WorldWideScience

Sample records for clon sudamericano multi-resistente

  1. Análisis genómico del resistoma de la cepa de Acinetobacter baumannii ABIBUN 107m multi-resistente y persistente en hospitales colombianos

    Directory of Open Access Journals (Sweden)

    Maria Teresa Reguero

    2014-07-01

    Full Text Available Título en español: Análisis genómico del resistoma de la cepa  de  Acinetobacter baumannii  ABIBUN 107m multi-resistente  y persistente  en hospitales colombianos Título en ingles: Genomic analysis of the resistoma of the strain of Acinetobacter baumannii ABIBUN 107m multi-resistant and persistent in Colombian hospitals Título corto: Análisis genómico del resistoma de la cepa  de  Acinetobacter baumannii  Resumen: Acinetobacter baumannii es una bacteria, causante de infecciones asociadas a la atención en salud como neumonía, septicemia, meningitis e infecciones urinarias entre otras. Se caracteriza por su capacidad para desarrollar y acumular rápidamente una gran variedad de mecanismos de resistencia a antibióticos. En esta investigación se realizó el análisis genómico de una cepa de A. baumannii ABIBUN 107m que forma parte de un clon persistente en hospitales colombianos, resistente a los antibióticos carbapenémicos (imipenem y meropenem,  antibióticos de elección en el tratamiento  infecciones causadas por este microorganismo. El genoma de esta bacteria fue secuenciado utilizando técnicas de alto rendimiento, ensamblado y anotado, obteniéndose un genoma constituido por  3954000 pb con 56 contigs;  consta de 4256 genes con un tamaño promedio de 912 pb;  3796 CDS  de los cuales por anotación 2884  se asignaron a COG; 57 tRNA y un porcentaje de GC de 38,74%. A. baumannii ABIBUN 107m es resistente a b-lactámicos, aminoglicósidos, quinolonas, tetraciclina, sulfonamida y colistina. En su genoma se localizaron genes asociados con el perfil de resistencia ya que presenta serin b-lactamasas (blaADC-38, blaOXA-64, blaOXA-23, blaampC-like,  blaamp(H-like, metalo b-lactamasa_B;  proteínas de unión a  penicilina de elevada masa molecular, secuencias de inserción tipo ISAba1; mutaciones en los genes de DNA girasa  y topoisomerasa IV subunidad A (gyrA y parC; enzimas modificadoras de aminoglicósidos (aph

  2. ClonEvol: clonal ordering and visualization in cancer sequencing.

    Science.gov (United States)

    Dang, H X; White, B S; Foltz, S M; Miller, C A; Luo, J; Fields, R C; Maher, C A

    2017-12-01

    Reconstruction of clonal evolution is critical for understanding tumor progression and implementing personalized therapies. This is often done by clustering somatic variants based on their cellular prevalence estimated via bulk tumor sequencing of multiple samples. The clusters, consisting of the clonal marker variants, are then ordered based on their estimated cellular prevalence to reconstruct clonal evolution trees, a process referred to as 'clonal ordering'. However, cellular prevalence estimate is confounded by statistical variability and errors in sequencing/data analysis, and therefore inhibits accurate reconstruction of the clonal evolution. This problem is further complicated by intra- and inter-tumor heterogeneity. Furthermore, the field lacks a comprehensive visualization tool to facilitate the interpretation of complex clonal relationships. To address these challenges we developed ClonEvol, a unified software tool for clonal ordering, visualization, and interpretation. ClonEvol uses a bootstrap resampling technique to estimate the cellular fraction of the clones and probabilistically models the clonal ordering constraints to account for statistical variability. The bootstrapping allows identification of the sample founding- and sub-clones, thus enabling interpretation of clonal seeding. ClonEvol automates the generation of multiple widely used visualizations for reconstructing and interpreting clonal evolution. ClonEvol outperformed three of the state of the art tools (LICHeE, Canopy and PhyloWGS) for clonal evolution inference, showing more robust error tolerance and producing more accurate trees in a simulation. Building upon multiple recent publications that utilized ClonEvol to study metastasis and drug resistance in solid cancers, here we show that ClonEvol rediscovered relapsed subclones in two published acute myeloid leukemia patients. Furthermore, we demonstrated that through noninvasive monitoring ClonEvol recapitulated the emerging subclones

  3. Tuberculose multi-resistente. A propósito de um caso clínico de reinfeção exógena adquirida no meio prisional

    Directory of Open Access Journals (Sweden)

    José Leon Bernardo

    1998-05-01

    Full Text Available RESUMO: Os autores descrevem um caso clinic de tuberculose multi-resistente num doente recluse, toxicodependente e com SIDA que se encontrava sob terapêutiea antibacilar em virtude de anterior episodin de tuberculose “sendivel”.Comentam alguns aspectos relacionadus com o diagnostic, tratamento e evoução exógena por estirpe multi-resistente.Em conclusão, us autores salientam o interesse do DNA “fingerprinting” no diagnostic e epidemiologia da tuberculose multi-resistente e a necessidade de implementação de um efectivo programa de luta contra a tuberculose multi-resistente na comunidade prisional.REV PORT PNEUMOL 1998; IV (3: 319-325 ARSTRACT: A case of multidrug-resistant tuberculosis in a drug-addicted and jailed patient with AIDS is reported. The patient was in anti-tuberculosis therapy, because a question of ongoing “sensitive” tuberculosis.The authors comment some aspects of the clinical management of the patient. Exogenous reinfection with a multidrug-resistant strain was convincelly demonstrated with DNA fingerprinting.The relevance of DNA fingerprinting in the diagnosis and epidemiology of multidrug-resistant tuberculosis is emphasized and the reformulation of the anti-tuberculosis programme in the prisional setting is warranted, in the face of ongoing transmissionREV PORT PNEUMOL 1998; IV (3: 319-325 Palavras-chave: Tuberculose multirresistente, RFLP, Key-words: Multidrug-resistant tuberculosis (MDR-TB, RELP

  4. Dinámicas migratorias transnacionales: el caso de los inmigrantes sudamericanos en Santiago de Chile

    OpenAIRE

    Baeza Virgilio, Pablo

    2016-01-01

    La presente investigación se centra en la inmigración sudamericana en la ciudad de Santiago de Chile. Se analizan los elementos políticos, económicos y sociales que conforman el espacio social de incorporación en el que los inmigrantes se insertan. A través de los datos producidos por una encuesta, identificamos las características, magnitud e intensidades de las prácticas transnacionales que los inmigrantes sudamericanos despliegan en la ciudad como parte de sus estrategias de incorporación....

  5. Informe sobre el Tercer Congreso Sudamericano de Neurocirugía

    Directory of Open Access Journals (Sweden)

    Alejandro Jiménez Arango

    1949-07-01

    Full Text Available Bogotá, abril 16 de 1949. Señor Profesor Dr. Jorge Bejarano, Ministro de Higiene. E.S.D. Señor Ministro: De conformidad con el Decreto No 540 de 2 de marzo del presente año, por el cual tuve el honor de ser nombrado Delegado de Colombia ad honorem al tercer Congreso Sudamericano de Neurocirugía que se reumo en Buenos Aires del 2 al 9 de los presentes, me permito informar a S. S. sobre el origen, desarrollo y acuerdos de dicho congreso.

  6. Clon: Cyberzine de Arte y Cultura. Un modelo de comunicación multimedia

    Directory of Open Access Journals (Sweden)

    Antonio del Rivero Herrera

    2005-01-01

    Full Text Available En nuestra vida existen circunstancias que, por su condición de cotidianas, parecerían desvanecerse en el quehacer de todos los días al que, sin embargo, le dan forma. Tal es el caso de mantener vivo un proyecto como Clon: Cyberzine de Arte y Cultura; para el que la preparación y elaboración de este texto significó brindarnos la oportunidad de hacer un alto en nuestra vida diaria, y dedicar un tiempo considerable a reflexionar sobre lo complejo de su producción y la variedad de aristas que caracterizan a los procesos que la hacen posible, así como del compromiso que implica la presencia, cada vez más sólida, del proyecto en la escena cultural, a través de su sitio en Internet.

  7. El emprendimiento social: una comparativa entre España y países sudamericanos

    Directory of Open Access Journals (Sweden)

    Catalina Nicolás Martínez

    2012-07-01

    Full Text Available La crisis global que sufrimos en la actualidad está haciendo que las labores realizadas por las empresas sociales sean imprescindibles para alcanzar una sociedad igualitaria, eficiente y justa. El número empresas sociales va creciendo año tras año, atendiendo problemas sociales generalmente olvidados por las instituciones. Los estudios empíricos que profundizan en el conocimiento de este tipo de emprendimiento social son escasos. Este trabajo, bajo el marco del proyecto Global Entrepreneurship Monitor (GEM, analiza la influencia de una serie de variables objetivas y cognitivas del emprendedor social, sobre una muestra constituida por emprendedores sociales en España y en diversos países sudamericanos.

  8. Anarquistas y policías en el atlántico sudamericano: una red transnacional, 1890-1910

    Directory of Open Access Journals (Sweden)

    Martín Albornoz

    Full Text Available Este artículo analiza la emergencia de mecanismos de cooperación policial para la vigilancia y expulsión de anarquistas en el atlántico sudamericano. Buscando ampliar las aproximaciones más corrientes sobre el tema, en su mayoría enfocadas en los efectos de las políticas represivas dentro de las fronteras nacionales, propone un recorte geográfico que abarca las conexiones entre las policías de Buenos Aires, Montevideo y diversas ciudades portuarias brasileñas. A partir de la reconstrucción de intercambios epistolares y de una abundante circulación de telegramas se esboza una cartografía específica para repensar rutas de la represión y del destierro, con foco en la dinámica que las expulsiones de extranjeros provocaron en los puertos de la región. Aunque sean centrales para este estudio, el análisis no se ciñe únicamente a las fuentes policiales, incorporando documentos de la prensa comercial y relatos de los propios anarquistas.

  9. Multiplicación in vitro de segmentos nodales del clon de ñame Blanco de Guinea (Dioscorea cayenensis - D. rotundata ) en sistemas de cultivo semiautomatizado

    OpenAIRE

    Manuel Cabrera Jova; Rafael Gómez Kosky; Sergio Rodríguez Morales; Jorge López Torres; Aymé Rayas Cabrera; Milagros Basail Pérez; Arletys Santos Pino; Víctor Medero Vega; Germán Rodríguez Rodríguez

    2009-01-01

    Con el empleo del sistema de inmersión temporal fue posible incrementar la multiplicación in vitro de los segmentos nodales en el clon de ñame Blanco de Guinea. Con este tipo de sistema de cultivo se obtuvieron los más altos valores para la altura de la planta, número de entrenudos por planta, así como para la masa fresca y seca de las mismas. Las condiciones de cultivo creadas en el sistema de inmersión temporal para la multiplicación in vitro de los segmentos nodales lograron el más alto co...

  10. Uso de distintos tratamientos de desinfección en el cultivo in vitro de Dioscorea alata L. clon caraqueño

    Directory of Open Access Journals (Sweden)

    Misterbino Borges García

    2009-07-01

    Full Text Available El cultivo in vitro, como técnica, consiste en cultivar asépticamente una porción aislada de la planta bajo condiciones de ambiente controlado, para que las células expresen su potencial intrínseco e inducido. El presente trabajo tuvo como objetivo determinar el efecto de diferentes concentraciones y tiempos de inmersión en hipoclorito de sodio en el establecimiento in vitro de explantes primarios de ñame (Dioscorea alata L. clon caraqueño. Las variantes de desinfección consistieron en la utilización de diferentes concentraciones de hipoclorito de sodio (1,5; 2 y 2,5% durante distintos tiempos de inmersión (10; 20 y 30 min. A los 7 días se evaluó el porcentaje de contaminación de bacterias y hongos respectivamente, y a los 40 días el número de nudos de novo, la longitud del vástago, el número de hojas, y el porcentaje de explantes establecidos y necrosados. Se aplicó un diseño experimental completamente aleatorizado con análisis de varianza bifactorial y clasificación simple. Se realizó la prueba de comparación de medias de Tukey para un nivel de significación del 5%. Los resultados obtenidos arrojaron que el tratamiento de desinfección de segmentos uninodales de ñame con hipoclorito de sodio al 1,5% durante un tiempo de inmersión 30 min es el de mayor efectividad para el establecimiento in vitro de explantes primarios del ñame (D. alata L. clon caraqueño con altos porcentajes de supervivencia en condiciones ex vitro.

  11. La influencia de los proyectos políticos de Brasil y Venezuela en la configuración del escenario sudamericano

    OpenAIRE

    Falomir Lockhart, Nicolás

    2010-01-01

    El presente trabajo analiza la influencia de los proyectos políticos de Brasil y de Venezuela en el fenómeno de la integración y fragmentación latinoamericana; con especial referencia a la determinación de lo sudamericano. Desde el fin de la guerra fría, América Latina parece haber entrado en un proceso de diferenciación de sus partes, manifestado en la inserción económica de México a América del Norte, en la distinción entre el norte y el sur de América del Sur o en la multiplicidad de proce...

  12. Aislamientos de Staphylococcus aureus sensibles a meticilina relacionados genéticamente con el clon USA300, ¿origen de los aislamientos SARM de genotipo comunitario en Colombia?

    Directory of Open Access Journals (Sweden)

    Javier Antonio Escobar-Pérez

    2014-04-01

    Full Text Available Introducción. USA300 es un linaje genético que se encuentra en aislamientos de Staphylococcus aureus sensibles (SASM y resistentes a meticilina (SARM. Actualmente, en Colombia las infecciones por SARM en hospitales y en la comunidad son causadas principalmente por un clon con genotipo comunitario (SARM-GC relacionado genéticamente con el clon USA300. El origen de esta variante es aún desconocido. Objetivo. Identificar y caracterizar aislamientos de S. aureus resistentes y sensibles a meticilina con el fin de aportar información para establecer un posible origen de los aislamientos SARM-GC en Colombia. Materiales y métodos. Se realizó una caracterización de aislamientos SASM relacionados con el clon USA300 detectados a partir de un análisis de 184 aislamientos de S. aureus (90 SARM y 94 SASM causantes de infecciones. La relación genética de los aislamientos se determinó por electroforesis en gel de campo pulsado (PFGE, tipificación de secuencias multilocus (MLST y tipificación del gen de la proteína A (spa. Resultados. De los 184 aislamientos, 27 (14,7 % presentaron características moleculares y relación genética con el clon USA300, y de ellos, 18 fueron SARM y nueve fueron SASM. Todos los aislamientos SARM relacionados con este clon albergaban un casete estafilocócico cromosómico mec (SCCmec IVc (3.1.2. En ningún aislamiento SASM se detectaron secuencias remanentes de SCCmec o una duplicación del sitio attB que evidenciaran la pérdida del casete. Conclusión. El origen de los aislamientos SARM-GC en Colombia probablemente se encuentre en la diseminación de clones SASM relacionados con el clon USA300 que adquirieron el SCCmec IVc posteriormente.

  13. Circulation of Streptococcus pneumoniae clone Colombia5 ST289 in nine Latin American countries Circulación de Streptococcus pneumoniae clon Colombia5 ST289 en nueve países de América Latina

    Directory of Open Access Journals (Sweden)

    Carolina Firacative

    2009-04-01

    Full Text Available OBJECTIVE: To determine genetic relatedness of clone Colombia5 ST289 with invasive Streptococcus pneumoniae serotype 5 isolates recovered in nine Latin American countries. METHODS: Forty-four invasive S. pneumoniae serotype 5 isolates recovered from children under 5 years of age in Bolivia, Chile, Dominican Republic, Ecuador, Nicaragua, Panama, Paraguay, Peru, and Venezuela were studied. Pulsed-field gel electrophoresis patterns of DNA treated with SmaI restriction enzyme were classified using Tenover's criteria and analyzed with the Fingerprinting II program to determine their genetic relatedness with the Colombian clone. RESULTS: All isolates had a genetic similarity of 78.5% or more with the Colombian clone. Thirteen electrophoretic subtypes derived of pattern A were identified, and five of them (A5, A6, A8, A13, A27 comprised 61.4% of the isolates. CONCLUSIONS: Clone Colombia5 ST289 is disseminated in Latin America. This is important because S. pneumoniae serotype 5 frequently causes invasive disease in the region and is associated with trimethoprim-sulfamethoxazole resistance.OBJETIVO: Determinar la relación genética del clon Colombia5 ST289 con los aislamientos invasores de Streptococcus pneumoniae serotipo 5 provenientes de nueve países latinoamericanos. MÉTODOS: Se estudiaron 45 aislamientos invasores de Streptococcus pneumoniae serotipo 5 procedentes de niños menores de 5 años de Bolivia, Chile, Ecuador, Nicaragua, Panamá, Paraguay, Perú, República Dominicana y Venezuela. Los patrones en electroforesis en gel de campo pulsante del ADN tratado con la enzima de restricción SmaI se clasificaron mediante el criterio de Tenover y se analizaron con el programa Fingerprinting II para determinar su relación genética con el clon colombiano. RESULTADOS: Todos los aislamientos tuvieron una similitud genética de 78,5% o mayor con el clon colombiano. Se identificaron 13 subtipos electroforéticos derivados del patrón A y cinco de ellos

  14. Colonización por Staphylococcus aureus resistente a la meticilina en una unidad de cuidados intensivos de adultos de un hospital colombiano: caracterización fenotípica y molecular con detección de un clon de circulación en la comunidad

    Directory of Open Access Journals (Sweden)

    Narda María Olarte

    2010-09-01

    Conclusiones. El 7,2% de los pacientes que ingresaron a la unidad de cuidados intensivos estaban colonizados con SARM. Éste es el primer reporte de colonización por aislamientos de SARM-ST8-SCCmec IVc adquirido en la comunidad y relacionado genéticamente con el clon pandémico USA300-0114 en Colombia.

  15. Killer whales attack on South American sea lion associated with a fishing vessel: predator and prey tactics Ataque de orcas a un lobo marino sudamericano asociado a un barco pesquero: tácticas del predador y la presa

    Directory of Open Access Journals (Sweden)

    M. Florencia Grandi

    2012-11-01

    Full Text Available Interactions between killer whales and sea lions are widely known. This work describes the predator-prey behaviour of killer whales and South American sea lion associated with a trawling fishery. In Argentina the predatory behaviours of killer whales and anti-predatory behaviours of South American sea lions have been described from costal based observations, but predator-prey behaviour of these species is poorly known at open waters. Here we describe a killer whale group attack on an individual sea lion, using a video recorded from a trawling vessel and an interview of the ship captain. This predator-prey behaviour represents an example of the complexity of interactions between marine mammals and fisheries along the Patagonian coast.Las interacciones entre orcas y lobos marinos son ampliamente conocidas. Este trabajo describe el comportamiento predador-presa entre orcas y un lobo marino sudamericano asociados a un barco pesquero de arrastre. Particularmente en Argentina el comportamiento predatorio de las orcas y el anti-predatorio de los lobos marinos comunes fueron descriptos mediante observaciones costeras, pero se sabe poco sobre el comportamiento de estas especies en aguas abiertas. En este trabajo, a partir de un video grabado desde un barco de pesca arrastrero, junto con la entrevista del capitán del barco, se describe cómo un grupo de orcas ataca a un lobo marino Sudamericano. Este comportamiento predador-presa representa un ejemplo sobre la complejidad de las interacciones entre mamíferos marinos y las pesquerías a lo largo de la costa patagónica.

  16. Multiplicación del clon de banano ‘FHIA-18’ (AAAB en Sistema de Inmersión Temporal

    Directory of Open Access Journals (Sweden)

    Milagros Basail Pérez

    2012-01-01

    Full Text Available Título en inglés: Multiplication of banana clone 'FHIA-18' (AAAB in Temporary Immersion System Resumen Con el propósito de desarrollar un protocolo para la multiplicación del clon de banano ´FHIA-18´ (AAAB en sistema de inmersión temporal, se definieron como objetivos del trabajo determinar el efecto del tiempo (5, 10 y 15 minutos y la frecuencia de inmersión (3, 6 y 8 horas por día, así como la influencia de diferentes combinaciones de reguladores del crecimiento (2,0; 3,0 y  4,0 mg.L-1 de 6-BAP y 2,0; 2,5; 3,0; 3,5 y 4,0 mg.L-1 de 6 AIA,  el efecto del volumen de medio de cultivo por planta (20, 30, 40 y 50 ml/explante y la densidad de explantes por frasco de cultivo (30, 50, 70 y 90 explantes/frasco para incrementar el coeficiente de multiplicación. Con el empleo de un tiempo de 10 minutos y una frecuencia de inmersión cada tres horas, se alcanzaron los mejores resultados en cuanto al número de explantes obtenidos. Con este tiempo y frecuencia de inmersión los explantes presentaron el mayor diámetro del pseudotallo. Para cada frasco de 10,0 L se inocularon 70 explantes y la renovación con 2800 ml de medio de cultivo (40 ml/explante con un tiempo de cultivo de 21 días permitió alcanzar la mayor productividad del material en fase de multiplicación. Además al utilizar las sales MS suplementadas con 3,0 mg.L-1 de 6-BAP; 2,0 mg.L-1 de AIA; 10,0 mg.L-1 de ácido ascórbico, se logró disminuir el crecimiento innecesario de los tallos y hojas de los brotes en la fase de multiplicación y por lo tanto un mayor número de explantes. Palabras claves: coeficiente, densidad de explantes, tiempo, frecuencia, volumen de medio de cultivo. Abstract In order to develop a protocol for multiplication of Banana clone 'FHIA-18' (AAAB in temporary immersion systems, the following working objectives were defined: to determine the effect of immersion time (5, 10 and 15 minutes and frequency (3, 6 and 8 hours per day, as well as, the influence

  17. Revision de las especies del genero Hyperdidelphys Ameghino, 1904 (Mammalia, Marsupialia, Didelphidae. Su significacion filogenetica, estratigrafica y adaptativa en el neogeno del Cono Sur Sudamericano

    Directory of Open Access Journals (Sweden)

    Pardiñas, U. F. J.

    1996-12-01

    nuevamente todas las especies de marsupiales fósiles asignable al género Hyperdidelphys Ameghino, 1904 (Didelphidae, Didelphinae, Didelphini: H. inexpectata (Ameghino, 1889, H. pawula (Rovereto, 1914, H. pattersoni (Reig, 1952 y la nueva especie H. dimartinoi. El biocrón del género se extiende desde el Mioceno tardío (PisoIEdad Huayqueriense hasta el Plioceno tardío (PisotEdad Chapadmalalense; la totalidad de los registros procede de yacimientos del centro y noroeste del territorio argentino. Hyperdidelphys y Lutreolina conforman un grupo monofilético en el contexto de los Didelphini, siendo Lutreolina el grupo hermano plesiomorfo de Hyperdidelphys. Entre los representantes de este género, H. pattersoni es el grupo hermano de un clado conformado por dos grupos monofiléticos, uno integrado por H. pawula y el otro por H. inexpectata + H. dimartinoi. Se descartan varios taxones previamente referidos a este género: (1 Hyperdidelphys brachyodonta» (Reig, 1952 es un sinónimo junior de Didelphis crucialis Ameghino, 1904; (2 Hyperdidelphys biforata (Ameghino, 1904 es una especie de Lutreolina (L. biforata n. comb., y (3 «Paradidelphys nodosu» Ameghino, 1904 es un sinónimo junior de Thylophorops perplana (Ameghino, 1904, n. comb. Es poco clara la significación bioestratigráfica de las especies de Hyperdidelphys en el contexto del Cenozoico tardío del Cono Sur sudamericano: su registro en los distintos niveles es poco frecuente, la identificación de dos de ellas (H. inexpectata y H. parvula es compleja sobre la base de las estructuras confrontables, y los biocrones de casi todas son poco restringidos en el marco estratigráfico de referencia. Las adaptaciones carnívoras de las especies de Hyperdidelphys se corresponden con un proceso general de declinación de los marsupiales Sparassodonta hacia el Mioceno tardío y Plioceno de América del Sur, un proceso que precedió a la llegada de los carnívoros placentarios inmigrantes de origen holártico a partir del

  18. Correspondencias múltiples entre índices morfológicos cefálicos y postcefálicos en aborígenes del Gran Chaco Sudamericano

    Directory of Open Access Journals (Sweden)

    Colantonio, Sonia Edith

    2002-01-01

    Full Text Available Los comportamientos correlativos de los índices cefálicos y postcefálicos en los análisis de relaciones intergrupales no han sido suficientemente explorados hasta hoy. La escasez de datos de ambos segmentos corporales ha limitado este tipo de estudios. A la vez, otras estimaciones de la "forma" mediante ajustes del "tamaño" han sido propuestas, dándose por sentada su superioridad al uso de los índices. En este ensayo se analizan la correspondencia entre formas y la eficiencia discriminante de los índices, aprovechando los datos de la colección Vellard que comprende 1734 aborígenes provenientes de 12 grupos étnicos del Gran Chaco Sudamericano. Se empleó para ello el Análisis de Homogeneidad (HOMALS, mediante el cual se calcularon los vectores propios y los "pesos" tanto de las variables (índices cuanto de los grupos en las dimensiones principales de la variación, representando gráficamente su ubicación en el sistema coordenado de las mismas. Los resultados muestran similares relaciones entre las formas de la cabeza en hombres y en mujeres, pero en éstas hay una neta independencia entre las categorías de la porción neural y las de la facial. La mayor diferenciación morfológica de los chaquenses se registra en esas regiones cefálicas, mientras que a nivel del segmento postcefálico las etnias son más semejantes. Las relaciones morfológicas interétnicas son diferentes según el sexo considerado. En el interior de cada sexo, la topología obtenida es idéntica ya se tome en cuenta solamente la cabeza o ésta conjuntamente con el cuerpo.

  19. Desarrollo de un sistema de regeneración en Papa criolla (Solanum phureja Juz et Buck var. Yema de huevo clon 1

    Directory of Open Access Journals (Sweden)

    Diazgranados Cristina

    2007-06-01

    Full Text Available

    En el presente estudio se obtuvo un 46% de regeneración en explantes sin cocultivo de Solanum phureja (Juzet et Buck variedad Yema de huevo clon 1 con la utilización del medio CIP-MS suplementado con reguladores de crecimiento (2 mg· L-1 ZR, 0,02 mg· L-1 ANA, 0,02 mg· L-1 AG3. A fin de mejorar los porcentajes de regeneración se modificó la proporción citoquininas:auxinas del CIP-MS obteniéndose un 55% de formación de callo con concentraciones de 2 mg· L -1 ZR y 0,04 mg· L-1 ANA. Posteriormente se evaluó el efecto de tres concentraciones de ácido giberélico (0,02 mg· L-1 , 0,05 mg· L-1 y 0,1 mg· L-1 obteniéndose un 87,6% de callogénesis y un 48,6% de regeneración mediante la utilización de un medio que contenía 2 mg· L-1 ZR, 0,04 mg· L-1 ANA, 0,02 mg· L-1 AG3 en explantes bajo condiciones de cocultivo. Estos resultados fueron corroborados en un segundo ensayo de regeneración bajo condiciones de cocultivo con Agrobacterium tumefaciens cepa LBA4404 transformada mediante el vector binario pNOV022, de lo cual se obtuvieron porcentajes de callogénesis y regeneración muy similares. Previamente se reportó un promedio de 4 ± 3,3 regenerantes por callo utilizando entrenudos de S. phureja mientras en este estudio se obtuvieron 15,2 ± 3 regenerantes por callo.

  20. Key to higher taxa of South American weevils based on adult characters (Coleoptera, Curculionoidea Clave de taxones superiores de gorgojos sudamericanos basada en caracteres de los adultos (Coleoptera, Curculionoidea

    Directory of Open Access Journals (Sweden)

    ADRIANA E. MARVALDI

    2005-03-01

    , Mesoptiliinae (= Magdalidinae, Molytinae, Baridinae, Lixinae, Conoderinae (= Zygopinae, Cossoninae, Scolytinae y Platypodinae. En la presente contribución se brinda una clave dicotómica para la identificación de las siete familias y 28 subfamilias de Curculionoidea sudamericanos, y para varias (21 tribus de Curculioninae y Molytinae. Estas tribus son Curculionini, Anthonomini, Ceutorhynchini, Derelomini, Otidocephalini, Erodiscini, Camarotini, Piazorhinini, Prionobrachiini, Smicronychini, Rhamphini y Tychiini, dentro de Curculioninae, e Hylobiini, Pissodini, Conotrachelini, Cleogonini, Sternechini, Pacholenini, Cholini, Petalochilini y Amalactini, dentro de Molytinae. La mayoría de estas tribus han sido clasificadas como subfamilias en los esquemas tradicionales. La clave se basa principalmente en caracteres morfológicos externos, e incluye además datos de la genitalia, piezas bucales, y rasgos biológicos de las especies. El trabajo provee definiciones e ilustraciones de los caracteres diagnósticos utilizados en la clave

  1. A synopsis of the South American Hydrovatus (Coleoptera: Dytiscidae: Hydroporinae, with notes on habitat and distribution, and a key to species Sinopsis de los Hydrovatus sudamericanos (Coleoptera: Dytiscidae: Hydroporinae, con notas sobre hábitat y distribución, y una clave para las especies

    Directory of Open Access Journals (Sweden)

    Edgardo R. Trémouilles

    2005-07-01

    Full Text Available We revised the South American members of the genus Hydrovatus Motschulsky. Each of the three recognized species is diagnosed, with emphasis on diagnostic characters. A key summarizing the main differences is provided. To identify South American specimens of H. caraibus Sharp, they were compared with Central American specimens, including type material. Based on the material examined, H. caraibus is a species broadly distributed in Central and South America, with representatives of different areas separated by minor differences. The geographical distributions of the three species are considerably enlarged: H. crassulus Sharp and H. turbinatus Zimmermann are recorded for the first time from Paraguay, and H. caraibus is recorded for the first time from Argentina and Nicaragua. Bionomical information of the species is presented.Se estudiaron los representantes sudamericanos del género Hydrovatus Motschulsky. Se diagnostica cada una de las tres especies conocidas, enfatizando el reconocimiento de caracteres valiosos para su identificación; las principales diferencias se resumen en una clave. Para identificar los ejemplares sudamericanos de H. caraibus Sharp, se los comparó con especímenes de América Central, incluyendo material tipo. En base al material examinado, H. caraibus se encuentra ampliamente distribuida en America Central y del Sur, con representantes de diferentes áreas separados por diferencias menores. Las distribuciones geográficas de las tres especies se amplían considerablemente: H. crassulus Sharp y H. turbinatus Zimmermann se citan por primera vez de Paraguay, y H. caraibus se cita por primera vez de Argentina y Nicaragua. Se presenta información bionómica de las especies.

  2. Influencia de factores agroambientales sobre la calidad del clon de cacao (Theobroma cacao L. PH-16 en la región cacaotera de Bahia, Brasil/Inuence of agro-environmental factors on the quality of cacao (Theobroma cacao L. clone PH-16 in the cacao region of Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Guilherme Amorim Homem de Abreu Loureiro

    2017-09-01

    Full Text Available Los desafíos técnicos y cientícos actuales para el cultivo del cacao implican la necesidad de evaluar múltiples atributos relacionados con la producción primaria y con los criterios de calidad. El estudio se realizó con el clon de cacao PH-16 en la zona húmeda de la región cacaotera de Bahia, Brasil. El objetivo fue conocer la inuencia del sitio de cultivo sobre las variables físicas y químicas antes y después de la fermentación de los granos de cacao. Las variables químicas más inuenciadas por el medio ambiente fueron el pH y la acidez total de los granos con mucílago, y el pH, acidez total e índice de pigmentos de los granos fermentados. El sitio de cultivo que corresponde al Argisol Amarillo Distróco latosólico, en el sistema agroforestal Cabruca con densidad media de 35 árboles de sombra por hectárea, presentó los granos con mejores atributos de calidad.

  3. Respuesta del banano (Clon «Gran Enano» a la fertirrigación con diferentes fuentes potásicas en ciénaga (Magdalena Banana response to different potassium sources in fertirrigation at Ciénaga, Magdalena

    Directory of Open Access Journals (Sweden)

    Guerrero Riascos Ricardo

    1996-06-01

    Full Text Available En un sistema de fertirrigación (por goteo se efectuó un experimento para evaluar la eficiencia agronómica y económica de dos fertilizantes potásicos (KN03 y K2S04 y su mezcla en el cultivo del banano (Clon «Gran Enano», 3ª. cepa. En comparación con el K2S04, la fertirrigación con KN03 consiguió incrementar en 4,6 kg el peso promedio por racimo (P<0,01, produjo cerca de una mano más por racimo (P<0,01 y dos dedos adicionales por mano (P<0,01, incrementando también la longitud del dedo central . La mezcla en partes iguales de KN03 y K2S04 resultó, para algunas variables, en efectos análogos, pero de magnitud cuántica y estadística inferior. El KN03, en comparación con el K2S04, incrementó el rendimiento en cajas/racimo de 1,7 a 1,9 (319 cajas/Ha y su relación Beneficio/Costo (B/C fue de 10/1.
    This experiment was conducted to examine the agronomic and economic impact of different sources of potassium (K2S04" KN03 and [K2S04 (50% + KN03 (50%] in a drip
    irrigation system in a banana farm planted with the «Gran Enano clone (3rd harvest, in Ciénaga, Colombia. In comparison with potassium sulfate, potassium nitrate increased the average weight of banana bunches in 4,6 kg (P<0,01. Potassium nitrate also produced nearly one hand more per bunch (P<0,01 and two fingers more per hand (P<0,01. In addition, fingers were larger with KN03 than with K2S04. The combination of K2S04 and KN03 produced similar effects for sorne response variables, but with lower statistical confidence. Potassium nitrate increased the yield ratio in boxeslbunch from 1,7 to 1,9 (319 boxes/Ha, and its benefit/cost was 10/1.

  4. Skull morphometrics of adult male Antartic fur seal, Arctocephalus gazella, and South American fur seal A. australis Morfometría craneana comparada de ejemplares machos adultos de lobo fino antártico, Arctocephalus gazella y lobo fino sudamericano, A. australis

    Directory of Open Access Journals (Sweden)

    Gustavo A. Daneri

    2005-09-01

    Full Text Available The skull morphometrics of adult male Antarctic fur seal, Arctocephalus gazella (Peters, 1875 and South American fur seal, A. australis (Zimmermann, 1783 were investigated using a collection of 45 and 38 skulls, respectively. Eighteen measurements were taken for each specimen. Comparative univariate and multivariate statistical analyses included standard statistics, one-way analysis of variance, principal component analysis and discriminant analysis. Individual variation was relatively high for some variables, as expressed by the coefficient of variation. Skulls of A. gazella were larger than those of A. australis for all but two variables: squamosal jugal suture and rostral length. Both species differed significantly as shown by both univariate and multivariate analyses. The discriminant function correctly classified all specimens. The standardized canonical coefficients showed that the variables which most contribute to the differentiation between species were, in decreasing order, the rostral length, palatal length, palatal width at postcanine 5 and braincase width. The present study corroborates that A. gazella and A. australis are phenotipically distinct species.Se estudió la morfometría craneana de especímenes machos adultos de lobo fino Antártico, Arctocephalus gazella (Peters, 1875 y lobo fino sudamericano, A. australis (Zimmermann, 1783, consultando una colección de 45 y 38 cráneos respectivamente. Para cada ejemplar se tomó un total de 18 medidas. El análisis comparativo univariado y multivariado incluyó estadística standard, análisis de varianza, análisis de componentes principales y análisis discriminante. La variación individual, según lo expresado por el coeficiente de variación, fue relativamente alta para algunas variables. Los cráneos de A. gazella fueron proporcionalmente más grandes que aquellos de A. australis para todas las variables estudiadas, excepto dos: longitud de la sutura escamoso-yugal y longitud

  5. CLON: Overlay Networks and Gossip Protocols for Cloud Environments

    Science.gov (United States)

    Matos, Miguel; Sousa, António; Pereira, José; Oliveira, Rui; Deliot, Eric; Murray, Paul

    Although epidemic or gossip-based multicast is a robust and scalable approach to reliable data dissemination, its inherent redundancy results in high resource consumption on both links and nodes. This problem is aggravated in settings that have costlier or resource constrained links as happens in Cloud Computing infrastructures composed by several interconnected data centers across the globe.

  6. Distribution of aquaporins in the nasal passage of Octodon degus, a South-American desert rodent and its implications for water conservation Distribución de acuaporinas en los pasajes nasales de Octodon degus, un roedor de ambientes desérticos sudamericanos: implicaciones en la conservación de agua

    Directory of Open Access Journals (Sweden)

    PEDRO GALLARDO

    2008-03-01

    Full Text Available Rodents from arid and semiarid environments live under conditions where the spatial and temporal availability of water is limited. Octodon degus is a South-American desert-dwelling rodent inhabiting arid and semiarid habitats of central and northern Chile. Its survival depends on morphological, physiological and behavioral adaptations that allow water conservation. This rodent has a high urine concentrating ability, high capacity of fecal dehydration and low evaporative water loss, related to the ability of the nasal passages to condense water from the exhaled air; this water must be absorbed in order to avoid its accumulation in the nasal passages and potential loss through the nostrils. We hypothesize that aquaporins (AQPs might be present in the nasal mucosa; therefore, we studied the distribution of AQP-1, AQP-2, AQP-3 and AQP-4 through immunocytochemistry. Intense AQP-1 labeling was observed throughout the subepithelial vascular network; no AQP-1 immunoreactivity was detected in olfactory and non-olfactory epithelial cells. No signal was detected for AQP-2 and 4. AQP-3 distribution was restricted to the surface non-olfactory epithelial cells lining the turbinates in narrow passages and blind spaces. Therefore, AQP-1 and AQP-3 coincided at the level of the turbinates, although in different cell types which suggest a pathway for water removal from the nasal surface first through AQP-3 in non-olfactory epithelial cells and then into the capillary lumen through AQP-1Los roedores de ambientes áridos y semiáridos viven bajo una disponibilidad limitada de agua tanto espacial como temporal. Octodon degus es un roedor sudamericano que habita ambientes áridos y semiáridos del norte y zona central de Chile. Su supervivencia depende de adaptaciones morfológicas, fisiológicas y conductuales que permiten optimizar la conservación de agua. Este tiene una alta capacidad de concentración urinaria y de deshidratación de la fecas además de una baja

  7. The diet of the South American sea lion (Otaria flavescens at Río Negro, Patagonia, Argentina, during the winter-spring period Dieta del lobo marino de un pelo sudamericano (Otaria flavescens en Río Negro, Patagonia, Argentina, durante el invierno y primavera

    Directory of Open Access Journals (Sweden)

    Raimundo L. Bustos

    2012-12-01

    Full Text Available The South American sea lion, Otaria flavescens (Shaw, 1800 population is steadily expanding along the Patagonian coast of Argentina in the last decades. However, little is known about the feeding ecology of the species in the area. The aim of this study was to analyze the food habits of O. flavescens from 91 scats collected at Río Negro province, during the winter and spring of 2005. Fish occurred in 96% of scats containing prey remains, followed by cephalopods (26%. Raneya brasiliensis (Kaup, 1856 was the most frequent and abundant species occurring in 58.6% of samples and constituting almost 50% of fish predated. Second in importance were Porichthys porosissimus (Cuvier, 1829 and Cynoscion guatucupa (Cuvier, 1830 in terms of occurrence (%FO 20.7 and numbers (29.6% respectively. The squid Loligo gahi (d'Orbigny, 1835 was the most frequent cephalopod prey (42.1%, whereas Octopus tehuelchus (d'Orbigny, 1834 was the most abundant (77%. The higher amount and diversity of prey found in the spring in comparison with the winter season might be related to a higher feeding activity of seals or to a seasonal increase in food availability in the area.La población del lobo marino de un pelo sudamericano Otaria flavescens (Shaw, 1800 ha experimentado un crecimiento continuo en las ultimas décadas en las costas de la Patagonia Argentina. Sin embargo, poco se conoce sobre la ecología trófica de la especie en el área. El objetivo de este estudio fue analizar los hábitos alimentarios de O. flavescens a partir de 91 fecas colectadas en la provincia de Río Negro, durante el invierno y la primavera del 2005. Los peces estuvieron presentes en el 96% de las fecas que contenían remanentes presas, seguidos por los cefalópodos (26%. Raneya brasiliensis (Kaup, 1856 fue la especie mas frecuente y abundante ocurriendo en el 58.6% de las muestras y constituyendo casi el 50% de los peces predados. Le siguieron en importancia Porichthys porosissimus (Cuvier, 1829 y

  8. Uso referido de medicamentos e suplementos alimentares nos atletas selecionados para controle de doping nos Jogos Sul-Americanos Uso referido de medicinas y suplementos alimenticios en los atletas seleccionados para control de doping en los Juegos Sudamericanos Referred use of medication and dietary supplements in athletes selected for doping control in the South-American Games

    Directory of Open Access Journals (Sweden)

    Eduardo Henrique De Rose

    2006-10-01

    Full Text Available O objetivo do presente estudo foi descrever a prevalência do uso de medicamentos e suplementos alimentares em atletas que participaram dos controles obrigatórios de dopagem dos VII Jogos Desportivos Sul-Americanos, realizados em quatro cidades brasileiras, analisando estatisticamente um quesito proposto no controle de dopagem e relativo às substâncias utilizadas nos dias que antecederam a competição. Foram analisados dados coletados em 234 atletas de 25 esportes dos Jogos, 136 do sexo masculino e 98 do feminino, distribuídos entre os 13 países participantes. Constatou-se que no controle de doping, 44% dos atletas informaram a utilização de medicamentos até três dias antes da competição. Estes medicamentos foram classificados em antiinflamatórios não esteróides (AINEs (24,8%, analgésicos (15,9%, antibióticos (4,3%, antigripais (3% e outros medicamentos (19,3%. Relataram o uso de suplementos alimentares 50% de atletas da amostra estudada, sendo este grupo dividido em vitaminas (39,7%, sais minerais (21,9%, aminoácidos (18,9% e outras substâncias (13,3%. Os autores concluem que há um uso exagerado de antiinflamatórios e analgésicos em várias modalidades desportivas, o que causa preocupação em termos de controle de sintomatologia dos atletas em competição, além de uso excessivo de suplementos alimentares, para os quais não existe indicação específica, e que podem ocasionar um eventual resultado analítico adverso no controle de doping por contaminação ou manipulação.El objetivo del presente estudio ha sido el de describir la prevalencia del uso de medicamentos y suplementos alimenticios en atletas que participaron de los controles obligatorios de dopaje de los VII Juegos Deportivos Sudamericanos, realizados en cuatro ciudades brasileñas, analizando estadísticamente un requisito propuesto en el control de dopaje relativo a substancias utilizadas durante días que antecedieron a la competición. Fueron

  9. Rio de Janeiro y el Campeonato Sudamericano de Futbol de 1919: América del Sur corre detrás de una bola = Rio de Janeiro and the 1919 South American Football Championship: South America runs for a ball Rio de Janeiro e o Campeonato Sul-Americano de futebol de 1919: América do Sul a correr atráz de uma bola

    Directory of Open Access Journals (Sweden)

    João M.C. Malaia Santos

    2013-03-01

    Full Text Available El actual artículo pretende analizar la primera gran competición internacional del fútbol celebrada en Brasil, el Campeonato Sudamericano de Fútbol de 1919, que tuvo lugar en Río de Janeiro. El objetivo es discutir las cuestiones relativas a la organización de la competición, la selección brasileña de fútbol, los intentos de representación del equipo con elementos que identificaran a los jugadores con valores nacionales a través de la gran prensa carioca y paulista y el papel de los espectadores en este proceso. Usando las fuentes impresas y la metodología de la Historia Económica, la intención es poner al lector en contacto con una gran gama de elementos para el estudio de las grandes competiciones deportivas internacionales.------------------------------------------------------------------------------The present article aims at analyzing the first great international football tournament hosted by Brazil, the 1919 South American Football Championship held in Rio de Janeiro. The objective is to discuss questions concerning the organization of the competition, the national football team, the attempts of the great press of Rio de Janeiro and Sao Paulo to represent the team with elements that could identify the players with national values and the role played by the spectators in this process. Using printed documents and the methodology of economic history, the intention is to put the reader in contact with a range of elements for the study of major international sport competitions.O presente artigo destina-se a analisar a primeira grande competição de futebol sediada no Brasil, o Campeonato Sul-Americano de 1919, que aconteceu no Rio de Janeiro. Os objetivos é problematizar as questões que envolveram a organização do torneio, da seleção brasileira de futebol, as tentativas de representação da equipe com elementos que identificassem os jogadores a valores nacionais através da grande imprensa carioca e paulista e o papel

  10. Partial clonning cytogenetic and linkage mapping of the porcine resistin (RSTN) gene

    Czech Academy of Sciences Publication Activity Database

    Čepica, Stanislav; Rohrer, G. A.; Masopust, m.; Kubíčková, S.; Musilová, P.; Rubeš, J.

