systems. Several books have appeared which discuss the development of ontologies or of multi-agent systems separately on their own. The growing interaction between agents and ontologies has highlighted the need for integrated development of these. This book is unique in being the first to provide an integrated treatment of the modeling, design and implementation of such combined ontology/multi-agent systems. It provides clear exposition of this integrated modeling and design methodology. It further illustrates this with two detailed case studies in (a) the biomedical area and (b) the software engineering area. The book is, therefore, of interest to researchers, graduate students and practitioners in the semantic web and web science area. (orig.)
multiPDEVS: A Parallel Multicomponent System Specification Formalism
Directory of Open Access Journals (Sweden)
Damien Foures
2018-01-01
Full Text Available Based on multiDEVS formalism, we introduce multiPDEVS, a parallel and nonmodular formalism for discrete event system specification. This formalism provides combined advantages of PDEVS and multiDEVS approaches, such as excellent simulation capabilities for simultaneously scheduled events and components able to influence each other using exclusively their state transitions. We next show the soundness of the formalism by giving a construction showing that any multiPDEVS model is equivalent to a PDEVS atomic model. We then present the simulation procedure associated, usually called abstract simulator. As a well-adapted formalism to express cellular automata, we finally propose to compare an implementation of multiPDEVS formalism with a more classical Cell-DEVS implementation through a fire spread application.
Consistency in multi-viewpoint architectural design
Dijkman, R.M.; Dijkman, Remco Matthijs
2006-01-01
This thesis presents a framework that aids in preserving consistency in multi-viewpoint designs. In a multi-viewpoint design each stakeholder constructs his own design part. We call each stakeholder’s design part the view of that stakeholder. To construct his view, a stakeholder has a viewpoint.
Closed forms and multi-moment maps
DEFF Research Database (Denmark)
Madsen, Thomas Bruun; Swann, Andrew Francis
2013-01-01
We extend the notion of multi-moment map to geometries defined by closed forms of arbitrary degree. We give fundamental existence and uniqueness results and discuss a number of essential examples, including geometries related to special holonomy. For forms of degree four, multi-moment maps are gu...
Interconnected levels of Multi-Stage Marketing – A Triadic approach
DEFF Research Database (Denmark)
Vedel, Mette; Geersbro, Jens; Ritter, Thomas
2012-01-01
must not only decide in general on the merits of multi-stage marketing for their firm, but must also decide on which level they will engage in multi-stage marketing. The triadic perspective enables a rich and multi-dimensional understanding of how different business relationships influence each other......Multi-stage marketing gains increasing attention as knowledge of and influence on the customer's customer become more critical for the firm's success. Despite this increasing managerial relevance, systematic approaches for analyzing multi-stage marketing are still missing. This paper conceptualizes...... different levels of multi-stage marketing and illustrates these stages with a case study. In addition, a triadic perspective is introduced as an analytical tool for multi-stage marketing research. The results from the case study indicate that multi-stage marketing exists on different levels. Thus, managers...
Multi-factor authentication using quantum communication
Hughes, Richard John; Peterson, Charles Glen; Thrasher, James T.; Nordholt, Jane E.; Yard, Jon T.; Newell, Raymond Thorson; Somma, Rolando D.
2018-02-06
Multi-factor authentication using quantum communication ("QC") includes stages for enrollment and identification. For example, a user enrolls for multi-factor authentication that uses QC with a trusted authority. The trusted authority transmits device factor information associated with a user device (such as a hash function) and user factor information associated with the user (such as an encrypted version of a user password). The user device receives and stores the device factor information and user factor information. For multi-factor authentication that uses QC, the user device retrieves its stored device factor information and user factor information, then transmits the user factor information to the trusted authority, which also retrieves its stored device factor information. The user device and trusted authority use the device factor information and user factor information (more specifically, information such as a user password that is the basis of the user factor information) in multi-factor authentication that uses QC.
Response of multi-strip multi-gap resistive plate chamber using pulsed electron beam
International Nuclear Information System (INIS)
Datta Pramanik, U.; Chakraborty, S.; Rahaman, A.; Ray, J.; Chatterjee, S.; Bemmerer, D.; Elekes, Z.; Kempe, M.; Sobiella, M.; Stach, D.; Wagner, A.; Yakorev, D.; Leifels, Y.; Simon, H.
2011-01-01
A prototype of Multi-strip Multi-gap Resistive Plate Chamber (MMRPC) with active area 40 cm x 20 cm has been developed at SINP, Kolkata. Electron response of the developed detector was studied using the electron linac ELBE at Forschungszentrum Dresden-Rossendorf. The development of this detector started with the aim of developing a neutron detector but this ultrafast timing detector can be used efficiently for the purpose of medical imaging, security purpose and detection of minimum ionising particle. In this article detailed analysis of electron response to our developed MMRPC will be presented
DEFF Research Database (Denmark)
Ren, Jingzheng; Fedele, Andrea; Mason, Marco
2013-01-01
The purpose of this paper is to develop a sustainability assessment method to rank the prior sequence of biomass-based technologies for hydrogen production. A novel fuzzy Multi-actor Multi-criteria Decision Making method which allows multiple groups of decision-makers to use linguistic variables...