    2002-01-01

    Roč. 33, - (2002), s. 381-383 ISSN 0268-9146 R&D Projects: GA ČR GA523/99/0842; GA AV ČR KSK5052113 Keywords : cytogenetic and linkage mapping Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.443, year: 2002

  11. Editorial: invitación al segundo congreso sudamericano de neurología

    OpenAIRE

    Revista, Facultad de Medicina

    2011-01-01

    Estimado colega: tenemos el agrado de invitarlo al Segundo Congreso Latino Americano de Neurocirugía que se celebrará en Santiago de Chile, en abril de 1947.Los temas oficiales han sido distribuidos a los diferentes servicios de Neurocirugía de Argentina, Brasil, Chile, Perú y Uruguay.

  12. Expresiones conceptuales del insólito en el espacio literario sudamericano

    Directory of Open Access Journals (Sweden)

    Luciana Mazzutti

    2015-07-01

    Full Text Available Esta investigación pretende esclarecer el uso indiscriminado de los términos que, a principio, “catalogaban” la obra literaria hispano-americana; y, de cierto modo, corroboraron con el deslizamiento que se instauró en la definición de los conceptos del Realismo Mágico, Realismo Maravilloso y Fantástico. El estudio teórico-literario visa entender especialmente la incidencia de esas dos últimas modalidades narrativas del Insólito en la América del Sur, sin desconsiderar la cultura de ese continente, pero asociándolo al mapeo literario que, no obstante, no niega zonas de contactos y diálogos. Buscamos, así, articular una discusión que, a partir, del enraizamiento en los campos de la crítica y de la historia literaria, no sólo destaca la especial configuración del Insólito en la literatura sudamericana, pero también establece la modalidad que contribuyó/e para con la visualización y la representación de la diversidad cultural. Nos valemos de una pesquisa con metodología de cuño bibliográfico que aspira analizar, caracterizar, definir y consignar diferencias pertinentes a las modalidades insólitas en cuestión.

  13. Evidence of heritable lethal mutations in progeny of X-irradiated CHO cells by micronucleus count in clon-cells

    International Nuclear Information System (INIS)

    Hagemann, G.; Kreczik, A.; Treichel, M.

    1996-01-01

    Low doses of ionizing radiation reduce the growth rates of clones following irradiation of the progenitor cells. Such reductions of clone growth have been proven by means of measurements of clone size distributions. The medians of such distributions can be used to quantify the radiation damage. Prolongations of generation times and cell death as result of heritable lethal mutations have been discussed as causes for the reduction of clone growth. The cell number of a clone of hypotetraploid CHO-cells was compared to the frequency of micronucleated binucleated cells in the same clone using the cytokinesis-block-micronucleus method. The dose dependent reduction of clone sizes is measured by the difference of the medians (after log transformation) of the clone size distributions. At cytochalasin-B concentrations of 1 μg/ml and after an incubation time of 16 h a yield of binucleated cells of about 50% was obtained. Median clone size differences as a measure of clonal radiation damage increased linearly with incubation times of 76, 100, 124, and 240 h following irradiation with 3, 5, 7, and 12 Gy. The frequency of binucleated clone cells with micronuclei strongly increased with decreasing clone size by a factor up to 20 following irradiation with 3, 5, and 7 Gy. The frequency of micronucleated binucleated clone cells was found to be independent of incubation time after irradiation. Radiation induced clone size reductions result from cell losses caused by intraclonal expression of micronuclei which have its origin in heritable lethal mutations. Measurements of clone size distributions can be done automatically. They can serve as predictive test for determination of median cell loss rates of surviving cell clones. (orig./MG) [de

  14. Impacto de las condiciones de beneficio sobre los compuestos precursores de aroma en granos de cacao (Theobroma cacao L del clon CCN-51.

    Directory of Open Access Journals (Sweden)

    Andrea Pallares Pallares

    2016-01-01

    Full Text Available Abstract The influence of the days of fermentation and drying in the aroma compounds (volatile fraction of cocoa beans CCN-51 was evaluated. The method used was Gas ChromatographyMass Spectrometry, coupled to Head Space Solid Phase Micro Extraction (HS-SPMEGC-GS. A multifactorial experimental design was created, containing 15 experiments per repetition. The fermentation technique was microfermentation in boxes, while drying was achieved by exposing the samples to the sun. A Principal Component Analysis (PCA allowed to explain 68% of the total variability associated with aroma characteristics (volatile compounds. Both, desirable and undesirable compounds were identified throughout the processes of fermentation and drying. The benefit process (fermentation and drying was divided in stages depending on the degree of fermentation. The desirable compounds identified were: 3-methy-1-butanol, 2-phenyl-ethanol, benzaldehyde, phenyl acetaldehyde, ethylhexanoate, ethyl benzoate, ethylphenyl acetate and 2-phenyl ethyl acetate, which are associated with odoriferous notes very nice (chocolate, candy, sweet, nutty, honey, fruity, floral. Finally, a pre-treatment of cocoa beans CCN-51 prior to fermentation was proposed to be incorporated during the benefit of the beans as it seems to enhance the formation of desirable aroma compounds.

  15. El efecto de las plantaciones forestales sobre el funcionamiento de los ecosistemas sudamericanos / The effect of tree plantations on south american ecosystems functioning

    Directory of Open Access Journals (Sweden)

    Germán Baldi

    2008-09-01

    Full Text Available El establecimiento de plantaciones forestales sobre áreas bajo vegetaciónoriginal o uso agrícolo-ganadero se expande en la mayoría de los países de Sudamérica, incentivado por los altos rendimientos, el apoyo fi scal y por el inminente comercio de bonos de carbono. En este trabajo se evaluócómo esta transformación afecta la producción de biomasa y la dinámicadel agua sintetizando información preexistente y original. Mediciones satelitales muestran que el “Índice de Vegetación de DiferenciasNormalizadas” (NDVI de las plantaciones forestales superó a la dela matriz del paisaje agrícolo-ganadera en todos los países y regiones ecológicas analizadas y –con excepción de los bosques valdivianos- a todos los tipos de vegetación original. A escala regional, este aumento enla productividad fue acompañado en el litoral del Río Uruguay por una mayor evapotranspiración y un menor rendimiento hidrológico que redujoa la mitad el caudal de cuencas forestadas, en acuerdo con lo observado en pastizales forestados de la región. Es apremiante generar informaciónacerca de otros impactos de las forestaciones tales como cambios en la dinámica del fuego y el avance de especies invasoras. Reconocer integralmente la infl uencia de las forestaciones sobre la producción de servicios y bienes permitirá plantear sistemas y políticas forestales más sustentables y útiles para la sociedad.

  16. Noticias y política en diarios sudamericanos. El tratamiento noticioso del rol de UNASUR en Venezuela (marzo de 2014

    Directory of Open Access Journals (Sweden)

    María Alaniz

    2015-10-01

    Full Text Available El texto presenta el tratamiento informativo que la prensa escrita realizó en torno al papel de la Unión de Naciones Suramericanas (UNASUR ante el conflicto socio-político venezolano en marzo de 2014. Se caracteriza la UNASUR y su constitución como organismo que fortalece los lazos de integración regional. Luego, se considera el rol de los medios informativos en la visibilización de temas relevantes para la sociedad y la confi-guración de percepciones y sentidos otorgados a los mismos. En este sentido, se analizan los criterios noticiosos de los diarios El Universal (Venezuela, El Tiempo (Colombia, El Comercio (Ecuador y El Peruano (Perú.

  17. Chemistry, Dynamics, and Radiation of Ozone Loss: Airborne Measurements of OH, HO2, N02, Cl0, BrO, IO, ClON02, BrON02, CIOOCl, and H2O

    Science.gov (United States)

    Anderson, James G.

    2005-01-01

    This research addresses, through a combination of in situ and remote aircraft-borne Which mechanisms are responsible for the continuing erosion of ozone over midlatitudes of the Northern Hemisphere? Will the rapid loss of ozone over the Arctic in late winter continue to worsen over the next two decades? Are these large losses dynamically coupled to midlatitudes? Which mechanisms dictate the rate of exchange of material between the troposphere and stratosphere? How will these processes change in response to changes in climate? Will regional scale pollution episodes, that are emerging as predictable seasonal events, significantly affect the middle-to-upper troposphere chemical composition. If so, how will these changes alter the chemical composition of the middle world? What changes are predicted for the overworld? Why has the arctic stratosphere become colder in the late winter phase in recent years? Have increases in tropical upper troposphere temperatures increased the temperature gradient such as to change the trajectories of vertically propagating waves, thus reducing the effectiveness of the meridional circulation for transport of heat, momentum and ozone from the tropics to high latitudes?

  18. Comercio y atlantización del Pacífico mexicano y sudamericano: La crisis del lago indiano y del Galeón de Manila, 1750-1821

    Directory of Open Access Journals (Sweden)

    Mariano Ardash Bonialian Assadourian

    2017-01-01

    Full Text Available The essay has to aims to identify the factors that contributed to the crisis and disappearance of a trading system that was developed by the colonial Pacific between 1580 and 1750. They identified three reasons, all of which occurred in the period from 1750 to 1821. The first, the appearance on the scene of the peninsular commercial companies by the Pacific novohispano begin to compete commercially with the Manila galleon under review. The second reason is about the market close Peru foreign goods trade from Acapulco, through the opening of the route around Cabo de Hornos (1740 for the registration of ships traffic from Europe. The third one examines the British trade between Jamaica, Panama and the Mexican port of San Blas in the early decades of the nineteenth century.

  19. Utilización de hematíes de primates sudamericanos en la prueba inhibición de hemaglutinación para el diagnóstico del Virus del Sarampión

    Directory of Open Access Journals (Sweden)

    Rosa Palacios

    1997-07-01

    Full Text Available La utilidad del empleo de hematíes de especies sudamericanas de primates no humanos durante pruebas de hemaglutinación e inhibición de la hemaglutinación con virus sarampión ha sido evaluada. El estudio se Ilevó a cabo en 18 meses, habiéndose iniciado a fines de 1995 y terminado a comienzos de 1997. Se obtuvo muestras de sangre de primates en solución citratada, en la sede del Instituto de Investigaciones Tropicales y de Altura en Iquitos (IVITA y en el Parque de las Leyendas en Lima; el procesamiento se realizó en el Laboratorio de Virología del Instituto Nacional de Salud. Se analizaron muestras de 22 primates de 8 especies de la Amazonía peruana, probándolos en paralelo con hematíes patrón de monos Rhesus y Cercophitecus, por hemaglutinación con antígeno purificado de virus sarampión. Las especies Saimiri boliviensis peruvianus y Sanguinus mystax exhibieron afinidad hemaglutinante con el virus, siendo ésta parcial o incompleta y no persistente, con elusión espontánea a los 30 minutos. Se hizo ensayos de inhibición de hemaglutinación con sueros pareados de personas que estuvieron con infección sarampionosa 10 a 15 días antes de obtener la segunda muestra. No se recomienda su empleo rutinario durante encuestas serológicas por IHA, dados los sesgos en lecturas e interpretación que podrián presentarse.

  20. La Mobilización de Recursos Estratégicos como Perspectiva de Análisis de Proceso de Internacionalización: La Expansión de Azaleia para el Mercado Sudamericano.

    Directory of Open Access Journals (Sweden)

    Juliana Balin Suzin

    2014-03-01

    Full Text Available The aim of this article is to identify and analyze strategic resources mobilization as a theoretical perspective to evaluate the internationalization process, searching to contribute beyond the usual interpretation. The purpose was to investigate how the resource articulation developed by an organization can contribute to the internationalization process, ant its influences on the operations and competitiveness. In the empiric field, a qualitative research through a case study was conducted in Vulcabrás/Azaleia company, focusing on the implementation of subsidiaries for selling and distribution in Colombia, Peru and Chile. The main competencies identified and found in this study were: Capacity of Understanding the Market (DAY, 1994; KNIGHT; LIESCH, 2002, WEERAWARDENA, 2003; Capacity of Learning with a Focus on Internal Environment (WEERAWARDENA, 2003; and Networking Capacity (AXELSSON; JOHANSON, 1992; JOHANSON; VAHLNE, 2009; WEERAWARDENA, 2003. The results indicated that the development and adaptation of the three global operations were dependent on the resources mobilization and have been promoting the construction of these skills as articulators of the internationalization process.

  1. Nutritional ecology and digestive response to dietary shift in the large South American fox, Pseudalopex culpaeus Ecología nutricional y respuesta digestiva a cambios en la dieta en el zorro sudamericano grande, Pseudalopex culpaeus

    Directory of Open Access Journals (Sweden)

    SERGIO I. SILVA

    2005-06-01

    Full Text Available We tested the role of dietary shifts (from rodents to fruits and to mixed diets on the nutritional ecology of the culpeo fox Pseudalopex culpaeus, a native canid of South America. We studied the effects of food quality on digestive processes, nutrition, and mass balance, and the implications of diet quality for fox survival. We observed at the end of the nutritional trials that body mass differed significantly between the three diet groups (fruits, rats and mixed diets, while percentage of body mass change differed significantly only in the fruit diet treatment. Foxes fed with fruits consumed more food to meet their dietary and metabolic needs. Across diets, dry-matter as well as energy digestibility increased significantly with diet quality. Also, mean retention time was negatively and significantly correlated with dry-matter intake. We put forth that mixed diet may yield higher assimilation efficiencies and hence higher nutrient intakes than those predicted from the ingestion and assimilation of pure diets (i.e,. only rats, only fruits. We hypothesize that during periods of low availability of mammalian prey, a mixed diet should yield a positive energy/mass balance for the fox. We conclude that temporal and spatial variation in nutrient, energy, and water contents of prey available in a given habitat could have an important effect on fox nutrition, energy use, and mass balance. Finally, we postulate that P. culpaeus could not survive on fruits only past seven daysSometimos a prueba el papel del cambio de dieta (desde roedores a frutos y dieta mixta sobre la ecología nutricional del zorro culpeo Pseudalopex culpaeus, especie nativa de Sudamérica. Estudiamos el efecto de la calidad del alimento sobre los procesos digestivos, nutrición, balance de masas y las implicancias de la calidad de la dieta sobre la sobrevivencia de los zorros. La masa corporal al final de los ensayos nutricionales difirió significativamente entre los tres grupos de dietas (frutos, ratas y dieta mixta, en tanto que el porcentaje de cambio en masa corporal solo fue significativo en el caso de la dieta de frutos. Los zorros alimentados con frutos consumieron más alimento para satisfacer sus necesidades dietarias y metabólicas. Tanto la ingesta de materia seca como la digestibilidad se incrementaron significativamente con la calidad de la dieta. Más aún, el tiempo de retención promedio estuvo negativa y significativamente correlacionado con la ingesta de materia seca. Pensamos que la dieta mixta puede entregar mayores eficiencias de asimilación y por lo tanto mayores ingestas de nutrientes que lo predicho por la ingesta y asimilación de dietas puras (i.e., solo ratas, solo frutos. Proponemos la hipótesis que durante períodos de baja disponibilidad de presas (micromamíferos una ingesta de dieta mixta podría entregar un balance energía/masa positivo para los zorros. Concluímos que la variación temporal y espacial de nutrientes, energía y contenido de agua presente en las presas disponibles en un determinado hábitat puede tener un importante efecto sobre la nutrición, uso de energía y balance de masa de los zorros. Finalmente, postulamos que P. culpaeus no puede sobrevivir con una dieta exclusivamente de frutos mas allá de siete días

  2. EL USO DE LAS TECNOLOGÍAS DE LA INFORMACIÓN Y COMUNICACIÓN (TIC POR LOS MIGRANTES SUDAMERICANOS EN LA ARGENTINA Y LA CONFORMACIÓN DE REDES SOCIALES TRANSNACIONALES

    Directory of Open Access Journals (Sweden)

    Cecilia MELELLA

    Full Text Available Resumo El uso de las TIC implica un punto de inflexión para los procesos migratorios tradicionales al posibilitar que el migrante desarraigado se transforme en migrante conectado. Las TIC, y en especial Internet, generan un universo frondoso de posibilidades de conexión y comunicación con los países de origen, con la diáspora y con la colectividad en destino que modifica la construcción de la subjetividad migrante y conforman redes sociales transnacionales. En este artículo, nos proyectamos dar cuenta de la importancia de las TIC, más allá de considerarse herramientas y artefactos culturales de la esfera pública, como dispositivos a los que los migrantes recurren para construir un espacio referencial que admite la conservación de vínculos asiduos con las redes sociales en origen y se mitiga o reconfigura la nostalgia de la ausencia y/o del retorno. Nos proponemos, a través de la realización de entrevistas en profundidad y cuestionarios, estudiar los medios y las tecnologías más utilizadas por los individuos pertenecientes a estos grupos para comunicarse con sus redes sociales en origen, las causas de su elección, los usos más frecuentes y las temáticas que despiertan su interés a la hora de recurrir a estos dispositivos tecnológicos.

  3. Estudio fisicoquímico de la solubilidad del clonixinato de lisina en mezclas etanol + agua

    OpenAIRE

    Gutiérrez Castro, Rahumir Alfredo

    2012-01-01

    En el presente trabajo se presenta la información fisicoquímica del proceso de disolución en mezclas binarias etanol + agua de Clonixinato de lisina (ClonLis) en diferentes temperaturas. A partir de los datos experimentales de solubilidad determinados a diferentes temperaturas, mediante el uso de las ecuaciones de Van't Hoff y Gibbs, se calcularon las funciones termodinámicas estándar aparentes de solución, energía de Gibbs, entalpía y entropía de solución. La mayor solubilidad de ClonLis fu...

  4. Evaluación microbiológica y epidemiológica de los clones de Acinetobacter baumannii resistentes a los carbapenemes aislados en la unidad de cuidados intensivos de un Hospital Universitario de la ciudad de Buenos Aires Microbiological and epidemiological evaluation of carbapenem-resistant Acinetobacter baumannii clones isolated at an intensive care unit of a University Hospital in Buenos Aires city

    Directory of Open Access Journals (Sweden)

    C. H. Rodriguez

    2009-09-01

    Full Text Available Entre junio y diciembre de 2004 se estudiaron 33 aislamientos de Acinetobacter baumannii resistentes a los carbapenemes, aislados de materiales clínicos de 29 pacientes internados en la unidad de cuidados intensivos del Hospital de Clínicas de la Universidad de Buenos Aires. La distribución clonal de esos aislamientos fue la siguiente: clon I (n = 14, clon IV (n = 7, clon III (n = 6, clon VI (n = 3, clon II (n = 2 y clon X (n = 1.Veintiún aislamientos se recuperaron de materiales del tracto respiratorio inferior, 11 de ellos pertenecieron al clon I. Casi todos los aislamientos pertenecientes al clon III (5/6 se recuperaron de materiales no respiratorios, y todos los del clon IV se recuperaron de pacientes que no recibieron imipenem. En los aislamientos pertenecientes a los clones I y III se observó una mayor adherencia a catéteres, principalmente en los asociados con bacteriemias. La mayoría de los aislamientos de los clones I y IV sobrevivieron en materiales inertes durante un período superior a los 5 días. La totalidad de los aislamientos del clon III fueron sensibles a colistina, gentamicina y levofloxacina, mientras que los del clon I y la mayoría de los del clon IV sólo fueron sensibles a colistina y tetraciclinas.From June to December 2004, thirty-three carbapenem-resistant Acinetobacter baumannii isolates recovered from twenty nine patients at the intensive care unit in Hospital de Clínicas, Universidad de Buenos Aires, were studied. The isolates were categorized by molecular methods as: clone I (n = 14, clon IV (n = 7, clone III (n = 6, clone VI (n = 3, clone II (n = 2 and clone X (n = 1. Twenty one isolates were recovered from lower respiratory tract samples, 11 of which belonged to clon I. Clone III isolates were mainly recovered from non-respiratory samples (5/6. Clone IV isolates were recovered from patients not receiving previous imipenem therapy. The majority of the isolates belonging to clones I and IV were able to

  5. Evaluación de la severidad, proporcionalidad y riesgo de muerte de recién nacidos de muy bajo peso con restricción del crecimiento fetal: análisis multicéntrico sudamericano An assessment of the severity, proportionality and risk of mortality of very low birth weight infants with fetal growth restriction: a multicenter South American analysis

    Directory of Open Access Journals (Sweden)

    Carlos Grandi

    2005-06-01

    Full Text Available OBJETIVOS: 1 evaluar la severidad y la proporcionalidad de los PEG para diferentes grados de prematurez; 2 estimar el riesgo de mortalidad de los PEG según la severidad y proporcionalidad. MATERIAL Y MÉTODOS: Diseño observacional y analítico. Población: todos los recién nacidos de muy bajo peso (RNMPB entre 25 y 36 semanas que mantiene el grupo NEOCOSUR (n = 1.518. Índices antropométricos: a peso de nacimiento (PN 0,55 y la transformación z del índice ponderal (Ponderal Index, PI = g/cm³ x 100. Restricción del crecimiento intrauterino (RCIU asimétrico: score z OBJECTIVES: To evaluate the clinical severity and proportionality of small for gestational age, very low birth weight neonates (< 1,500 g and to estimate the neonatal mortality risk associated with the condition of being small for gestational age according to the degree of severity and proportionality. METHODS: Observational design. All of the NEOCOSUR Collaborative Group's very low birth weight infants (25-36 weeks' gestation were included (n = 1,518. Anthropometric indices: birth weight < 3rd and 10th percentile. Severity (fetal growth ratio = observed weight/mean birth weight for gestational age; no growth restriction: fetal growth ratio 0.90-1.10, mild: fetal growth ratio 0.80-0.89, moderate: fetal growth ratio 0.75-0.79 and severe: fetal growth ratio < 0.75. Proportionality: coefficient of bimodality and z score for ponderal index (PI = g/cm³ *100. Neonatal mortality until discharge. RESULTS: < 3rd percentile: 13.5% (p < 0.001; < 10th percentile: 31% (p < 0.001; fetal growth ratio: 0.90±0.21 (p < 0.001, mild restriction: 20.8%, moderate restriction: 8.7% and severe restriction: 32.6%. Coefficient of bimodality: 0.53; PI z score < -1: 8%. Maternal hypertensive disease was systematically associated with being small for gestational age (aOR 1.20, 95% CI 0.86-1.67, fetal growth ratio < 0.89 (aOR 1.71, 1.24-2.36 and PI z score < -1 (aOR 1.60, 1.03-2.41. Adjusted odds ratios for neonatal mortality were: 2.64 (95% CI 1.71-3.92 for being small for gestational age, 2.76 (95% CI 1.85-4.10 for fetal growth ratio < 0.89, and 1.37 (95% CI 0.80-2.32 for z score PI < -1. CONCLUSIONS: Small for gestational age, mostly symmetric and severe restriction is a frequent condition in < 1,500 g neonates and is associated with higher mortality rates.

  6. New forms of sampling for minority and hidden populations: respondent samples conducted in a south american immigrant population [Nuevas formas de muestreo para minorías y poblaciones ocultas: muestras por encuestado conducido en una población de inmigrantes sudamericanos

    Directory of Open Access Journals (Sweden)

    José Manuel Cárdenas Castro

    2012-06-01

    Full Text Available The Respondent-Driven Sampling (RDS is a method of sampling for hidden or hard-to-reach populations. This is a procedure for estimating the repre- sentativeness of the sample in those groups that is unknow the sampling frame. This study presents both the theoretical description of this form of sampling as the report of its practical application in the case of ethnic minorities (immigrants Bolivians, Peruvians and Colombians in northern Chile. The study started with 8 seeds and recruited a total sample of 109 people from Colombia, Peru and Bolivia. The information resulting from the procedure RDS reports a similar pattern of recruitment for men and women, reflecting the sizes of the networks of both groups did not differ significantly.

  7. Genotype, phenotype and cancer: Role of low penetrance genes ...

    Indian Academy of Sciences (India)

    Unknown

    cancer families using linkage analysis and positional clon- ing and have ... Analysis of such data provide evidence ..... polygenic disorders like cancer, diabetes, obesity etc. it is ... Boffetta P 2003 Meta- and pooled analyses of GSTM1,. GSTT1 ...

  8. Caracterización molecular de aislamientos invasores colombianos de Streptococcus pneumoniae serotipo 5, recuperados entre 1994 y 2004

    Directory of Open Access Journals (Sweden)

    Sandra Carolina Firacative Ropero

    2006-01-01

    resistentes a tetraciclina y cloranfenicol, estuvieron relacionados con el patrón electroforético A (n=32 y los subtipos A16 (n=1 y A28 (n=1, caracterizados por presentar una banda de 340 Kb, al igual que el clon. Estos resultados muestran la prevalencia y circulación continua de aislamientos de S. pneumoniae serotipo 5, los cuales están genéticamente relacionados con el clon 19-Colombia.

  9. alpha-Adrenoceptor and opioid receptor modulation of clonidine-induced antinociception.

    Science.gov (United States)

    Sierralta, F; Naquira, D; Pinardi, G; Miranda, H F

    1996-10-01

    1. The antinociceptive action of clonidine (Clon) and the interactions with alpha 1, alpha 2 adrenoceptor and opioid receptor antagonists was evaluated in mice by use of chemical algesiometric test (acetic acid writhing test). 2. Clon produced a dose-dependent antinociceptive action and the ED50 for intracerebroventricular (i.c.v.) was lower than for intraperitoneal (i.p.) administration (1 ng kg-1 vs 300 ng kg-1). The parallelism of the dose-response curves indicates activation of a common receptor subtype. 3. Systemic administration of prazosin and terazosin displayed antinociceptive activity. Pretreatment with prazosin produced a dual action: i.c.v. Clon effect did not change, and i.p. Clon effect was enhanced. Yohimbine i.c.v. or i.p. did not induce antinonciception, but antagonized Clon-induced activity. These results suggest that alpha 1- and alpha 2-adrenoceptors, either located at the pre- and/or post-synaptic level, are involved in the control of spinal antinociception. 4. Naloxone (NX) and naltrexone (NTX) induced antinociceptive effects at low doses (microgram kg-1 range) and a lower antinociceptive effect at higher doses (mg kg-1 range). Low doses of NX or NTX antagonized Clon antinociception, possibly in relation to a preferential mu opioid receptor antagonism. In contrast, high doses of NX or NTX increased the antinociceptive activity of Clon, which could be due to an enhanced inhibition of the release of substance P. 5. The results obtained in the present work suggest the involvement of alpha 1-, alpha 2-adrenoceptor and opioid receptors in the modulation of the antinociceptive activity of clonidine, which seems to be exerted either at spinal and/or supraspinal level.

  10. Tuta absoluta: una nueva plaga para el cultivo del tomate en Europa (Sesión Técnia: Hortalizas)

    NARCIS (Netherlands)

    Stol, W.; Griepink, F.C.; Deventer, van P.

    2009-01-01

    Tuta absoluta es una polilla originaria de Chile cuyas larvas producen minas en las hojas de las plantas de tomate. En las últimas décadas de este insecto se ha extendido por gran parte del continente sudamericano. Después de su primera observación en Europa (España, Valencia) en 2007, esta polilla

  11. Tuta absoluta: una nueva plaga para el cultivo del tomate en Europa (Sesión Técnia: Hortalizas). II Jornadas sobre feromonas, atrayentes, trampas y Control Biológico: Alternativas para la agricultura del siglo XXI

    NARCIS (Netherlands)

    Stol, W.; Griepink, F.C.; Deventer, van P.

    2009-01-01

    Tuta absoluta es una polilla originaria de Chile cuyas larvas producen minas en las hojas de las plantas de tomate. En las últimas décadas de este insecto se ha extendido por gran parte del continente sudamericano. Después de su primera observación en Europa (España, Valencia) en 2007, esta polilla

  12. Caracterización biológica y genética de dos clones pertenecientes a los grupos I y II de Trypanosoma cruzi de Colombia

    Directory of Open Access Journals (Sweden)

    Luz Adriana Botero

    2007-01-01

    Resultados. El clon T. cruzi I fue más infectivo, observándose un tropismo preferencial por corazón, recto y músculo esquelético, mientras que el clon T. cruzi II presentó un tropismo preferencial por bazo e hígado. Durante la infección con la mezcla de los clones, se observó que el clon T. cruzi I predominó sobre el T. cruzi II tanto en sangre como en órganos. Conclusiones. Los resultados confirman que las diferencias genéticas entre los grupos de T. cruzi podrían estar determinando el tropismo tisular y de esta manera jugar un papel fundamental en el entendimiento de las manifestaciones clínicas de la enfermedad de Chagas en Colombia.

  13. Caracterización molecular de aislamientos invasores colombianos de Streptococcus pneumoniae serotipo 5 recuperados entre 1994 y 2004.

    Directory of Open Access Journals (Sweden)

    Carolina Firacative

    2006-06-01

    Full Text Available Introducción. Streptococcus pneumoniae serotipo 5 es causa importante de enfermedad invasora en Colombia, donde se ha demostrado la circulación del clon 19-Colombia(5 susceptible a penicilina pero resistente a tetraciclina y a cloranfenicol. Objetivo. Establecer las relaciones genéticas de aislamientos invasores colombianos de S. pneumoniae serotipo 5 recuperados entre 1994 y 2004 con el clon 19-Colombia(5. Materiales y métodos. Se estudiaron 83 aislamientos que tenían datos de susceptibilidad a penicilina, vancomicina, ceftriaxona, eritromicina, trimetoprim sulfametoxazol, cloranfenicol y tetraciclina, de los cuales 29 fueron obtenidos de niños menores de cinco años. El patrón de restricción del ADN se determinó por electroforesis en gel de campo pulsado, usando la enzima Sma I. La similitud genética entre los aislamientos y el clon se estableció según los criterios de Tenover y utilizando el programa Fingerprinting II. Resultados. Todos los aislamientos se relacionaron con el clon 19-Colombia5 y se agruparon en el patrón electroforético A con 17 subtipos. El patrón A se estableció en 32 aislamientos (38,6%, el A8 en 18 (21,7% y el A5 en 10 (12%, los 15 patrones restantes agruparon los otros 23 aislamientos. Los 34 aislamientos resistentes a tetraciclina y cloranfenicol mostraron relación con los patrones electroforéticos A (n = 32, A16 (n = 1 y A28 (n = 1, caracterizados, al igual que el clon, por presentar una banda de 340 Kb. Conclusión. Estos resultados muestran la circulación continua en el país de aislamientos de S. pneumoniae serotipo 5 genéticamente relacionados con el clon 19-Colombia(5.

  14. ADHD & Tourette Syndrome

    Directory of Open Access Journals (Sweden)

    J Gordon Millichap

    2002-03-01

    Full Text Available The efficacy of methylphenidate (MPH and clonidine (CLON, alone and in combination, in 136 children with attention deficit hyperactivity disorder (ADHD and chronic tic disorder, was evaluated in a multicenter, randomized, double-blind clinical trial, and reported by the Tourette Syndrome Study Group from the University of Rochester, NY.

  15. GETDB: 114071 [GETDB

    Lifescience Database Archive (English)

    Full Text Available 090 3 NP line. Received from the National Institute of Genetics. TM6UW23-1 - 2 - - 0 - weak tr (DT) sg, tr -...0 Chr. 3 Comments NP line. Received from the National Institute of Genetics. Balancer TM6UW23-1 Link to Clon

  16. Submission to GenBank of the Plasma membrane intrinsic protein (PIP) Subfamily in Cotton – GenBank Accession No. GU998827-GU998830 and GenBank Accession TPA;inferential No. BK007045-BK007052

    Science.gov (United States)

    The plasma membrane intrinsic proteins (PIP) are one of the five aquaporin protein subfamilies. Aquaporin proteins are known to facilitate water transport through biological membranes. In order to identify NIP aquaporin gene candidates in cotton (Gossypium hirsutum L.), in silico and molecular clon...

  17. Clonidine Extended-Release Tablets for Pediatric Patients with Attention-Deficit/Hyperactivity Disorder

    Science.gov (United States)

    Jain, Rakesh; Segal, Scott; Kollins, Scott H.; Khayrallah, Moise

    2011-01-01

    Objective: This study examined the efficacy and safety of clonidine hydrochloride extended-release tablets (CLON-XR) in children and adolescents with attention-deficit/hyperactivity disorder (ADHD). Method: This 8-week, placebo-controlled, fixed-dose trial, including 3 weeks of dose escalation, of patients 6 to 17 years old with ADHD evaluated the…

  18. Dicty_cDB: AFI889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3'HPRT insertion targeting and chromosome engineering clone MHPP164a17. 46 1.3 1 CK255549 |CK255549.1 EST73...nd read from insert in 3'HPRT insertion targeting and chromosome engineering clon

  19. A synopsis of the South American Hydrovatus (Coleoptera: Dytiscidae: Hydroporinae, with notes on habitat and distribution, and a key to species

    Directory of Open Access Journals (Sweden)

    Edgardo R. TRÉMOUILLES

    2005-01-01

    Full Text Available Se estudiaron los representantes sudamericanos del género Hydrovatus Motschulsky. Se diagnostica cada una de las tres especies conocidas, enfatizando el reconocimiento de caracteres valiosos para su identificación; las principales diferencias se resumen en una clave. Para identificar los ejemplares sudamericanos de H. caraibus Sharp, se los comparó con especímenes de AméricaCentral, incluyendo material tipo. En base al material examinado, H. caraibus se encuentra ampliamente distribuida en America Central y del Sur, con representantes de diferentes áreas separados por diferencias menores. Lasdistribuciones geográficas de las tres especies se amplían considerablemente: H. crassulus Sharp y H. turbinatus Zimmermann se citan por primera vez de Paraguay, y H. caraibus se cita por primera vez de Argentina y Nicaragua. Se presenta información bionómica de las especies.

  20. Puma (Herpailurus) pumoides (Castellanos, 1958) nov. comb: Comentarios sistemáticos y registro fósil

    OpenAIRE

    Chimento, Nicolás R; Derguy, Maria Rosa; Hemmer, Helmut

    2014-01-01

    Entre los Felinae de procedencia dudosa descritos para Argentina se encuentra Felis pumoides Castellanos 1958, hallado en estratos asignados al Plioceno ("horizonte Brocherense”) de la provincia de Córdoba (Argentina). Los restos craneanos y post-craneanos que posee el ejemplar tipo (MUFyCA 767) fueron comparados primeramente con todos los felinos sudamericanos y con Acinonyx jubatus concluyendo que posee un gran parecido a la especie actual Puma (Herpailurus) yagouaroundi, con algunos rasgos...

  1. Identificación de una nueva proteína en Leishmania (Viannia peruviana

    Directory of Open Access Journals (Sweden)

    Maxy De los Santos

    1998-01-01

    Full Text Available El análisis de la secuencia nucleotídica y aminoacídica de un clon de la biblioteca de expresión en fago λgt11 de Leishmania (Viannia peruviana, estableció identidad parcial con los genes de las proteínas acídicas ribosomales P2 de Leishmania (Leishmania infantum. Este hallazgo unido a ciertos dominios geonómicos conservados, sugeridos de la comparación de 14 secuencias de otras proteínas P1 eucarióticas, confirman que la secuencia del inserto de clon codifica la proteína acídica ribosomal P1 de L. (V. peruviana denominada LpP1. Este es el primer reporte sobre este tipo de proteína en el género Leishmania.

  2. Soil microorganisms and plant diseases associated to cocoa (Theobroma cacao L. genotypes in the Ecuadorian Amazon

    Directory of Open Access Journals (Sweden)

    Jorge Antonio Freile Almeida

    2018-01-01

    Full Text Available El objetivo de la presente investigación fue analizar la relación de los microorganismos del suelo y las principales enfermedades que afectan los clones promisorios de cacao (Theobroma cacao L. en la Amazonía Ecuatoriana. Se evaluaron los clones EET-95, EET-96, EET-103 y CCN-51, respectivamente, éste último utilizado como control, para ello, se determinó la cantidad de bacterias, hongos y actinomicetos totales, expresados en unidades formadoras de colonias (UFC por gramo de suelo, presentes en la rizósfera de los tres clones de cacao, así como la aparición de las principales enfermedades que atacan al cultivo del cacao. Los datos fueron analizados estadísticamente mediante ANOVA de un factor y prueba HSD de Tukey p≤0,05. Las bacterias fueron los microorganismos de mayor asociación a los clones en este estudio, seguido de actinomicetos y hongos. El clon CCN-51 presentó la mayor cantidad de bacterias, los clones EET-96 y EET-103, presentaron mayor incidencia de actinomicetos y el clon EET-103, la mayor presencia de hongos. La enfermedad escoba de bruja, cuyo agente causal es Cripinellis perniciosa Sthael Singer., afectó en menor medida a los clones EET-103 y CCN-51, mientras que la moniliasis causada por el hongo Moniliophthora roreri (Cif & Par Evans et al., puso en evidencia al clon EET-103 con la mayor incidencia de esta enfermedad y conversivamente al clon CCN-51 con la menor incidencia del patógeno.

  3. A human D1 dopamine receptor gene is located on chromosome 5 at q35.1 and identifies an EcoRI RFLP.

    OpenAIRE

    Grandy, D K; Zhou, Q Y; Allen, L; Litt, R; Magenis, R E; Civelli, O; Litt, M

    1990-01-01

    Dopaminergic neurons have been shown to affect voluntary movement, hormone secretion, and emotional tone. Mediating these activities are two receptor subtypes, D1 and D2, which are biochemically and pharmacologically distinct. The D1 subtype, the most abundant form of dopamine receptor in the central nervous system, stimulates adenylate cyclase, modulates D2 receptor activity, regulates neuron growth and differentiation, and mediates several behavioral responses. Recently we reported the clon...

  4. Dicty_cDB: Contig-U16444-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 001503 |pid:none) Burkholderia glumae BGR1 chromos... 130 5e-30 AF511570_1( AF511570 |pid:none) Uncultured soil...) Pseudomonas syringae pv. phaseo... 80 2e-13 AF511571_1( AF511571 |pid:none) Uncultured soil bacterium clon...00390 |pid:none) Mesorhizobium sp. BNC1, complete... 57 3e-09 AF511572_1( AF511572 |pid:none) Uncultured soil

  5. Dicty_cDB: SLJ419 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CB367289.1 E38 early-oocyst library Plasmodium berghei/Anopheles stephensi mixe...7 |CB367287.1 E830 early-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone ...oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clon...ly-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone E3015 similar to Plasm

  6. Dicty_cDB: Contig-U16439-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA clon... 50 6e-16 3 ( FK739797 ) av01001d15r1.1 Symbiotic sea anemone (Anemonia vi... 84 4e-15 2 ( D872... ( CB933531 ) ri31b11.y1 Meloidogyne chitwoodi egg pAMP1 v1 Mel... 64 4e-11 2 ( FK729638 ) av02130e15r1.1 Symbiotic

  7. Características clínicas y epidemiológicas de la infección por VIH en inmigrantes latinoamericanos versus chilenos: estudio comparativo en un centro de atención de Santiago a partir de registros de 2003-2013

    OpenAIRE

    Rodríguez, M. Fernanda; Wolff, Marcelo; Cortés, Claudia

    2015-01-01

    Introducción: Chile ha experimentado un aumento de inmigrantes, especialmente sudamericanos. La literatura médica internacional describe necesidades de atención diferenciadas entre migrantes y poblaciones autóctonas. En Chile se han mantenido estrategias de prevención de la infección por virus de inmunodeficiencia humana (VIH) únicamente basadas en necesidades de la población nacional. Objetivos: Describir las características clínicas y epidemiológicas de la infección por VIH en pacientes inm...

  8. Formas terminales de Hippidion (Mammalia, Perissodactyla de los yacimientos del Pleistoceno Tardio-Holoceno de la Patagonia (Argentina y Chile

    Directory of Open Access Journals (Sweden)

    Prado, J. L.

    1987-04-01

    Full Text Available The present study is a revision of the terminal forms of the South-American horses coming from the archeological sites of Patagonia. They are compared with those from the Northwest of Argentine. The study also includes paleoenvironmental and cronological related aspects.El presente estudio comprende una revisión de las formas terminales de caballos sudamericanos recuperados de sitios arqueológicos de la Patagonia. Se comparan con las formas del noroeste argentino. Incluye aspectos paleoambientales y cronológicos relacionados.

  9. Presencia de Malameba locustae (Protozoa: Rhizopoda en acridios (Orthoptera: Acrididae de la provincia de Misiones, Argentina Presence of Malameba locustae (Protozoa: Rhizopoda in grasshoppers (Orthoptera: Acrididae of Misiones province, Argentina

    Directory of Open Access Journals (Sweden)

    Carlos E. Lange

    2004-07-01

    Full Text Available La ameba patógena Malameba locustae King y Taylor fue detectada parasitando ejemplares del acridio Ronderosia bergi (Stal recolectados en las cercanías del Parque Nacional Iguazú, Misiones. El hallazgo constituye el segundo registro de M. locustae para acridios sudamericanos.Individuals of the grasshopper Ronderosia bergi (Stal collected in the surroundings of Iguazú National Park, Misiones, were found to be parasitized by the pathogenic amoeba Malameba locustae King & Taylor. The finding constitutes the second record of M. locustae for southamerican grasshoppers.

  10. EL CHOCOLATE, UN PLACER SALUDABLE

    OpenAIRE

    Valenzuela B, Alfonso

    2007-01-01

    El cacao, que se obtiene de la almendra del árbol del cacao, fue utilizado durante cientos de años por los indígenas sudamericanos en la preparación de una bebida amarga, que los europeos modificaron en su preparación y composición, hasta originar lo que hoy se conoce como el chocolate, en sus variedades negro (u oscuro), con leche, y blanco. De ellos el más interesante es el chocolate negro, debido a su alto contenido de los flavanoles epicatequina, catequina y procianidinas. Se ha demostrad...

  11. Plan estratégico de la Provincia de Caylloma de la Región de Arequipa

    OpenAIRE

    Calcina Cateriano, Marjorie Agueda; Chávez Rodríguez, Yhordan Jorge; Herrera Escobedo, Fernando Mauricio; Valdivia Abril, Ornela Gricelda

    2016-01-01

    El presente trabajo se ha centrado en la elaboración del plan estratégico de la provincia de Caylloma hacia el año 2026. El objetivo es convertirla en una provincia modelo del país fortaleciendo tres aspectos económicos principales: turismo, producción de quinua y camélidos sudamericanos; enfocado en el desarrollo social y económico de sus pobladores. Para ello, la metodología del estudio ha tomado el modelo estratégico del Dr. Fernando D’Alessio. En cuanto a las referencias, éstas incluyeron...

  12. Estudio de la variabilidad genética en camélidos bolivianos

    OpenAIRE

    Barreta Pinto, Julia

    2013-01-01

    El estudio de los camélidos sudamericanos es de gran interés en los países andinoscomo Perú, Bolivia, Chile, Argentina, debido a su importante valor económico y suimportancia en el mantenimiento y desarrollo de las poblaciones rurales en dichos países. Dada la falta de estudios genéticos centrados en las poblaciones de camélidos quehabitan en Bolivia, y la necesidad de realizar una valoración de la diversidad genética deestas poblaciones, la presente Tesis doctoral ha abordado el estudio gené...

  13. Impacto de la Globalización Neoliberal en Sudamérica desde la perspectiva de la Transición Epidemiológica

    OpenAIRE

    Justich Zabala, Pablo Ricardo

    2010-01-01

    Esta tesis estudia la relación experimentada entre la Globalización Neoliberal en Sudamérica y la mortalidad por grupos de edad y causa, clasificados según la teoría de la transición epidemiológica. Se han estudiado 4 países sudamericanos (Argentina, Brasil, Chile y Venezuela). Se demuestra que la Globalización Neoliberal no experimenta las mejoras esperables en términos de reducción de mortalidad por causas prevenibles, presentando en muchos casos efectos negativos sobre la reducción de las ...

  14. Engorde de bagres (Rhamdia quelen) en sistema de cultivo intensivo por sexos separados

    OpenAIRE

    Comolli, J; Roux, J.P; Sánchez, S; Hernández, D

    2013-01-01

    El bagre sudamericano (ramdiá o jundiá) se caracteriza por rápido crecimiento en los primeros meses de vida e importante diferencia de desarrollo entre ambos sexos. La madurez sexual del macho es precoz, por lo cual la hembra alcanza un peso vivo 30% mayor que el del macho. El presente trabajo tuvo por objetivo analizar el engorde de especimenes de Rhamdia quelen separados por sexos en un sistema intensivo. Se llevaron a cabo tres tratamientos: TA- hembra, TB- mixto y TC- macho. El engorde se...

  15. Comunicación y migración : análisis de un proceso de interactividad en los periódicos on line del Ecuador

    OpenAIRE

    Cruz Páez, Pamela Johana

    2009-01-01

    En 1993, cuando diario Hoy fue el pionero sudamericano en la entrega de noticias por Internet, la prensa escrita y periódica del Ecuador se introdujo en la exploración de las posibilidades de la red de redes digitales. En la actualidad, más del 50 por ciento de los miembros de la Asociación Ecuatoriana de Editores de Periódicos ha construido sus versiones on line que, a diario, difunden información sobre la migración internacional de ecuatorianos: deportaciones, remesas, demandas nacionales e...

  16. Identidades Islámicas Contemporáneas en América Latina

    OpenAIRE

    Caro, Isaac

    2007-01-01

    En este artículo, distinguimos cuatro grandes modelos del "Islam latinoamericano". Primero, la conformación de comunidades musulmanas a partir de un "islam indo-asiático". Segundo, el predominio, especialmente en los países sudamericanos, de un "islam árabe". Tercero, un proceso creciente de conversión al islam a través de la formación de "nuevos musulmanes". Cuarto, un fenómeno de carácter minoritario, que tiene que ver con la presencia de una tendencia islamista. Postulamos que la diversida...

  17. El papel de la categorización social y las diferencias sociodemográficas en la autoestima, el ajuste y el bienestar psicológicos de una muestra de inmigrantes

    OpenAIRE

    José Andrés Peña-Pinzón; Carmen Gómez-Berrocal; Antonio Fernández-Parra

    2014-01-01

    Se explora el efecto de la saliencia de la categorización social inmigrante y su interacción con diferencias sociodemográficas (nivel de estudios, situación laboral, sexo) de los sujetos, en ajuste psicológico, bienestar psicológico y autoestima. 210 inmigrantes de origen sudamericano, residentes en las provincias de Granada y Almería, fueron distribuidos en dos condiciones experimentales: "saliencia baja/alta de la categorización social inmigrante". Encontramos efecto de la manipulación sobr...

  18. Fiebre amarilla: una enfermedad reemergentes en América del Sur 2000 - 2016.

    OpenAIRE

    Lara Torres, Sara Gabriela

    2017-01-01

    Introducción. La fiebre amarilla selvática es una enfermedad zoonótica viral, reemergente de América del Sur que se ha mantenido durante años, a pesar de que exista una vacuna eficaz hace más de 50 años. Objetivo. Identificar los casos confirmados de fiebre amarilla en el continente Suramericano. Materiales y Métodos. Se realizó un estudio descriptivo, de revisión bibliográfica de los casos confirmados de FA en el Continente Sudamericano desde el 2000 hasta el 2016. Obteniendo la información ...

  19. LA RESPUESTA DEL ANTICICLÓN DEL PACÍFICO SUR EN LA COSTA DE CHILE FRENTE AL CAMBIO CLIMÁTICO-IMPACTOS

    OpenAIRE

    Juan Minetti

    2007-01-01

    Aprovechando la reconstrucción del índice de posición latitudinal del anticiclón del O.Pacífico Sur sobre la costa de Chile (L) durante el período 1901-2004, se analiza su comportamiento de largo plazo como variable anual o mensual en el período más precipitante del clima mediterráneo sudamericano. Existe una importante evidencia del traslado de L hacia latitudes altas desde mediados del Siglo XX al presente, que podría ser justificado con el actual proceso de calentamiento global, sin embarg...

  20. Desarrollo y migración de un juego para TV Digital y las lecciones aprendidas aplicadas a la definición de una metodología de desarrollo

    OpenAIRE

    Campos, Diego; Luna, Carlos Raúl; Bosso, Agustina; Navarro, Néstor; Medel, Ricardo

    2014-01-01

    Argentina y la mayoría de los países sudamericanos se encuentran en proceso de migración desde el sistema actual de TV analógico hacia el nuevo sistema de TV Digital, el cual permite la transmisión de software que se ejecuta en el aparato receptor bajo comando del usuario/televidente. Esta nueva tecnología propone también nuevos desafíos para el desarrollo y la distribución del software. Dentro del proyecto de I+D en el que indagamos sobre la potencialidad de la TV Digital como plataforma ...

  1. ENERGÍA DE BAJA INTENSIDAD: gobiernos, mercados e instituciones en el regionalismo energético de América del Sur

    Directory of Open Access Journals (Sweden)

    Stefano Palestini

    Full Text Available A pesar de haber sido considerada un área prioritaria de cooperación, el regionalismo energético sudamericano muestra signos de estancamiento, evidenciados por las infructuosas negociaciones de un Tratado Energético Sudamericano. Este artículo explica la paradoja de por qué, no obstante la voluntad política, las favorables condiciones estructurales para la integración, y la creación de instituciones regionales ad hoc, el regionalismo energético no consiguió pasar de las declaraciones intergubernamentales a la implementación de políticas. Se argumenta que ninguna de las instituciones creadas ha sido capaz de mediar la divergencia entre mercados y entre preferencias gubernamentales. Se requiere por tanto de un nuevo consenso que replantee la necesidad y la capacidad de la región para llevar adelante la agenda de integración energética. A un nivel más general, el caso del sector energético brinda lecciones importantes acerca de los desafíos futuros que enfrenta la cooperación regional en materia de políticas públicas en Sudamérica.

  2. Calidad de consumo en variedades de boniato

    Directory of Open Access Journals (Sweden)

    Sergio Caballo

    2011-04-01

    Full Text Available El presente trabajo describe una experiencia de degustación de cuatro variedades de boniatos, Beauregard, INIA- Arapey, Morada INTA, y el clon E9227.1, en dos formas de cocción, hervidos y horneados, realizada en INIA y LATU. Dos paneles pilotos de consumidores de ambas instituciones, evaluaron los atributos de sabor, textura, color y agrado general, empleando una escala hedónica de nueve puntos. El aspecto comercial fue evaluado estableciendo el orden de preferencia de las variedades sin cocinar. Se realizaron ensayos fisicoquímicos de fructosa, glucosa, sacarosa y maltosa sobre el material crudo y de materia seca y sólidos solubles totales a las muestras crudas y cocidas. El Morada se diferenció por su alto contenido de materia seca y sólidos solubles totales (SST del material procesado. El análisis estadístico  determinó mayor preferencia en aspecto comercial de Morada y clon E9227.1, como también un mayor valor en sabor y agrado general, tanto en la forma hervida como horneada. El valor obtenido en el atributo de color fue mayor en las variedades de pulpa naranja, Beauregard y clon E9227.1. Estos resultados  podrían tomarse como orientativos de las preferencias de consumidores uruguayos y una referencia para el mejoramiento genético, la producción, el comercio y el consumo. Sería recomendable ajustar medidas analíticas que se correlacionen con las preferencias sensoriales.

  3. EFECTO DE BIOFERTILIZANTES SOBRE LA TOLERANCIA DE BANANO A LA DESINFECCIÓN E INDUCCIÓN DE ORGANOGÉNESIS

    Directory of Open Access Journals (Sweden)

    Gabriela Sandoval-Cancino

    2013-01-01

    Full Text Available El objetivo de este estudio fue evaluar el efecto de biofertilizantes y medios de cultivo sobre la tolerancia al establecimiento aséptico y la inducción de la organogénesis en banano. Se utilizaron explantes de hijuelos de dos genotipos de Musa cavendish AAA, cultivares ‘Clon Francés’ y ‘Clon Oaxaqueño’. Se evaluaron tres aplicaciones de biofertilizante (1 g de Glomus intraradices, 1 ml de la bacteria diazotrófica 11B y la interacción de ambos microorganismos y una sin biofertilizantes. Se sembraron los ápices en tres medios de cultivo: MS sin reguladores de crecimiento, MS adicionado con 22.2 μM de bencilaminopurina (BAP y MS adicionado con 11.4 μM de ácido indolacético (AIA y 22.2 μM de BAP. Se midieron las relaciones hídricas, el contenido de catalasa y peroxidasa, los explantes con brotes y los brotes por explante. En ambos clones se elevó la inducción de la organogénesis con la adición de BAP y por la biofertilización previa de los hijuelos. En el ‘Clon Oaxaqueño’ los tratamientos 6, 8 y 11 indujeron mayor organogénesis, con promedios entre 66 y 71 % de explantes con brotes y entre 3.16 y 2.28 brotes por explante. Para el ‘Clon Francés’ los tratamientos 8 y 9 elevaron la inducción de la organogénesis con promedios de 66 hasta 83 % de explantes con brotes y 1.83 a 2.16 brotes por explante. En ambos genotipos, los biofertilizantes propiciaron mayor porcentaje de supervivencia, mayor tolerancia a la oxidación y menor contaminación. En los dos genotipos, los tratamientos 1 (Glomus intraradices y 4 (Testigo produjeron menos estrés en las plantas.

  4. Solution Thermodynamics of Lysine Clonixinate in Some Ethanol + Water Mixtures

    OpenAIRE

    Delgado, Daniel R.; Martínez, Fleming; Gutiérrez, Rahumir A.

    2012-01-01

    The solubility of lysine clonixinate (LysClon) in several ethanol + water mixtures was determined at 293.15 to 313.15 K. The thermodynamic functions, Gibbs energy, enthalpy, and entropy of solution and of mixing were obtained from these solubility data by using the van’t Hoff and Gibbs equations. In general this drug exhibit good solubility and the greatest value was obtained in the mixture 0.60 in mass fraction of ethanol. A non-linear enthalpy–entropy relationship was observed from ...

  5. Dicty_cDB: Contig-U15883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi

  6. Influencia de distintas citocininas en el cultivo in vitro de apices caulinares de Fragaria x ananassa y F. virginiana

    OpenAIRE

    Brutti, Cristina B.; Sánchez, Marcela I.; Caso, Osvaldo H.

    1984-01-01

    p.65-70 Se estudió la respuesta de Fragaria x ananassa (2n igual a 8x) cv. Brighton, de día netro (refloreciente) y cv. Douglas, de día corto, y de F. virginiana clon UC11 (2n igual 8x), de día corto, a distintas citocininas: 6- (4 - hidroxi - 3 metilbuí - 2 - txans - enilamino) purina (Z), 6 - (? -? - dimetil - alil - amimo) purina (2ip), 6 - bencilaminopurina (BAP) y 6 - furfurilaminopurina (Kin), mediante el cultivo in vitro de ápices caulinares. Se empleó el medio básico de Boxus (1974...

  7. El sistema de señalización de la reelina en la homeostasis y en la inflamación del colon

    OpenAIRE

    Carvajal Vázquez, Ana Eloisa

    2016-01-01

    En 1951, Falconer describió por primera vez un tipo de ratones mutantes espontáneos a los que denominó reeler, los cuales presentaban una mutación autosómica recesiva que les provocaba anormalidades arquitectónicas severas en la corteza cerebral. En 1995 se clonó el gen que codifica la Reelina y se descubrió que el ratón “reeler” no expresaba Reelina (D’Arcangelo y cols., 1995). La Reelina es una glicoproteína de la matriz extracelular de gran tamaño (420 KDalton) fundamental para la regul...

  8. Dicty_cDB: Contig-U05900-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 39018 ) 1278280 NCCCWA 03RT Oncorhynchus mykiss cDNA clon... 50 0.15 1 ( CN809704 ) 2O5 Suppression subtractive hybridization... (SSH) l... 50 0.15 1 ( CN809695 ) 2E1 Suppression subtractive hybridization... (SSH) l... 50 0.15 1 ( CN809694 ) 2I24 Suppression subtractive hybridization (SSH) ... 50 0.15 ...1 ( CN809693 ) 1B14 Suppression subtractive hybridization (SSH) ... 50 0.15 1 ( CN809692 ) 2D5 Suppression subtractive hybridization... (SSH) l... 50 0.15 1 ( CN809691 ) 2D8 Suppression subtractive hybridization (SSH) l

  9. Streptococcus pneumoniae: evolución de los serotipos y los patrones de susceptibilidad antimicrobiana en aislamientos invasores en 11 años de vigilancia en colombia (1994 -2004.

    Directory of Open Access Journals (Sweden)

    Clara Inés Agudelo

    2006-06-01

    Full Text Available Introducción. Streptococcus pneumoniae es una las principales causas de morbilidad y mortalidad en niños y adultos en el mundo. Objetivo. Realizar un análisis de los datos de la vigilancia por el laboratorio de los aislamientos invasores de S. pneumoniae recuperados entre 1994 y 2004. Materiales y métodos. Se empleó la información de los aislamientos invasores de S. pneumoniae recibidos en el Grupo de Microbiología del Instituto Nacional de Salud durante la vigilancia de meningitis bacteriana aguda e infección respiratoria aguda entre 1994 y 2004. Los aislamientos contaban con datos epidemiológicos, serotipo, patrones de susceptibilidad antimicrobiana y algunos con tipificación molecular. Resultados. Se analizaron los datos de 2.022 aislamientos procedentes de 120 hospitales de diferentes regiones del país, recuperados principalmente de hemocultivos (50,7% y líquido cefalorraquídeo (42%. Los serotipos más importantes fueron el 14, 6B, 23F, 1, 5, 6A, 19F, 18C y 9V, los cuales corresponden al 83,6% en niños menores de 6 años, al 74,0% en el grupo de 6 a 14 años y al 61,4% en mayores de 14 años. El 29,8% de los aislamientos presentó susceptibilidad disminuida a la penicilina (SDP, 44,3% a trimetoprim-sulfametoxazol, 32,4% a tetraciclina, 8,2% a cloranfenicol, 3,8% a eritromicina; todos fueron sensibles a vancomicina y el 13% fue multirresistente. Se tipificaron 602 aislamientos con SDP, de los cuales 27 (4,5% se relacionaron con el clon 1-España23F, 38 (6,3% con el clon 2-España6B, 301 (50% con el 3- España9V y 75 (12,5% con el clon 26-Colombia23F, además, los 138 aislamientos con tipo capsular 5 se relacionaron con el clon 19-Colombia5. Conclusiones. Los resultados proporcionan información básica necesaria para el diseño e implementación de estrategias para la prevención de la enfermedad neumocócica en nuestro país.

  10. Potencial de actividad antioxidante de extractos fenólicos de Theobroma cacao L. (cacao)

    OpenAIRE

    Quiñones Gálvez, Janet; Trujillo Sánchez, Reinaldo; Capdesuñer Ruiz, Yanelis; Quirós Molina, Yemeys; Hernández de la Torre, Martha

    2013-01-01

    Introducción: Theobroma cacao L. (cacao), familia Sterculiaceae, es una planta rica en fenoles, los cuales en las plantas son de especial interés por su potente actividad antioxidante, dada esencialmente por sus propiedades redox, que pueden desempeñar un papel importante en la absorción y neutralización de los radicales libres. Objetivos: seleccionar un clon promisorio en la producción de compuestos fenólicos, determinar los órganos con mayor contenido de fenoles, establecer el cultivo in vi...

  11. Dicty_cDB: Contig-U16487-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 ( DW406563 ) EST000984 Trichophyton rubrum cDNA library Tricho... 72 1e-17 4 ( FL496835 ) Mg_Nor01_07E06 Nor01 Myti... stress library Fra... 101 6e-18 3 ( DB668091 ) Saccharomyces cerevisiae mRNA, clon...isia annua normalized leaf... 62 2e-15 4 ( DW680253 ) EST003734 Trichophyton rubrum cDNA library 0 Tric... 7...R946874 ) EST1138413 Aquilegia cDNA library Aquilegia formo... 66 5e-10 2 ( FC787763 ) CBGC17953.fwd CBGC Lotti...:VS... 293 9e-75 1 ( DT758323 ) EST1192172 Aquilegia cDNA library Aquilegia formo

  12. Clonación animal: avances y perspectivas.

    OpenAIRE

    Lilian Chuaire; Magda Carolina Sánchez; María Liliana Franco

    2009-01-01

    Pocos avances han revolucionado tanto la biología del desarrollo como la clonación animal. A partir del nacimiento de la oveja Dolly en 1996, primer clon derivado de un animal adulto, se inició una nueva era científica caracterizada por una creciente desmitificación de las células diferenciadas como entes inmutables en su organización nuclear y estructura cromatínica, y por una mejor comprensión de los mecanismos que regulan el desarrollo. Este trabajo revisará algunos de los logros y de las ...

  13. 1 ALPHA-Hydroxyvitamin D5 as a Chemotherapeutic and Possibly Chemopreventive Agent

    Science.gov (United States)

    2004-09-01

    cancer cells. TTT TG. The primer -for the housekeeping gene G3PDH was purchased from ClonTech. The touchdown 3.2. Induction of differentiation of breast...the housekeeping gene The effects of vitamin D analogues as differentiating G3PDH (C) was identical for all the cDNAs, indicating . agents and...control housekeeping gene. "* G. Lazzaro et al. / European Journal of Cancer 36 (2000) 780-786 785 levels of VDR, do not respond to active vitamin D p53

  14. AcEST: BP920998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven

  15. Gene : CBRC-HSAP-13-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-13-0003 13 B UNKNOWN PCFT_XENLA 8e-30 30% gb|AAH60850.1| SLC46A3 protein [Homo sapi...ens] emb|CAI17158.1| novel protein [Homo sapiens] gb|EAX08438.1| hypothetical protein LOC283537, isoform CRA_b [Homo sapi...ens] 1e-159 100% gnl|UG|Hs#S16817523 Homo sapiens mRNA; cDNA DKFZp686H0448 (from clon...SSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLGEFQV ...

  16. Diseño de dos metodologías moleculares para la rápida identificación de aislamientos de Staphylococcus aureus resistente a meticilina asociados a la comunidad en Colombia

    OpenAIRE

    Javier Antonio Escobar; Ingrid Tatiana Gómez; Martha Johanna Murillo; Betsy Esperanza Castro; Bibiana Chavarro; Ricaurte Alejandro Márquez; Natasha Vanegas

    2012-01-01

    Introducción. Los aislamientos de Staphylococcus aureus resistente a la meticilina asociado a la comunidad (SARM-AC), están aumentando la frecuencia de infecciones en personas sanas de la comunidad y en pacientes hospitalizados. En Colombia y en la región andina estos aislamientos tienen un componente genético relacionado con el clon pandémico USA300. Objetivo. Diseñar y estandarizar dos metodologías para la diferenciación rápida de aislamientos colombianos de S. aureus resistente a la me...

  17. STAPHYLOCOCCUS AUREUS IN NURSING PROFESSIONALS AND THE MICROORGANISM’S SUSCEPTIBILITY PROFILE TO ANTIMICROBIALS

    Directory of Open Access Journals (Sweden)

    Letícia Pimenta Lopes

    2017-01-01

    Full Text Available Objetivo: identificar el estado del cargador y el perfil de susceptibilidad a los antibióticos de los Staphylococcus aureus aislados de la saliva y de la secreción nasal de los profesionales de enfermería. Método: estudio transversal, que utilizó muestras de saliva y secreción nasal, obtenidas de 100 profesionales de enfermería que asisten a personas con VIH/SIDA. Resultados: se identificó que 43,0% de los participantes presentaron muestras de saliva y/o secreción nasal positiva por Staphylococcus aureus . De las 74 muestras de secreción nasal con Staphylococcus aureus , 14,9% presentaron resistencia a la oxacilina; 91,9% a la penicilina; 44,6% a la eritromicina y 41,9% a la clindamicina. De las 12 muestras de saliva positivas, 16,7% fueron resistentes a la oxacilina; 100% a la penicilina; 33,4% a la eritromicina y 25,0% a la clindamicina. Conclusión: se cree que el profesional al obtener conocimiento de su estado de portador del microorganismos multi-resistentes, pasará a supervisar sus prácticas asistenciales y adoptar con mayor eficacia las medidas para la prevención y el control de la cadena epidemiológica de estas bacterias en el ambiente laboral.

  18. Effects of the addition of subarachnoid clonidine to the anesthetic solution of sufentanil and hyperbaric or hypobaric bupivacaine for labor analgesia.

    Science.gov (United States)

    Tebaldi, Thaís Cristina; Malbouisson, Luíz Marcelo Sá; Kondo, Mario M; Cardoso, Mônica M S C

    2008-01-01

    The addition of subarachnoid clonidine (alpha-agonist) prolongs the analgesia produced by the combination of sufentanil and isobaric bupivacaine in combined labor analgesia(1). The objective of this study was to compare the quality of analgesia and the prevalence of side effects after the addition of subarachnoid clonidine to the anesthetic solution in labor analgesia. After approval by the Ethics Commission, 22 pregnant women in labor were randomly assigned to the subarachnoid administration of either 2.5 mg of 0.5% hyperbaric bupivacaine (CLON/HYPER Group; n = 11) or 2.5 mg of 0.5% isobaric bupivacaine (CLON/ISO Group; n = 11) associated with 2.5 microg of sufentanil and 30 microg of clonidine. Pain, evaluated by the Visual Analogue Scale, heart rate, and mean arterial pressure were assessed every 5 minutes during the first 15 minutes, and then every 15 minutes afterwards until delivery. The prevalence of side effects (nausea, vomiting, pruritus, and sedation) was evaluated. The study was terminated whenever the patient needed supplemental epidural analgesia (pain > 3) or upon delivery of the fetus. The Student t test, Chi-square test, Fisher exact test, and two-way ANOVA for repeated measurements were used in the statistical analysis and a p hyperbaric and isobaric solutions showed similar behavior.

  19. Efeito da adição de clonidina subaracnóidea à solução anestésica de sufentanil e bupivacaína hiperbárica ou hipobárica para analgesia de parto Efecto de la adición de clonidina subaracnoidea a la solución anestésica de sufentanil y bupivacaína hiperbárica o hipobárica para la analgesia de parto Effects of the addition of subarachnoid clonidine to the anesthetic solution of sufentanil and hyperbaric or hypobaric bupivacaine for labor analgesia

    Directory of Open Access Journals (Sweden)

    Thaís Cristina Tebaldi

    2008-12-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Adição de clonidina subaracnóidea (±-agonista prolonga a ação analgésica da combinação sufentanil e bupivacaína isobárica em analgesia combinada para o trabalho de parto ¹. O objetivo deste estudo foi comparar a qualidade de analgesia e a prevalência de efeitos colaterais após a adição de clonidina subaracnóidea à solução anestésica em gestantes durante trabalho de parto. MÉTODO: Após aprovação da Comissão de Ética, 22 gestantes em trabalho de parto receberam aleatoriamente no espaço subaracnóideo 2,5 mg de bupivacaína hiperbárica 0,5% (grupo CLON/HIPER; n = 11 ou 2,5 mg de bupivacaína isobárica 0,5% (grupo CLON/ISO; n = 11 em associação ao sufentanil 2,5 µg e à clonidina 30 µg. A dor avaliada pela Escala Analógica Visual, a freqüência cardíaca e a pressão arterial média foram estudadas a cada 5 minutos nos primeiros 15 minutos e, a seguir, a cada 15 minutos até o nascimento. Foi avaliada a prevalência de efeitos colaterais (náusea, vômito, prurido e sedação. O estudo foi encerrado no momento em que foi necessária complementação analgésica peridural (dor > 3 cm ou ao nascimento. A análise estatística foi realizada pelos testes t de Student, Qui-quadrado, Fisher e ANOVA de duas vias para medidas repetidas, considerando como significativo p JUSTIFICATIVA Y OBJETIVOS: La adición de la clonidina subaracnoidea (±-agonista, prolonga la acción analgésica de la combinación sufentanil y bupivacaína isobárica en analgesia combinada para el trabajo de parto ¹. El objetivo de este estudio fue comparar la calidad de analgesia y la prevalencia de los efectos colaterales, después de la adición de clonidina subaracnoidea a la solución anestésica en gestantes durante el parto. MÉTODO: Después de la aprobación de la Comisión de Ética, 22 gestantes en trabajo de parto recibieron aleatoriamente en el espacio subaracnoideo 2,5 mg de bupivacaína hiperbárica 0

  20. Criolla Latina, Criolla Paisa y Criolla Colombia, nuevos cultivares de papa criolla para el departamento de Antioquia (Colombia

    Directory of Open Access Journals (Sweden)

    Rodríguez Luis Ernesto

    2009-12-01

    Full Text Available

    Se evaluaron nueve clones de papa criolla durante dos semestres consecutivos en cuatro localidades del departamento de Antioquia (Colombia, a través de las siguientes variables agronómicas: potencial de rendimiento del tubérculo, rendimiento en el proceso de enlatado, gravedad específica, respuesta a Phytophthora infestans y estabilidad fenotípica. La estabilidad fenotípica fue medida por el procedimiento de rendimiento-estabilidad. La contribución de cada clon en la interacción genotipo-ambiente fue calculada mediante la varianza de Shukla. El estudio permitió seleccionar tres clones superiores de papa criolla, que fueron registrados como nuevos cultivares en el año 2005. Estos fueron: 'Criolla Latina' (98-68.5, con rendimiento entre 18 y 20 t ha -1, resistencia moderada a P. infestans, y buena aptitud para enlatado o encurtido; 'Criolla Paisa' (98-70-12, rendimiento de 22 a 25 t ha -1, resistencia moderada a P. infestans, y buena aptitud para consumo en fresco; y 'Criolla Colombia' (Clon 1, rendimiento entre 13 y 15 t ha -1, sensible a P. infestans, y adecuada para consumo en fresco y elaboración de papa precocida congelada.

  1. Establecimiento de plántulas in vitro de clones de ajo peruano (Allium sativum L.

    Directory of Open Access Journals (Sweden)

    Leidy López Quintero

    2014-06-01

    Full Text Available Se evaluó el establecimiento in vitro de dos clones de ajo peruano mediante el uso de procesos estandarizados de desinfección e introducción in vitro de meristemos de ajo de clones nacionales. Se validó el uso de hipocloritode calcio (1 g.L-1 e hipoclorito de sodio (0.1% como desinfectantes, permitiendo la eliminación total de los microorganismos presentes en los explantes yuna viabilidad del 66.3 y 64.5% en los clones P-007A y P-007B. El establecimiento in vitro de las plántulas se realizó en medio de cultivo MS con 0,5 mg.L-1 de ácido naftalen acético (ANA y 0,64 mg.L-1 de 2-Isopentil adenina(2ip, donde el clon P-007A desarrollo plántulas de 15mm con 2.52 hojas, mientras en el clon P-007B las plántulas tenían 13.6mm con 2.16 hojas. Las plántulas establecidas de ajo de los clones peruanos lograron los parámetros de desarrollo indicados para la etapa de establecimiento de la especie.

  2. Modelamiento geométrico del cambio de coordenadas UTM causadas por mudanza de referencial geodésico: Caso Sirgas - Chile

    Directory of Open Access Journals (Sweden)

    Carlos Mena Frau

    Full Text Available Los avances tecnológicos de las últimas décadas han permitido determinar cada vez con mayor precisión, las dimensiones, forma y campo gravitacional de la Tierra. Estas nuevas tecnologías y sus métodos de observación y análisis, admiten el uso de distintos Sistemas Geodésicos de Referencia (SGR que hacen posible la descripción de posición de cualquier punto sobre la superficie terrestre con precisiones sub-métricas. Actualmente en Chile hay diversos SGR usados en la generación de productos cartográficos, tales como el Datum Provisorio Sudamericano de 1956 (PSAD56, el Datum Sudamericano de 1969 (SAD69 y el nuevo Sistema de Referencia Geocéntrico para las Américas (SIRGAS. Este último, a diferencia de los dos anteriores, es un sistema geocéntrico actual, compatible en precisión y exactitud con las modernas tecnologías de posicionamiento. Actualmente, el Instituto Geográfico Militar de Chile (IGM promueve la adopción del nuevo sistema SIRGAS e indica el modelo y los parámetros oficiales de transformación para la cartografía nacional a escala 1:50.000. Con la adopción de SIRGAS, una cantidad significativa de documentos cartográficos, en pleno uso actualmente, deberán ser transformados o adecuados al nuevo referencial geodésico. Existen diversos métodos y modelos, propuestos en la geodesia, para la transformación de valores de coordenadas asociados a un SGR en valores de coordenadas asociados a otro SGR. En el presente trabajo se realiza un análisis del impacto del cambio de referencial geodésico SIRGAS en la geometría de los rasgos representados en el sistema de proyección Universal Transversa de Mercator, para el caso de Chile continental sudamericano. Posteriormente, se definen modelos y parámetros alternativos al procedimiento clásico de transformación de coordenadas. Los resultados muestran que los modelos alternativos son eficaces en el caso de Chile.

  3. Then Fandango Complex in the Spanish Atlantic: a Panoramic View

    Directory of Open Access Journals (Sweden)

    Peter Manuel

    2015-01-01

    Full Text Available Así como las formas andaluzas más conocidas del fandango muestran ciertos rasgos musicales distintivos, que pueden servir para vincular estos subgéneros, histórica y estructuralmente, a grupos mucho más amplios de las familias musicales transatlánticas, como el fandango popular y el semiclásico del siglo XVIII, géneros anteriores como la zarabanda y la chacona, la amplia familia de patrón ternario de la cuenca del Caribe, además de otros géneros andinos y sudamericanos. Mientras tanto, existen diferencias claras entre el complejo del fandango y otras familias importantes en el Atlántico español.

  4. Nuevos inmigrantes en Chile: Los determinantes de su actividad emprendedora

    Directory of Open Access Journals (Sweden)

    Claudio MANCILLA

    2014-01-01

    Full Text Available En Chile es poca la literatura que estudia a los inmigrantes desde una perspectiva económica, y menos la que aborda su actitud emprendedora (a pesar de que son proporcionalmente más emprendedores que los habitantes locales. El objetivo de este trabajo es estudiar los factores que influyen en el emprendimiento de los in - migrantes sudamericanos en Chile. Se utilizó un modelo logit ajustado para even - tos extraños para determinar el impacto sobre la probabilidad de emprendimiento individual. Algunos resultados indican que el tiempo de residencia, forma legal de ingreso al país, nivel educacional y experiencia previa de emprendimiento, influyen en la probabilidad de crear una actividad empresarial.

  5. Desigualdad social. Un viaje por Latinoamérica: Diarios de Motocicleta (2004

    Directory of Open Access Journals (Sweden)

    Laura María Moratal Ibáñez

    2008-10-01

    Full Text Available Dos jóvenes, Ernesto Guevara de 23 años, estudiante avanzado de Medicina y Alberto Granado de 29 años, bioquímico, comienzan un viaje por Latinoamérica a través de 5 países. Este recorrido por más de 12.000 kilómetros se inicia en Argentina en diciembre de 1951 y finaliza en Venezuela 8 meses más tarde. La película relata esta historia real, con un guión basado principalmente en los diarios de viaje publicados por los protagonistas. Nos muestra las experiencias de estos jóvenes en su viaje de descubrimiento por la rica y compleja topografía humana y social del continente sudamericano, deteniéndose especialmente en el tiempo que ambos pasan en una leprosería de la Amazonia.

  6. Naturaleza y ciudad en épocas prehispánicas. El caso de las culturas nucleares sudamericanas

    Directory of Open Access Journals (Sweden)

    Leonel Ramos Santibáñez

    2007-11-01

    Este trabajo, busca dilucidar algunos de estos temas en el particular caso sudamericano prehispánico, donde la enorme cantidad de frágiles e interrelacionados ecosistemas que alberga la variedad geográfica, unida a su inestabilidad climática y geológica, hizo que el hombre desarrollara a lo largo de miles de años, un conocimiento y un pensamiento dirigido a encontrar los medios tecnológicos necesarios para buscar la forma de integrarse armónicamente a la Naturaleza. Para esto, a diferencia de otras culturas, desarrolló el particular modo de ver y entender el mundo como un todo vivo e interrelacionado del que el hombre es parte indesligable, que se muestra en este trabajo.

  7. Presencia de Hippidion y Equus (Amerhippus (Mammalia, Perissodactyla y su distribución en el Pleistoceno superior de Chile

    Directory of Open Access Journals (Sweden)

    Frassinetti, D.

    2000-12-01

    Full Text Available Fossil remains belonging to Equidae fram Chilean localities are described and taxonomically determined. Equus (Amerhippus and Hippidion species are identified; its geographic distribution in Chile and relations with others South American Equidae are given; a Late Pleistocene age is regarded for them. Stratigraphic and paleoecological considerations are also included.Se describen y sitúan taxonómicamente los restos de équidos de las localidades chilenas. Se identifican distintas especies de Equus (Amerhippus e Hippidion, señalando su distribución geográfica y relaciones con otros équidos sudamericanos, además de referirlos al Pleistoceno superior. Se analiza su situación estratigráfica así como consideraciones de tipo paleoecológico.

  8. México en el mercado internacional de aguacate

    Directory of Open Access Journals (Sweden)

    Alejandro Macías Macías

    2011-01-01

    Full Text Available El mercado internacional de aguacate ha sufrido importantes modificaciones durante las dos últimas décadas. Por un lado, aunque se trata de una fruta exótica, cada vez es más consumida en el mundo Por otro, surgen nuevas potencias exportadoras que desplazan a anteriores naciones líderes: México, principal productor y consumidor de la fruta, es, a partir de la década de 1990, en el máximo exportador, como resultado de la apertura del mercado de los Estados Unidos. Al mismo tiempo, países sudamericanos como Chile y Perú, cada vez tienen mayor presencia en el mercado europeo, desplazando relativamente a Israel, Sudáfrica, España, Kenia o Ecuador. Finalmente, se emergen nuevos vendedores como Australia o se reafirman otros como República Dominicana.

  9. De la letra de la constitución a la realidad de las prácticas: formas de construcción del estado y la ciudadanía en tres estados rioplatenses durante la primera mitad del siglo XIX

    Directory of Open Access Journals (Sweden)

    Buchbinder, Pablo

    2008-06-01

    Full Text Available This article examines the ambivalent relation between Constitutional Texts and Political Practices in three South American States during the XIX Century. The Study focuses on the Building of Citizenship, the changes of the system of local government, the military power and the Electoral System in Corrientes, Paraguay and Uruguay.

    El artículo examina la ambigua relación entre textos constitucionales y prácticas políticas en tres estados sudamericanos durante la primera mitad del siglo XIX. El estudio se centra especialmente en cuestiones tales como la construcción de la ciudadanía, el poder miliciano, los cambios en la organización municipal y la cuestión del sufragio en Corrientes, Paraguay y Uruguay.

  10. Variabilidad del peso de los recién nacidos según el país de origen materno

    OpenAIRE

    García Andrés, R; Valerio Rodríguez, FT; Casuscelli, L; Barón Mizzi, I; García Moreno, M

    2016-01-01

    Resumen: Objetivo: establecer las diferencias de peso al nacer en recién nacidos a término de mujeres españolas, sudamericanas y magrebíes en el Hospital Universitario Rafael Méndez, en Lorca (Murcia), España. Material y métodos: el estudio incluye a recién nacidos de gestación única y controlada a término, en madres sanas, sin hábitos tóxicos y origen español, magrebí o sudamericano, con una muestra de 240 mujeres, 80 en cada grupo. Se excluyen los recién nacidos pretérmino, gestación mú...

  11. El turismo social como política estatal en Sudamérica

    Directory of Open Access Journals (Sweden)

    Erica Schenkel

    2013-01-01

    Full Text Available El acceso a las prácticas de ocio forma parte de los derechos humanos. Sin embargo, aun existen amplios sectores sociales que tienen velado su acceso. Esta exclusión se manifiesta especialmente en regiones con altos índices de desigualdad, como América Latina. La modalidad turística que intenta dar respuesta a esta problemática es el turismo social, que surge para coadyuvar a que ciertos colectivos vulnerables logren hacer efectivo su derecho a las vacaciones. Conforme a lo descrito, la investigación pretende analizar las políticas de turismo social impulsadas por gobiernos sudamericanos, destinadas a ofrecer vacaciones a aquellos grupos vulnerables. El estudio describe un primer análisis de situación y esboza una serie de propuestas optimizadoras.

  12. Efecto del ácido giberélico y la 6-bencilaminopurina sobre el desarrollo de yemas en injertos de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Cárdenas-Hernández Julián F.

    2010-04-01

    Full Text Available

    Gran parte de los cultivos de cacao en el país son viejos y necesitan ser renovados debido a sus bajos rendimientos. Por esta razón se aborda la producción masiva de plántulas injertadas con materiales de alta productividad, que sin embargo presentan problemas en el prendimiento y desarrollo de las yemas. En el Centro de Investigación Nataima-Corpoica (Espinal, Tolima, plántulas de cacao del clon IMC67 tratadas con desbrote apical fueron injertadas con yemas de los clones CCN51 e ICS95. El ensayo siguió un diseño completamente aleatorizado con siete tratamientos, tres de ellos correspondientes a concentraciones de 5, 10 y 15 mg L-1 de ácido giberélico (AG3, y otros tres aplicando 6-bencilaminopurina (6BAP en las mismas concentraciones, más un testigo sin aplicación de hormonas. Cada 3 días se midieron la altura, el diámetro, la longitud, el número de hojas y el área foliar del injerto, además de su masa fresca y seca al final del experimento, el cual duró 30 días. El AG3 permitió alcanzar los mayores valores en longitud, número de hojas, área foliar y masa fresca y seca del injerto. Para los mismos parámetros, los tratamientos con 6BAP alcanzaron valores similares a los obtenidos con AG3 (con diferencias estadísticas en algunos casos, además de los mayores diámetros del injerto. Dentro de las aplicaciones de AG3, la realizada a una concentración de 10 mg L-1 mostró los mejores resultados en ambos clones. Sin la aplicación de hormonas, las yemas del clon ICS95 desarrollaron una mayor área foliar y alcanzaron mayores valores de masa fresca y seca que las yemas del clon CCN51. Sin embargo, después de aplicar los tratamientos, los dos clones presentaron valores similares.

  13. Susceptibilidad antimicrobiana de Staphylococcus aureus sensible, con sensibilidad "BORDERLINE" y resistentes a la meticilina

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Mendoza Ticona

    2003-10-01

    Full Text Available Objetivo: Determinar las susceptibilidad a diversos antibacterianos de tres categorías de S. aureus según su sensibilidad a la meticilina. Materiales y Métodos: Se aislaron 76 cepas de S. aureus que colonizaban pacientes y personal de salud de tres servicios del Hospital Honorio Delgado de Arequipa, de los cuales 36 fueron sensibles a meticilina (MSSA, 15 con susceptibilidad "borderline" (BORSA y 25 fueron resistentes a la meticilina (MRSA. Se les sometió a antibiograma a 14 antibacterianos. Resultados: El único antibiótico al cual todas los aislamientos fueron sensibles fue vancomicina. Los MRSA fueron resistentes a todos los b-lactámicos excepto imipenem que obtuvo 64% de susceptibilidad. Los BORSA mantuvieron un 80% de sensibilidad a cefalotina y un 100% al imipenem. Los antibióticos cefalotina, imipenem, ciprofloxacina, cotrimoxazol, rifampicina, eritromicina, tetraciclina, cloranfenicol, lincomicina y gentamicina tuvieron sensibilidades variables (p<0.01 entre las tres categorías; una mayor proporción de MSSA fue sensible a estos antibióticos, luego los BORSA y finalmente los MRSA. Las cepas multi-resistentes fueron mucho más frecuentes en los MRSA que en los otros dos grupos (p <0.01. Conclusión: Existe en nuestro medio cepas de S. aureus con resistencia "borderline" a meticilina. Hay diferencias entre la sensibilidad a diversos antimicrobianos entre los tres grupos de S. aureus. Esta diferenciación podría beneficiar una terapia antimicrobiana más racional. Se debe aplicar en todo aislamiento de S. aureus las recomendaciones internacionales para la detección de meticilino resistencia.

  14. Evaluación de un programa controlado de tuberculosis en un centro periférico de Lima

    Directory of Open Access Journals (Sweden)

    Antonio Bernabe Ortiz

    2005-06-01

    Full Text Available Objetivo: Evaluar y analizar la evolución de la tuberculosis desde el año 2000 al 2004 en una zona urbano marginal de Lima. Materiales y métodos: Este es un estudio observacional de reporte de casos, realizado en Pampas de San Juan desde enero del 2000 hasta diciembre del 2004. Los datos se obtuvieron del Libro de Sintomáticos respiratorios y del Libro de Evolución y seguimiento de casos de tuberculosis del programa. Resultados: Se diagnosticaron 694 casos de tuberculosis en el periodo de estudio, de los cuales 528 casos eran nuevos (76,1%. La forma pulmonar fue la más diagnosticada con 530 casos, teniendo el 82,1% baciloscopía positiva. La incidencia ha disminuido desde 208.96 hasta 187.05 por 100000 habitantes. La condición de egreso hasta fines del 2003 fue de 427 curados (87,5%, 27 abandonos (5,5%, 13 fracasos (2,7% y 21 fallecidos durante el tratamiento (4,3%. Conclusiones: En este estudio se demuestra la caída sostenida de los casos informados de tuberculosis en una zona marginal de Lima. Aunque los recursos son escasos, estos deben ser aprovechados al máximo para controlar la tuberculosis con los nuevos problemas que acarrea, como la asociación con la infección por VIH, las formas multi-resistentes y la mayor diseminación por el hacinamiento secundario a la pobreza existente en el lugar.(Rev Med Hered 2005;16:114-119.

  15. Resistência a β-lactâmicos em Acinetobacter spp isolados de efluente hospitalar no sul do Brasil Resistance to β-lactams among Acinetobacter spp isolated from hospital sewage in southern Brazil

    Directory of Open Access Journals (Sweden)

    Carolina de Souza Gusatti

    2009-04-01

    Full Text Available Acinetobacter spp é um importante patógeno causador de infecções nosocomiais que acomete pacientes imunocomprometidos e capaz de adquirir resistência a antimicrobianos com facilidade. Os esgotos hospitalares são importantes disseminadores de genes de resistência a antimicrobianos para a microbiota ambiental. Neste contexto, 30 cepas de Acinetobacter spp provenientes de efluente de um hospital em Porto Alegre, RS, foram analisados quanto ao perfil de susceptibilidade a β-lactamases, quinolonas e aminoglicosídeos através de antibiograma e testes de triagem para metalo beta-lactamases e β-lactamases de espectro estendido. O perfil encontrado revela cepas multi-resistentes e que mecanismos de resistência como a produção de β-lactamases de espectro estendido e bombas de efluxo podem estar presentes nesses isolados.Acinetobacter spp is an important pathogen that is responsible for nosocomial infections affecting immunocompromised patients, and it can easily acquire resistance to antimicrobial agents. Hospital sewage is an important means for disseminating genes for resistance to antimicrobial agents, to the microbiota of the environment. Within this context, 30 strains of Acinetobacter spp from the sewage of a hospital in Porto Alegre, Rio Grande do Sul, were analyzed regarding their profile of susceptibility to β-lactams, quinolones and aminoglycosides, by means of an antibiogram and tests to screen for metallo-β-lactamases and extended-spectrum β-lactamases. The profile obtained revealed the presence of multidrug-resistant strains and showed that resistance mechanisms such as the production of extended-spectrum β-lactamases and efflux pumps may be present in these strains.

  16. Roles sociales de la sociedad contemporánea en la película 'Multiplicity' de Harold Ramis

    Directory of Open Access Journals (Sweden)

    Raquel Fernández Cobo

    2015-10-01

    Full Text Available Multiplicity (2010, dirigida por Harold Ramis, plasma en pantalla a través del motivo del doble los elementos que constituyen la crisis del sujeto y que representan al individuo bajo el signo de la disipación. Mediante un análisis temático y discursivo del motivo del doble examinamos cómo el protagonista, al intentar llevar a cabo la totalidad de los roles sociales, se ve abocada a las contradicciones más agudas de la sociedad, manifestadas, sobre todo, a nivel del cuerpo, tanto en el manifiesto simbolismo del motivo del doble como en el “terror biológico” que de forma absolutamente irónica y humorística se representa en el último clon del protagonista.

  17. Ensayo in vivo para determinar agentes extraños en células BHK-21 empleadas en la obtención de biológicos.

    OpenAIRE

    Ernesto Almora; Odalys Fidalgo; Arelys Zamora,; Niurka Rodríguez; Ela María Pérez

    2000-01-01

    La controversia sobre los parámetros de calidad de las células de línea como substrato para la obtención de productos farmacéuticos ha sido un tema de interés desde 1987. Las pruebas realizadas a las células, generalmente siguen las recomendaciones de los “Puntos a considerar en la Caracterización de Líneas Celulares empleadas para la Producción de Biológicos” entre las que se encuentra que estén libres de agentes adventicios. En este estudio al clon 13 de células BHK-21 procedente de riñó...

  18. Dicty_cDB: SSL552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 28 0.36 3 BZ330174 |BZ330174.1 hv90e08.b1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor gen...S-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone hv90e08 5', DNA sequence. 36 0.63 ...2 BZ335743 |BZ335743.1 hz26f02.g1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clon...e hz26f02 5', DNA sequence. 36 0.68 2 BZ628823 |BZ628823.1 ih62d12.g1 WGS-SbicolorF (DH5a methyl filtered) S...06.1 ic39h07.b1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ic39h07 5', DNA

  19. Dicty_cDB: Contig-U14068-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A(XYZ) common wild sunflowe... 52 3e-06 2 ( EL475764 ) CHUL3727.b1_M20.ab1 CHU(LMS) puzzle sunflower Hel... ...44 2e-05 3 ( EL484083 ) CHUM594.b1_C06.ab1 CHU(LMS) puzzle sunflower Heli... 44 3e-05 3 ( EH295921 ) UAHYP_0...) serpentine sunflower... 44 5e-04 2 ( EL482465 ) CHUM4440.b1_O06.ab1 CHU(LMS) puzzle sunflower Hel... 44 5e...16607_g1 Cowpea IT97K-461-4 Mixed Tis... 38 5e-04 2 ( EL489951 ) CHUS5070.b1_K19.ab1 CHU(LMS) puzzle... hirsutum cDNA clon... 34 0.002 3 ( EL480989 ) CHUM2981.b1_J02.ab1 CHU(LMS) puzzle

  20. Construction and Identification of cDNA Library of Trichomonas vaginalis%阴道毛滴虫cDNA文库的构建和鉴定

    Institute of Scientific and Technical Information of China (English)

    章家新; 傅玉才; 郑晓虹; 刘红

    2003-01-01

    目的:构建阴道毛滴虫(Trichomonas vaginalis,Tv)全长cDNA表达文库,筛选全长目的基因,研究与其细胞周期相关基因的结构和功能.方法:从Tv中提取总RNA,用ClonTech公司的SMARTTMcDNA文库试剂盒构建其全长cDNA表达文库. 结果:所建文库的初始滴度为6.78×106pfu/mL,经一次扩增后的滴度为1.68×109pfu/mL,重组率>98%.结论:成功构建Tv全长cDNA文库,并从该文库中筛选出了与细胞周期相关的基因.

  1. Dicty_cDB: Contig-U03718-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1). 44 6.3 1 ( CN956824 ) 4324_50012_33 Fundulus Heteroclitus Heart Fundulu... 44 6.3 1 ( CK582239 ) IST_WI5_40351 AD-wrmcDNA library...083_N07_... 44 6.3 1 ( CC819391 ) 1O0006N02F Oxytricha plasmid UUGC1O library Sterk... 44 6.3 1 ( CC816592 ) 1O0002I07F Oxytric...ha plasmid UUGC1O library Sterk... 44 6.3 1 ( AU208961 ) Caenorhabditis elegans cDNA clon... Caenorhabditis e... 44 6.3 1 ( CK582236 ) IST_WI5_40347 AD-wrmcDNA library Caenorhabditi...s e... 44 6.3 1 ( CK577651 ) IST_WI5_17736 AD-wrmcDNA library Caenorhabditis e... 44 6.3 1 ( CK577644

  2. Dicty_cDB: Contig-U14355-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lkiii*iwl *ly*iiivk*ipmklipliqkvihhyimpyslnvlikfsciy*ikrkyvlenviwmvihh fiisvknsnhqnvre*fkp*lkkvqiltnkiim...AQ046505 ) RPCI11-42E14.TJ RPCI-11 Homo sapiens genomic clon... 46 1.5 1 ( EJ349319 ) 1092963571972 Global-Ocean-Sampli...655( CP000236 |pid:none) Ehrlichia chaffeensis str. Arkan... 46 0.001 DQ058898_1( DQ058898 |pid:none) Nasutitermes graveolus reli...041156664 Global-Ocean-Sampling_GS-34-01-01-1... 48 0.37 1 ( EJ247332 ) 1095337027578 Global-Ocean-Sampling_...ry Neovison vison ... 46 1.5 1 ( ER388657 ) 1094428746559 Global-Ocean-Sampling_GS-34-01-01-1... 46 1.5 1 (

  3. Dicty_cDB: SSA534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ng vector pDXA-3strep. 204 1e-50 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 204 1e-...50 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 204 1e-50 2 AJ510165 |AJ510165.1 Clon...ing vector pDXA-3FLAG. 204 1e-50 2 X85118 |X85118.1 Artificial sequences cloning ...vector DNA pDXA-3C. 204 1e-50 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 204 1e-50 ...2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 204 1e-50 2 X85120 |X85120.1 Artificial sequences cloning

  4. Uso de la repetibilidad clonal en la selección de ambientes en ensayos regionales de variedades de caña de azúcar en los estados Lara y Yaracuy

    OpenAIRE

    De Sousa-Vieira, Orlando; Rea, Ramón; Briceño, Rosaura

    2003-01-01

    El término "repetibilidad clonal" se refiere a la correlación existente entre diferentes plantas de un mismo clon. Esta técnica es muy útil para medir la efectividad de la selección de clones de caña de azúcar (Saccharum sp., híbrido) y para estimar la magnitud de la interacción genotipo x ambiente. Este trabajo se realizó con el objeto de ubicar localidades y épocas de zafra similares para rendimiento de caña (TCH) y Pol % caña a fin de disminuir racionalmente su número y desplazar recursos ...

  5. Genetic homogeneity between two populations of the parthenogenetic lizard Aspidoscelis cozumela Homogeneidad genética entre dos poblaciones de la lagartija partenogenética Aspidoscelis cozumela

    Directory of Open Access Journals (Sweden)

    Norma L. Manríquez-Morán

    2008-12-01

    Full Text Available We used skin-grafting to assess the genetic variability between 2 populations of the parthenogenetic lizard Aspidoscelis cozumela. We transplanted 238 skin fragments among individuals of 2 coastal populations at Cozumel Island. Grafts belonging to individuals that survive more than 60 days suggested genetic homogeneity between both populations, consistent with the existence of only 1 clone within this unisexual species.Se utilizó el método de transplantes de piel para evaluar la variabilidad genética entre 2 poblaciones de la lagartija partenogenética Aspidoscelis cozumela. Se transplantaron 238 fragmentos de piel entre individuos de 2 poblaciones costeras de Isla Cozumel. Los transplantes pertenecientes a individuos que vivieron más de 60 días, mostraron homogeneidad genética entre ambas poblaciones, lo cual sugiere la existencia de 1 sólo clon dentro de esta especie unisexual.

  6. CARTOGRAPHIE DU PLASMIDE pSU100, PLASMIDE CRYPTIQUE DE LACTOBACILLUS CASEI

    Directory of Open Access Journals (Sweden)

    F BENSALAH

    2003-06-01

    Ce plasmide appelé pSU100 a été cloné dans le vecteur de transformation pUC18 au site EcoRI chez E. coli JM103. Les profils électrophorétiques de restriction obtenus par des digestions simples, doubles et triples sous l’action de 33 endonucléases, ont contribué à l’élaboration d’une carte de restriction de ce plasmide. Cinq sites uniques ont été identifiés, ainsi que d’autres sites doubles et multiples. Une étude préliminaire du rôle physiologique de ce plasmide a permis de déceler une résistance à la kanamycine.

  7. INFLUENCIA DE LA ÉPOCA DE COSECHA EN LA CALIDAD DEL LICOR DE CACAO TIPO NACIONAL

    Directory of Open Access Journals (Sweden)

    Milton Alexis Ruíz Pinargote

    2014-12-01

    Full Text Available El objetivo de esta investigación fue evaluar la influencia de las épocas de cosecha (invierno y verano sobre las características físicas, sensoriales y bromatológicas del cacao nacional perteneciente al jardín clonal de la ESPAM MFL. Los análisis se efectuaron a partir de muestras de almendras secas evaluándose porcentaje de fermentación, almendras violetas, peso de semillas y testa, sabores básicos y específicos, pH, acidez, ceniza y grasa. Los datos fueron procesados mediante la prueba de T para encontrar diferencias entre épocas usando el programa estadístico INFOSTAT versión 2008. Los resultados muestran significación estadística para la fermentación entre las épocas del año, el mayor porcentaje de fermentación obtenido fue de 96.5 % del clon EET-19 en verano, mientras que en invierno sobresalió el clon EET-103. El perfil sensorial de los sabores específicos obtuvo mayores diferencias en el sabor floral con respecto al frutal y nuez, además de los sabores básicos con niveles medios y altos entre épocas; las propiedades bromatológicas acidez y ceniza fueron parecidas entre invierno y verano; contrario al pH y grasa que varían significativamente entre épocas. Se concluye que las épocas del año influyen sobre las propiedades físicas, sensoriales y bromatológicas del cacao nacional.

  8. Mutagénesis inducida en microbulbos de Allium sativum L.

    Directory of Open Access Journals (Sweden)

    Adriana Pardo Roldán

    2015-07-01

    Full Text Available Se estableció un protocolo de mutagénesis en microbulbos de ajo (Allium sativum L. clon Boconó cultivado in vitro. Para el efecto se realizaron dos ensayos, uno de radiosensibilidad para establecer la dosimetría apropiada de radiación gamma y otro de mutagénesis para determinar el comportamiento de los materiales hasta la etapa de almacenamiento. En el primero los microbulbos fueron tratados con cuatros dosis de radiación gamma (6, 8, 10 y 12 Krad, más un control. Para establecer la dosis óptima se consideró la sobrevivencia del 50% de los microbulbos (DL50. Se empleó un diseño de bloques al azar con cinco tratamientos y 20 repeticiones por tratamiento. En el ensayo mutagénico los microbulbos fueron irradiados con 8 y 10 Krad y almacenados durante 45 días a 10 °C en condiciones de oscuridad En este caso se utilizó un diseño de bloques al azar con tres tratamientos (0, 8 y 10 Krad y 20 repeticiones por tratamiento. En ambos ensayos, los microbulbos irradiados con 8 y 10 Krad registraron los mayores promedios para peso y diámetro, lo cual permite concluir que estas dosis son adecuadas para favorecer la producción de mutantes con características agronómicas deseables en el clon Boconó

  9. Caracterización e inmunoreactividad de la proteína acídica Ribosomal P2ß de L. (V. braziliensis

    Directory of Open Access Journals (Sweden)

    Carlos Padilla R

    2003-04-01

    Full Text Available Introducción: El diagnóstico serológico de la leishmaniasis usando proteínas totales presenta reacciones cruzadas. La caracterización de nuevos antígenos de Leishmania mejorará el uso de herramientas serológicas en el diagnóstico de esta enfermedad. Objetivo: Caracterizar un nuevo antígeno de Leishmania. Materiales y métodos: Se seleccionó el bacteriófago T166-U19 de una biblioteca de cADN de L. (V. braziliensis el cual es reactivo a mezclas de sueros de leishmaniasis cutánea y mucocutánea. El cADN del clon T166-U19 fue subclonado en el plásmido pGEX, luego secuenciado y la proteína recombinante fue expresada. La reactividad de esta proteína recombinante se evaluó por ELISA. Resultados: El cADN del clon T166- U19 presentó un marco de lectura abierto de 318 pb que traduce una proteína de 105 aminoácidos con 81,1%, 82,9% y 60,7% de identidad total con la proteína acídica ribosomal LiP de L. (L. infantum, P2 de L. (L. donovani, y P2 de T. cruzi, respectivamente. Además, la proteína recombinante presentó baja reactividad (50% con sueros de pacientes con leishmaniosis, mientras que presentó reactividad cruzada con sueros de pacientes chagásicos. Conclusiones: Se caracterizó por primera vez la proteína acídica ribosomal P2B de L. (V. braziliensis, y presentando baja reactividad con sueros de pacientes con leishmaniasis.

  10. Comparación de diferentes sondas de DNA para la detección de Plasmodium falciparum

    Directory of Open Access Journals (Sweden)

    L. Eugenio Andrade

    1989-12-01

    Full Text Available Las sondas pRepHind, Rep20, p242B1-1, pPF-14, clon 26 y clon 34 se compararon a fin de examinar su capacidad para detectar P. falciparum en estudios de campo. Noventa y cuatro muestras de pacientes procedentes de Tumaco, región endémica de malaria situada en la Costa Pacífica Colombiana y 78 muestras provenientes de Villavicencio (Llanos Orientales, se estudiaron en experimentos de hibridación en "dot-blot". Las sondas Rep 20, p242B1-1, pRepHind y pPF-14 detectaron hasta 17 pg de DNA purificado de P. falciparum, mientras que los clones 26 y 34 detectaron 425 pg de DNA. Las sondas pPF-14, p242B1-1, pRepHind y Rep 20 mostraron niveles comparables de detección en muestras de sangre infectada. La sensibilidad mostró variaciones desde 75-94% en sujetos con parasitemias mayores de 10.000 par. a 15-42% en sujetos con parasitemias menores de 100 par. .Las sondas pPF-14 y p242B1-1 mostraron la mayor sensibilidad, mientras que los clones 26 y 34 presentaron niveles de detección significativamente menores. Todas las sondas demostraron ser altamente específicas. Los niveles de detección fueron dependientes del tratamiento de la muestra. El tratamiento consiste en eliminación del suero, lisis con Triton X-100, digestión con Proteinasa K, extracción con Fenol y Cloroformo, y precipitación con etanol condujo a niveles de detección del 100% cuando se realizó en muestras con parasitemias igual y/o mayores de 1.000 par.

  11. Factores relacionados con el control exitoso de un brote por Klebsiella pneumoniae productora de KPC-2 en una unidad de cuidado intensivo en Bogotá, Colombia

    Directory of Open Access Journals (Sweden)

    Gisell Bustos-Moya

    Full Text Available La resistencia a carbapenémicos en Klebsiella pneumoniae ha aumentado de manera considerable, incrementando las tasas de morbimortalidad. El objetivo de este trabajo fue describir las características epidemiológicas, microbiológicas y las medidas de intervención que permitieron el control exitoso de un brote de Klebsiella pneumoniae productora de KPC-2. Métodos: El estudio se realizó en 2 periodos: el primero durante el brote, con instauración de un protocolo de medidas de intervención; y el segundo, de seguimiento posbrote. Se realizaron pruebas de identificación y susceptibilidad por sistema automatizado, tamización de carbapenemasas por test de Hodge modificado, PCR para detección de los genes bla KPC , bla KPC-2 , NDM-1 y estudio de clonalidad por electroforesis de campos pulsados. Resultados: Durante el brote, se identificaron 18 aislamientos de Klebsiella pneumoniae productora de KPC en 11 pacientes. Tres casos fueron confirmados como infección intrahospitalaria. La técnica de PCR reveló la presencia del gen bla KPC en 21 de 22 aislamientos (pacientes y medio ambiente y se identificó la presencia de un clon con una similitud superior al 75%. En el periodo posbrote los cultivos ambientales y de búsqueda de colonizados fueron negativos. Discusión: Se evidenció un control exitoso del brote producido por un clon. La implementación de un protocolo de intervención y la monitorización de su cumplimiento, la comunicación efectiva y el trabajo en equipo fueron indispensables para evitar su propagación y evitar un comportamiento endémico posbrote.

  12. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica IV: Dendrocalamus asper, clones Taiwán y Tailandia

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available El análisis ultraestructural de los clones taiwanés y tailandés de Dendrocalamus asper, realizado al microscopio electrónico de barrido, mostró que el clon de Taiwán tiene estomas de bajo domo en la lámina foliar, mientras que el de Tailandia tiene estomas de alto domo; las acumulaciones de cera cuticular en el clon de Taiwán son de dos formas (cuatro en el de Tailandia. La distribución de los tejidos vasculares es igual en ambos, así como los tejidos que los rodean. Sería difícil identificar estos clones por la observación macroscópica o microscópica de las brácteas del culmo, pues no presentan diferencias significativas: una identificación fiable requiere considerar la ultraestructura de los estomas y las acumulaciones de cera cuticular.An ultraestructural analysis of the Taiwan and Thailand clones of Dendrocalamus asper made with the scanning electron microscope showed that the Taiwan clone had low dome stomata while the Thailand clone has high dome stomata in the leaf lamina. Cuticular wax accumulations in the Taiwan clone has two shapes, against four in the Thailand clone. Both have the same distribution of vascular and surrounding tissues. Macroscopic or microscopic observation of culm bracts are not recommended to differentiate these clones: a reliable identification requires observation of the ultrastructure of stomata and cuticular wax accumulations. Rev. Biol. Trop. 54(Suppl. 2: 65-75. Epub 2006 Dec. 01.

  13. A package of Linux scripts for the parallelization of Monte Carlo simulations

    Science.gov (United States)

    Badal, Andreu; Sempau, Josep

    2006-09-01

    Despite the fact that fast computers are nowadays available at low cost, there are many situations where obtaining a reasonably low statistical uncertainty in a Monte Carlo (MC) simulation involves a prohibitively large amount of time. This limitation can be overcome by having recourse to parallel computing. Most tools designed to facilitate this approach require modification of the source code and the installation of additional software, which may be inconvenient for some users. We present a set of tools, named clonEasy, that implement a parallelization scheme of a MC simulation that is free from these drawbacks. In clonEasy, which is designed to run under Linux, a set of "clone" CPUs is governed by a "master" computer by taking advantage of the capabilities of the Secure Shell (ssh) protocol. Any Linux computer on the Internet that can be ssh-accessed by the user can be used as a clone. A key ingredient for the parallel calculation to be reliable is the availability of an independent string of random numbers for each CPU. Many generators—such as RANLUX, RANECU or the Mersenne Twister—can readily produce these strings by initializing them appropriately and, hence, they are suitable to be used with clonEasy. This work was primarily motivated by the need to find a straightforward way to parallelize PENELOPE, a code for MC simulation of radiation transport that (in its current 2005 version) employs the generator RANECU, which uses a combination of two multiplicative linear congruential generators (MLCGs). Thus, this paper is focused on this class of generators and, in particular, we briefly present an extension of RANECU that increases its period up to ˜5×10 and we introduce seedsMLCG, a tool that provides the information necessary to initialize disjoint sequences of an MLCG to feed different CPUs. This program, in combination with clonEasy, allows to run PENELOPE in parallel easily, without requiring specific libraries or significant alterations of the

  14. Visiones sobre los tránsitos socio-técnicos hacia patrones de consumo sustentable en agua y energía en la minería sudamericana - dos controversias argentinas

    Directory of Open Access Journals (Sweden)

    Gloria Baigorrotegui

    2014-12-01

    Full Text Available Este trabajo aborda el problema del consumo de agua y energía en la minería sudamericana desde una arista menos explorada: el consumo sustentable. A partir de la sociología y los estudios sociales de la ciencia y la tecnología exponemos esta problemática presentando tres patrones de consumo distintos: convencional, alternativo y progresista. A partir de fuentes secundarias y entrevistas semi-estructuradas hemos rastreado las controversias en torno a dos proyectos mineros históricos argentinos: La Alumbrera y Cerro Vanguardia, focalizando nuestras interrogantes en torno al consumo sustentable de recursos vitales como el agua y la energía. Hemos podido constatar cuán urgente se interpreta la necesidad de transitar hacia patrones de consumo sustentable, quiénes son los llamados a emprenderlos y cuáles precisiones serían necesarias a distintas escalas para efectuar dicha transición. Reconociendo que el agua y la energía son factores constitutivos del tránsito hacia patrones de consumo sustentable en minería, planteamos su centralidad en la gestión de conflictos locales dentro de la gobernanza ambiental latinoamericana. Este estudio forma parte de uno más amplio que abarca varios países sudamericanos.

  15. Los Criollos, las Cuidades y la Lengua: aproximaciones

    Directory of Open Access Journals (Sweden)

    Juan Antonio Ennis

    2009-06-01

    Full Text Available Lo criollo designa un término relacional, definido históricamente en la Hispanoamérica poscolonial por oposición a lo Europeo −a la antigua metrópoli peninsular y a las nuevas metrópolis neocoloniales− y a sus otros internos, los sujetos subalternos del orden emergente en las nuevas naciones latinoamericanas. Mary Louise Pratt (1992:328 lo define de este modo, en un recorrido por los textos en los cuales, desde Bolívar y Bello hasta Echeverría y Sarmiento, se dirimen los términos de la identidad latinoamericana en la novedosa experiencia de la descolonización. El criollo, en este contexto, debe pensar el des-linde, abonar el terreno para la gestión de un lugar de lo propio. Al dar cuenta de algunas de las operaciones de los martinfierristas en los años ‘20 del pasado siglo, Raúl Antelo (2008:122, por su parte, describe lo criollo como reapropiación de la cultura occidental, como “la constante construcción de una diferencia, que es también la búsqueda, en sí misma, de un modo sudamericano de ser universal”, a partir del establecimiento de “un desgarrado linde o entre-lugar que guarda la memoria del desgarramiento originario”.

  16. Estudios de Futuros: El Mercosur: ¿alternativa eficaz de integración sudamericana?

    Directory of Open Access Journals (Sweden)

    Sonia Opazo Rodríguez

    2009-12-01

    Full Text Available Este artículo se enmarca dentro de un análisis de prospectiva histórica mediante proyecciones de integración sudamericana, tomando como eje integrador el MERCOSUR. Para esto presentamos un marco teórico que analiza históricamente temas claves para cualquier proceso de integración. De lo anterior se desprenden tres ejes: a avance de los gobiernos socialistas, b hegemonía de Estados Unidos, c relaciones como bloque entre el MERCOSUR y la Unión Europea. Esto nos permitirá plantear ocho proyecciones, las que nos presentaran escenarios que se desplazan desde un avance progresivo del MERCOSUR como real alternativa de integración, hasta un MERCOSUR manipulado por intereses extra sudamericanos.________________________ABSTRACT:This paper is framed within a prospective historical analysis through projections of South-American integration, taking MERCOSUR as the main axis. For this aim, we will present a theoretical framework and a historical analysis of key issues for every integration proccess. From that, three main themes emerge: a the advance of socialist governments, b United States hegemony, c ‘block relations’ between MERCOSUR and the European Union. From this perspective we present 8 different projections, from MERCOSUR as a real alternative for integration, to a manipulated MERCOSUR, controlled by non-South American forces.

  17. Ropas americanas: Comercio, contrabando y compradores de ropa usada en la frontera de Corumbá, Brasil, y Puerto Quijarro, Bolivia

    Directory of Open Access Journals (Sweden)

    ALBERO HERNÁNDEZ HERNÁNDEZ

    2017-01-01

    Full Text Available Este artículo analiza la comercialización y venta de ropa usada en la frontera entre Bolivia y Brasil, la cual atraviesa un proceso de traslado por varios países, medios de transporte, contra - bando, reúsos y resignif icación de vestimentas. a f inales del siglo xx , el comercio de ropa usada adquiere mayor importancia con la incorporación de onG norteamericanas y europeas, quienes recaudan estas mercancías en calidad de donativos para reenviarlas y comercializarlas en países sudamericanos. l as ropas usadas realizan extensos recorridos hasta los puertos chilenos, para después iniciar un trayecto por tren, y otros medios de transporte, rumbo al este boliviano fronterizo con Brasil. Puerto Quijarro, Bolivia, y c orumbá, Brasil, representan una experiencia de intercambio cultural y comercial, donde el contrabando y la compra y venta de ropa usada son parte de su interacción cotidiana.

  18. LA RESPUESTA DEL ANTICICLÓN DEL PACÍFICO SUR EN LA COSTA DE CHILE FRENTE AL CAMBIO CLIMÁTICO-IMPACTOS

    Directory of Open Access Journals (Sweden)

    Juan Minetti

    2007-12-01

    Full Text Available Aprovechando la reconstrucción del índice de posición latitudinal del anticiclón del O.Pacífico Sur sobre la costa de Chile (L durante el período 1901-2004, se analiza su comportamiento de largo plazo como variable anual o mensual en el período más precipitante del clima mediterráneo sudamericano. Existe una importante evidencia del traslado de L hacia latitudes altas desde mediados del Siglo XX al presente, que podría ser justificado con el actual proceso de calentamiento global, sin embargo esto no parece justificar el comportamiento opuesto observado en la primer mitad del Siglo XX. En términos mensuales la tendencia hacia latitudes altas es más evidente en L, pero el mes de Junio (opuesto es el encargado de mostrar que fluctuaciones de media y alta frecuencia pueden torcer una tendencia larga, lo que no hace recomendable el análisis en esta escala. Esto también es válido para series de variables anuales de alrededor de medio siglo o menos. Otra variable importante para el análisis en esta ocasión fue la intensidad anual del flujo de los Oeste en latitudes altas, que sí parece tener un comportamiento tendencial acorde a los cambios del calentamiento global.

  19. Aprovechamiento de Salto Grande Argentina – Uruguay

    Directory of Open Access Journals (Sweden)

    Bongiovanni, M.

    1979-12-01

    Full Text Available The power harnessing of Salto Grande will be the first common project carried out by two South American Countries and this will foster greater integration of both countries. The project involves the following: — One 39 m-high dam — Two hydroelectric power plants — One international bridge — One shipping canal The benefits to be obtained from the project include: increase and improvement of the waterway network; increase of electricity production; railways and highway tie-ups between both countries; industrial development; increased availability of irrigation water; new tourist resorts; increase of fishing resources.

    El aprovechamiento hidroeléctrico de Salto Grande será el primer aprovechamiento común a dos países sudamericanos, lo que permitirá una mayor integración entre ellos. Consta de las siguientes obras: _ una presa de 39 m de altura; _ dos centrales hidroeléctricas; _ un puente internacional; _ un canal de navegación, etc. Entre los beneficios que se obtendrán destacan: aumento y mejora de la red de navegación; aumento de la producción eléctrica; enlace de las vías de ferrocarril y carreteras entre los dos países; desarrollo industrial; aumento de la disponibilidad de agua de riego; creación de zonas de turismo, e incremento de la riqueza piscícola.

  20. Emigration and Economic Crisis: Recent Evidence from Uruguay

    Directory of Open Access Journals (Sweden)

    Adela Pellegrino

    2005-01-01

    Full Text Available Uruguay es uno de los países sudamericanos con una proporción significativa de su población viviendo en el exterior. Desde los años setenta, el país ha tenido una emigración neta. Aunque esta tendencia se debilitó a principios de los noventa, recobró fuerza con la llegada de una severa crisis económica en 1999. En este artículo se discuten las características de la migración reciente de uruguayos y se pone en evidencia la relación entre crisis económica y emigración. El volumen del flujo poblacional en 2002 es comparable con las olas de migración que tuvieron lugar en los setenta. Los emigrantes con educación universitaria están sobrerrepresentados en comparación con la población general. Existe una correlación entre el acceso a redes de emigrantes uruguayos en los países de destino y la probabilidad de que un hogar haya tenido un miembro que emigró en 2002.

  1. El papel de la categorización social y las diferencias sociodemográficas en la autoestima, el ajuste y el bienestar psicológicos de una muestra de inmigrantes

    Directory of Open Access Journals (Sweden)

    José Andrés Peña-Pinzón

    2014-05-01

    Full Text Available Se explora el efecto de la saliencia de la categorización social inmigrante y su interacción con diferencias sociodemográficas (nivel de estudios, situación laboral, sexo de los sujetos, en ajuste psicológico, bienestar psicológico y autoestima. 210 inmigrantes de origen sudamericano, residentes en las provincias de Granada y Almería, fueron distribuidos en dos condiciones experimentales: "saliencia baja/alta de la categorización social inmigrante". Encontramos efecto de la manipulación sobre las medidas de pertenencia e identidad (autoestima colectiva, autoestima individual, ansiedad (SA-45 y bienestar laboral. Cuando la saliencia de la categorización social es baja (vs. alta, los sujetos presentan mejor autoestima, menos ansiedad y menos bienestar laboral. El sexo se asocia con la manipulación experimental en las escalas privada y pública (autoestima colectiva y en somatización, depresión y ansiedad (SA45. Los hombres para los que es menos saliente su condición de inmigrante presentan resultados más óptimos. El nivel de estudios y la situación laboral se asocian con ajuste psicológico: los sujetos sin trabajo (vs. los que están trabajando y los de estudios básicos o sin estudios (vs. los de estudios medios o superiores presentan peor ajuste.

  2. LA ESPECIALIDAD DE MEDICINA DE URGENCIA EN CHILE: 20 AÑOS DE HISTORIA

    Directory of Open Access Journals (Sweden)

    WK Mallon

    2017-03-01

    Full Text Available Chile está en una posición privilegiada para ser el líder del desarrollo sudamericano de la especialidad Medicina de Urgencia. La Medicina de Urgencia chilena ha hecho una transición exitosa de ser una idea de capacitación novedosa a una entidad reconocida nacionalmente e internacionalmente con serios objetivos para la salud pública. Existen más programas de capacitación por residencia médica en Chile que en cualquier otro país en América del Sur o América Latina y la especialidad es formalmente reconocida por el Ministerio de Salud. Los líderes de la Medicina de Urgencia chilena se han contactado con múltiples grupos internacionales, han usado de manera inteligente los recursos externos y han creado lazos académicos duraderos. Mientras han estado enfocados en asuntos locales importantes y en la atención al paciente, también han logrado avanzar exitosamente en su programa. A pesar de esto, la especialidad enfrenta muchos desafíos nuevos y sigue siendo frágil, pero sostenible. Los responsables de formular políticas y el MINSAL chileno necesitan tener especial conciencia de esta fragilidad para conservar el progreso logrado hasta ahora y apoyar la maduración en curso de la especialidad de Medicina de Urgencia.

  3. El Control Judicial de la Contramajoritário y la Preservación de la Hegemonía de la Élite Dominante: Un Análisis Crítico para la Expansión de la Democracia Participativa en Brasil

    Directory of Open Access Journals (Sweden)

    Carla Vladiane Alves Leite

    2016-06-01

    Full Text Available El objetivo de este trabajo es discutir el activismo judicial que comenzó en los Estados Unidos de América y las ganancias de fuerza en otros países sudamericanos, como Brasil, donde el poder judicial está ganando fuerza para decidir varios casos en los últimos años, desencadenando el fenómeno de la judicialización de la política. Se produce esa judicialización generar demasiado poder en manos del poder judicial, que puede utilizarse para satisfacer a una élite dominante.

  4. TENSIONES INTERPRETATIVAS EN TORNO AL FENÓMENO DE LA “MEDIATIZACIÓN”: ¿LA SOCIEDAD DE LOS MEDIOS MASIVOS O LOS MEDIOS MASIVOS DE LA SOCIEDAD?

    Directory of Open Access Journals (Sweden)

    Ana Pamela Paz García

    2011-01-01

    Full Text Available En la búsqueda de una lectura reflexiva suficientemente comprensiva de la multiplicidad de aspectos implicados en la relación de los medios masivos de comunicación con la sociedad en general y la política en particular, la discusión presentada adopta como norte significativo la trama de relaciones estructurales en que éstos intervienen a nivel macro y micro social, así como los procesos de largo plazo a los que se asocia su poder e influencia como actores centrales de la institucionalidad contemporánea. Desde esta perspectiva, en primer término se distinguen y discuten una serie de aportes conceptuales a la comprensión actual del fenómeno, para luego analizar información empírica específica sobre el proceso de mediatización de la política en el contexto sudamericano. La integración de aspectos teóricos con la interpretación situada de datos empíricos, abonan la idea de una necesaria complementariedad de abordajes y niveles analíticos a fin de alcanzar una aproximación acorde a la complejidad económica, política y cultural que la comunicación social mediatizada hoy reviste.

  5. dos estudios de caso

    Directory of Open Access Journals (Sweden)

    Daniel Kersffeld

    2013-01-01

    Full Text Available La UNASUR se ha destacado desde sus inicios en la compleja labor de mediación y resolución de conflictos internacionales. Para ello, esta entidad multilateral ha apelado a distintas fórmulas políticas tendientes al encausamiento de problemáticas y conflictos apartados del camino de la institucionalidad y de los medios tradicionales de resolución. Con todo, y pese a la búsqueda de caminos alternativos, han sido las cumbres presidenciales la principal herramienta destinada a encontrar soluciones innovadoras y respetuosas del orden democrático y constitucional de los países sudamericanos. En este artículo se analiza de manera específica la actuación de la unasur en dos casos de profunda gravedad institucional: el intento de golpe de Estado ocurrido en Ecuador el 30 de septiembre de 2010 y el derrocamiento del ex presidente Fernando Lugo en Paraguay en junio de 2012. Luego de analizar estos dos casos extremos, y las implicancias políticas generadas, se avanza en una visión comprensiva acerca del éxito o el fracaso del papel político de la unasur como instancia de resolución de conflictos a nivel internacional.

  6. Comportamiento de reubicación del alimento de Eucranium, escarabajo estercolero endémico de la Argentina y comparación con Scarabaeus (Pachysoma del sudoeste de África (Coleoptera: Scarabaeidae: Scarabaeinae Food relocation and nesting behavior of the Argentinian dung beetle genus Eucranium and comparison with the southwest African Scarabaeus (Pachysoma (Coleoptera: Scarabaeidae: Scarabaeinae

    Directory of Open Access Journals (Sweden)

    Federico C. Ocampo

    2005-07-01

    Full Text Available Se describe el comportamiento de reubicación del alimento del género sudamericano Eucranium Brullé basado en observaciones en su ambiente natural. La preferencia de alimento, el modo de transportarlo, preferencia de hábitat, y período de actividad en la superficie son discutidos para dos especies: E. arachnoides Brullé y E. planicolle Burmeister. La biología y comportamiento de relocación del alimento de Eucranium es comparado con la biología y comportamiento del subgénero del sudoeste de África Scarabaeus (Pachysoma MacLeay, el cual es similar morfológicamente. La convergencia adaptativa a los ambientes áridos de Eucranium y S. (Pachysoma son discutidas.The food relocation and nesting behavior of the South American genus Eucranium Brullé is described based on observations carried out under natural conditions. Food preference, food transportation, period of surface activity, and habitat preference are described for two species, E. arachnoides Brullé and E. planicolle Burmeister. The biology and food relocation behavior of Eucranium is compared with that of the morphologically similar South African subgenus Scarabaeus (Pachysoma MacLeay. The convergent adaptations to psamophilous habitats of Eucranium and S. (Pachysoma are discussed.

  7. Circulación y consumo de cacao en la ciudad de México en el siglo XVIII

    Directory of Open Access Journals (Sweden)

    Enriqueta Quiroz

    2014-01-01

    Full Text Available La investigación se refiere a la importancia delconsumo de cacao en la ciudad de México en elsiglo XVIII; señala las dimensiones de su comercio, como también calcula los volúmenes decacao ingresados a la capital y menciona losprincipales circuitos a través de los cuales seabastecía. Del mismo modo percibe las fricciones que se generaron para surtir de cacao a la ciudad de México, al grado de entrar en competencia con la demanda de los mercados atlánticos. Se considera que el estudio permite tener un acercamiento a la integración que tuvo laciudad de México con el resto de los mercadoslocales y del ámbito centro y sudamericano. Deese modo, se considera que particularmente ladescripción de aquellas interconexiones permitevisualizar la integración de los mercados hispanoamericanos en función de la demanda degrandes centros urbanos, tales como la capitalnovohispana.

  8. La contribución de los modelos de gestión participativos en el desarrollo de los gobiernos municipales

    Directory of Open Access Journals (Sweden)

    Xavier Alberto Vélez Romero

    2015-12-01

    Full Text Available La nueva gestión pública municipal tiene la responsabilidad de ser eficiente y eficaz en la asignación de los recursos públicos, para dejar en el pasado la crisis de legitimidad generada por el modelo burocrático tradicional. Los modelos participativos permiten involucrar a la ciudadanía en la planificación, gestión, ejecución, control y evaluación de las políticas públicas, con el fin de consolidar el derecho democrático. La siguiente investigación es de tipo exploratoria-descriptiva y pretende exponer la contribución de los modelos de gestión participativos implementados en los gobiernos municipales, tomado como referencia casos sudamericanos y españoles. Como resultado, se obtuvo que los estudios destinados a evaluar los efectos de la participación ciudadana para encasillarla como un proceso exitoso son pocos, y la misma se presenta en un 70%, aproximadamente, en las instancias deliberativas que en las de planificación y gestión.

  9. Procesamiento de papa criolla precocida y congelada mediante la técnica de congelación individual (IQF, en seis genotipos promisorios de papa criolla (Solanum phureja

    Directory of Open Access Journals (Sweden)

    Rivera Velasco Jesús Elías

    2003-08-01

    Full Text Available

    Se evaluó el comportamiento industrial de seis clones promisorios de papa criolla provenientes de hibridación interespecífica cultivados en tres localidades (Soacha, Duitama y Mosquera en los procesos de papa precocida y congelada IQF (Individual Quick Freezing. Como testigo se utilizó la variedad común Yema de Huevo o “Clon 1”. Las variables evaluadas fueron: peso seco, gravedad específica, rendimiento en el proceso, numero de ojos por tubérculo, profundidad de los ojos y tipo de piel. Se encontró que la mayoría de las variables, a pesar de ser definidas por el genotipo, son afectadas por las  condiciones ambientales. Los tubérculos producidos en Marengo, presentaron bajos contenidos de materia seca, característica apropiada para la elaboración de papa precocida. El clon 98-71.26, presentó alto potencial para ser procesado en forma precocida, debido a sus bajas

    pérdidas en precocción y sus características organolépticas similares al “Clon 1”, adicionalmente presentó un alto valor heterótico para la variable rendimiento. En la

    papa precocida y congelada la

  10. Evaluación de patógenos en clones de lulo (Solanum quitoense Lam. Pathogenity evaluation on Solanum quitoense Lam. Clones

    Directory of Open Access Journals (Sweden)

    Consuelo Montes Rojas

    2010-04-01

    Full Text Available En el noroccidente de Popayán, Colombia, se evaluó la presencia de plagas causadas por patógenos en 42 clones de lulo (Solanum quitoense Lam.. Los clones fueron plantados en bolsas plásticas, donde se desarrollaron por 3 semanas antes de ser trasplantados al campo. Se utilizó un diseño de bloques completos al azar con cuatro repeticiones, la parcela útil estuvo conformada por 6 plantas, las cuales se sembraron a ‘tresbolillo’ a 2.5 m entre surcos y 2 m entre plantas. Para determinar el efecto de las plagas en el cultivo, se calculó el porcentaje de incidencia y severidad del ataque. La incidencia se evaluó como porcentaje de plantas afectadas, y la severidad como porcentaje de tejido afectado por el patógeno. Las enfermedades más limitantes para los 42 clones fueron: gota (Phytophthora infestans que provocó una mortalidad de plantas superior a 40%; fusarium (Fusarium oxysporum que se presentó en 12 de los clones evaluados; antracnosis (Colletotrichum sp. que afectó 21 clones, los cuales se clasificaron entre tolerantes y medianamente tolerantes; y mancha clorótica (Cladosporium sp. que afectó 21 clones, clasificados como susceptibles. Los clones PL19, PL24, PL11, PL35 fueron medianamente tolerantes. Se seleccionaron por supervivencia los clones: JY E1 (52.2%, PH E 1 (45.8%, VM E2 (45.8%; por supervivencia y por tolerancia a Fusarium oxysporum los clones PL35, PL11, PL24, PL8, PL19, 120052, 120043, ORE1, AGE1. Los clones SER 7, SER 15, SER 9, SEC 31, SEC 27 presentaron alta mortalidad pero se seleccionaron por ser medianamente tolerantes a gota, tolerantes a antracnosis y medianamente resistentes a nematodos, con buen vigor y producción.Presence of plant disease caused by pathogens on 42 clones of Solanum quitoense Lam. were evaluated in the north-western region of Popayán, Colombia. The seed of the clons were planted in plastic bags during three weeks and afterwards transplanted to the field. The statistical design

  11. Inmunofenotipaje celular en el diagnóstico de las leucemias agudas híbridas Cellular immunophenotyping in the diagnosis of acute hybrid leukemias

    Directory of Open Access Journals (Sweden)

    Vianed Marsán Suárez

    1999-12-01

    Full Text Available Se estudiaron 118 leucemias agudas en un período de 4 años. El fenotipaje celular se realizó a través del ultramicrométodo inmunocitoquímico (UMICIQ, mediante la utilización de un panel de anticuerpos monoclonales con el que se evaluó la expresión de antígenos linfoides y mieloides. La expresión de antígenos mieloides en pacientes con leucemia linfoide aguda se encontró en el 28,4 % y de antígenos linfoides en pacientes con leucemia mieloide aguda en el 56,7 %. Las leucemias agudas híbridas representaron el 16,1 % del total de pacientes estudiados: 73,7 % al inicio de la enfermedad y el 26,3 % restante en el estudio posterior al tratamiento de inducción de la remisión, lo que sugiere en estos últimos la posibilidad de cambio de linaje por la selección de variantes resistentes a drogas procedentes del clon original, o la aparición de neoplasias secundarias por el uso de drogas genotóxicas118 acute leukemias were studied during 4 years. The cellular phenotyping was carried out through the immunocytochemical ultramicromethod by using a panel of monoclonal antibodies with which the expression of lymphoid and myeloid antigens was evaluated. The expression of myeloid antigens in patients with acute lymphoid leukemia was found in 28.4 %, whereas the expression of lymphoid antigens in patients suffering from acute myeloid leukemia was observed in 56.7 %. The acute hybrid leukemias accounted for 16.1 % of the total of patients studied: 73.7 % at the onset of the disease and the other 26.3 % in the study following the induction treatment of the referred patients, which suggests in the latter the possibility of changing lineage by selecting variantes resistant to drugs from the original clon, or the appearance of secondary neoplasias due to the use of genotoxic drugs

  12. Germinación in vitro de polen de feijoa (Acca sellowiana Berg

    Directory of Open Access Journals (Sweden)

    Mavel Hernández

    2011-02-01

    Full Text Available Actualmente no existen estudios de viabilidad y caracterización del grano de polen de Feijoa, ante lo cual la cantidad y calidad del polen producidos por una flor, son aspectos importantes en estudios evolutivos y de adaptación de genotipos. Así, se determinó la solución germinativa adecuada para realizar pruebas de germinación in vitro, mediante pruebas de las siguientes soluciones:agua, agar, agua + sacarosa 5%, agua + sacarosa 10%, agar +sacarosa 5% ý agar + sacarosa 10%, ante lo cual, en la solución germinativa compuesta por agar y sacarosa al 5% se registró el mayor porcentaje de germinación de granos de polen en el tiempo. Se efectuó la prueba de fertilidad del polen para los dos clones por medio del método de tinción con azul de lactofenol en tres estados de apertura floral E1 (pétalos visibles, E2 (sépalos desplegados y E3 (pétalos maduros, presentando 100% de tinción del total de granos observados por estado de apertura floral. Se realizaron pruebas de germinación para los dos clones en los tres estados de apertura floral y se observó germinación en el clon 8-4 a las 10 horas después de la siembra para el estado E3, alcanzando un alto porcentaje de germinación (80%, mientras que los otros dos estados no germinaron en el tiempo de medición establecido. En el clon 41, la germinación inició a las 10 horas después de la siembra para el estado E2 ý a las 12 horas para el E3, mientras que el E1 no germinó. Los estados E2 y E3 alcanzaron 80% de germinación aproximada 16 horas después de siembra.

  13. Repopulation of FaDu human squamous cell carcinoma during fractionated radiotherapy correlates with reoxygenation

    International Nuclear Information System (INIS)

    Petersen, Cordula; Zips, Daniel; Krause, Mechthild; Schoene, Kerstin; Eicheler, Wolfgang; Hoinkis, Cordelia; Thames, Howard D.; Baumann, Michael

    2001-01-01

    Purpose: FaDu human squamous cell carcinoma (FaDu-hSCC) showed a clear-cut time factor during fractionated radiotherapy (RT) under ambient blood flow. It remained unclear whether this is caused solely by proliferation or if radioresistance resulting from increasing hypoxia contributed to this phenomenon. To address this question, repopulation of clonogenic FaDu cells during fractionated RT under clamp hypoxia was determined by local tumor control assays, and compared to the results after irradiation with the same regimen under ambient blood flow. Methods and Materials: FaDu-hSCC was transplanted into the right hind leg of NMRI nu/nu mice. In the first set of experiments, irradiation was performed under clamp hypoxia. After increasing numbers of 3 Gy fractions (time intervals 24 h or 48 h), graded top-up doses were given to determine the TCD 50 (dose required to control 50% of the tumors). In the second set of experiments, all 3 Gy fractions were applied under ambient conditions, but as in the previous experiments the graded top-up doses were given under clamp hypoxia. A total of 26 TCD 50 assays were performed and analyzed using maximum likelihood techniques. Results: With increasing numbers of daily fractions, the top-up TCD 50 under clamp hypoxia decreased from 39.4 Gy [95% CI 36, 42] after single dose to 19.8 Gy [15, 24] after 18 fractions in 18 days and to 37.8 Gy [31, 44] after 18 fractions in 36 days. The results were consistent with biphasic repopulation, with a switch to rapid repopulation after about 22 days [13, 30]. The clonogen doubling time (T clon ) decreased from 9.8 days [0, 21] in the beginning of RT to 3.4 days after 22 days. Under ambient blood flow the top-up TCD 50 decreased from 37.6 Gy [34, 40] after single dose irradiation to 0 Gy [0, 1] after 18 fractions in 18 days and 22.4 Gy [18, 27] after 18 fractions in 36 days. Similar to results from irradiations under clamp hypoxia, the ambient data were consistent with a biphasic course of clonogen

  14. EXPRESIÓN DE IDURONATO 2-SULFATO SULFATASA HUMANA RECOMBINANTE (IDShr EN Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Raúl Alberto Poutou

    2005-06-01

    Full Text Available El objetivo de este trabajo fue expresar la enzima humana iduronato 2-sulfato sulfatasa en la levadura metilotrófica Pichia pastoris. La deficiencia de esta enzima causa una enfermedad denominada Síndrome de Hunter. Siete clones fueron seleccionados por PCR (10, 28, 92, 94, 144, 149 y 153 al amplificar una banda de 826pb, indicativo de la presencia de la IDSh y de la orientación del fragmento. Diferentes medios de cultivo se emplearon en la fase de crecimiento (YPG, YPGli y BMGliY, la fase de inducción fue llevada a cabo cambiando el medio de crecimiento por BMMY. Una vez crecido en YPGli, los clones 10, 28, 144, 149 y 153 mostraron actividad IDS de 1.53, 2.95, 4.35, 4,07 y 4.15 nmol/h mg a las 24, 48, 72 y 120h de inducción respectivamente. El clon 28 produjo 4.21nmol/h mg al crecer en YPG; sólo los clones 92 y 94 produjeron mejores actividades cuando se crecieron en BMGliY; reportando 1.62 y 1.20nmol/mg h respectivamente. La producción de la IDShr se logró en fermentador de 1l, con medio salino (MBS-sF con el clon IDS28. El crecimiento se realizó en cultivo discontinuo utilizando glicerol (fuente de carbono y energía hasta obtener 12.08g/l de biomasa seca. Para el paso de inducción se utilizó un cultivo alimentado con metanol (<1% (v/v; este último sirvió como fuente de carbono y energía e indujo la expresión de IDShr actuando sobre el promotor nativo AOX1 presente en el constructo pPIC9- IDSh. La actividad específica osciló entre 25.4 y 29.36 nmol/mg h. Se destaca que el valor de referencia de nuestro laboratorio para la IDSh en plasma humano es 12.58 nmol/mg h.

  15. El uso de alteraciones genéticas en la estratificación por riesgo del mieloma múltiple

    Directory of Open Access Journals (Sweden)

    Esteban Braggio

    2013-08-01

    Full Text Available Los estudios genéticos han alcanzado un papel central en el estudio del mieloma múltiple (MM, al convertirse en un componente crítico en la estratificación basada en el riesgo de la enfermedad. Se han hecho grandes esfuerzos para identificar cambios genéticos que puedan predecir el resultado clínico e incluirlos en la práctica clínica diaria. La hibridización in situ fluorescente (FISH es todavía la técnica genética más utilizada en la práctica clínica, mayormente debido a su sencilla implementación y su simplicidad para el análisis de datos. El advenimiento de la genómica (hibridización genómica comparativa, secuenciación exónica o genómica completa y del transcriptoma de alta resolución (perfiles de expresión de genes - GEP y secuenciación de ARNm proveen un análisis exhaustivo de los ya definidos factores pronósticos genéticos y son herramientas útiles para la identificación de potenciales nuevos marcadores pronósticos de enfermedad en el clon tumoral de MM. Más aún, GEP ha sido exitosamente implementado en MM como una herramienta de estratificación de riesgo, siendo la de mayor poder de discriminación de resultados. De todas maneras, algunos aspectos técnicos y logísticos complejos (necesidad de una elevada purificación del clon tumoral, costo de los ensayos y complejidad en los análisis de los datos deben ser considerados antes de la incorporación definitiva de estas tecnologías de alto rendimiento dentro de los ensayos clínicos de rutina. Hasta entonces, FISH continúa siendo la herramienta estándar para la detección de anormalidades genéticas y de valoración pronóstico de enfermedad.

  16. Cambios a lo largo del tiempo en la distribución de los complejos de clones dominantes de Staphylococcus aureus resistente a la meticilina en Medellín, Colombia

    Directory of Open Access Journals (Sweden)

    Ana M. Ocampo

    2014-04-01

    Full Text Available Introducción. Parte del éxito de Staphylococcus aureus resistente a la meticilina (SARM como patógeno se debe a la rápida diseminación de linajes pandémicos con perfiles variables de virulencia y sensibilidad antimicrobiana. En Colombia se han identificado clones asociados al hospital como el pediátrico (CC5-ST5-SCCmecIV, el brasilero (CC8-ST239-SCCmecIII y el chileno/cordobés (CC5-ST5-SCCmecI. Asimismo, se describió el USA300 (CC8-ST8-SCCmecIV, tradicionalmente asociado a la comunidad, causante de infecciones hospitalarias. Objetivo. Describir el comportamiento en el tiempo de los clones de SARM provenientes de un hospital universitario de Medellín en aislamientos recolectados con una década de diferencia. Materiales y métodos. Se analizaron 398 aislamientos de SARM, 67 recolectados en 1994 y 331 recolectados entre 2008 y 2010. La identificación y la sensibilidad a la meticilina se confirmaron mediante los genes nuc y mecA. La caracterización molecular incluyó la tipificación de spa, SCCmec, la electroforesis en gel de campo pulsado (Pulsed Field Gel Electrophoresis, PFGE, y la tipificación por secuenciación de locus múltiples (Multilocus Sequence Typing, MLST. Resultados. Al analizar los aislamientos de SARM de 1994 se encontró que pertenecían a un único linaje, el CC5-SCCmecIV, mientras que los aislamientos de 2008 a 2010 presentaron dos linajes dominantes: el CC8-SCCmecIVc, con cepas de los tipos spa t008 y t1610, estrechamente relacionadas con el clon USA 300, y el CC5-SCCmecI, con las de tipo spa t149, relacionadas con el clon chileno; no se detectaron cepas del linaje encontrado en 1994. Conclusiones. En este estudio se demuestra una dinámica en el tiempo de las cepas de S. aureus, y se señala la importancia de la vigilancia local y la difusión de los resultados, sobre todo en países como el nuestro, donde SARM es prevalente y la comprensión de su epidemiología es limitada.

  17. Absorption characteristics of epidural levobupivacaine with adrenaline and clonidine in children.

    Science.gov (United States)

    Chalkiadis, George A; Abdullah, Farah; Bjorksten, Andrew R; Clarke, Alexander; Cortinez, Luis I; Udayasiri, Sonal; Anderson, Brian J

    2013-01-01

    To determine if the addition of adrenaline, clonidine, or their combination altered the pharmacokinetic profile of levobupivacaine administered via the caudal epidural route in children. Children aged adrenaline 5 mcg · ml(-1) or clonidine 2 mcg · ml(-1) or their combination. Covariate analysis included weight and postnatal age (PNA). Time-concentration profile analysis was undertaken using nonlinear mixed effects models. A one-compartment linear disposition model with first-order input and first-order elimination was used to describe the data. The effect of either clonidine or adrenaline on absorption was investigated using a scaling parameter (Fabs(CLON), Fabs(ADR)) applied to the absorption half-life (Tabs). There were 240 children (median weight 11.0, range 1.9-56.1 kg; median postnatal age 16.7, range 0.6-167.6 months). Absorption of levobupivacaine was faster when mixed with clonidine (Fabs(CLON) 0.60; 95%CI 0.44, 0.83) but slower when mixed with adrenaline (Fabs(ADR) 2.12; 95%CI 1.45, 3.08). The addition of adrenaline to levobupivacaine resulted in a bifid absorption pattern. While initial absorption was unchanged (Tabs 0.15 h 95%CI 0.12, 0.18 h), there was a late absorption peak characterized by a Tabs(LATE) 2.34 h (95%CI 1.44, 4.97 h). The additional use of clonidine with adrenaline had minimal effect on the bifid absorption profile observed with adrenaline alone. Neither clonidine nor adrenaline had any effect on clearance. The population parameter estimate for volume of distribution was 157 l 70 kg(-1). Clearance was 6.5 l · h(-1) 70 kg(-1) at 1-month PNA and increased with a maturation half-time of 1.6 months to reach 90% of the mature value (18.5 l · h(-1) 70 kg(-1)) by 5 months PNA. The addition of adrenaline decreases the rate of levobupivacaine systemic absorption, reducing peak concentration by half. Levobupivacaine concentrations with adrenaline adjuvant were reduced compared to plain levobupivacaine for up to 3.5 hours. Clonidine as an

  18. Pseudomonas aeruginosa: freqüência de resistência a múltiplos fármacos e resistência cruzada entre antimicrobianos no Recife/PE Pseudomonas aeruginosa: frequency of resistance to multiple drugs and cross-resistance between antimicrobials in Recife/PE

    Directory of Open Access Journals (Sweden)

    Eduardo Andrada Pessoa de Figueiredo

    2007-12-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A multi-resistência bacteriana tem crescido significativamente nos últimos anos. Entre os gram-negativos a P. aeruginosa demonstra maior facilidade de desenvolvimento de resistência aos antibióticos. O objetivo deste estudo foi determinar os padrões de susceptibilidade antimicrobiana, freqüência de resistência a múltiplos fármacos e de resistência cruzada entre antimicrobianos das cepas de Pseudomonas aeruginosa. MÉTODO: O estudo foi realizado entre setembro de 2004 e janeiro de 2006. Os testes de susceptibilidade antimicrobiana foram realizados em 304 cepas de P. aeruginosa segundo os padrões do National Committee for Clinical and Laboratory Standards (NCCLS. RESULTADOS: Os materiais mais freqüentes foram urina com 26,7% e secreção traqueal com 26,1%. Os seguintes antibióticos, com respectivos percentuais de susceptibilidade, foram observados: piperacilina-tazobactam (66,2%; aztreonam (59,8%; amicacina (59,4%; meropenem (58,2%; imipenem (57,7%; ciprofloxacina (49,7%; gentamicina e cefepima (48,6%; ceftazidima (30% e cefotaxima (6,8%. Detectou-se elevada prevalência de multi-resistência, com 49,7% das cepas resistentes a três antibióticos ou mais e 28% resistentes a seis antibióticos ou mais. Adicionalmente se demonstraram taxas de resistência cruzada entre os beta-lactâmicos (carbapenêmicos e piperacilina/tazobactam e os aminoglicosídeos e quinolonas entre 22,9% e 38,1% (fármacos comumente utilizados como adjuvantes no tratamento das infecções graves por pseudomonas, refletindo dificuldade nas opções de associação de antimicrobianos para tratamentos combinados. CONCLUSÕES: A freqüência de cepas multi-resistentes de P. aeruginosa foi semelhante à descrita na literatura nacional e maior do que a mundial. Para reduzir a freqüência destes clones multi-resistentes, monitorização epidemiológica e racionalização de antimicrobianos devem ser implementadas urgentemente.BACKGROUND AND

  19. Motivar y aprender con el móvil creando una aplicación para Android, mediante una metodología lúdica, constructivista y social

    Directory of Open Access Journals (Sweden)

    Isabel Lozano Ortiz

    2013-01-01

    Full Text Available Es común en nuestra sociedad el uso de teléfonos avanzados para llevar a cabo muchas acciones diferentes (actividades. Los adolescentes se desenvuelven muy bien con estas tecnologías, pero con frecuencia, el uso de estos dispositivos en las escuelas de secundaria es muy limitado, ya que no se entiende como un método de aprendizaje. Esta unidad didáctica está diseñada para guiar al alumno a lo largo del proceso, con el fin de construir su propia aplicación para Android, mientras que él / ella adquiere diferentes competencias. Todo el curso se ha planificado en una aplicación Android. Sin embargo, se clonó en un sitio web, ya que es un formato más común y puede ser reproducido en una multitud de dispositivos. La manera de conseguir este objetivo es mediante el uso de un método de aprendizaje llamado serious game, que consiste en pasar seis misiones diferentes. Para introducir al alumno en la historia, las misiones son presentadas con diferentes instrucciones mediante vídeos interactivos (por ejemplo, tweets, correos electrónicos o mensajes de Facebook. A lo largo del curso, el estudiante diseña, construye, ejecuta y publica su propia aplicación.

  20. Novel concept of nonimaging single reflection solar energy concentrator

    Energy Technology Data Exchange (ETDEWEB)

    Gasparovsky, D.

    2004-07-01

    Many solar applications require temperatures higher than those that can be achieved by common flat-plate collectors. Temperatures over 100 C are necessary e.g. for industrial process heat. Such temperatures can be obtained by means of solar energy concentrators. Advantages of concentrating the solar radiation can bring in addition to higher temperatures also decrease in heat losses and material savings due to smaller size of absorber, if taking into account that costs for material absorber per square meter can be possibly higher than costs for e.g. concentrating mirrors. On the other hand, using the concentration, two other kinds of losses will raise: losses of diffuse radiation and optical losses. There exist a variety of solar energy concentrators for different purposes. For lowtemperature applications, inexpensive concentrators of diffuse radiation can be used. For these concentrators, acceptance angle A defines the ability to concentrate the diffuse radiation and also its concentration factor C. To this class of concentrators belongs e.g. nonimaging types like CPC (Compound Parabolic Concentrator), V-trough types, cylindrical concentrators etc. This paper deals with development of a new type of concentrator, novel concept of which is based on functionality of CPC by means of flat mirrors, primarily designed for needs of SME's (Small and Medium Enterprises). The CLON project is being ellaborated under the 5th Framework Programme of the EU. (orig.)

  1. Variación temporal a Microcyclus ulei en los clones de caucho FX 3864 y FX 4098 en condiciones controladas

    Directory of Open Access Journals (Sweden)

    Armando Sterling Cuellar

    2014-07-01

    Full Text Available Título en español: Variación temporal a Microcyclus ulei en los clones de caucho FX 3864 y FX 4098 en condiciones controladas Título en ingles: Temporal variation to Microcyclus ulei in rubber tree clones FX 3864 and FX 4098 under controlled conditions Título corto: Variación temporal a Microcyclus ulei Resumen:  Este estudio tuvo como objetivo evaluar la variación temporal de los principales componentes fisiológicos asociados a la reacción de dos clones (FX 3864 y FX 4098de Hevea brasiliensis a Microcyclus ulei en condiciones controladas. Las inoculaciones se realizaron en cámara húmeda a 23 ºC, una humedad relativa superior al 90% y un fotoperíodo de 12 h. Con un modelo de medidas repetidas en el tiempo y mediante correlaciones se analizaron cuatro variables: severidad de ataque (SA, intensidad de esporulación conidial (IE, tamaño de lesión (TL y frecuencia de infección (FI. M. ulei generó síntomas en los dos clones a los 4 días después de la inoculación. Los signos de la enfermedad (IE= 3 se manifestaron a los 8 días en el clon FX 3864 y a los 12 días en el clon FX 4098. FX 3864 presentó la mayor susceptibilidad a M. ulei (mayor severidad y una esporulación alta, IE= 4. En general, se observó una influencia del tiempo en la reacción de cada clon para las variables SA, IE y TL. Altas correlaciones significativas se encontraron entre SA y las variables IE, TL y FI, excepto en el día 12 para IE. Este estudio permite concluir que en condiciones controladas la intensidad  y la frecuencia de los síntomas así como el grado de esporulación  producidos por M. ulei cambian significativamente a través del tiempo y esta variación está influenciada a su vez por el nivel de susceptibilidad a M. ulei presentado por cada clon de H. brasiliensis.  Palabras clave: Hevea brasiliensis, mal suramericano de las hojas, severidad, esporulación. Abstract:  This study aimed to evaluate the effect of temporal variation on the

  2. The Assessment of Parameters Affecting the Quality of Cord Blood by the Appliance of the Annexin V Staining Method and Correlation with CFU Assays

    Directory of Open Access Journals (Sweden)

    Teja Falk Radke

    2013-01-01

    Full Text Available The assessment of nonviable haematopoietic cells by Annexin V staining method in flow cytometry has recently been published by Duggleby et al. Resulting in a better correlation with the observed colony formation in methylcellulose assays than the standard ISHAGE protocol, it presents a promising method to predict cord blood potency. Herein, we applied this method for examining the parameters during processing which potentially could affect cord blood viability. We could verify that the current standards regarding time and temperature are sufficient, since no significant difference was observed within 48 hours or in storage at 4°C up to 26°C. However, the addition of DMSO for cryopreservation alone leads to an inevitable increase in nonviable haematopoietic stem cells from initially 14.8% ± 4.3% to at least 30.6% ± 5.5%. Furthermore, CFU-assays with varied seeding density were performed in order to evaluate the applicability as a quantitative method. The results revealed that only in a narrow range reproducible clonogenic efficiency (ClonE could be assessed, giving at least a semiquantitative estimation. We conclude that both Annexin V staining method and CFU-assays with defined seeding density are reliable means leading to a better prediction of the final potency. Especially Annexin V, due to its fast readout, is a practical tool for examining and optimising specific steps in processing, while CFU-assays add a functional confirmation.

  3. de papa en Costa Rica

    Directory of Open Access Journals (Sweden)

    Zeidy Montero

    2007-01-01

    Full Text Available Especies del género Meloidogyne causan importantes daños al cultivo de la papa (Solanum tuberosum L alrededor del mundo. Su efecto puede ser directo al disminuir el rendimiento o indirecto al infectar los tubérculos y causar agallas o protuberancias, que les confiere una apariencia verrugosa, que afecta su calidad y reduce su valor comercial. En Capellades y Llano Grande de Cartago, Costa Rica, fueron encontrados tubérculos de papa, de la variedad Floresta y del clon Bananito, con numerosas protuberancias en su superficie. De las protuberancias se extrajo hembras ovígeras de Meloidogyne spp. Estudios morfológicos (diseño perineal de las hembras y moleculares (PCR y PCRRFLP mostraron que las hembras extraídas de las protuberancias pertenecen a la especie M. incognita. Se recomienda estudiar las causas que promueven la infección de los tubérculos en ambas localidades, ya que cerca del 90% del área cultivada de papa en el país corresponde a la variedad Floresta. En adición, se debe prestar especial atención a las zonas semilleristas, ya que los tubérculos-semilla podrían servir como fuente de inóculo y contribuir a la diseminación del patógeno a otras áreas.

  4. Descripción de un inmunoensayo enzimático que reconoce anticuerpos anti-factor VIII/von Willebrand obtenidos a partir de hibridomas múridos Description of an enzime immunoassay that recognizes anti-factor VIII/von Willebrand antibodies obtained from murine hybridomas

    Directory of Open Access Journals (Sweden)

    Renée González Sampedro

    1999-04-01

    Full Text Available Se describe un inmunoensayo enzimático (ELISA que detecta anticuerpos anti-Factor-VIII/von Willebrand (FVIII/vW, con una relación de enlace > 5, que permite reconocer dichos anticuerpos tempranamente en los cultivos de hibridomas múridos. Para la adsorción de las placas del inmunoensayo se utilizaron preparados semipurificados de FVIII/vW obtenidos en Cuba. Se inmunizaron ratones Balb/c con la finalidad de generar los anticuerpos monoclonales detectados por este ELISA. Se obtuvo un clon con crecimiento estable y varios subclones positivos por el ELISA con actividad biológica específica de anticuerpos inhibidores de FVIIIAn enzime immunoassay (ELISA that detects anti-Factor VIII/von Willebrand (FVIII/vw antibodies with a binding relationship > 5 that allows the early recognition of such antibodies in the cultures of murine hybridomas is described. Semipurified preparations of FVIII/vw obtained in Cuba were used for the adsorption of the immunoassay plates. Balb/c mice were immunized in order to generate the monoclonal antibodies detected by this ELISA. A clone with stable growth and several positive subclones were obtained by ELISA with specific biological activity of FVIII-inhibiting antibodies

  5. Transcriptomic profiling of chemical exposure reveals roles of Yap1 in protecting yeast cells from oxidative and other types of stresses.

    Science.gov (United States)

    Zhang, Chao; Li, Zhouquan; Zhang, Xiaohua; Yuan, Li; Dai, Heping; Xiao, Wei

    2016-01-01

    Transcriptomic profiles are generated by comparing wild-type and the yeast yap1 mutant to various chemicals in an attempt to establish a correlation between this gene mutation and chemical exposure. Test chemicals include ClonNAT as a non-genotoxic agent, methyl methanesulphonate (MMS) as an alkylating agent, tert-butyl hydroperoxide (t-BHP) as an oxidative agent and the mixture of t-BHP and MMS to reflect complex natural exposure. Differentially expressed genes (DEGs) were identified and specific DEGs were obtained by excluding overlapping DEGs with the control group. In the MMS exposure group, deoxyribonucleotide biosynthetic processes were upregulated, while oxidation-reduction processes were downregulated. In the t-BHP exposure group, metabolic processes were upregulated while peroxisome and ion transport pathways were downregulated. In the mixture exposure group, the proteasome pathway was upregulated, while the aerobic respiration was downregulated. Homologue analysis of DEGs related to human diseases showed that many of DEGs were linked to cancer, ageing and neuronal degeneration. These observations confirm that the yap1 mutant is more sensitive to chemicals than wild-type cells and that the susceptible individuals carrying the YAP1-like gene defect may enhance risk to chemical exposure. Hence, this study offers a novel approach to environmental risk assessment, based on the genetic backgrounds of susceptible individuals. Copyright © 2015 John Wiley & Sons, Ltd.

  6. Response of cultivars of malanga (Xanthosoma sagittifolium (L. Schott to dry rot

    Directory of Open Access Journals (Sweden)

    Ernesto Espinosa Cuéllar

    2017-01-01

    Full Text Available Malanga (Xanthosoma sagittifolium (L. Schott is an important food crop for over 400 million people in the tropics and subtropics. In order to determine the response of different varieties of malanga Xanthosoma to dry rot, a series of experiments were conducted in the period between 2012 and 2014. The experiments were performed on loamy Soil at the National Research Institute in Tropical Crops and Roots (INIVIT. We determined the incidence and severity of damage, yields and percent of losses at harvest. The lowest values of incidence and the highest total return was achieved in clons ‘INIVIT MX-95-2’, ‘INIVIT MX-95-1’ and ‘INIVIT MX-2007’. Clones of malanga Xanthosoma belonging to the group purple, showed lower incidence that of white and yellow groups. These results will allow selecting cultivars of malanga with greater resistance to the dry rot and with this to diminish the losses in the harvest.

  7. Characterization of the symptoms of sugarcane orange rust (Puccinia kuehnii (W. Kruger E. J. Butler in four sugarcane cultivars in Cuba

    Directory of Open Access Journals (Sweden)

    Osmany de la Caridad Aday Díaz

    2017-07-01

    Full Text Available The characterization of the symptoms of the orange rust was carried out on the Sugar Cane Research Territorial Station (ETICA Centro Villa Clara, of the Sugarcane Research Institute (INICA in Cuba. Ten infected stalks of the cultivars B52107, CSG398-92, C01-227 and Clon218-2011 were evaluated. With a photographic camera the image of the three thirds of 236 leaves infected was captured on a squared paper with well-known distances. By means of the processing of images ImageJ® 1.43u the Affected Foliate Area (AFA was determined to in each third and of the complete leaf, later on the long, wide and area occupied by 554 pustules of the P. kuehnii. In the leaves from +3 at +7 were the intermediate values of AFA for P. kuehnii and this it was significantly major in the superior third of the leaves and minor in the basal part. The most frequent dimensions in the pustules of P. kuehnii reached the length understood between 0.75 and 3.0 mm, between 0.24 and 0.61 mm wide and an area of 1.39 mm2, with differences among cultivars. The emergency of the pustules was generally presented in to add form and with collapsed areas of 2.97 mm2 to 979.8 mm2.

  8. Redes y territorio: la iniciativa IIRSA en foco

    Directory of Open Access Journals (Sweden)

    Roberto Chiarella Quinhoes

    2011-12-01

    ón de la Infraestructura Regional Sudamericana – IIRSA.La Visión Estratégica para la Integración Física Sudamericana (VESA se constituye en el enfoque principal de tal iniciativa, y la Metodología de Planificación Territorial Indicativa, en la herramienta metodológica central para implantar dicha visión y, así, desencadenar procesos de desarrollo sostenible en el territorio.Pretendemos desentrañar las relaciones entre el enfoque de la estrategia de desarrollo territorial brasileño y la VESA. Señalamos, además, algunos elementos que deberían ser puestos en consideración de manera que se perfeccione la herramienta metodológica. En tal sentido, partimos de la visión estratégica proponer un nuevo enfoque metodológico más integrador del territorio. Los elementos que unen un punto al otro pasan por el análisis de la propuesta metodológica en sí, de los ejes de integración y desarrollo, el estudio de las relaciones entre las redes y el territorio, así como por la evaluación de la necesidad de una propuesta de sistema urbano sudamericano.Consideramos que dicho sistema debería ser la base sobre la que se soporte toda la estructura del proceso de integración para el desarrollo sostenible del territorio sudamericano, que incluya los ejes IIRSA y las inversiones necesarias en los centros urbanos de la red, así como su jerarquización y funcionalidad.

  9. Brasil y Argentina: política externa para América Latina en tiempos recientes

    Directory of Open Access Journals (Sweden)

    Miriam GOMES SARAIVA

    2009-11-01

    Full Text Available RESUMEN: Desde el principio de su gestión, el presidente Lula da Silva busca profundizar de forma más activa el comportamiento en relación a América Latina que Brasil ya venía adoptando en la gestión anterior. La seguridad en América del Sur, identificada con la estabilidad democrática, viene articulada a la intención brasileña de construir un papel de liderazgo en la región. En este proceso, la diplomacia brasileña está asumiendo progresivamente un papel cada vez más protagónico. Argentina, a su vez, busca un espacio propio de actuación frente a los temas sudamericanos que dificulte una proyección autónoma brasileña. La búsqueda, por parte de la diplomacia argentina, de un espacio propio frente a la región está ocupando un lugar destacado en el arco de las acciones externas del país. El objetivo de este artículo es examinar estos dos comportamientos y compararlos, teniendo siempre en cuenta las posibilidades/dificultades de una acción conjunta de los dos países en relación a terceros Estados de la región. Con este propósito, el texto está dividido en cuatro partes y algunas consideraciones finales. La primera y la segunda parte presentan características importantes de las políticas exteriores argentina y brasileña desde una perspectiva histórica, que tuvieron impacto en sus respectivos comportamientos frente a temas sudamericanos. La tercera trata directamente de las políticas externas de Argentina y Brasil para la región, mientras la cuarta se centra en los gobiernos actuales.ABSTRACT: From the beginning of his administration, President Lula da Silva has been seeking a deeper & more active role in Latin America, continuing with the former administration’s policy. The Brazilian concerns with the security situation in South America identified with democratic stability, comes articulated to its intention of creating a leadership in the region. In this process, Brazilian diplomacy is increasingly assuming a

  10. New Transnational Literary Histories on the World Scene

    Directory of Open Access Journals (Sweden)

    Remo Ceserani

    2013-12-01

    Full Text Available Il saggio discute il rapporto sempre più problematico fra storia della letteratura e identità nazionale. Dopo aver esaminato alcune storie recenti che continuano a privilegiare la dimensione nazionale ed esclusivamente letteraria della materia trattata, si sofferma su alcune interessanti esperienze di storie che trattano la produzione culturale e letteraria di intere zone geografiche, a prescindere dalle identità statali, culturali e linguistiche di singoli Paesi e nazioni (per esempio: l’Europa centro-orientale, la penisola iberica, l’intero continente sudamericano. Fra i testi presi in esame: la Storia della letteratura ungherese, a cura di B. Ventavoli (2002-2004, la Storia della letteratura polacca, a cura di L. Marinelli (2004, la Geografia e storia della civiltà letteraria rumena nel contesto europeo, a cura di B. Mazzoni e A. Tarantino (2010, la History of the Literary Cultures of East-Central Europe, a cura di M. Cornis-Pope e J. Neubauer (2004-2010, la New History of German Literature, a cura di D. E. Wellbery e J. Ryan (2004, la New History of French Literature, a cura di D. Hollier (1998, la Comparative History of Literatures in the Iberian Peninsula, a cura di F. Cabo Aseguinolaza, A. Abuín Gonzales e C. Domínguez (2010, la New Literary History of America, a cura di G. Marcus e W. Sollors (2009 e le Literary Cultures of Latin America, a cura di M. Valdés e D. Kadir (2004.

  11. La repolarización precoz en el electrocardiograma del futbolista: Prevalencia, características y evolución

    Directory of Open Access Journals (Sweden)

    Roberto M Peidro

    2014-12-01

    Full Text Available La repolarización precoz (RP en el electrocardiograma (ECG del deportista ha sido considerada un hallazgo benigno. Algunas publicaciones la han asociado a incremento de riesgo de muerte súbita. Los objetivos del presente trabajo fueron evaluar la prevalencia de RP inferolateral en una población de futbolistas entrenados, describir variables asociadas a esta patente e investigar la aparición de eventos en el seguimiento. Se analizaron ECG de futbolistas sin antecedentes personales y familiares de cardiopatía, con examen físico cardiovascular normal. Se consideró RP a la elevación del punto J ≥ 0.1 mV sobre la línea de base en, al menos, 2 derivaciones inferiores y/o precordiales laterales, asociada o no a deflexión positiva o muesca en la parte final del QRS. Se relacionaron con RP el voltaje de R en V5 o V6, el intervalo PR, la frecuencia cardíaca (FC y la edad. Fueron contactados a los 60±5 meses de la evaluación inicial con ECG. Estadística: chi cuadrado y test t para datos no apareados. Fueron evaluados 210 ECG de futbolistas hombres, de origen europeo-sudamericano, con entrenamiento de alta intensidad. Edad: 18 ±4.6 años. La RP se encontró en 86 ECG (40.9%, incluida el subtipo inferior en 17 (8.1%. Un ECG mostró RP en cara inferior en forma aislada. Los futbolistas con RP tuvieron mayor edad, menor FC, PR más prolongado y menor voltaje de R. Ninguno de los futbolistas presentó eventos cardiovasculares a los 5 años de la evaluación.

  12. Larrea interspecific hybrids revisited (Zygophyllaceae

    Directory of Open Access Journals (Sweden)

    Juan H. Hunziker

    2002-01-01

    Full Text Available Estudios moleculares recientes nos han inducido a realizar una reinterpretación de las relaciones genómicas entre Larrea ameghinoi y las otras especies sudamericanas del género. Se hicieron nuevos intentos para estudiar el apareamiento de los cromosomas del híbrido L. ameghinoi x L. cuneifolia (2n = 3x = 39. El promedio de bivalentes y univalentes fue de 9.8 y 19.4, respectivamente. Dado que el número básico x es 13 la interpretación más razonable es que L. ameghinoi (2n = 2x = 26 (AA y L. cuneifolia (2n = 4x = 52 (DDCC comparten genomas parcialmente homeólogos (A y C que forman la mayoría de los bivalentes y eso explicaría la producción de semillas (15-19.4 % de estos híbridos triploides. El genoma de L. ameghinoi (A podría haber retenido varias partes de un genoma ancestral que hace posible algún apareamiento con aquellos de las otras especies y que lo capacitaría para funcionar como un genoma pivote que permite alguna fertilidad (desde parcial a completa en todas las posibles combinaciones híbridas con sus tres congéneres sudamericanos. Se incluye un apéndice con las leyendas completas del capítulo 2 del libro de Mabry et al. (1977 que fueran omitidas por error en el proceso editorial y de impresión

  13. Crecimiento del camarón excavador Parastacus pugnax (Poeppig, 1835 determinado mediante técnica de marcaje Growth of burrowing crayfish Parastacus pugnax (Poeppig, 1835 determined by marking technique

    Directory of Open Access Journals (Sweden)

    Mauricio Ibarra

    2011-07-01

    Full Text Available Para determinar el crecimiento en el camarón excavador (Parastacus pugnax en la zona centro sur de Chile se utilizó un marbete tipo cinturón. Los parámetros longitud cefalotorácica asintótica (Lc m y la velocidad de incremento en longitud y peso (K, se establecieron mediante el método de Gulland & Holt (1959. El parámetro t0 se determinó mediante la ecuación inversa del modelo de von Bertalanffy, estableciéndose que las curvas de crecimiento en longitud y peso fueron definidas por los parámetros K = 0,35 mm año-1, t0 = -0,38 años, Lc∞ = 55, 9 mm y W∞ = 83,8 g, valores similares a los de Samastacus spinifrons, especie chilena de alto potencial de cultivo, y de otros parastácidos sudamericanos, tales como P. brasiliensis y P. deffosus.A modified tag belt type was used in the burrowing crayfish (Parastacus pugnax, in the central-south of Chile. The parameters asymptotic carapace length (Lc0 and rate of increase (K were determined through the Gulland & Holt (1959 method. The parameter t0 was determined by the inverse equation of von Bertalanffy model, which allowed to establish that the growth curves in length and weight are defined by the parameters K = 0.35 mm yr-1, t0 = -0.38 years, Lc∞ = 55. 9 mm and W∞= 83.8 g. These values were similar to those of Samastacus spinifrons, Chilean species with high potential for aquaculture, and similar to those of other South American parastacids such as P. brasiliensis and P. deffosus.

  14. Implicaciones del comercio por el puerto de San Blas durante la guerra de independencia

    Directory of Open Access Journals (Sweden)

    Trejo Barajas, Dení

    2006-12-01

    Full Text Available This article analyzes the importance acquired during the Independence war by the maritime trade coming from other Central and South American ports and operating through the San Blas port. The antecedents of the colonial commerce are studied, as well as the British presence and the consequences of the free trade measures taken by the Spanish government which particularly affected the Nueva Galicia Intendencia and the Pacific coasts of Nueva España. In the end, this highly polemical traffic permitted by the Spanish authorities strengthened Nueva Galicia both politically and economically, and prefigured the regionalism that was to be characteristical in 19th Century Mexico.

    En este artículo se analiza la importancia que adquirió, durante la guerra de Independencia, el comercio marítimo por el puerto de San Blas procedente de Panamá y otros puertos centro y sudamericanos. Se exponen los antecedentes relativos a la crisis del comercio colonial, la presencia inglesa y los efectos de las medidas de libre comercio adoptadas por el gobierno español que afectaron de manera particular a la intendencia de Nueva Galicia y las costas del Pacífico novohispano. Se revisan las consecuencias de este polémico tráfico permitido por las autoridades hispanas y que desembocó en el fortalecimiento político y económico de la Nueva Galicia, prefigurando el regionalismo característico del siglo XIX mexicano.

  15. Análisis genético del virus peruano de la fiebre amarilla

    Directory of Open Access Journals (Sweden)

    Carlos Yábar V

    2002-01-01

    Full Text Available Objetivo: Determinar las variantes genéticas de aislamientos del virus peruano de la Fiebre Amarilla (FA. Materiales y métodos: la región carboxiterminal del gen de la envoltura (E de cinco aislamientos de FA obtenidas de pacientes provenientes de Ayacucho 1978 (PER1, Junín 1995 (PER2, Cerro de Pasco (PER3, Cusco (1998 y San Martín (1999 fue amplificada por PCR, secuenciada y analizada con programas software de ADN. Resultados: el índice de similaridad de la secuencia de nucleótidos entre los cinco aislamientos reveló valores oscilantes entre 94,3% y 99,3%, mientras que la secuencia de aminoácidos presentó valores entre 97,6% y 99,7% de similaridad. El análisis filogenético demostró una distancia genética entre 0,40 y 6,50 mediante la secuencia de nucleótidos y a través de la secuencia de aminoácidos se observó un rango de 0,30 y 4,29. Sin embargo, las secuencias correspondientes a los sitios de glicosilación y a los epítopes de reconocimiento humoral fueron conservadas entre los cinco aislamientos, con excepción de algunos aislamientos de referencia reportados por otros autores. Conclusiones: los virus de FA peruanos forman un grupo filogenético distinto a otros virus de FA sudamericanos, basados en el análisis genéticos del gen E.

  16. Notas acerca de psicólogos y teorías psicológicas de Europa Oriental en la historia de la psicología de América del Sur (Notes About East European Psychologists and Psychological Theories in tahe History of Psychology in South America

    Directory of Open Access Journals (Sweden)

    Ramón León

    2014-06-01

    Full Text Available RESUMEN: Psicólogos de Europa Oriental tuvieron un rol importante en los años iniciales de desarrollo de la psicología en América del Sur. En el presente artículo se describe el trabajo y la influencia de cuatro de ellos: Waclaw Radecki (1887-1953, Béla Székely (1899-1955, F. Oliver Brachfeld (1908-1967 y Hélène Antipoff (1892-1974. Además, teorías provenientes de Rusia y la Unión Soviética encontraron una amplia resonancia entre los psicólogos sudamericanos, como la teoría de Pavlov y las ideas de Vygotsky que atrajeron el interés de los especialistas en la región, quienes las consideraron alternativas válidas frente a la psicología proveniente de los Estados Unidos, sobre todo en la década de1960, cuando predominaba una fuerte atmósfera antiestadounidense en esa parte del mundo. ABSTRACT: Psychologists from Eastern Europe had an important role in the initial years of the development of psychology in South America. In the present communication is the work and influence of four of them: WaclawRadecki (1887-1953, BélaSzékely (1899-1955, F. Oliver Brachfeld (1908-1967 and Hélène Antipoff (1892-1974. Furthermore, theory from Russia and the Soviet Union found a wide resonance among South American Psychologists as Pavlov's theory and the ideas of Vygotsky caught the interest of specialists in the region, who considered them valid alternatives to the psychology coming from the United States, at a time as in the 1960 when a strong anti-american atmosphere prevailed in that part of the world.

  17. Análisis multivariado del dimorfismo sexual en doce etnias del Gran Chaco

    Directory of Open Access Journals (Sweden)

    Marcellino, Alberto José

    2002-01-01

    Full Text Available Se ensaya el cálculo de las distancias morfológicas para cuantificar el dimorfismo antropométrico sexual en distintas etnias aborígenes. Paralelamente se investiga: a- el grado de las diferencias entre los dimorfismos de los segmentos cefálico y postcefálico; b- los resultados con distintas combinaciones de variables, redundantes y no redundantes; c- la magnitud de participación de "forma" y "tamaño" en la distancia "total". Las distancias se calcularon mediante los algoritmos de Penrose (1954. El material utilizado fueron los datos antropométricos (inéditos correspondientes a 890 varones y 844 mujeres, obtenidos por Jehan A.Vellard, en 12 etnias del Gran Chaco Sudamericano. Las conclusiones indican: 1 la sensibilidad discriminatoria del procedimiento; 2 el segmento corporal postcefálico proporciona valores de dimorfismo notoriamente más altos que el cefálico en 11 de las 12 etnias investigadas, siendo los Ayoreo la única en que ambas distancias resultan iguales; 3 el dimorfismo sexual antropométrico está dado por el componente "tamaño" más que por el componente "forma", en proporciones cuyo rango aproximado es de 3:1 a 1:0; 4 se indica la combinación más apta para calcular el dimorfismo somatométrico "global" (cefálico+postcefálico que consta de 14 dimensiones, sin redundancia; 5 se plantea la hipótesis de que la razón dimorfismo cefálico/dimorfismo corporal postcefálico se vincularía, en relación inversa, al grado de mestización del grupo.

  18. Paleobiogeografía y paleoecología de los mamíferos continentales de América del Sur durante el Cretácico tardío-Paleoceno: una revisión

    Directory of Open Access Journals (Sweden)

    Ortiz Jaureguizar, E.

    1996-04-01

    observed in South America beginning with the Tiupampian SALMA is radically different to that recorded in the holarctic continents. The placental are restricted to the herbivorous adaptive zones, while marsupial s successfully fill those of the carnivorous, insectivorous, and rodentiform ones. This South American distribution of trophic types would be related with the peculiar physical history of the continent, characterized by vast intervals of isolation with North America, sporadically interrupted by short lapses of intercontinental connection.El objetivo de este trabajo es reseñar los últimos avances en el conocimiento de la paleobiogeografía y la paleoecología los mamíferos sudamericanos durante el intervalo Cretácico tardío-Paleoceno. Para ello se tomaron en cuenta dos parámetros básicos: 1 riqueza taxonómica; y 2 diversidad trófica, en ambos casos utilizando como unidades de análisis los géneros registrados en las cuatro «Edades-mamífero» (SALMAs que representan dicho lapso, i.e., Alamitense (Cretácico tardío, Tiupampense (Paleoceno temprano, Itaboraiense (Paleoceno medio y Riochiquense (Paleoceno tardío. A modo de conclusión, cabe destacar que: 1 Durante la SALMA Alamitense la composición faunística de América del Sur fue marcadamente diferente al de los continentes holárticos, debido a la presencia de una fauna compuesta exclusivamente por taxones pretribosfénicos de abolengo jurásico pangeico, aunque presentando en la mayoría de los casos un marcado grado de endemismo. 2 La fauna la SALMA Tiupampense se caracterizó básicamente por la ausencia de la casi totalidad de los grupos pretribosfénicos alamitenses (con la excepción de los «multituberculados» gondwanaterios y la presencia de una «mezcla» de formas estrechamente vinculadas con América del Norte (e.g., pantodontes junto con otras propias de América del Sur pero de abolengo holártico (e.g., marsupiales o gondwánico oriental (i.e., monotremas. 3 El mayor cambio

  19. Prevalência e prognóstico dos pacientes com pneumonia associada à ventilação mecânica em um hospital universitário Prevalence of ventilator-associated pneumonia in a university hospital and prognosis for the patients affected

    Directory of Open Access Journals (Sweden)

    Márcio Martins de Queiroz Guimarães

    2006-08-01

    Full Text Available OBJETIVO: Determinar prevalência de pneumonia associada à ventilação mecânica em unidade de terapia intensiva, fatores associados e evolução. MÉTODOS: Foram avaliados 278 pacientes sob ventilação mecânica por mais de 24 horas prospectivamente em hospital universitário. RESULTADOS: Desenvolveram a doença 38,1% dos pacientes, 35,7 casos/1.000 dias de ventilação mecânica: 45,3% por bacilos gram negativos, Pseudomonas aeruginosa (22% o mais comum e 43,4% por germes multi-resistentes. O grupo com pneumonia associada à ventilação mecânica teve maiores tempos de ventilação mecânica, desmame, permanência no hospital e na unidade de terapia intensiva (p 10 dias (7,7; 4,1 - 14,2, imunodepressão (4,3; 1,3 - 14,3, síndrome do desconforto respiratório agudo (3,5; 1,4 - 9,0, atelectasia (3,0; 1,2 - 7,3, parada cardiorrespiratória (0,18; 0,05 - 0,66 e hemorragia digestiva alta (0,07; 0,009 - 0,62]. Fatores associados ao óbito hospitalar: insuficiência renal crônica (26,1; 1,9 - 350,7, admissão prévia na unidade de terapia intensiva (15,6; 1,6 - 152,0, simplified acute physiologic score II > 50 pontos (11,9; 3,4 - 42,0 e idade > 55 anos (4,4; 1,6 - 12,3. CONCLUSÃO: A pneumonia associada à ventilação mecânica aumentou tempos de ventilação mecânica, permanência na unidade de terapia intensiva e no hospital, número de complicações, mas não a letalidade.OBJECTIVE: To determine the prevalence of ventilator-associated pneumonia in an intensive care unit, as well as to identify related factors and characterize patient evolution. METHODS: This study evaluated 278 patients on mechanical ventilation for more than 24 hours in a university hospital. RESULTS: Ventilator-associated pneumonia developed in 38.1% of the patients, translating to 35.7 cases/1000 ventilator-days: 45.3% were caused by gram-negative agents (Pseudomonas aeruginosa accounting for 22%; and multidrug resistant organisms were identified in 43.4%. In the

  20. Evaluación y selección preliminar por rendimiento de tubérculo y potencial industrial de 36 clones de papa (Solanum tuberosum L. Preliminary evaluation and selection of yield and industrial potential of 36 potato clones (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Perilla C. Alexánder

    2002-08-01

    Full Text Available Se evaluaron 36 clones de papa por calidad para la industria, rendimiento, respuesta a gota y precocidad, utilizando como testigos las variedades cultivadas para procesamiento industrial, Diacol Capiro, Diacol Monserrate e lCA Unica. Las variables evaluadas fueron porcentaje de tiras y hojuelas no quemadas, gravedad específica, rendimiento procesable, peso tamaño 2, área bajo la curva de la severidad de gota y días después de la siembra a maduración. El experimento se realizó en la Estación Experimental San Jorge, municipio de Soacha (Cundinamarca, se analizó bajo una metodología estadística propuesta en el Programa de Fitomejoramiento de
    Papa de la Universidad Nacional, que utiliza la suma de rangos en el análisis de diseños incrementados bajo bloques
    completos al azar para seleccionar clones por varias variables y no por una como el análisis tradicional. Se seleccionaron 19 clones, de los cuales 7 son superiores para el conjunto de las variables: los clones 6.5 y 12.59 recomendables para procesamiento en forma de tiras; 2.14,6.8, 11.35, 12.62 y 12.71 para hojuelas. Entre los 7 clones se destacan el 6.8 y 2.14 por presentar menor susceptibilidad a gota y, el clon 6.5 por tener menor tiempo a maduración de tubérculo (15 días menos que Capiro.
    36 clones ofpotato were evaluated for industrial quality, yield, late blight response and early ripen, using the varieties grew for industrial processing, Diacol Capiro, Diacol Monserrate and lCA Unica. Data consisted of the percentage of french fries and chips than did not burn, specific gravity, useful yield, weight of second tubers, area under the curve for the severity of late blight and days to ripen. The experiment was carried out at San Jorge Experiment Station, at Soacha municipality (Cundinamarca - Colombia, it was analyzed under a new statistic methodology proposed in the Breeding Program of
    the Universidad Nacional of Colombia that uses ranks sum on the

  1. Resultados Preliminares sobre Estudios de Evapotranspiración del Cacao.

    Directory of Open Access Journals (Sweden)

    Navarrete S. Cristóbal

    1960-06-01

    Full Text Available El objeto de este trabajo fue determinar los requerimientos de agua por el cacaotero. De los múltiples métodos que existen para este fin, solo el que hace uso de la evapotranspirometría da la solución deseada. El método se basa en que el agua del suelo establece un equilibrio entre el agua que entra, como resultado de la precipitación y el agua que sale a través de la evaporación y transpiración. Para este estudio se están usando cuatro evapotranspirómetros de 2 x 2 metros en la parte superior y 1.20 metros de profundidad: un quinto tanque sirve de fosa colectora, donde se tienen las canecas que recogen las aguas de drenajes. A los evapotranspirómetros se trasplantaron cacaoteros de tres y medio años de edad del Clon 6. Posteriormente fueron rellenados consuelo del mismo lugar y procedente de la excavación. La estación de evapotranspirometría se localizó en medio de una plantación comerciaal de cacao del clon 6 de la misma edad, en la que se ha demarcado una zona buffer de 50 x 50 mts., ésta se riega en la misma forma que los tanques evapotranspirómetros. A éstos se les aplica una cantidad medida de agua cuando no llueve en las 24 horas anteriores. La evapotranspiración potencial se mide restando del agua aplicarla la la cantidad recogida en las canecas, esto se hace para cada tanque todos los días a las 8 a.m. Además de la evapotranspiración potencial, diariamente se toman datos metereológicos en aparatos localizados junto a los tanques experimentales. La información para tres meses; indica que el agua de lluvia sólo suministró el 42.19% y el 63.33% de los requerimientos de agua para el cacaotero en los meses de febrero y marzo respectivamente. En el mes de abril la precipitación fue superior a los requerimientos de agua, va que el consumo fue de 58.46 mm. Y la precipitación de 129.5 mm. Debido a la información tan escasa (tres meses solamente aquí presentada, es imposible, por el momento

  2. Novel organic solvent-tolerant esterase isolated by metagenomics: insights into the lipase/esterase classification Nueva esterasa tolerante a los solventes orgánicos aislada por metagenómica: ideas sobre la clasificación de las esterasas/lipasas

    Directory of Open Access Journals (Sweden)

    Renaud Berlemont

    2013-03-01

    Full Text Available In order to isolate novel organic solvent-tolerant (OST lipases, a metagenomic library was built using DNA derived from a temperate forest soil sample. A two-step activity-based screening allowed the isolation of a lipolytic clone active in the presence of organic solvents. Sequencing of the plasmid pRBest recovered from the positive clone revealed the presence of a putative lipase/esterase encoding gene. The deduced amino acid sequence (RBest1 contains the conserved lipolytic enzyme signature and is related to the previously described OST lipase from Lysinibacillus sphaericus 205y, which is the sole studied prokaryotic enzyme belonging to the 4.4 a/ß hydrolase subgroup (abH04.04. Both in vivo and in vitro studies of the substrate specificity of RBest1, using triacylglycerols or nitrophenyl-esters, respectively, revealed that the enzyme is highly specific for butyrate (C4 compounds, behaving as an esterase rather than a lipase. The RBest1 esterase was purified and biochemically characterized. The optimal esterase activity was observed at pH 6.5 and at temperatures ranging from 38 to 45 °C. Enzymatic activity, determined by hydrolysis of p-nitrophenyl esters, was found to be affected by the presence of different miscible and non-miscible organic solvents, and salts. Noteworthy, RBest1 remains significantly active at high ionic strength. These findings suggest that RBest1 possesses the ability of OST enzymes to molecular adaptation in the presence of organic compounds and resistance of halophilic proteins.Con el fin de aislar nuevas variantes de lipasas tolerantes a solventes organicos (OST, se construyo una libreria metagenomica a partir de ADN obtenido de una muestra de suelo de bosque templado. A traves de un monitoreo en dos etapas, basado en la deteccion de actividades, se aislo un clon con actividad lipolitica en presencia de solventes organicos. La secuenciacion del plasmido pRBest recuperado del clon positivo revelo la presencia de un

  3. Caracterización molecular de aislamientos de enterobacter cloacae multirresistentes, productores ß-Lactamasas provenientes de pacientes de un hospital de tercer nivel de Bogotá

    Directory of Open Access Journals (Sweden)

    Ibonne Aydee García Romero

    2005-07-01

    -PCR (ERIC; REP y BOX agrupó la población estudiada en siete clones: seis constituidos por un solo aislamiento y el clon predominante E1/B1/R1 agrupó 14 aislamientos causantes de infección en diez pacientes. Conclusión. Se identificó un clon de Enterobacter cloacae multirresistente, endémico en una institución de tercer nivel en Bogotá, causante de infección nosocomial y quirúrgica en particular.

  4. Construcción de un vector para la integración cromosomal de un gen de fitasa de Bacillus licheniformis

    Directory of Open Access Journals (Sweden)

    Maria Teresa Fernández

    2011-07-01

    Full Text Available Las fitasas son una clase especial de fosfatasas que catalizan la hidrólisis secuencial del fitato. La incapacidad de las plantas para utilizar el fósforo a partir de los fitatos del suelo es debido a la baja actividad de fitasas en sus raíces. Los microorganismos del suelo juegan un importante papel en los procesos que afectan la trans- formación de los compuestos fosforados. Muchos de ellos pueden solubilizar el fósforo a partir de los fitatos, mediante la liberación de fitasas. Este proceso permite la movilización del fósforo hacia las plantas y un mejor aprovechamiento de este nutriente. Sin embargo, muchas bacterias carecen de los genes que codifican para estas enzimas, lo que disminuye la disponibilidad de este elemento en el suelo. Una alternativa es mejorar las rizobacterias en cuanto a su capacidad de solubilizar los fitatos del suelo, mediante la transformación genética. En este trabajo el gen phyL de Bacillus licheniformis fue clonado en el vector de liberación suicida pJMT6 (vector derivado del sistema pUT/mini Tn5. La construcción recombinante que contiene un marcador de selección no antibiótico, fue transformada en Escherichia coli CC118λpir. Un clon transformante (F16 fue seleccionado y posteriormente caracterizado. Estos resultados constituyen un primer paso para desarrollar rizobacterias promotoras del crecimiento mejoradas en cuanto a la producción de actividad fitasa recombinante, como alternativa para reducir la contaminación ambiental y mejorar la productividad de los cultivos.

  5. Evaluación del potencial biofertilizante de bacterias diazótrofas aisladas de suelos con cultivo de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Adriana Zulay Argüello-Navarro

    2014-09-01

    Full Text Available La adaptabilidad del cacao (Theobroma cacao L. en condiciones adversas permite sugerir que la microbiota asociada con la rizosfera desempeña una función importante para la nutrición y el desarrollo de la planta. En el trabajo se evaluó el potencial biofertilizante de bacterias fijadoras de nitrógeno (diazótrofas aisladas de suelos cacaoteros por la técnica de diluciones seriadas. Las bacterias se aislaron en medios semiselectivos (NFb, JMV, LGI, JNFb. Los aislados puros se caracterizaron morfológica y bioquímicamente y complementariamente se evaluó la capacidad de fijación biológica de nitrógeno (FBN por el método de Micro-Kjeldahl. Los aislados con mejor capacidad de fijación de nitrógeno fueron seleccionados para evaluar su potencial promotor de crecimiento durante 120 días en plantas de cacao clon CCN 51 establecidas a partir de semillas. El análisis de datos mostró que las plantas de cacao respondieron efectivamente a los tratamientos con bacterias donde las variables de crecimiento y N (% foliar incrementaron significativamente, en comparación con el testigo. Se destacó el aporte de los aislados DKA2J24, DKB3J73 presuntamente del género Burkholderia sp. y DKA1L3 semejante al género Gluconacetobacter sp., todos con un gran potencial como biofertilizantes en la prueba de bioensayo.

  6. Ensayo de neutralización in vitro de aplicación en la evaluación de inmunógenos contra la hepatitis A, obtenidos mediante la tecnología de expresión en fagos filamentosos

    Directory of Open Access Journals (Sweden)

    Alicia Aguilar

    2010-04-01

    Full Text Available La inmunidad contra el virus de la hepatitis A (VHA se debe en primera instancia a la inducción de anticuerpos neutralizantes. Disponer de ensayos de neutralización es indispensable para evaluar nuevos candidatos vacunales contra este patógeno. En el presente trabajo se desarrolló un ensayo de neutralización in vitro que permitió evaluar la inmunogenicidad de mimotopos del VHA obtenidos mediante la tecnología de expresión en fagos al ser inmunizados ratones Balb/c. Diferentes diluciones de anticuerpos se incubaron con 103 o 102 Dosis Infecciosas en Cultivo de Tejidos 50% (DICT50 del clon citopático HM175/18f de VHA, y se inocularon en placas con células FRhK4. Después de 7 días de incubación el título neutralizante se determinó como el recíproco de la dilución del suero capaz de reducir la multiplicación viral al 50%. Tanto 103 como 102 DICT50 fueron neutralizadas por el anticuerpo monoclonal 7E7 y los sueros humanos (A12 y A31 positivos a anticuerpos anti-VHA. Los controles negativos del ensayo no neutralizaron al virus. Los títulos neutralizantes de los sueros de ratones inmunizados con fagos portadores de mimotopos de VHA oscilaron entre 4 y 16, mientras que los sueros preinmunes y los de ratones inmunizados con fago salvaje M13 no neutralizaron la infectividad viral. Este ensayo de neutralización resultó adecuado para la evaluación de los inmunógenos propuestos

  7. Descripción morfoagronómica de materiales de plátano (Musa AAB, ABB y banano (Musa AAA cultivados en San Andrés Isla

    Directory of Open Access Journals (Sweden)

    Oscar Javier Parra Pachón

    2009-10-01

    Full Text Available Durante el primer semestre de 2005 se estudiaron los cultivares de plátano y banano en fincas y parcelas de 15 agricultores típicos participantes en programas conjuntos de la Secretaría de Agricultura y Pesca de San Andrés Isla y de la Universidad Nacional de Colombia sede Caribe. A partir de descriptores de INIBAP, IPGRI y CIRAD y revisiones bibliográficas.se describen morfológicamente los materiales de Musa cultivados en la Isla, así como las prácticas de los productores isleños, Se identificaron cuatro clones del subgrupo plátano (Musa AAB: un Hartón (‘Horse’ y tres Dominico-Hartón (‘Tallo Negro’, ‘Tallo Blanco’ y ‘Cincuenta’ del subgrupo ABB se hallaron un material de Bluggoe (‘Boscó’ y un Felipita. El subgrupo banano AAA presentó dos materiales Gros Michel (denominados Común y Chino y uno de banano (Rojo. El plátano tiene gran importancia para los agricultores de la Isla, siendo el Boscó el clon más aceptado entre consumidores por su adaptación a las condiciones edafológicas y climáticas. El banano es menos cultivado; ya que los suelos, el clima y las enfermedades como sigatoka negra, condicionaron el desarrollo de clones. El trabajo sugiere prácticas de fácil implementación que podrían aumentar la producción en los sistemas de huerto mixto tropical que predominan en la Isla.

  8. Descripción morfoagronómica de materiales de plátano (Musa AAB, ABB y banano (Musa AAA cultivados en San Andrés Isla

    Directory of Open Access Journals (Sweden)

    Parra Pachón Oscar Javier

    2009-12-01

    Full Text Available Durante el primer semestre de 2005 se estudiaron los cultivares de plátano y banano en fincas y parcelas de 15 agricultores típicos participantes en programas conjuntos de la Secretaría de Agricultura y Pesca de San Andrés Isla y de la Universidad Nacional de Colombia sede Caribe. A partir de descriptores de INIBAP, IPGRI y CIRAD y revisiones bibliográficas.se describen morfológicamente los materiales de Musa cultivados en la Isla, así como las prácticas de los productores isleños, Se identificaron cuatro clones del subgrupo plátano (Musa AAB: un Hartón (‘Horse’ y tres Dominico-Hartón (‘Tallo Negro’, ‘Tallo Blanco’ y ‘Cincuenta’ del subgrupo ABB se hallaron un material de Bluggoe (‘Boscó’ y un Felipita. El subgrupo banano AAA presentó dos materiales Gros Michel (denominados Común y Chino y uno de banano (Rojo. El plátano tiene gran importancia para los agricultores de la Isla, siendo el Boscó el clon más aceptado entre consumidores por su adaptación a las condiciones edafológicas y climáticas. El banano es menos cultivado; ya que los suelos, el clima y las enfermedades como sigatoka negra, condicionaron el desarrollo de clones. El trabajo sugiere prácticas de fácil implementación que podrían aumentar la producción en los sistemas de huerto mixto tropical que predominan en la Isla.

  9. "More human than human": instrumentalización y sublevación de los sujetos artificiales / «More Human than Human»: Instrumentalization and Uprising of Artificial Subjects

    Directory of Open Access Journals (Sweden)

    Jimena Escudero Pérez

    2016-08-01

    Full Text Available La vida sintética, orgánica y mixta creada artificialmente tiene siempre como fin satisfacer algún tipo de necesidad de su creador, el ser humano. La inteligencia de estos engendros, así como su interacción con el medio, puede ser muy variable proporcionándoles distintos grados de conciencia. Desde los robots de limpieza hasta los clones, pasando por cíborgs y replicantes o por superordenadores que toman el mando, el inventario de sujetos artificiales autoconscientes en el cine de ciencia ficción es prácticamente inagotable. En el presente artículo abordaremos algunas de sus representaciones más icónicas e influyentes para el género, así como el impacto que estas han tenido sobre nuestra concepción de la propia naturaleza humana.Palabras clave: artificial, sujeto, identidad, instrumentalización, robot, clon, cíborg, consciencia, humanidad, creación.AbstractArtificially created life, whether it is synthetic, organic or mixed, always has the purpose of fulfilling some need of its creator, human kind. The intelligence of these beings as well as their interaction with the environment can vary widely, providing them with different degrees of consciousness. From maintenance robots to clones, through cyborgs and replicants or supercomputers that take control, the inventory of self-conscious artificial subjects in science fiction is almost endless. In this article we will take a look at some of the most iconic and influential manifestations of artificial identities in Sci Fi and see how they have moulded our perception of human nature itself.Keywords: artificial, subject, identity, instrumentalization, robot, clone, cyborg, consciousness, humanity, creation.

  10. Preparación de genotecas de ADNc de Plasmodium falciparum para la búsqueda de los genes de proteínas de unión a calmodulina, GOGAT y Pfmyo A.

    Directory of Open Access Journals (Sweden)

    Dary L. Mendoza

    2002-09-01

    Full Text Available Se construyó una genoteca de ADNc representativa de los estadios asexuales de Plasmodium falciparum, en el vector lZipLox. Esta genoteca (de la cepa colombiana FCB2 y otra genoteca construida en lZAP II (de la cepa Dd2, se rastrearon en busca de genes de proteínas que se unen a calmodulina (CaM o a proteínas relacionadas con CaM. Para el rastreo se usó tanto el ensayo de Hot-start PCR como la hibridización de filtros réplica con sondas radiomarcadas. Se identificaron clones de actina I, calmodulina (CaM, glutamato sintasa (GOGAT y las tres miosinas Pfmyo A, Pfmyo B y Pfmyo C. Se aislaron clones para actina I, CaM y GOGAT en la genoteca construida en lZipLox y clones para GOGAT y Pfmyo A en la genoteca construida en lZAP II. Uno de los clones de GOGAT contiene un inserto de 2.413 pb que corresponde al 24,8% de la secuencia codificante informada. El inserto de Pfmyo A aislado tiene 2.457 pb y representa el mensajero completo del gen. La identidad de este inserto se confirmó mediante análisis de restricción. Este es el primer informe de un clon de ADNc completo de la miosina A de P. falciparum. Los clones aislados se utilizarán en estudios futuros, tales como la obtención de las proteínas recombinantes, producción de anticuerpos y ensayos de funcionalidad.

  11. Diagnóstico de leucemias bifenotípicas por citometría de flujo

    Directory of Open Access Journals (Sweden)

    Martha Vizcaíno

    2010-05-01

    Full Text Available Las leucemias bifenotípicas son raras en los niños y representan menos de 5% de todas las leucemias agudas. El diagnóstico requiere de una evaluación cuidadosa con apoyo de la morfología celular, la citogenética y la citometría de flujo. El tratamiento está orientado a remitir el clon predominante de células, aunque no existen datos conclusivos sobre la remisión completa. En el tratamiento, la quimioterapia ha demostrado mejores resultados que el trasplante de médula ósea. La supervivencia está influenciada por la respuesta a la terapia y otros factores inherentes a la enfermedad y al paciente.Se presenta el caso de dos niños diagnosticados en el año 2009. El primero fue una niña de ocho años de edad que consultó por palidez cutánea, anemia, leucopenia y blastos en el hemograma. El segundo caso fue un niño de 10 años que consultó por dolor abdominal, que tuvo que ser intervenido por peritonitis secundaria a una apendicitis y en quien se demostró la presencia de blastos en sangre periférica a las 48 horas del posoperatorio. La morfología celular y la citometría de flujo confirmaron, en el primer caso, leucemia linfoide aguda bilineal y, en el segundo caso, leucemia bifenotípica.

  12. Respuesta fotosintética de Eucalyptus grandis W. Hill a la disponibilidad de agua en el suelo y a la intensidad de luz

    Directory of Open Access Journals (Sweden)

    María Sara Mejía de Tafur

    2014-12-01

    Full Text Available En condiciones de campo en la Universidad Nacional de Colombia sede Palmira (950 m.s.n.m., 24°C y 75% de humedad relativa se evaluó la respuesta fotosintética de cuatro clones de Eucalyptus grandis (28-3, 18-3, 24A-5, 19-1 al estrés hídrico: capacidad de campo (1 cc, 0.5 cc, 0.25 cc y a la saturación de agua e intensidades lumínicas variables de 1500, 1000, 500, 250, y 0 µmol/m²/s en el primer ensayo y de 1500, 1000, 435, 87, 70, 52, 35, 26, y 0 µmol/m²/s en el segundo. En ambos estudios, se utilizó un diseño experimental de parcelas divididas con cuatro repeticiones, donde la parcela principal correspondió al nivel de humedad en el suelo y la subparcela a los clones. El análisis estadístico mostró que E. grandis reduce la tasa de fotosíntesis de manera significativa cuando se presenta estrés hídrico en el suelo y que el grado de la respuesta depende del clon, lo que sugiere la presencia de mecanismos fisiológicos dependientes del genotipo para responder al estrés hídrico. Se presentaron curvas de luz típicas con puntos de compensación bajos (0.9 - 7.0 µmol/m²/s, tasas de fotosíntesis altas (68 - 39 µmol CO2 /m²/s y alta eficiencia fotosintética (0.0003 - 0.0086 mol CO2 /mol luz

  13. La proteína PthB de Xanthomonas axonopodis pv. manihotis es autoactiva en ensayos de doble hibrido

    Directory of Open Access Journals (Sweden)

    Juliana Gil

    2011-01-01

    Full Text Available La bacteriosis vascular de yuca producida por la bacteria Xanthomonas axonopodis pv. manihotis (Xam es uno de los factores limitantes para la producción de yuca. Dentro de los primeros factores de patogenicidad identificados en esta bacteria se encuentra el gen pthB. La proteína PthB pertenece a la familia de efectores PthA/AvrBs3, que se caracterizan por presentar dominios NLS (Nuclear Localization Signal y un dominio AAD (Acidic Activation Domain, lo cual sugiere que estas proteínas actúan como factores de transcripción. La identificación de las proteínas de yuca que interactúan con PthB permitiría dar luces sobre la función de esta proteína en la patogenicidad de esta bacteria. En este trabajo se clonó pthB en una fusión traduccional con el BD (Binding Domain del factor de transcripción GAL4. Después de transformar este constructo en una cepa de levadura, se observó autoactivación de los genes reporteros, incluso a concentraciones altas de 3-AT. La eliminación del primer, segundo o de los dos NLS y del AAD no eliminaron la capacidad de autoactivación de los genes reporteros mediada por PthB. Estos resultados indican la imposibilidad de su utilización en un tamizaje de una librería de ADNc de yuca para identificar las proteínas que interactúan con PthB.

  14. Almacenamiento del carbono en varios suelos cultivados con cacao en la provincia El Oro-Ecuador

    Directory of Open Access Journals (Sweden)

    Dr. C. Salomón Barrezueta-Unda

    2018-04-01

    Full Text Available Con el objetivo de estimar la variabilidad de carbono almacenado en suelos cultivados de cacao en la parte baja de la provincia El Oro, fueron seleccionadas al azar 30 parcelas cultivadas con cacao del tipo Nacional (n=12 tomado como modelo agrofestal y del clon de cacao CCN51 (n=18 como modelo en monocultivo, para lo cual se conformaron transeptos de 30 x 15 metros en el centro de cada parcela de donde se tomaron muestras de suelo a una profundidad de 0-30 cm a las que realizaron análisis de arena, limo y arcilla por Bouyucos, densidad aparente (Da por el método del cilindro, pH relación 1:25 con lectura en potenciómetro en laboratorio, Capacidad de intercambio catiónico (CIC con acetato de amonio pH 7, nitrógeno (N y carbono (C en un analizador elemental. Para cuantificar la cantidad de C almacenado se utilizó la profundidad del muestreo, la Da para determinar el volumen del suelo, el cual se multiplica por el C orgánico. Los resultados mostraron un predominio de la arena (>39% y el limo (>30%, con poca variabilidad en la Da con medias de 1,37 g-1 m3. La CIC fue superior en los cultivares de Nacional con 35,25 cmol (+ kg-1 al determinado en CCN51 (27,34 cmol (+ kg-1, al igual que el C orgánico (2,2% y N (0,20%. Los niveles de C almacenados fueron de 33,096 Mg de C ha-1 en CCN51 y 45,555 Mg de C ha-1 en Nacional, sin existir diferencias significativas (p=0,117. Palabras clave: Cacao Nacional, CCN51, carbono orgánico, densidad aparente.

  15. Eficiencia fisiológica de uso de NPK en clones autoincompatible y autocompatible de cacao (Theobroma cacao L. en Colombia

    Directory of Open Access Journals (Sweden)

    Yina Jazbleidi Puentes-Páramo

    2016-06-01

    Full Text Available La investigación tuvo como objetivo evaluar la eficiencia fisiológica de N-P-K en clones de cacao de sabor y aroma autocompatible (CCN-51, ICS-95 y autoincompatible: (TSH-565, ICS-39, con la finalidad de determinar la capacidad de producción de grano seco por unidad de nutriente absorbido. Se utilizó un diseño en bloques completos al azar con cinco tratamientos y cuatro repeticiones, los tratamientos fueron diseñados a partir del nivel de fertilidad natural del suelo (TR-Tratamiento de referencia y sobre este el 25, 50, 75 y 100% más de Nitrógeno-Fósforo-Potasio (N-P-K, correspondiente al T1, T2, T3 y T4. Los resultados evidencian que hay diferencias altamente significativas entre clones para los nutrientes N-P-K absorbidos, exhibiendo mayor absorción de nitrógeno, seguido de potasio y por ultimo fósforo, en este sentido, el clon autocompatible CCN-51 mostro mayor habilidad de absorción para la mayoría de nutrientes, excepto fósforo, sin embargo, no es generalizada la mayor habilidad para clones autocompatibles con respecto a clones autoincompatibles.  La mayor eficiencia fisiológica de uso de nutrientes N-P-K se presentó en el tratamiento uno y la menor capacidad de producción de grano seco de cacao por unidad de nutriente se presentó con la dosis nutricional más alta en el tratamiento cuatro, lo cual sugiere que a mayor dosis disminuye la eficiencia fisiológica de uso de nitrógeno, fósforo y potasio de los clones.

  16. EVALUACIÓN DE CUATRO PATRONES PARA INJERTOS DE GUAYABA (Psidium guajava L.

    Directory of Open Access Journals (Sweden)

    Antonio Bogantes-Arias

    2010-01-01

    Full Text Available El trabajo se realizó en la Estación Experimental Los Diamantes del INTA entre el 2004 y el 2007, con el objetivo de determinar el efecto de varios patrones en la injertación de la guayaba. Se evaluaron cuatro patrones: tres de cas (Psidium friedrichsthalianum, y uno de guayaba, sobre el crecimiento y desarrollo de un clon experimental de guayaba (Psidium guajava. En la etapa de vivero, el prendimiento fue de un 100% para los patrones guayaba y "cas brasileño", mientras que para los tratamientos con "arrayán" y "cas criollo" fue de un 90%. El crecimiento vegetativo inicial fue significativamente mayor en el testigo. En el campo, se observó la misma tendencia de mayor crecimiento en el tratamiento de guayaba como patrón. También, se observó un claro efecto enanizante del patrón arrayán, mientras que los patrones "cas brasileño" y "cas criollo" mostraron un crecimiento intermedio. El número y peso de la fruta fue superior en el tratamiento de guayaba como patrón y no hubo diferencias entre los tipos de cas. Con el fin de evaluar la susceptibilidad de los patrones a nematodos en plantas adultas, se incluyó un testigo adicional de guayaba al que se le aplicó nematicida en campo. Los resultados indican que los nematodos Meloidogyne sp. y Pratylenchus sp. lograron colonizar las raíces de los tratamientos de guayaba con y sin nematicida, así como del cas brasileño. No se detectaron nematodos en las raíces de los patrones cas criollo ni de arrayán.

  17. Reef-coral proteins as visual, non-destructive reporters for plant transformation.

    Science.gov (United States)

    Wenck, A; Pugieux, C; Turner, M; Dunn, M; Stacy, C; Tiozzo, A; Dunder, E; van Grinsven, E; Khan, R; Sigareva, M; Wang, W C; Reed, J; Drayton, P; Oliver, D; Trafford, H; Legris, G; Rushton, H; Tayab, S; Launis, K; Chang, Y-F; Chen, D-F; Melchers, L

    2003-11-01

    Recently, five novel fluorescent proteins have been isolated from non-bioluminescent species of reef-coral organisms and have been made available through ClonTech. They are AmCyan, AsRed, DsRed, ZsGreen and ZsYellow. These proteins are valuable as reporters for transformation because they do not require a substrate or external co-factor to emit fluorescence and can be tested in vivo without destruction of the tissue under study. We have evaluated them in a large range of plants, both monocots and dicots, and our results indicate that they are valuable reporting tools for transformation in a wide variety of crops. We report here their successful expression in wheat, maize, barley, rice, banana, onion, soybean, cotton, tobacco, potato and tomato. Transient expression could be observed as early as 24 h after DNA delivery in some cases, allowing for very clear visualization of individually transformed cells. Stable transgenic events were generated, using mannose, kanamycin or hygromycin selection. Transgenic plants were phenotypically normal, showing a wide range of fluorescence levels, and were fertile. Expression of AmCyan, ZsGreen and AsRed was visible in maize T1 seeds, allowing visual segregation to more than 99% accuracy. The excitation and emission wavelengths of some of these proteins are significantly different; the difference is enough for the simultaneous visualization of cells transformed with more than one of the fluorescent proteins. These proteins will become useful tools for transformation optimization and other studies. The wide variety of plants successfully tested demonstrates that these proteins will potentially find broad use in plant biology.

  18. Integración de prácticas culturales y control biológico para el manejo de Moniliophthora roreri Cif & Par

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Villamil

    2015-12-01

    Full Text Available En Colombia las pérdidas ocasionadas por Moniliophthora roreri Cif & Par en el cultivo de cacao, son considerables y los métodos de control tradicional no son suficientes. Para el manejo de la enfermedad el control biológico, surge como alternativa económicamente viable y ambientalmente sostenible. El objetivo del presente estudio fue evaluar el control de Moniliophthora roreri mediante parámetros de incidencia y severidad, utilizando aislamientos nativos y cepas comerciales de Trichoderma spp., en combinación con prácticas culturales (PC. Se evaluaron diez tratamientos, los cuales resultaron de combinar prácticas culturales, productos biológicos comerciales, aislamientos nativos de hongos y funguicidas de síntesis química. Para la evaluación, se empleó un diseño completamente aleatorio (DCA con cuatro repeticiones, para un total de 40 UE cada una compuesta por una planta del clon TCS01 (Theobroma CORPOICA la Suiza 01. Se hizo inoculación dirigida al dosel, utilizando una concentración de 1,2, 1,5 y 2,9 x107 UFC.g-1 para aislamientos nativos y 2,0 y 5,0 x108 UFC.g-1 para cepas comerciales. Se evaluó incidencia y severidad externa en los frutos durante 25 semanas. Los resultados indicaron que los frutos inoculados con el tratamiento T7 (P.C + Safer soil ®W.P y T4 (P.C + mezcla Trichoderma H20, H3, H5, presentaron los menores porcentajes de incidencia y severidad externa y los mayores rendimientos de cosecha sin diferencias significativas respecto al control químico y regional, representando una alternativa promisoria para la producción de cacao en la subregión occidental de Boyacá.

  19. AISLAMIENTO DE CLONES CON ACTIVIDAD ENDO-b-1,4-GLUCANASA A PARTIR DE UN SEGMENTO DE ADN DE 13KB DE Clostridium sp IBUN22A

    Directory of Open Access Journals (Sweden)

    I. Roncancio-Sánchez

    2006-06-01

    Full Text Available La producción de combustibles, solventes y algunos productos químicos a partir de sustratos celulósicos usando microorganismos ofrece una ventaja frente a los de origen fósil. Un acercamiento prometedor ha sido la implementación de ingeniería genética utilizando genes de enzimas involucradas en la degradación de desechos celulósicos. En la última década se han generado bibliotecas genéticas para proveer enzimas celulolíticas, que hagan el proceso más rentable, lo cual permitiría aprovechar mejor residuos celulósicos disponibles. Este trabajo describe el aislamiento de dos fragmentos de ADN que expresan actividad endo-β-1,4-glucanasa, a partir de un segmento ADN de 13Kb (clon 02080-25 aislado de una biblioteca genómica de la cepa nativa Clostridium sp IBUN22A. El aislamiento de la región codificadora se realizó a través de pruebas de inducción de la actividad, análisis por restricción del segmento y de una sub-biblioteca con la enzima Sau3A I. 325 clones fueron obtenidos, de los cuales 271 tenían inserto. El tamizaje molecular de estos últimos mostró que siete clones presentaron tamaños entre 3500pb y 7000pb y el tamizaje enzimático con carboximetilcelulosa como sustrato permitió el aislamiento de los clones pBSh-37 y pBSh-26 con la actividad endo-β-1,4-glucanasa original, de tamaños de inserto de 627pb y 879pb respectivamente. Este trabajo es el punto de partida para el aislamiento de enzimas de alto potencial biotecnológico.

  20. Obtención de anticuerpos monoclonales de ratón contra proteasa de cisteína 5 recombinante de Entamoeba histolytica

    Directory of Open Access Journals (Sweden)

    Juanita Trejos S.

    2012-08-01

    Full Text Available Objetivo. Obtener anticuerpos monoclonales de ratón contra la proteasas de cisteína 5 (EhCP5 de Entamoeba histolytica. Materiales y métodos. Se inmunizaron ratones BALB/c por vía intraperitoneal con adyuvante de Freund completo e incompleto con la proteína recombinante EhCP5 obtenida a partir del cultivo de E.coli DH5α trasfectada con el vector recombinante pJC45 que expresa dicha proteína. Se seleccionó el animal con mejor respuesta de anticuerpos. Al cual se le extrajo su bazo como fuente de linfocitos B, los cuales se fusionaron utilizando PEG con células de mieloma de ratón SP2-0/Ag14. Se procedió a selección de los hibridomas y a la evaluación de los sobrenadantes de las colonias que crecieron a los 7 días mediante ELISA. Los hibridomas con valores más altos de anticuerpos específicos contra la proteína EhCP5r se seleccionaron, y los clones obtenidos por diluciones limitantes fueron expandidos. Resultados. A partir de un clon secretor estable se purifico el anticuerpo monoclonal anti EhCP5r del isotipo IgG1 por cromatografía de afinidad con proteína G. Los clones fueron expandidos in vivo e in vitro. Con el anticuerpo purificado se diseñaron tres sistemas de captura para evaluar la aplicabilidad del anticuerpo monoclonal anti EhCP5r como método inmunodiagnóstico. Conclusiones. Se logro la producción de un anticuerpo monoclonal específico contra EhCP5r que permite diferenciar Entamoeba histolytica de Entamoeba dispar.

  1. La expresión y actividad catalítica diferencial de GDP-manosa pirofosforilasa influye en la producción de vitamina C en Myrciaria dubia “camu-camu”

    Directory of Open Access Journals (Sweden)

    Juan Castro Gómez

    2013-12-01

    Full Text Available Myrciaria dubia muestra una amplia variación en la producción de vitamina C (vit.C. Para entender las bases moleculares de esta variación, se determinó la relación del nivel de expresión genética y actividad de GDP-Manosa pirofosforilasa (GMP con la variación del contenido de vit.C en M. dubia. Las muestras fueron obtenidas de una colección de germoplasma. La vit.C se cuantificó por HPLC, la actividad de GMP se midió por espectrofotometría. El ARN se purificó, el ADNc se sintetizó, amplificó, clonó y secuenció con técnicas estándares. La expresión del gen se midió mediante PCR en tiempo real. Las diferencias en el contenido de vit.C de las hojas, pulpa y cáscara dependieron de la expresión y actividad de GMP. Esta relación también se observó entre plantas que producen frutos con bajo y alto contenido de vit.C. En conclusión, Las hojas, pulpa y cáscara de M. dubia muestran diferencias significativas en el contenido de vit.C, el cual se atribuye a la expresión y actividad catalítica diferencial de la GMP. Asimismo, las plantas que producen frutos con diferencias marcadas en el contenido de vit. C en sus pulpas, también dependen del nivel de expresión y actividad catalítica de esta enzima.

  2. La expresión y actividad catalítica diferencial de GDP-manosa pirofosforilasa influye en la producción de vitamina C en Myrciaria dubia “camu-camu”

    Directory of Open Access Journals (Sweden)

    Juan Castro Gómez

    2013-12-01

    Full Text Available Myrciaria dubia muestra una amplia variación en la producción de vitamina C (vit.C. Para entender las bases moleculares de esta variación, se determinó la relación del nivel de expresión genética y actividad de GDP-Manosa pirofosforilasa (GMP con la variación del contenido de vit.C en M. dubia. Las muestras fueron obtenidas de una colección de germoplasma. La vit.C se cuantificó por HPLC, la actividad de GMP se midió por  espectrofotometría. El ARN se purificó, el ADNc se sintetizó, amplificó, clonó y secuenció con técnicas estándares. La expresión del gen se midió mediante PCR en tiempo real. Las diferencias en el contenido de vit.C de las hojas, pulpa y cáscara dependieron de la expresión y actividad de GMP. Esta relación también se observó entre plantas que producen frutos con bajo y alto contenido de vit.C. En conclusión, Las hojas, pulpa y cáscara de M. dubia muestran diferencias significativas en el contenido de vit.C, el cual se atribuye a la expresión y actividad catalítica diferencial de la GMP. Asimismo, las plantas que producen frutos con diferencias marcadas en el contenido de vit.C en sus pulpas, también dependen del nivel de expresión y actividad catalítica de esta enzima.

  3. Capital social y participación,una perspectiva desde el Cono Sur de América: Porto Alegre, Montevideo y Santiago de Chile

    Directory of Open Access Journals (Sweden)

    Patricio Valdivieso

    2012-06-01

    Full Text Available En este estudio presento evidencias sobre la participación ciudadana y el Capital Social (CS en tres casos sudamericanos - Porto Alegre, Montevideo y Santiago de Chile-, con el propósito de revitalizar el debate sobre la opinión pública, cultura política y CS. El estudio parte de los siguientes supuestos: el CS es el resultado de decisiones racionales de las personas, y los diseños políticos, las instituciones y la cultura política tienen efectos en esas decisiones. Con ayuda de un modelo de utilidad, datos de encuestas e información complementaria, analizo información sobre asociativismo y confianza, y otras variables socio-económicas, demográficas y políticas relacionadas. Las conclusiones son: a mediados de la década del 2000, Montevideo, Porto Alegre y Santiago de Chile disponían de un stock de CS equivalente al de sociedades desarrolladas; en esas ciudades, y por extensión en los países, los factores político-institucionales y de cultura política tuvieron efectos en la confianza y la disposición de las personas a participar, operando de forma variada, en relación con distintos contextos y situaciones de participación. En el análisis más desagregado del caso de Chile en el nivel municipal, se observan las mismas relaciones.This study presents evidence on citizen participation and social capital (SC in three South American cases - Porto Alegre, Montevideo and Santiago of Chile, in order to revitalize the debate on public opinion, political culture and SC. The study has the following assumptions: the SC is the output of rational decisions of individuals and political designs and institutions and political culture have an impact on those decisions. Using a utility model, survey data and information, I analyze information on associative life and trust, and other socio-economic, demographic and political information. The conclusions: in the mid-2000s, Montevideo, Porto Alegre and Santiago de Chile had a stock of SC

  4. Irrigation Water Management in Latin America Manejo del Agua de Riego en Sudamérica

    Directory of Open Access Journals (Sweden)

    Aureo S de Oliveira

    2009-12-01

    Full Text Available Latin American countries show a great potential for expanding their irrigated areas. Irrigation is important for strengthening local and regional economy and for enhancing food security. The present paper aimed at providing a brief review on key aspects of irrigation management in Latin America. Poor irrigation management can have great impact on crop production and on environment while good management reduces the waste of soil and water and help farmers maximizing their profits. It was found that additional research is needed to allow a better understanding of crop water requirements under Latin American conditions as well as to provide farmers with local derived information for irrigation scheduling. The advantages of deficit irrigation practices and the present and future opportunities with the application of remote sensing tools for water management were also considered. It is clear that due to the importance of irrigated agriculture, collaborative work among Latin American researchers and institutions is of paramount importance to face the challenges imposed by a growing population, environment degradation, and competition in the global market.Los países sudamericanos tienen un gran potencial para aumentar sus áreas regadas. El riego es importante para fortalecer las economías locales y regionales y para mejorar la seguridad alimentaria. Esta revisión tiene por objeto proporcionar un resumen de los aspectos más importantes del manejo del riego en Sudamérica. Un manejo pobre del riego puede tener un alto impacto en la producción de cultivos y en el ambiente, en tanto que un buen manejo reduce las pérdidas de suelo y agua, y ayuda a los productores a maximizar sus ingresos. Se encontró que se requiere investigación adicional que permita una mejor comprensión de los requerimientos de agua de los cultivos en las condiciones sudamericanas, y también para proporcionar a los agricultores información local que permita hacer programaci

  5. Felicidad, cultura y valores personales: estado de la cuestión y síntesis meta-analítica

    Directory of Open Access Journals (Sweden)

    María Ángeles Bilbao

    2007-12-01

    Full Text Available Este estudio presenta un meta-análisis sobre la relación entre los valores de Schwartz y el bienestar subjetivo en distintos contextos culturales, con estudiantes, sus familiares e inmigrantes en España. Los resultados confirman una asociación significativa entre los valores y el bienestar. Auto trascendencia y apertura al cambio, y con menor intensidad, conservación, se asocian positivamente con mayor bienestar. Auto trascendencia se asocia con felicidad y satisfacción de forma positiva no homogénea, siendo los inmigrantes quienes presentan medias más bajas. Apertura al cambio se asocia con felicidad, siendo más fuerte la asociación en inmigrantes que en estudiantes. Los valores conservacionistas se asocian homogéneamente. Un segundo estudio sobre criterios de salud psicosocial y bienestar subjetivo -analizando un país sudamericano colectivista y jerárquico como Brasil, y otro europeo más individualista e igualitario como España- confirma que los valores conservacionistas, así como los de aperturaal cambio y auto trascendencia, son deseables y favorecen el bienestar. -- This article presents a meta-analysis of the relationship between Schwartz personal values and subjective well-being among different cultural contexts, with students, their families, and immigrants in Spain. Results show a significant association between personal values and well-being. Self-transcendence and openness to change, as well as conservation, but with less intensity, are positively associated with greater well-being. Self-transcendence is non-homogenous and positively associated with both happiness and satisfaction, being the immigrants who present lower levels. Openness to change is associated with happiness, being this relationship stronger for immigrants than for students. Conservation values are homogenously associated with subjective well-being. A second study about psychosocial health and subjective well-being analyzes two countries: a

  6. Arctocephalus (Hydrarctos Lomasiensis, subgen. nov. et nov. sp., un nouvel otariidae du mio-pliocène de Sacaco, Pérou

    Directory of Open Access Journals (Sweden)

    1978-01-01

    Full Text Available La découverte d'une tête (crâne et mandibule et de quelques éléments post-crâniens d'un nouvel Otariidae dans la Formation Pisco (Miocène supérieur - Pliocène inférieur à Sacaco (Pérou représente un événement très important dans l'histoire du groupe il s'agit en effet du premier Otariidae préquaternaire sud-américain: Arctocephalus (Hydrarctos sugen nov. lomastensis sp nov. Sa description anatomique comparative entreprise ici conduit à considérer l'espèce nouvelle comme une tentative de spécialisation avortée du genre Arctocephalus. De plus, quelques considérations sur les divisions subfamiliales des Otariidae permettent aussi d'établir une nouvelle sous-famille: Callorhinae subfam. nov. El descubrimiento de una cabeza (cráneo y mandíbula de un nuevo Otariidae y de algunos elementos postcraniales, en la Formación Pisco (Mioceno superior - Plioceno inferior representa un suceso muy importante en la historia del grupo. Se trata efectivamente del primer Otariidae precuaternario sudamericano: Arctocephalus (Hydrarctos subgen nov lomastensis sp nov. Su descripción anatómica y comparación están aquí ejecutadas y conducen a considerar la nueva especie como una tentativa de especialización abortada del género Arctocephalus. Además, algunas consideraciones sobre las divisiones subfamiliares de los Otariidae permiten también establecer una nueva subfamilia: Callorhinae subfam nov. The discovery of a head (skull and mandible of a new Otariidae and of some post cranial elements in the Pisco Formation (Peru is a very important event in the group's history, as it represents the first prequaternary south american Otariid: Arctocephalus (Hydrarctos subgen. nov lomastensis sp nov. Its anatomical description and comparison are here undertaken and lead to consider the new species as an aborted specialization attempt of the genus Arctocephalus. Moreover, some considerations about the subfamily divisions of the Otariidae also

  7. Ética e investigación Ethics and investigation

    Directory of Open Access Journals (Sweden)

    Salomón Zavala

    2011-12-01

    Full Text Available Los autores hacen una evaluación crítica de los aspectos éticos de la investigación en base a su experiencia como docentes universitarios y como miembros de Comités de Ética en Investigación. Invitan a la discusión de temas que consideran polémicos. Comienzan mencionando el rol regulador de las Normas Éticas Internaciones y Locales y de los Comités de Ética en Investigación. Comentan la postura de bioeticistas sudamericanos respecto del llamado "doble estándar" ético y sobre la liberalización del uso del placebo. Critican el perjuicio que ocasiona a los pacientes de bajos recursos el sistema de patentes así como la falta de interés en el desarrollo de nuevos medicamentos para tratar enfermedades raras o propias de países pobres, y la excesiva extensión de los Consentimientos Informados. Terminan opinando acerca de la distribución de los ensayos clínicos entre los investigadores, los problemas que afectan a los Comités de Ética en Investigación y sobre algunos contenidos del Reglamento de Ensayos Clínicos del Instituto Nacional de Salud.The authors make a critical evaluation of the ethical aspects of research based on their experience as university teachers and members of Ethics Committees. They invite to the discussion on topics that they consider polemic. They begin by mentioning the regulatory role of the International and Local Ethical Norms and of the Ethics Committees. They comment on the position of South American bioethicists regarding the so-called ethical "double standard" and on the liberalization of the use of the placebo. They criticize the damage that the system of patents causes on low- resources patients, as well as the lack of interest in the development of new medications to treat neglected diseases or those diseases which are only prevalent in poor countries, and the excessive length of the Informed Consents. They finish giving their opinion about the distribution of the clinical trials among the

  8. First report of diarrheic shellfish toxins in mollusks from Buenos Aires province (Argentina associated with dinophysis spp.: evidence of okadaic acid, dinophysistoxin-1 and their acylderivatives

    Directory of Open Access Journals (Sweden)

    Eugenia A Sar

    2012-06-01

    ón precolumna. Los datos evidenciaron contaminación de los moluscos con toxinas DSP y un perfil compuesto por Ácido Okadaico (OA, Dinophysistoxina-1 (DTX-1, Acyl-Dinophysistoxina-1 (Acyl-DTX-1 y Acyl-Ácido Okadaico (Acyl-OA. Las toxinas DSP encontradas en este estudio producen síntomas de diarrea consistentes con los experimentados por los pacientes que habían ingerido moluscos cocinados en enero. Este es el primer reporte de Acyl-derivados en muestras de moluscos procedentes del Atlántico Sudamericano y de OA en muestras de moluscos procedentes de Argentina.

  9. Alimentación, salud y demografía de las poblaciones prehistóricas de Colombia

    Directory of Open Access Journals (Sweden)

    Rodríguez, J. V.

    2003-01-01

    Full Text Available Los Andes Orientales de Colombia tienen una secuencia de poblamiento de más de 10.000 años, según los yacimientos precerámicos (10.000-3000 a.P. excavados en Tequendama, Sueva, Galindo, Nemocón, Checua y Aguazuque, que están acompañados de restos óseos humanos, además de Tibitó y El Abra. El Formativo (800 a.C. a 800 d. C. está representado por sitios funerarios como Madrid, Duitama y Arboloco. Sobre las comunidades indígenas que encontraron los españoles en el siglo XVI existen evidencias óseas de muiscas de Bogotá, Tunja, Sogamoso, además de guanes, laches y chitareros. En fin, con más de 600 individuos de los períodos precerámico, formativo y agroalfarero tardío, existe la posibilidad de un análisis osteológico que de cuenta de la variación en el tiempo y el espacio, de las principales características físicas, el problema de la etnogénesis, la alimentación, salud y estrategias demográficas. Además de contrastar la información de Colombia con el ámbito Sudamericano y abordar la problemática del poblamiento temprano de América. Se discuten los modelos migracionista, microevolutivo e integracionista sobre el poblamiento de América, además de los orígenes de algunas enfermedades infecciosas como la treponematosis y tuberculosis. Las lesiones dentales se discuten en el ámbito del tiempo, espacio, sexo y edad. Finalmente, se aborda la problemática de las estrategias adaptativas que emplearon las comunidades prehispánicas en el contexto de la ecología humana, su calidad de vida y el papel de los sacrificios humanos en las regulaciones demográficas. Se plantea el poblamiento de los Andes Orientales en dos oleadas, una por el norte por la cuenca del río Sogamoso-Chicamocha, dando origen a la diversidad nororiental, y otra por el sur, por la cuenca del río Bogotá, que configuró la diversidad suroccidental.

  10. Un tributo a Roberto Caldeyro-Barcia, considerado el pionero de la Perinatología

    Directory of Open Access Journals (Sweden)

    A. Zárate

    2017-03-01

    Full Text Available Roberto Caldeyro-Barcia nació en Montevideo en 1921, estudió Medicina graduándose como médico cirujano en 1947. Fue aceptado como investigador asociado en el Instituto de Fisiología bajo la supervisión del profesor Hermógenes Álvarez, quien estaba trabajando sobre el efecto de la actividad uterina en el pulso cardiaco fetal durante el parto. La presión amniótica se registró con el uso de un pequeño catéter introducido dentro de la cavidad amniótica, por lo que Caldeyro-Barcia propuso introducir un microcatéter directamente en el músculo uterino para obtener información más específica de la contracción uterina y su efecto sobre la actividad cardiaca fetal. Se observó que la frecuencia cardiaca disminuía en los casos de hipoxia fetal. Dichos descensos fueron llamados DIP I y II. Así, se confirmó que la hipoxia durante el parto tiene una deletérea acción en la oxigenación fetal, lo cual fue registrado y graduado como unidades montevideo. Dos años después, Edward H. Hon, quien trabajaba en la Universidad de Yale, confirmó estos hallazgos, lo que fue el inicio de la monitorización fetal durante el trabajo de parto en todo el mundo. Caldeyro-Barcia fue galardonado por muchas asociaciones académicas internacionales; asimismo fue designado director del Centro Sudamericano de Perinatología y presidente de la Federación Internacional de Ginecología y Obstetricia. Se consideró un amigo de México, país que visitó muchas veces, por lo que tuvo una relación académica muy cercana con Luis Castelazo-Ayala.

  11. AVANCES EN BIOARQUEOLOGÍA DEL CHACO BOREAL (Advances in the Bioarchaeology of Northern Chaco

    Directory of Open Access Journals (Sweden)

    Guillermo N. Lamenza

    2015-12-01

    Full Text Available Las investigaciones bioantropológicas llevadas a cabo en el Gran Chaco sudamericano han comenzado a revertir el estado de desconocimiento que sumía a la región. En esta oportunidad se presentan los avances de los análisis de los materiales recuperados en el sitio arqueológico Puerto 14 de Mayo, cuya particular importancia reside en ser el único en el Chaco boreal abordado de manera sistemática. Sucesivas excavaciones arqueológicas han puesto de manifiesto entierros humanos datados en ca. 1800 años AP (LP2897 y LP3167. Se pudo constatar la presencia de al menos seis individuos, cinco adultos y un subadulto. A partir del análisis paleopatológico se determinaron posibles características del modo de vida del grupo, considerando una dieta con bajos niveles de hidratos de carbono y el consumo de alimentos de características abrasivas. Estos resultados permiten introducir nueva información en una región prácticamente inexplorada en términos arqueológicos y contribuye a la comprensión del marco espacio-temporal de las ocupaciones humanas de las tierras bajas sudamericanas. ENGLISH: Bioanthropological research carried out in the South American Gran Chaco has begun to address the lack of such knowledge in the region. Here we present the analysis of materials recovered at the site Puerto 14 de Mayo, whose particular importance lies in being the only site in the Chaco Boreal that has been systematically addressed archaeologically. Successive archaeological excavations have revealed human burials dated to ca. 1800 B.P. (LP2897 and LP3167, in which there are at least six individuals, five adults and one subadult. Through paleopathological analysis, possible features of the group’s way of life were determined, such as a diet with low levels of carbohydrates and the consumption of food with abrasive characteristics. These results allow us to add new information to a virtually unexplored archaeological region and contribute to an

  12. Los balleneros Anglo-estadunidenses y la cuestión de la 'extranjerización' del comercio peruano a fines de la época colonial, 1790-1820

    Directory of Open Access Journals (Sweden)

    Ramiro Alberto Flores Guzmán

    2011-12-01

    Full Text Available La mayor parte de los historiadores coincide en señalar que el fin del monopolio mercantil español en la costa oeste del océano Pacífico fue resultado de las reformas imperiales en el ámbito comercial. Desde nuestra perspectiva, esta explicación es insuficiente pues no toma en consideración los tratados internacionales firmados por la corona mediante los cuales cedió derechos de navegación a barcos de otras naciones en aguas territoriales españolas. En este artículo proponemos que el monopolio español en el Pacífico fue socavado por la masiva intrusión de barcos balleneros anglo-estadunidenses que llegaron amparados por los tratados de pesca de 1790 y 1795. Al combinar la pesca con el contrabando, los balleneros llevaron, tal vez sin proponérselo, al colapso de los sistemas de control del comercio extranjero. La apertura de la navegación al tráfico ballenero desempeñó, en consecuencia, una participación significativa en el desmantelamiento del monopolio comercial español en aguas del Pacífico sudamericano.Most historians agree that the end of the Spanish commercial monopoly on the west coast of the Pacific Ocean was the result of imperial reforms in trade. From our perspective, this explanation is insufficient since it does not take into account the international treaties signed by the crown through which gave rights of navigation to ships of other nations in Spanish territorial waters. In this paper we propose that the Spanish monopoly in the Pacific was undermined by the massive intrusion of Anglo-American whalers who arrived covered by the fishing treaties of 1790 and 1795. By combining fishing with smuggling, the whalers drove, perhaps unintentionally, the collapse of systems of control of foreign commerce. The opening of the whaling traffic played, therefore, a significant role in dismantling the Spanish trade monopoly in the South American Pacific waters.

  13. Spatial and temporal variability of stable isotope composition of precipitation over the south american continent

    Directory of Open Access Journals (Sweden)

    1995-01-01

    Full Text Available VARIABILITE SPATIALE ET TEMPORELLE DE LA COMPOSITION EN ISOTOPES STABLES DE LA PRECIPITATION SUR LE CONTINENT SUDAMERICAIN. L’Agence Internationale de l’Energie Atomique, en coopération avec l’Organisation Météorologique Mondiale, exploite un réseau mondial de stations pour la prise d’échantillons mensuels de précipitation. Actuellement, à peu près 60 stations fournissent des informations sur la composition isotopique de la précipitation sur le continent sudaméricain. Ces dernières années plusieurs réseaux d’échantillonnage d’un caractère national (Argentine, Brésil, Chili, Equateur, Pérou ont été initiés. Les données apportées par ces réseaux contribuent au réseau mondial de l’AIEA/OMM. Ces travaux se concentrent sur l’étude de la variabilité spatiale et temporelle de la composition isotopique stable de la précipitation sur le continent. Dans cette étude, est examinée en détail la relation entre la composition isotopique de la précipitation dans la région et quelques paramètres climatiques, tels que la quantité de précipitation et la température de l’air. VARIABILIDAD ESPACIAL Y TEMPORAL DE LA COMPOSICIÓN DE ISÓTOPOS ESTABLES DE LA PRECIPITACIÓN EN EL CONTINENTE SUDAMERICANO. El Organismo Internacional de Energía Atómica (OIEA, en colaboración con la Organización Meteorológica Mundial (OMM, está llevando a cabo un estudio a escala global de la composición isotópica de la precipitación a partir de muestras mensuales de lluvia recogidas en estaciones meteorológicas. En la actualidad alrededor de 60 estaciones proporcionan información sobre la composición isotópica de la precipitación en el continente sudamericano. Durante los últimos años se han establecido en la región varias redes de control con carácter nacional (Argentina, Brasil, Chile, Ecuador, Perú. Los datos aportados por estas redes representan una valiosa contribución a la red mundial del OIEA/OMM. Este trabajo se

  14. Patrones de distribución geográfica de la riqueza de especies de roedores de la tribu Oryzomyini (Rodentia: Sigmodontinae en Sudamérica: Evaluando la importancia de los procesos de colonización y extinción Geographic patterns of richness distribution of rodents species from the Oryzomyini tribe (Rodentia: Sigmodontinae in South America: Evaluating the importance of colonization and extinction processes

    Directory of Open Access Journals (Sweden)

    EVELYN VALENCIA-PACHECO

    2011-09-01

    Full Text Available La tribu de roedores Oryzomyini es la más diversa dentro de la subfamilia Sigmodontinae. Está constituida por 120 especies y 31 géneros, de las cuales 83 son endémicas del continente sudamericano. Este grupo exhibe una extensa distribución que abarca toda la región Neotropical, caracterizada por la presencia de una mayor riqueza en la Amazonia con una disminución monotónica hacia el sur y norte de Sudamérica. Este es un patrón bastante conocido en la mayoría de los taxones, por lo que se han propuesto varios mecanismos causales. Sin embargo, se desconocen los mecanismos que dan cuenta de este gradiente latitudinal en la riqueza de especies de Oryzomyini. Debido a que estas especies son originarias de la Amazonia, y que a través de su historia colonizaron ambientes nuevos y más variables (sur y norte, se evaluó la hipótesis fuente-sumidero, mediada por procesos de colonización y extinción, como potencial explicación al patrón de riqueza observado. Para evaluar esta hipótesis se reunió una base de datos de distribución y riqueza de especies por grado de latitud para todo el continente sudamericano. Posteriormente se evaluó el grado de anidamiento mediante los índices de T (temperatura, BR (discrepancia y NODF. Nuestros resultados evidenciaron un grado de anidamiento significativo en la distribución de Oryzomyini, y un anidamiento significativo separadamente en filas y columnas de la matriz. Por lo tanto, se concluye que la dinámica fuente-sumidero afecta el patrón de distribución de la riqueza de roedores Oryzominos, a través de un proceso de colonización durante su expansión en Sudamérica que fue mediado por los rangos de tolerancia de las especies. Finalmente, las especies menos tolerantes se habrían extinguido, lo que determinaría un menor número de especies hacia el sur y norte de la Amazonia.The Oryzomyini rodent tribe is the most diverse taxon within the Sigmodontinae subfamily. This tribe includes 120

  15. El cuajamiento de frutos de feijoa (Acca sellowiana [O. Berg] Burret en respuesta a nitrato de potasio, fosfato de potasio y ethephon

    Directory of Open Access Journals (Sweden)

    García Oskar Javier

    2008-08-01

    Full Text Available

    En la finca El Cortijo, municipio La Vega (Cundinamarca, ubicada a 2.350 msnm de altitud, con temperatura de 17 °C, humedad relativa de 85%, precipitación de 1.423 mm·año-1, se estudió el efecto de tres productos químicos en árboles de feijoa, Clon 41 ('Quimba', de 6 años de edad, sobre el cuajamiento de los frutos. Los productos fueron los fertilizantes foliares KNO3 (nitrato de potasio 13-0-46® al 1,0%, 1,5% y 2,0% y KH2PO4 (fosfato de potasio; Cosmofoliar al 0-32-43®; 0,5%, 0,75% y 1,0% y la fitohormona ethephon (Ethrel® 48SL, a 100, 150 y 200 mg·L-1, aplicados 4 veces, cada 15 días, a partir de 50 días después de la poda. Se evaluaron el número de flores formadas, el número y el porcentaje de frutos cuajados y el nivel de eficacia de los productos aplicados. El KH2PO4 al 0,5% presentó los valores significativamente más altos (P≤0,05 en las cuatro variables evaluadas y obtuvo, en su diferencia frente al testigo (0 aplicaciones, aumentos de 447,6% en el número de las flores formadas y de 465,4% en el número de frutos cuajados, destacando la importancia del P en el proceso reproductivo de la feijoa. El segundo mejor tratamiento, con una eficacia positiva (96,55% en el cuajamiento de frutos, fue el ethephon a 100 mg·L-1. El número de frutos cuajados en las diferentes concentraciones de KNO3 no pudo superar el del testigo, presentándose una eficacia negativa y así mismo, fitotoxicidad cuando se emplearon concentraciones al 2%. El porcentaje de cuajamiento en feijoa (66% del testigo fue relativamente alto comparado con el de otros frutales.

  16. Efecto del Hierro en el Desarrollo de las Raíces de las Plantas

    Directory of Open Access Journals (Sweden)

    Correa Velásquez Jairo

    1964-08-01

    Full Text Available Se investigó el efecto del hierro en el desarrollo de las raíces del cacao, el café y el fríjol. También se observó la velocidad de recuperación de la clorofila en plantas cloróticas de cacao y café, al agregarles cantidades crecientes de hierro, y el efecto de dicha recuperación sobre el desarrollo radical. Además, se estudió el grado de absorción y movilización de Fe50 en plantas de cacao, y el efecto de distintas dosis de hierro en el crecimiento de raíces aisladas cacao, café y fríjol. Las plantas fueron cultivadas en el invernadero en solución HoagIand N° 2 sin Fe y las raíces para cultivo se obtuvieron de semillas germinadas en el laboratorio. Se usaron plantas de cacao del clon uf 668 de 3 meses y de café (variedad caturra con la misma edad. El hierro radiactivo utilizado fue en forma de cloruro (Fe59 cl 3 y el agregado a la solución o al follaje, en forma de quelato (Fe E. D. T. A.. Las adiciones de este elemento se hicieron cuando las plantas mostraban síntomas característicos de su deficiencia. Hubo una recuperación casi total de la clorosis y tanto el volumen como la longitud radical aumentaron con las aplicaciones crecientes de hierro, aunque la longitud relativa de los tallos mostró una tendencia decreciente. En las hojas de cacao se presentó una acumulación del Fe y su movilización hacia los demás órganos de la planta fue lenta y en proporción reducida en relación con el total absorbido. Igual cosa sucedió con el Fe50 suministrado a las raíces. No se pudieron observar los efectos del Fe en el crecimiento de raíces aisladas de cacao, café y fríjol, pues el desarrollo fue muy reducido, debido a que la rápida oxidación de los tejidos (al separar aquéllas del resto de la planta redujo la viabilidad a unos pocos días.

  17. Consumo de forrajes tropicales por vacas lecheras, mestizas Siboney, manejadas en condiciones de estabulación

    Directory of Open Access Journals (Sweden)

    Julio J. Reyes

    2015-01-01

    Full Text Available Con el objetivo de estudiar el comportamiento de tres forrajes tropicales y su consumo por animales lecheros, durante tres años, se utilizó un área total de cultivos de 4.25 hectáreas, distribuidas en 1.50 hectáreas para caña de azúcar (Sacharum officinarun, 2 hectáreas del king grass clon CT-169 (Pennisetum purpureum vc Cuba CT-169 y 0.75 hectáreas de leucaena (Leucaena leucocephala; para estimar el consumo, se utilizaron 20 vacas lecheras mestizas de Siboney, mantenidas en régimen de estabulación, con dieta semi-integral. Se realizó un análisis de varianza, según diseño completamente aleatorizado, en arreglo factorial. Los resultados arrojan que las disponibilidades promedio del forraje caña de azúcar fueron mayores (P<0.05 en la época poco lluviosa: 1,916.64 vs. 1,474.73 kg MS ha-1 mes-1; mientras que los forrajes de CT-169 y leucaena fueron superiores sus disponibilidades (P<0.01 en la época lluviosa: 924.76 y 519.01 vs. 649.10 y 314.20 kg MS ha-1 mes-1, respectivamente. La calidad de los forrajes fue menor (P<0.001 en la época poco lluviosa. Los consumos totales de materia seca que realizaron los animales, fue superior (P<0.001 en la época lluviosa (10.56 vs. 9.33 kg MS animal-1 día-1; mientras que los animales de ordeño realizaron un mayor (P<0.001 consumo que los secos (10.82 vs. 9.06 kg MS animal-1 día-1. Los resultados expresan la posibilidad del sistema en estabulación de mantener una carga promedio de 4.70 a 4.9 UGM ha-1, con vacas lecheras de mediano potencial y obtener un consumo adecuado de estos forrajes.

  18. Composición química y degradación de cuatro especies de Pennisetum sp

    Directory of Open Access Journals (Sweden)

    Alexandra Elizabeth Barrera Álvarez

    2016-01-01

    Full Text Available La capacidad de degradación de los pastos de corte en la Costa, constituye una alternativa a la demanda de gramíneas para la alimentación de rumiantes. Se seleccionó cuatro especies de pasto Pennisetum (elefante, king grass morado, maralfalfa y Clon Cuba CT-115 a tres edades de corte (30, 45 y 60 días y se evaluó la dinámica degradativa en 0, 3, 6, 12, 24, 48 y 72 horas de incubación utilizando tres toros Brahman fistulados de 450 kg promedio. Se utilizó la técnica de las bolsas de nylon y se empleó un diseño de bloques al azar con un arreglo factorial 4x3 (especies forrajeras x edad de corte. Los datos fueron expuestos a un análisis de varianza con la prueba de Tukey (p<0.05 y con el programa estadístico (SAS, 2003. Se constató que el avance de la edad estuvo asociado con la disminución de la proteína, sus mejores proporciones fueron a los 30 días con 12.89%, seguido por 12.19, 11.53 y 9.77% para el maralfalfa, CT-115, king grass y elefante, respectivamente. La mayor tasa de degradación in situ fue p≤0.001 para el pasto maralfalfa a los 30 días de corte, obteniendo materia seca (88.85%, materia orgánica (89.53% y biodisponibilidad de cenizas (85.24% a las 72 horas de incubación. La liberación de estos componentes se vio influenciada con la madurez del forraje, por tanto, su alta degradación garantiza una cantidad de energía fermentable, disponible para el proceso de síntesis microbiana ruminal y es una buena alternativa de uso para los ganaderos.

  19. Semejanzas entre el ajo (Allium sativum costarricense y el ajo asiático según secuencias de ADN ribosomal

    Directory of Open Access Journals (Sweden)

    Karina Barboza Rojas

    2012-08-01

    Full Text Available En Costa Rica, la producción de ajo (Allium sativum es escasa y se limita principalmente a las regiones de Llano Grande de Cartago. Sin embargo, por el precio que tiene actualmente en el mercado, el ajo costarricense se vislumbra como una hortaliza que podría constituirse en un recurso valioso para los productores nacionales. Por lo anterior, en este artículo se presenta la caracterización mediante secuencias ribosomales de materiales de ajo provenientes Costa Rica y su comparación con ajo importado de China. El ADN se extrajo a partir de hojas de vitroplantas de ajo mantenidas en un congelador a -70°C, pulverizadas en un mortero. El ADN ribosomal se amplificó, purificó y secuenció. Se realizó el análisis bioinformático de las secuencias ribosomales. El BLASTn permitió determinar que los productos de PCR amplificados corresponden a la secuencia parcial de los genes 28S y 18S (sitios de unión de los cebadores y a la secuencia completa de la región ITS-1, 5.8S e ITS-2. Se encontró que todas las secuencias alinearon en casi un 100% con la accesión EU626375.1 publicada en la base de datos del GeneBank, correspondiente al clon Allium sativum voucher BF-ALL-037. En general, las secuencias mostraron ser muy conservadas. Los puntajes obtenidos del alineamiento realizado con ClustalW reflejaron una identidad del 97 al 99% entre las secuencias.El presente estudio es el primer reporte de este tipo que se realiza sobre ajo costarricense y generó información básica e indispensable para continuar con los estudios moleculares de este cultivo.

  20. Evaluación de dos tipos de esquejes para producción de tubérculo-semilla élite en cuatro variedades de papa Solanum phureja juz et buk y Solanum tuberosum

    Directory of Open Access Journals (Sweden)

    Sidney Benhur Moreno Rengifo

    2004-07-01

    (axilar y apical. Se evaluaron las siguientes variables respuesta: porcentaje de supervivencia de esquejes a la tercera semana, longitud y número de hojas de esquejes durante tres semanas, área foliar y peso seco de esquejes a la cuarta semana. Después de esto los esquejes se sembraron en bolsas plásticas de 10 x 14 pulgadas calibre seis y se llevaron a invernaderos donde se realizó el aporque y demás manejo agronómico. Luego de cumplido el ciclo vegetativo de las plantas se midieron los rendimientos (peso y número de tubérculos para cada tratamiento. Se utilizó un diseño completamente al azar para cada ensayo (dosis de ANA y Hormonagro en cada variedad en un arreglo factorial 2 x 4 y 2 x 2 correspondientes al tipo de esqueje (axilar o apical y concentración de ANA (0, 5, 10 y 15 mg/l en el primer caso y (sin Hormonagro y con Hormonagro en el segundo caso. El porcentaje de supervivencia de esquejes fue superior al 90% en los axilares y mayor del 95% en los apicales. El Hormonagro redujo significativamente la supervivencia de esquejes y afectó considerablemente las otras variables. En los rendimientos no se observaron diferencias respecto al control por la aplicación de Hormonagro. El regulador ANA en dosis entre 5 y 10 mg/l mostró ser conveniente para el prendimiento de los esquejes. Se obtuvo mayor peso total de tubérculos en esquejes axilares de las variedades Capiro y Puracé, mientras que para la variable número total de tubérculos los esquejes axilares de las variedades Capiro y Clon 1 mostraron los mejores promedios. La mayor cantidad de tubérculos-semilla cosechados pesaron entre 3 y 21 g. La aplicación adecuada de la metodología propuesta puede ayudar a reducir costos en producción de semilla de papa fase 1 de buena calidad fitosanitaria.

  1. Characterization of Listeria monocytogenes isolates from cattle and ground beef by pulsed-field gel electrophoresis Caracterización de aislamientos de Listeria monocytogenes obtenidos de ganado y de carne molida de vacuno por electroforesis de campo pulsado

    Directory of Open Access Journals (Sweden)

    Claudia Foerster

    2012-09-01

    Full Text Available The aims of this study were to determine the occurrence of Listeria monocytogenes in cattle feces and ground beef, to characterize these strains by pulsed-field gel electrophoresis and to compare them to three listeria strains found in humans. Cattle from different origins (n = 250 and ground beef obtained from supermarkets (n = 40 were sampled. The results show low occurrence in cattle feces (0.4 % but a higher presence in ground beef (37 %. An important part of the ground beef strains (80 % had > 95 % similarity with a strain isolated from a human sporadic case and the ATCC 19115 used as control. The strain isolated from cattle feces had 93 % similarity to clone 009, previously associated with a listeriosis outbreak related to cheese. Cattle and ground beef can harbor virulent L. monocytogenes strains. Further studies in animals and animal products are needed to improve listeriosis control.Los objetivos de este estudio fueron determinar la presencia de Listeria monocytogenes en el ganado y en la carne molida de vacuno comercializada en Chile, caracterizar los aislados mediante electroforesis de campo pulsado y compararlos con los obtenidos en tres cepas que han producido listeriosis en humanos, en ese país. Se tomaron muestras de heces de bovinos (n = 250 y de carne molida obtenida en supermercados (n = 40. Se encontró una baja incidencia de este patógeno en las heces de bovinos (0,4 %; un solo animal, pero mayores porcentajes en la carne molida (37 %. Gran parte de las cepas encontradas en la carne molida (80 % mostraron una similitud mayor del 95 % con un caso esporádico de listeriosis y con la cepa de referencia ATCC 19115. La cepa aislada de bovino tuvo un 93 % de similitud con el clon 009, responsable de un brote asociado al consumo de queso, ocurrido en 2008. Se concluye que el ganado y la carne molida pueden albergar cepas virulentas de L. monocytogenes. Se necesita un mayor número de estudios en animales y en los productos que se

  2. COMPOSICION QUIMICA Y CONCENTRACION DE PRECURSORES DE ACIDO RUMENICO Y VACCENICO EN FORRAJES ALTERNATIVOS PARA LA ALIMENTACION DE RUMIANTES EN ECOSISTEMAS ARIDOS

    Directory of Open Access Journals (Sweden)

    Ricardo Ortega Pérez

    2009-07-01

    Full Text Available Se determinó el valor nutrimental de alfalfa henificada (AH, dos genotipos de fríjol yorimón [IT90K-277-2 (FYG18 y Sesenteño (FYG25], un clon de pasto taiwán (PT, un cultivar local de nopal en dos presentaciones, pencas tiernas de 15 días de edad o ";;;nopalitos";;; (NT y pencas maduras (NM de 60 días de edad y germinado de semillas de maíz (GM del genotipo ASGROW 7573. Se cuantificó el contenido de materia seca (MS, proteína cruda (PC, lípidos totales (LT, cenizas (C, fibra cruda (FC y energía bruta (EB, así como la concentración de ácido linoleico (LA, ácido α-linolénico (ALA, ácidos grasos poliinsaturados (PUFA y ácidos grasos n-3. Los resultados revelan que los genotipos de frijol yorimón FYG25 y FYG18, mostraron el mayor contenido de PC. Respecto a la concentración de LT, el genotipo de yorimón FYG25 mostró la mayor cantidad seguido del FYG18 y AH. Los forrajes verdes de frijol yorimón (FYG25 y FYG18, así como el pasto Taiwán tuvieron el contenido mayor de ácido α-linolénico. Las semillas de germinado de maíz mostraron los contenidos mayores de ácido linolénico seguido del nopal tierno. Ambos ácidos grasos poliinsaturados (ALA y LA son precursores del ácido ruménico y del ácido vaccénico en rumiantes. Por lo tanto, el uso de estos forrajes verdes en la alimentación de rumiantes es una alternativa que podría modificar las proporciones de ácido grasos en la leche y la carne con el propósito de incrementar los PUFA, específicamente el ácido ruménico así como el ácido vaccénico.

  3. Culture supernatants from V. cholerae O1 ElTor strains isolated from different geographic areas induce cell vacuolation and cytotoxicity Cepas de V. cholerae O1 biotipo ElTor aisladas de diferente origen geográfico inducen vacuolización celular y citotoxicidad

    Directory of Open Access Journals (Sweden)

    Jorge E Vidal

    2009-02-01

    Full Text Available OBJECTIVE: To investigate whether the HlyA-induced vacuolating effect is produced by V. cholerae O1 ElTor strains isolated from different geographic origins, including Mexico. MATERIAL AND METHODS: Supernatant-induced haemolysis, vacuolating activity and cytotoxicity in Vero cells were recorded. PCR, RFLP analysis and molecular cloning were performed. RESULTS: All ElTor strains analyzed induced cellular vacuolation. Ribotype 2 strains isolates from the U.S. gulf coast yielded the highest titer of vacuolating activity. Eight of nine strains were haemolytic, while all strains were PCR positive for the hlyA gene. We cloned the hlyA gene from two ElTor strains, a toxigenic (2514-88, ctxAB+ and a non-toxigenic Mexican strain (CM 91-3, ctxAB-. Supernatant from those recombinant E. coli strains induced haemolysis, cell vacuolation and cytotoxicity. RFLP-PCR analysis revealed similarities in the hlyA gene from all strains tested. CONCLUSION: The HlyA-induced vacuolating effect is a widespread phenotype of epidemic V. cholerae O1 ElTor strains.OBJETIVO: Analizar el efecto vacuolizante de cepas de V. cholerae O1 ElTor aisladas de diferente origen geográfico, incluyendo México. MATERIAL Y MÉTODOS: Se realizaron pruebas de hemolisis, vacuolización y citotoxicidad en células Vero, así como PCR, análisis por RFLP y clonación molecular. RESULTADOS: Todas las cepas indujeron el efecto vacuolizante. Las cepas del ribotipo 2, aisladas de las costas del Golfo en Estados Unidos, presentaron títulos altos de vacuolización. El gen hlyA fue amplificado en las nueve cepas mediante PCR, aunque sólo ocho fueron hemolíticas. Se clonó el gen hlyA de una cepa toxigénica (2514-88, ctxAB+ y de una cepa no toxigénica aislada en México (CM 91-3, ctxAB-. El sobrenadante de las clonas recombinantes indujo hemólisis, efecto vacuolizante y citotoxicidad. El RFLP mostró alta similitud del gen hlyA de las cepas estudiadas. CONCLUSIÓN: El efecto vacuolizante es un

  4. Protocolo para la formación de microtubérculos de ñame (Dioscorea alata L. en sistema de inmersión temporal

    Directory of Open Access Journals (Sweden)

    Manuel Cabrera Jova

    2009-07-01

    Full Text Available Con el propósito de desarrollar un protocolo para la formación de microtubérculos en el clon de ñame Pacala Duclos (Dioscorea alata L. en sistema de inmersión temporal, que pudiera ser usado como alternativa para la propagación de esta especie, se definieron como objetivos de trabajo determinar el efecto del tiempo y la frecuencia de inmersión, así como la influencia del volumen de medio de cultivo por planta cultivada in vitro. Con el empleo de 15 min de inmersión y una frecuencia de inmersión cada 6 horas, se alcanzaron los mejores resultados en cuanto al número de microtubérculos formados por planta. Con este tiempo y frecuencia de inmersión los microtubérculos presentaron la mayor masa fresca y seca, así como el mayor diámetro. Además, a las 18 semanas de cultivo se obtuvo el mayor número total de microtubérculos por sistema y el mayor número de microtubérculos aprovechables como material vegetal de propagación. En cuanto al volumen de medio de cultivo por planta, con 60 ml de medio de cultivo por planta in vitro se alcanzó el mayor número de microtubérculos aprovechables, los cuales presentaron el contenido más alto de materia seca. Los microtubérculos obtenidos en este tipo de sistema de inmersión temporal presentaron una masa fresca superior a 2,40 gMF, lo cual podría permitir su uso como material de plantación directo a campo.Abreviaturas: sistema de inmersión temporal (SIT, gramos de masa fresca (gMF, recipiente de inmersión temporal automatizado (RITA.

  5. Evaluación de cinco genotipos promisorios de papa Solanum tuberosum sp. andigena según desempeño agronómico y calidad industrial

    Directory of Open Access Journals (Sweden)

    Martínez Nancy M.

    2005-06-01

    Full Text Available

    Con base en variables cualitativas y cuantitativas se llevó a cabo la evaluación de cinco genotipos promisorios de papa Solanum tuberosum sp. andigena pertenecientes a la Corporación Colombiana de Investigación Agropecuaria –CORPOICA– y de la variedad Diacol Capiro, en siete localidades del país. Los resultados se analizaron por métodos univariados y multivariados para conocer las características que discriminaban a los materiales. En el análisis multivariado de componentes principales, los primeros cuatro componentes representan el 95,22% de la variación total. Las variables de mayor influencia fueron época de maduración, época de emergencia, peso total de los tubérculos por parcela, peso de los tubérculos de tamaño primera, peso de los tubérculos de tamaño cero, peso de los tubérculos de tamaño cuarta, gravedad específica y materia seca. Se detectó que existe interacción significativa entre genotipo y ambiente para las variables de rendimiento en frito y calidad industrial, las cuales, según el análisis de estabilidad fenotípica de Kang (1991, permitieron seleccionar los clones 2, 7 y 14 como los más rendidores y estables según las características peso total de los tubérculos por parcela, materia seca y rendimiento en frito. Considerando el índice de rendimiento y la estabilidad fenotípica combinadas, el clon 7 se recomienda como el material más promisorio.

  6. Diseño de dos metodologías moleculares para la rápida identificación de aislamientos de Staphylococcus aureus resistente a meticilina asociados a la comunidad en Colombia

    Directory of Open Access Journals (Sweden)

    Javier Antonio Escobar

    2012-06-01

    Full Text Available Introducción. Los aislamientos de Staphylococcus aureus resistente a la meticilina asociado a la comunidad (SARM-AC, están aumentando la frecuencia de infecciones en personas sanas de la comunidad y en pacientes hospitalizados. En Colombia y en la región andina estos aislamientos tienen un componente genético relacionado con el clon pandémico USA300. Objetivo. Diseñar y estandarizar dos metodologías para la diferenciación rápida de aislamientos colombianos de S. aureus resistente a la meticilina asociado a la comunidad de los asociados al hospital (SARM-AH. Materiales y métodos. Se estandarizaron dos metodologías moleculares para la identificación de aislamientos de S. aureus resistente a la meticilina asociado a la comunidad. La primera se basa en la digestión diferencial con tres enzimas de restricción de los genes cinasa de carbamato (arcC y cinasa de guanilato (gmk para los tipos de secuencia 5 (ST5 y 8 (ST8, correspondientes a aislamientos de S. aureus resistente a la meticilina asociado al hospital y asociado a la comunidad, respectivamente. La segunda se basa en la amplificación por reacción en cadena de la polimerasa de cinco factores de virulencia que se encuentran de manera diferencial en estos aislamientos. Las dos metodologías fueron validadas en 237 aislamientos clínicos de S. aureus resistente a la meticilina. Resultados. Con la primera metodología se identificaron el 100 % y 93,2 % de los aislamientos de S. aureus resistente a la meticilina asociado a la comunidad y asociado al hospital, respectivamente. Con la segunda metodología se identificaron correctamente los dos tipos de aislamientos. Conclusiones. Estas dos metodologías son una buena alternativa en términos de ahorro en tiempo y dinero comparadas con otras técnicas, como la electroforesis en campo pulsado y la tipificación de secuencias multilocus para la rápida identificación de aislamientos de S. aureus resistente a la meticilina asociado a la

  7. Análisis clínico-epidemiológico de la portación intestinal de enterococos resistentes a vancomicina en una unidad de terapia intensiva Clinical and epidemiologic analysis of intestinal tract colonization with vancomycin-resistant enterococci in an intensive care unit

    Directory of Open Access Journals (Sweden)

    A.M. Togneri

    2005-03-01

    Full Text Available En un período de cinco meses y 25 días se investigó la portación intestinal de enterococos resistentes a vancomicina (EVR. Se estudiaron 124 pacientes (73% de 171 admitidos en la unidad de terapia intensiva (UTI, 35 de los cuales (28% resultaron ser portadores. Los aislamientos de EVR (n=35 fueron identificados como Enterococcus faecium (n=18, Enterococcus gallinarum (n=16 y Enterococcus raffinosus (n=1. Todos los aislamientos estudiados fueron resistentes a vancomicina (VAN (CIM90= 512 µg/ml y teicoplanina (CIM90= 32 µg/ml y portaban el gen vanA. Los estudios de tipificación molecular mostraron un alto grado de homología entre los aislamientos de E. faecium (un clon dominante y E. gallinarum (dos tipos clonales, sugiriendo su diseminación a modo de brote. No se encontraron diferencias significativas con la edad y el sexo de los pacientes no portadores (p>0,05, pero si con el tiempo de hospitalización y el uso de esquemas antibióticos de amplio espectro (pIntestinal tract colonization with vancomycin resistant enterococci (VRE was studied during five months and 25 days. Out of 171 patients hospitalized in the intensive care unit, 124 (73% were included in this study. Thirty five of them (28% were recognized as colonized with VRE. VRE isolates (n = 35 were identified as Enterococcus faecium (n=18, Enterococcus gallinarum (n=16, and Enterococcus raffinosus (n=1. All of them were resistant to vancomycin (MIC90= 512 µg/ml and to teicoplanin (MIC90= 32 µg/ml, having the vanA gene. By means of molecular methods a high homology was found among E. faecium and E. gallinarum isolates, respectively, suggesting their spread as a kind of outbreak. No significant differences in age or sex were found among colonized and non-colonized patients (p>0.05. On the other hand, the hospitalization time and the use of broad-spectrum antibiotics were associated with colonization. From this study we highlight the importance of enhancing all measures of

  8. Potencial productivo de esquejes de boniato (Ipomoea batatas (L. Lam. procedentes de una nueva tecnología de producción de semilla agámica.

    Directory of Open Access Journals (Sweden)

    Roberto Díaz Hernández

    2012-01-01

    Full Text Available RESUMEN El trabajo se realizó en el Instituto de Investigaciones en Viandas Tropicales durante el periodo de septiembre del 2008 a abril 2009, con los objetivos de determinar la cantidad de esquejes que proporciona el vivero y la frecuencia de corte, así como comparar el potencial productivo de cada corte. El Experimento consistió en el montaje de cámaras de aproximadamente 1m de ancho y 15m de largo, se utilizaron raíces tuberosas del clon comercial INIVIT B2-2005 como material de plantación. Se comprobó que durante la fase del vivero este proporcionó un total de nueve cortes tanto en la época frío como en primavera con un total de 764 y 1390 esquejes respectivamente. Después de cortados los esquejes fueron llevados al campo donde se realizó un estudio para determinar los rendimientos correspondientes a cada tratamiento (número de cortes. Se utilizó un diseño de bloques al azar con cuatros réplicas. Los resultados mostraron que en pequeñas áreas de viveros se puede obtener un número significativo de esquejes y de muy buena calidad productiva además de que los esquejes procedentes de diferentes momentos de cortes presentan igual comportamiento en cuanto al rendimiento. Productive potential of sweetpotato (Ipomoea batatas (L. Lam cuttings from a new technology for agamic seed production. ABSTRACT The work was conducted at the Research Institute of Tropical Root and Tuber Crops from September 2008 to April 2009 with the objectives of determining the amount of cuts provided by the nursery and cut frequency, as well as, to compare the productive potential of each cut. The experiment consisted of mounting chambers about 1m wide and 15m long. Tuberous roots from the commercial clone INIVIT B2-2005 were used as planting seeds. During the nursery stage, nine cuts were provided in the winter and rainy seasons with a total of 764 and 1390 cuttings respectively. Cuttings were transferred to field conditions to determine corresponding

  9. Estrategias bioinformáticas y moleculares para aislar genes con potencial biotecnológico a partir de especies huérfanas de la ciencia

    Directory of Open Access Journals (Sweden)

    Juan Castro Gómez

    2013-12-01

    Full Text Available La amazonía peruana es megabiodiversa y posee millones de genes con potencial biotecnológico que debemos descubrir. Para identificarlos, aislarlos y poder aprovecharlos tenemos que secuenciar los genomas y transcriptomas de las especies más importantes. Sin embargo, hasta concretar este tipo de proyectos, combinando estrategias bioinformáticas y moleculares podemos aislar genes con potencial biotecnológico. El objetivo fue aislar genes involucrados en la biosíntesis de vitamina C en Myrciaria dubia. De acuerdo a las relaciones filogenéticas de M. dubia con otras especies, se buscaron secuencias homólogas en el banco de genes del gen que codifica L-galactono-1,4-lactona deshidrogenasa (L-GalLDH. En base al alineamiento múltiple obtenido, se construyó un filograma consenso y de los clados formados se diseñaron cebadores degenerados. Los frutos fueron obtenidos de una colección de germoplasma y el ARN total se purificó, el ADNc se sintetizó y amplificó con cebadores degenerados. El amplicón sintetizado se clonó y secuenció con técnicas estándares. Con las aproximaciones empleadas se logró aislar, clonar y secuenciar un segmento de 921 pb del gen L-GalLDH de M. dubia. En conclusión, con las estrategias bioinformáticas y moleculares descritas se aisló el segmento de un gen que codifica la enzima L-galactono-1,4-lactona deshidrogenasa de la vía biosintética de vitamina C en M. dubia, especie de la que no se disponía de secuencias génicas. Con estas mismas aproximaciones será posible aislar genes de interés biotecnológico de esta y otras especies amazónicas que aún no cuentan con bases de datos de secuencias nucleotídicas.

  10. [The influence of EphA2 overexpression on proliferation and apoptosis of human lens epithelial cells exposed to high-concentration dexamethasone in vitro].

    Science.gov (United States)

    Ma, C X; Zheng, G Y

    2018-02-11

    Objective: To construct lentiviral-mediated EphA2 overexpression vectors, transfect them into human lens epithelial cells (HLE-B3) in vitro , and investigate the effect of EphA2 gene overexpression on the proliferation and apoptosis of HLE-B3 exposed to high-concentration dexamethasone. Methods: Experimental Study. The pCDH-CMV- MCS-EF1-RFP plasmid was set up by the digestion of NOTⅠand XbaⅠ double restriction enzyme and ligation of CE ligase, and then the plasmid was transformed into DH10B cells. Seven clons were picked for enzymatic digestion and the clons with correct results were chosen for sequencing. The 293 T/17 cells were co-transfected with the pCDH-CMV-MCS-EF1-RFP-EphA2 and the packaging mixture by Lipofectamine 2000. At different multiplicities of infection (MOI=20, 50, 100, and 200) after 72-hour infection, we observed the expression of RFP and morphological changes of HLE-B3 by an inverted fluorescence microscope, and calculated the transfection efficiency through the flow cytometry. EphA2 protein expression was detected by Western blot. The following experiments were divided into four groups: normal control group (group A), EphA2 overexpression vector transfection group (group B), HLE-B3 cells exposed to dexamethasone group (group C) and EphA2 overexpression vector transfection HLE-B3 cells exposed to dexamethasone group (group D). Statistical analysis method was single factor or two factors variance analysis. Cell survival rate was detected by the Cell Counting Kit-8 assay. Cell apoptosis index was detected by Tunel. Results: Restriction enzyme digestion and sequencing indicated that EphA2 cDNA fragment was successfully inserted in the vector. The infection efficiency was up to 38.6%±3.9%, 49.2%±4.2%, 79.5%±5.5% and 80.2%±6.0% when the MOI was 20, 50, 100 and 200, respectively. There was statistically significant difference ( F= 2 600.8, P= 0.001) among the four groups and between any two groups except between the MOI=100 group and MOI=200

  11. West Nile virus activity in Latin America and the Caribbean La actividad del virus del Nilo occidental en América Latina y el Caribe

    Directory of Open Access Journals (Sweden)

    Nicholas Komar

    2006-02-01

    cuales se obtuvieron muestras a principios de 2002. En 2002 se encontraron pruebas serológicas de infección por el VNO en caballos, pollos y aves de corral no estabuladas oriundas de Guadalupe, la República Dominicana y la parte oriental de México. En 2003, el VNO se diseminó dentro de México y por la parte norte de Centroamérica y se encontraron pruebas serológicas en las Bahamas, Puerto Rico y Cuba. En 2004, las primeras pruebas serológicas de actividad vírica en ecosistemas sudamericanos se detectaron en septiembre y octubre en Colombia y Trinidad, donde se observaron anticuerpos neutralizantes contra el VNO en animales domésticos. CONCLUSIONES: Estos informes esporádicos de enfermedad equina, humana y aviar en América Latina y el Caribe son desconcertantes. Es necesario aislar las cepas para determinar si la atenuación del virus u otro factor explica la carga de enfermedad reducida en ecosistemas tropicales.

  12. Sexual and age differences in ecological variables of the lizard Microlophus atacamensis (Tropiduridae from northern Chile Diferencias sexuales y etárias en variables ecológicas del lagarto Microlophus atacamensis (Tropiduridae del norte de Chile

    Directory of Open Access Journals (Sweden)

    MARCELA VIDAL

    2002-06-01

    Full Text Available Microlophus is a lizard genus of South-America which has many species with sexual size dimorphism. An ecological study was performed on M. atacamensis, a species inhabiting the intertidal zone of the coast of northern Chile. The following questions were addressed: (1 does M. atacamensis exhibit sexual dimorphism? (2 do individuals of different age and sex segregate spatially? (3 do individuals of different age and sex use different type of microhabitat? and (4 do individuals of different sexes exhibit differences in thermoregulatory characteristics? The study was conducted in different localities from northern Chile, which include two types of rocky systems used by this species, a high and a low type. At the moment of lizard capture, type of microhabitat, height of perch, body, air and substrate temperatures, were recorded. Individuals were then measured and weighted, and separated by age class and sex. Results indicate that this species exhibits sexual dimorphism, males being larger. There were no intersexual differences in microhabitat used and height of perch in the high type system, although adults and subadults were spatially segregated from juveniles. In the low type system adult females shared microhabitat with juveniles, a probable consequence of behaviors related to the burying of eggs. There were no differences between sexes in thermal characteristics, and body temperature of lizards showed independence from external thermal conditionsMicrolophus es un género de lagartos Sudamericanos, el cual tiene varias especies que presentan dimorfismo sexual del tamaño. Se realizó un estudio ecológico en Microlophus atacamensis, especie del intermareal de la costa del norte de Chile, para responder a las siguientes preguntas: (1 ¿presenta M. atacamensis dimorfismo sexual? (2 ¿existe segregación espacial entre individuos de diferentes edades y sexos? (3 ¿existe utilización diferencial de los tipos de hábitats, entre individuos de

  13. A dichotomous species of Codium (Bryopsidales, Chlorophyta is colonizing northern Chile Una especie dicotómica de Codium (Bryopsidales, Chlorophyta está colonizando el norte de Chile

    Directory of Open Access Journals (Sweden)

    ALEJANDRA GONZÁLEZ

    2004-06-01

    Chile, estudiamos la identidad taxonómica de la especie, examinando su relación con las especies de Codium de hábito erecto descritas para la costa temperada del Pacífico Sudamericano. El análisis morfológico sugiere que el alga encontrada en la Bahía de Caldera corresponde a la especie Codium fragile (Suringar Hariot. Tanto los caracteres morfológicos internos como externos del alga, son concordantes con la descripción de la especie, incluyendo utrículos de ápices redondeados apiculados terminados en un mucron puntiagudo. Esta especie posee una amplia distribución geográfica en aguas temperadas. En Chile, es conocida sólo para las costas entre Valdivia y Magallanes (39° 48’ S, 73° 26’ O a 53° 10’ S, 73° 49’ O. Este es el primer registro de C. fragile en el norte de Chile y además, este estudio discute diversas hipótesis alternativas de introducción de la especie en el área. Las características morfológicas de los materiales colectados en Caldera concuerdan parcialmente con los caracteres diagnósticos conocidos para C. fragile subespecies tasmanicum y C. fragile subespecies tomentosoides. Sin embargo, la expansión poblacional rápida que la especie está mostrando en Chile norte junto con análisis moleculares recientes apoyan la identificación de estas poblaciones como pertenecientes a la subespecie tomentosoides

  14. Impunity in Post-authoritarian Brazil: The Supreme Court’s Recent Verdict on the Amnesty Law

    Directory of Open Access Journals (Sweden)

    Nina Schneider

    2011-04-01

    Full Text Available While numerous countries in post-authoritarian South America have annulled Amnesty Laws issued under authoritarian rule and punished officials involved in repressive organs, Brazil continues to favour impunity. This attitude has recently been confirmed by the Brazilian Supreme Court’s decision to maintain the 1979 Amnesty Law granting de-facto impunity to violators of human rights during the military regime. The article considers this verdict within its historical context, and raises two questions which have previously attracted little attention: First, why has postauthoritarian Brazil processed the experience of the military regime so differently from its neighbouring countries, and what role did the Amnesty Law play in that difference? Second, what does this disinterest in punishment mean? This article concludes that one promising theory highlighted by political scientists – the low degree of participation in civil society in Brazil – cannot fully explain why the vast majority of Brazilians are not interested in punishment, as numerous citizens mobilized during the amnesty movement. It seems to imply that the heterogeneous antiauthoritarian alliance vanished once the Amnesty Law had been achieved. Another key finding is that the disinterest in punishment cannot be interpreted as moral support for the military regime or a sanctioning of its human rights violations, as the amnesty debate in Brazil is more complex. Resumen: Impunidad en el Brasil post-autoritario: fallo de la Corte Suprema sobre la ley de amnistíaMientras numerosos países sudamericanos han derogado las leyes de amnistía, aprobadas por pasados regímenes militares, y castigado a los oficiales de los órganos represivos, Brasil continúa favoreciendo la impunidad. Esta actitud ha sido recientemente ratificada por la Corte Suprema de Brasil, que ha mantenido la ley de amnistía de 1979, garantizando impunidad a los violadores de los derechos humanos durante el r

  15. La inmigración sudamericana en Italia: Efectos sobre el mercado de trabajo Southamerican Migration in Italy: Labour Market Effects

    Directory of Open Access Journals (Sweden)

    María Andrea Grasso

    2010-05-01

    Full Text Available Las migraciones sudamericanas no son las más numerosas ni las más preocupantes para el gobierno italiano y, quizás por ese motivo, no son las más estudiadas. Sin embargo, desde la década de 1970, las economías sudamericanas, en su mayoría, pasaron de ser receptoras de inmigrantes a expulsoras de su propia fuerza de trabajo, siendo Italia uno de los principales destinos elegidos. En qué trabajan los inmigrantes sudamericanos, cómo y en qué contribuyen a la economía italiana es uno de los interrogantes que busca elucidar este trabajo. El disparador para desarrollarlo fue un afiche de la campaña de gobierno del 2008 de la Liga Nord. En la gráfica se veía un indio Sioux y el texto rezaba: "ellos sufrieron la inmigración primero", haciendo alusión a los efectos negativos de la inmigración. Fue mi interés analizar estos efectos en lo económico y en lo social, restringiéndolo a la población de nuestro subcontinente. El artículo se basa en una experiencia personal de un año de residencia en el país como investigadora, trabajadora flexibilizada, italiana de segunda generación y partícipe de una red de contactos informales que movilizaron este análisis. Se identifica la coexistencia de una división del mercado laboral mediante una complementariedad de trabajos utilizando diferentes formas de acceso, trayectorias, y características en general. Para el segmento que ocupan los nativos se imponen barreras explícitas o no, que se traducen en exclusión. Éstas, se configuran en función de una tipificación que se hace del "otro", en particular los inmigrantes, como no apto, incapaz de realizar esa tarea, o poco "presentable".South American are neither the most numerous nor preoccupant migrations for the Italian government. Maybe that is the reason why they are not the most studied ones. However, since the seventy decade, South American economies- one day mainly receptives of inmigrants-, turned into emigration countries, being

  16. Botanical Composition of Alpaca (Lama pacos Linn. Diet in a Central Mediterranean Range of Chile Composición Botánica de la Dieta de Alpaca (Lama pacos Linn. en un Pastizal del Secano Mediterráneo de la Zona Central de Chile

    Directory of Open Access Journals (Sweden)

    G Castellaro

    2008-06-01

    Full Text Available The re-introduction of domestic South American camelids (alpacas and llamas in the central zone of Chile makes it necessary to study their behaviour and adaptability. Since it is fundamental to characterize the camelid’s diet, the present work had as an objective the determination of the plant species selected by the alpacas (Lama pacos Linn. in different phenological stages (vegetative, reproductive and dry season. The study was carried out over three years in a paddock of 2.5 ha of sparse shrubland dominated by Acacia caven (Mol. Mol. and annual species in the herbaceous stratum, which were continually grazed by five male alpacas. The botanical composition and the forage dry matter available for grazing in the pasture was evaluated. Botanical composition of diets was estimated with the microhistological technique, using dung samples collected directly from the rectum. During the vegetative season, the most consumed plant species were annual and perennial grasses. In the reproductive season, the most important components of the diet were woody plant species, annual grasses and forbs. In the dry season, the diet was composed of a high percentage of woody plant species.La reintroducción de camélidos sudamericanos domésticos (alpaca y llamas en la zona central de Chile, hace necesario estudiar su comportamiento y adaptabilidad. En este contexto, la caracterización de la dieta es fundamental. Por ello, el presente trabajo tuvo como objetivo determinar las especies vegetales seleccionadas por las alpacas en diferentes etapas fenológicas del pastizal (vegetativo, reproductivo y seco. El estudio se realizó durante tres temporadas en un potrero de 2,5 ha ocupado por un matorral claro dominado por Acacia caven (Mol. Mol. y especies anuales en el estrato herbáceo, las cuales fueron pastoreadas continuamente por cinco alpacas macho. En la pradera se evaluó la composición botánica y la disponibilidad de la materia seca bajo pastoreo. La

  17. Sistemática, taxonomía y domesticación de alpacas y llamas: nueva evidencia cromosómica y molecular Systematics, taxonomy and domestication of alpaca and llama: new chromosomal and molecular evidence

    Directory of Open Access Journals (Sweden)

    JUAN C MARÍN

    2007-06-01

    Full Text Available Existen cuatro especies de camélidos sudamericanos, dos de ellos silvestres, guanaco (Lama guanicoe y vicuña (Vicugna vicugna, y dos formas domésticas, alpaca (Lama pacos y llama (Lama glama, cuyo origen ha sido objeto de debate. En el presente estudio la variación en el patrón de bandas G de los cromosomas de llamas y alpacas y la secuencia de dos genes mitocondriales han sido usados para estudiar el origen y la clasificación de llamas y alpacas. Patrones de bandas cromosómicas similares fueron observados en las cuatro especies de Lamini, incluso similares a los descritos para camello, Camelus bactrianus. Sin embargo, se encontraron finas y consistentes diferencias en los brazos cortos del cromosoma 1, permitiendo separar a camellos, guanacos y llamas, de las de vicuñas y alpacas. Este patrón fue consistente incluso en un híbrido guanaco x alpaca. Relaciones equivalentes fueron encontradas en las secuencias completas del gen para citocromo b, así como en el árbol de expansión mínima de las secuencias parciales de la región control, agrupando a guanacos con llamas y a vicuñas con alpacas. Los análisis filogenéticos mostraron a V. vicugna y a L. guanicoe como grupos recíprocamente monofHéticos. El análisis de las secuencias de ambos genes mostró dos ciados entre las vicuñas, concordantes con las subespecies reconocidas para esta especie, pero los resultados obtenidos para guanacos no reflejaron la existencia de las cuatro subespecies previamente propuestas. El análisis combinado de variaciones cromosómicas y moleculares demostraron una alta similitud genética entre alpacas y vicuñas, así como entre llamas y guanacos. Aunque se revela hibridización direccional, nuestros resultados apoyan fuertemente la hipótesis de que la llama se deriva de L. guanicoe, y la alpaca de V. vicugna, apoyando la reclasificación de la alpaca como V. pacosFour camelid species exist in South America: two wild, the guanaco (Lama guanicoe and

  18. A Ricardian Analysis of the Impact of Climate Change on South American Farms Análisis Ricardiano del Impacto del Cambio Climático en Predios Agrícolas en Sudamérica

    Directory of Open Access Journals (Sweden)

    S Niggol Seo

    2008-03-01

    que predice el Modelo de Circulación General Atmosférico Oceánico (AOGCM: el escenario del Centro Canadiense del Clima (CCC, el del Centro para Investigación de Sistemas Climáticos (CCSR, y el del Modelo de Clima Paralelo (PCM. Se evaluaron varias especificaciones econométricas, y se realizaron cinco regresiones: todos los predios, predios pequeños, predios comerciales, predios de secano y predios con riego. El valor de la tierra agrícola disminuirá a medida que incrementa la temperatura y la lluvia, excepto en el caso de los predios regados. Bajo el severo escenario del CCC, los agricultores sudamericanos perderán 14% de sus ingresos el año 2020, 20% el año 2060, y 53 % el año 2100, y solo la mitad bajo el menos severo escenario de CCSR. Sin embargo, los predios perderán pequeños márgenes bajo el escenario suave y húmedo del PCM. Tanto los predios pequeños como los grandes son altamente vulnerables, pero los pequeños son más vulnerables mientras que los grandes son mas sensibles a un aumento de la precipitación. Los predios de secano y los de riego perderán más del 50% de sus ingresos el año 2100, con mayores daños los predios regados, pero la submuestra trata el riego como un factor exógeno

  19. Molecular diversity among domestic guinea-pigs (Cavia porcellus and their close phylogenetic relationship with the Andean wild species Cavia tschudii Diversidad molecular entre cuyes domésticos (Cavia porcellus y su relación filogenética cercana con la especie silvestre andina Cavia tschudii

    Directory of Open Access Journals (Sweden)

    ÁNGEL E SPOTORNO

    2004-06-01

    . tschudii (promedio de distancias K2P = 3,2 %; los mejores árboles tenían 609 pasos (CI = 0,796; Índice de Apoyo de Bremer (SI = 28, y un _Ln = 4.419,52; con apoyos de remuestreo de 100 % y 97 % respectivamente. Dicho clado también apareció en el análisis cladístico de los aminoácidos correspondientes, apoyado por tres sustituciones y 96 % remuestreo. Cuando el nodo de C. aperea fue forzado a unirse al de C. porcellus, estos árboles fueron consistentemente más largos, menos probables y robustos, y con menos caracteres definitorios que el óptimo. Todas las secuencias de C. porcellus se agruparon también en un nodo definido por 15 sustituciones. El subnodo con animales de mercados de ciudad, tiendas de mascota y laboratorios se caracterizó por cuatro sustituciones (una no silenciosa, SI = 7 y 91 % remuestreo. Los C. porcellus sudamericanos, llamados "criollos" por los criadores locales, son más diversos. Probablemente, un clado del sur del Perú y Chile representa un linaje precolombino. La distancia K2P promedio entre C. tschudii y aperea fué más bien grande, 7,7 %. Cavia apareció como un nodo robusto (100 % remuestreo. Estos resultados indican que C. tschudii es la especie más cercanamente relacionada a C. porcellus.

  20. UTILIZACIÓN DEL ANÁLISIS MULTIVARIANTE PARA LA SISTEMATIZACIÓN DEL COMPONENTE ALFARERO DEL CHACO PREHISPÁNICO (Using Multivariate Analysis to Systematize the Ceramic Assemblage from Prehispanic Chaco

    Directory of Open Access Journals (Sweden)

    Guillermo N. Lamenza

    2015-11-01

    Full Text Available Este trabajo se enmarca dentro de un proyecto interdisciplinario cuyo objetivo general es reconstruir el proceso biocultural prehispánico y el uso del espacio en el Gran Chaco sudamericano (Proyecto UNLP-CONICET Dinámica Cultural Chaqueña en el Holoceno Tardío. Esta vasta región se ubica en la porción centro-sur del continente y se caracteriza por ser la segunda región boscosa de América del Sur después de la selva amazónica. El ordenamiento general diferencia, de norte a sur, el Chaco Boreal, el Central y el Austral. El primero incluye parte de los estados de Brasil, Paraguay y Bolivia; y los restantes se encuentran dentro de territorio argentino. De manera particular el Chaco argentino ha sido sectorizado, en términos arqueológicos, en Ribereño Paraguay-Paraná, Central y Subandino. Se presentan los resultados de las últimas investigaciones orientadas a la caracterización y sistematización de los asentamientos humanos prehispánicos a partir del análisis del componente cerámico proveniente de los mismos. En esta oportunidad se realizan análisis multivariantes utilizando técnicas de taxonomía numérica. Como resultado se obtiene un ordenamiento que vincula los sitios arqueológicos entre sí, permite caracterizar conjuntos, establecer frecuencias, evaluar la dispersión de rasgos y plantear correlaciones; conformando identidades útiles como indicadores diagnósticos. Se propone que este tipo de análisis provee resultados promisorios para evaluar el grado de interacción de las sociedades prehispánicas chaqueñas y permitirá avanzar hacia una caracterización regional más amplia. ENGLISH: This work is part of an interdisciplinary project whose overall objective is to reconstruct the prehispanic biocultural process and use of the space in the South American Gran Chaco (UNLP CONICET Project Dinámica Cultural Chaqueña en el Holoceno Tardío. This large region is located in the south-central part of the continent and is

  1. Características biológicas e inmunológicas del veneno de Bothrops cotiara (Serpentes: Viperidae

    Directory of Open Access Journals (Sweden)

    Adolfo Rafael de Roodt

    2006-09-01

    Full Text Available Bothrops cotiara es una serpiente que se encuentra en la provincia de Misiones (Argentina, el Sur de Brasil y Paraguay. La información sobre las características clínicas de los accidentes por esta serpiente es muy escasa y existen pocos datos sobre su veneno y la capacidad neutralizante de las actividades tóxicas del mismo por antivenenos terapéuticos. En este trabajo se estudiaron características bioquímicas, actividades tóxicas y la reactividad inmunoquímica del veneno de B. cotiara. Seis antivenenos anti Viperinos Sudamericanos fueron estudiados frente a este veneno por el método ELISA y se probó la capacidad neutralizante de tres de estos frente a las actividades hemorrágica, necrotizante, procoagulante, trombina-símil, hemolítica indirecta y la potencia letal de veneno de ejemplares de B. cotiara de la provincia de Misiones. Los patrones cromatográficos y electroforéticos mostraron características similares a los de otros venenos de Bothrops. Las actividades tóxicas estuvieron dentro de los ámbitos descritos para los venenos botrópicos. Los seis antivenenos mostraron gran reactividad inmunoquímica por ELISA y las potencias neutralizantes de los tres estudiados fueron muy próximas para las actividades letal, hemorrágica, necrotizante, hemolítica indirecta, coagulante y trombina-símil. Los resultados de los estudios de neutralización indicarían que ante la mordedura de esta poco común especie de Bothrops, pueden usarse los diferentes tipos de antivenenos botrópicos o botrópico-crotálicos para uso terapéutico disponibles en esa región.Biological and immunological characteristics of the poison of Bothrops cotiara (Serpentes: Viperidae. Bothrops cotiara is a venomous snake sporadically found in the province of Misiones in Argentina, South of Brazil and Paraguay. Data on the clinics of the envenomation produced by its bite and on its venom are scarce. There is no information on the neutralizing capacity of the

  2. Prescrição do dia: infusão de alegria. Utilizando a arte como instrumento na assistência à criança hospitalizada Prescripción del día: infusión de alegría, utilizando el arte como instrumento, en la asistencia al niño hospitalizado Prescription for the day: infusion of joy. Using art as an instrument for the care of hospitalized children

    Directory of Open Access Journals (Sweden)

    Giovana Müler Françani

    1998-12-01

    Full Text Available O objetivo deste trabalho é relatar a experiência de um grupo de alunas do Curso de Graduação em Enfermagem da Escola de Enfermagem de Ribeirão Preto da Universidade de São Paulo que utiliza a arte (aspectos do teatro Clown como recurso auxiliar da enfermagem na assistência à criança hospitalizada. Baseado no trabalho realizado pelo grupo "Doutores da Alegria" e nos conhecimentos teóricos das disciplinas de Psicologia e Enfermagem Pediátrica e Neonatal estas alunas criaram a Companhia do Riso que procura resgatar o riso da criança/família hospitalizada. A partir desta experiência pode-se observar algumas transformações no dia-a-dia: o espaço hospitalar tornou-se mais informal e descontraído, o riso pode ser ouvido com maior freqüência e objetos, sons, movimentos, cores, espaços e personagens podem se tornar brinquedos.El objetivo de este trabajo es relatar la experiencia de un grupo de alumnos de curso de pregrado de Enfermería de la Escuela de Enfermería de Ribeirão Preto de la Universidad de San Pablo, que utiliza el arte (aspectos del teatro Clon, como recurso auxiliar de Enfermería en la asistencia al niño hospitalizado. Basado en el trabajo realizado por el grupo "Doctores de la alegría" y en los conocimientos teóricos de las disciplinas de Sicología y Enfermería Pediátrica y Neonatal, estas alumnas crearon la compañía de la risa, que procura rescatar la risa de los niños y su familia en el hospital. A partir de esta experiencia se puede observar algunas transformaciones en el diario vivir: El espacio hospitalario se tornó más informal y sin ambiente pesado, la risas pueden ser oídas con mayor frecuencia, sonidos, movimientos, colores, espacios y personas pueden transformarse en juguetes.The purpose of this study is to report on the experiment of a group of undergraduate students from the University of São Paulo at Ribeirão Preto College of Nursing, who use art (some aspects of the Clown Theatre as a

  3. Efecto del nitrato de potasio, fosfato de potasio y ethephon en la inducción floral de la feijoa o goiabeira serrana (Acca sellowiana [O. Berg] Burret Effect of potassium nitrate, potassium phosphate and ethephon in floral induction of pineapple guava (Acca sellowiana [O. Berg] Burret

    Directory of Open Access Journals (Sweden)

    Oskar Javier Garcia

    2008-09-01

    Full Text Available El ensayo se llevó a cabo en la finca El Cortijo (La Vega, Cundinamarca, Colombia [04°55'N y 74°18'W], 2350 m altitud, 17°C temperatura media, 1423 mm precipitación anual, 85% humedad relativa, 1377 horas brillo solar/año. Se utilizaron árboles de feijoa o goiabeira serrana de seis años, Clon 41 ('Quimba', evaluando fertilizantes foliares KNO3 (Nitrato de Potasio 13-0-46® 1%, 1,5% y 2% y KH2PO4 (fosfato de potasio; Cosmofoliar 0-32-43®; 0,5%, 0,75% y 1,0% y la fitohormona ethephon (Ethrel® 48 SL; 100, 150 y 200 mg L-1. Se determinaron el número de botones florales inducidos, flores formadas, además, el porcentaje de flores formadas y nivel de eficacia de los productos inductores. El KH2PO4 al 0,5% obtuvo resultados favorables en cada una de las variables evaluadas, comparado con el 0,75% y 1% del mismo producto y, sin embargo hubo un alto número de flores inducidas y formadas, no se presentaron diferencias significativas con el testigo. Ethephon a 150 mg L-1 en la inducción de botones florales y a 100 mg L-1 en la de formación de flores mostró resultados favorables, pero tampoco pudo superar el testigo por falta de significancia. La respuesta generada por KNO3 mostró una baja inducción de botones florales, y una eficacia negativa en la proporción de flores formadas; asimismo fitotoxicidad, cuando se emplearon concentraciones al 2% de este producto.The experiment was carried out in El Cortijo farm (La Vega, Cundinamarca, Colombia [ 04° 55' N and 74° 18' W ], 2350 m above sea level, 17° C average temperature, 1423 mm of annual precipitation, 85% of relative humidity, and 1.377 of sunshine hours/year. In the study, evaluation of foliar fertilizers KNO3 (potassium nitrate 13-0-46® 1%, 1.5%, and 2%, KH2PO4 (potassium phosphate; Cosmofoliar 0-32-43®; 0.5%, 0.75%, and 1.0%, and ethephon phytohormone (Ethrel® 48 SL; 100, 150, and 200 mg L-1 was done on six year old pineapple guava trees of Clone 41 ('Quimba'. The number of

  4. Alternativas de manejo en el control de la Sigatoka negra (Mycosphaerella fijiensis Morelet./

    Directory of Open Access Journals (Sweden)

    Yurisandra Sierra Reyes

    2015-09-01

    Full Text Available Resumen Con el objetivo de evaluar alternativas en el control de la Sigatoka negra n se desarrolló esta investigación en la Unidad Empresarial de Base “Atención a Productores” en Siboney, municipio Sibanicú, provincia Camagüey. En el período comprendido entre junio del 2008 a octubre del 2009 a través de un experimento con diseño bloques al azar con el fin de establecer el efecto de varias prácticas de manejo en el control de la Sigatoka negra en el plátano Enano Guantanamero. Se estudiaron combinaciones de prácticas de manejo como el uso de fertilizaciones de fórmula completa y orgánica, el marco de plantación utilizado fue de 1 m ×2 m × 3m, la compra de las semillas se realizó en la Biofábrica de Camagüey, que fueron desinfectadas al momento de la plantación durante una hora con una solución de Mancozeb SC (5 g /1 de agua y se adicionó lixiviado de humus de lombriz (ácido fúlvico (5ml/l de agua. Se realizaron labores agrotécnicas de despunte, aplicación de fertilización óptima y de un químico protectante, en combinación hasta llegar a doce tratamientos. Se evaluaron las hojas más jóvenes enfermas, hojas más joven manchada y el índice de severidad. Las combinación de Fertilización + Despunte + Fungicida + lixiviado de humus de lombriz, mostró las mejores respuestas al reducir el Índice de Severidad de las dos enfermedades, con valores medios que oscilaron entre 39,5 y 43,3, así como una alta respuesta a los indicadores morfológicos y productivos del clon AAB Enano Guantanamero. ABSTRACT In order to evaluate alternatives in the control of black Sigatoka n this research was conducted at the Base Business Unit "Attention to Producers" in Siboney, Sibanicú municipality, Camagüey province. In the period from June 2008 to October 2009 by an experiment with randomized block design in order to establish the effect of various management practices on the control of Black Sigatoka in banana Dwarf Guantanamero

  5. Martin Chalfie y la proteína verde fluorescente Martin Chalfie y la proteína verde fluorescente

    Directory of Open Access Journals (Sweden)

    Zacarías Pereira Vega

    2012-12-01

    Full Text Available The history of the green fluorescent protein (GFP starts with Osamu Shimomura at the beginning of the 1960s, with his discovery from the extracts of the Aequorea victoria jellyfish. However, it is not until the beginning of the 1990s, that the neurobiologist Martin Chalfie, applying genetic engineering tech- niques, achieved for the first time the heterology expression of the GFP in prokaryotes (E. coli and eukaryotes (Caernohabditis elegans, from a clone of the jellyfish’s gen that codifies the GFP prepared by Douglas Prasher. Besides fluorescing in green, the results from this work also demonstrated that it does not require any other cofactor or enzyme of the jellyfish for its expression or for the own forming of a fluorophore. At the same time, Chalfie proposed that the GFP could be used for the marking of cells on living ani- mals or the tag of proteins. Based upon these results, many scientists started working on research related to the GFP; actually this protein is used on different fields such as biotechnol- ogy, development biology, environmental chemistry and medicine. In the case of the latter, it has helped to elucidate the cellular mechanisms from which diseases are made of. Science owes Roger Tsien, amongst other contributions, the creation of differ- ent mutations of the GFP.La historia de la proteína verde fluorescente (GFP se inicia con Osamu Shimomura a principios de la década de 1960, con su descubrimiento de esta proteína a partir de extractos de la medusa Aequorea victoria. Sin embargo, es a principios de la década de 1990 que el neurobiólogo Martin Chalfie, aplicando técnicas de ingeniería genética, logra por primera vez la expresión heteróloga de la GFP en procariotas (Escherichia coli y eucariotas (Caernohabditis elegans, a partir de un clon del gen de la medusa que codifica a la GFP, preparado por Douglas Prasher. Además de fluorescer en verde, los resultados de este trabajo también demostraron que no se

  6. The use of an internal teat sealant in combination with cloxacillin dry cow therapy for the prevention of clinical and subclinical mastitis in seasonal calving dairy cows.

    Science.gov (United States)

    Runciman, D J; Malmo, J; Deighton, M

    2010-10-01

    Cows (n=2,053) from 6 seasonally calving dairy herds were enrolled in a trial to compare the efficacy of 2 dry cow treatments. Cows received either a combination dry cow therapy of 600 mg of cloxacillin (CL) followed by an internal teat sealant (ITS) containing 2.6 g of bismuth subnitrate in all 4 quarters immediately following their final milking for the season, or only an intramammary infusion of 600 mg of CL. All cases of clinical mastitis were recorded and cultured during the first 150 d of lactation in each herd, and cow somatic cell count (SCC) was measured between 7 and 50 d postcalving. A large difference was found between treatment groups in the rate at which cows were diagnosed with clinical mastitis over the first 21 d of lactation, after which time the rate at which cows were diagnosed with clinical mastitis was similar between treatment groups. Analysis of the relative proportions of cows with clinical mastitis was performed at both the gland and cow levels. The relative risk (RR) of clinical mastitis diagnosed within 21, 30, and 100 d of calving in a gland treated with the ITS-CL combination was, respectively, 0.30 [95% confidence interval (CI)=0.21-0.44], 0.39 (0.28-0.53), and 0.58 (0.46-0.75) that of the CL group. An interaction between treatment and previous SCC was found when clinical mastitis was analyzed at the cow level. In a subset of cows that had low SCC in their previous lactation, the RR of mastitis in cows with the ITS-CL combination within 21, 30, and 100 d of calving was, respectively, 0.54 (95% CI=0.33-0.87), 0.57 (0.37-0.88), and 0.69 (0.50-0.99) that of cows that received only CL at drying off. In the subset of cows that had at least 1 high SCC in the previous lactation, the RR of mastitis in the ITS-CL combination group within 21, 30, and 100 d of calving was, respectively, 0.26 (95% CI=0.16-0.44), 0.37 (0.24-0.57), and 0.72 (0.55-0.96) that of the CL-only group. The ITS-CL combination of dry cow treatments was associated with a

  7. DESARROLLO DE UN POXVIRUS RECOMBINANTE QUE EXPRESA LA GLICOPROTEÍNA D DEL HERPESVIRUS BOVINO-1

    Directory of Open Access Journals (Sweden)

    JULIÁN RUIZ SÁENZ

    2012-09-01

    Full Text Available El herpesvirus bovino-1 es un virus de genoma DNA perteneciente a la familia Herpesviridae, subfamilia Alfaherpesvinae, el cual afecta al bovino, en el que provoca un amplio espectro de manifestaciones clínicas, acarreando graves pérdidas económicas. El principal componente inmunogénico de su envoltura es la glicoproteína D (gD, la cual ha sido caracterizada y utilizada como inmunógeno en distintos sistemas de expresión. Diferentes estudios han demostrado la eficacia de los vectores poxvirales como un sistema eficiente para inmunizar animales contra diferentes antígenos. El objetivo de este trabajo fue generar un poxvirusrecombinante (Raccoonpox [RCN] que expresara una versión truncada de la gD del BHV-1 para ser usado como inmunógeno. Para ello, con ayuda de cebadores específicos se amplificó el gen que codifica para a versión truncada de la gD la cual no posee el dominio de anclaje de membrana (1,089 pares de bases, el cual posteriormente se clonó usando las enzimas EcoRI y BamHI en el plásmido de transferencia pTK/IRES/tpa que posee sitios de homología a la timidinakinasa del poxvirus, un sitio interno de entrada al ribosoma (IRES y una señal secretoria (tPA, generando el constructo pTK/gD/IRES/tpa. Para generar el RCN recombinante, se tomaron células de riñón de mono verde africano BSC-1, se infectaron con una cepa Silvestre del RCN (CDC/V71-I-85A a un Índice de Multiplicidad de Infección (MOI de 0,05, y se incubaron a 37ºC por 90 minutos; luego, las células fueron transfectadas con el constructo pTK/gD/IRES/tpa usando el sistema de transfección FuGENE 6®; generándose a través del sistema celular de recombinación de homólogos diferentes poblaciones virales con y sin el gen de interés. Para seleccionar los virus recombinantes que expresaban el gen de interés, se realizó una selección de recombinantes negativos para timidina kinasa y positivos para la gD por tres rondas de purificación de placas en monocapas

  8. Clonamiento, expresión y seroreactividad del antígeno recombinante flagelina de Bartonella bacilliformis

    Directory of Open Access Journals (Sweden)

    Karen Gallegos V

    2005-03-01

    Full Text Available Objetivos. Clonar el gen de la flagelina A (flaA de Bartonella bacilliformis, expresar y evaluar preliminarmente la seroreactividad de la proteína recombinante a sueros de pacientes con Bartonelosis por B. bacilliformis. Materiales y Métodos. Se diseñó una pareja de oligonucleótidos iniciadores -BbFlaA1 y BbFlaA2- para la amplificación del gen completo de la flagelina flaA de B. bacilliformis. El producto de amplificación obtenido se clonó en pGEM y luego se subclonó en el vector de expresión pGEX4T-1. Se indujo la expresión de la proteína de fusión rBbFlaA-GST con isopropil tio-β -D-galactosido (IPTG. La proteνna de fusiσn producida fue digerida con trombina para liberarla de GST. Finalmente, una prueba de ELISA fue estandarizada para detectar los anticuerpos IgG contra la proteína de fusión rBbFlaA-GST y rBbflaA libre de GST. Se evaluaron sueros de pacientes con diagnóstico de Bartonelosis por B. Bacilliformis (n= 30, sueros de individuos sanos (n= 20 y sueros de pacientes con otras enfermedades de posible reactividad cruzada; entre ellas, Brucelosis (n= 3, leptospirosis (n= 3 y salmonelosis (n=7. Resultados. Se determinó que para la expresión óptima en E. coli BL21 de la proteína de fusión rBbFlaA se requiere que el cultivo crezca en caldo LB/ampicilina a 30 °C suplementado con 2% de glucosa a partir de un preinóculo de 100 µL (crecido por toda la noche, hasta que alcance una densidad óptica de 1 OD600 y se induzca por dos horas con 2,5 mM de IPTG. Finalmente, el 57,6 % (17 de 30 sueros de pacientes con diagnóstico confirmado de bartonelosis reaccionaron con la proteína recombinante BbFlaA en el formato de ELISA. Conclusiones. Se logró expresar exitosamente en E. coli la proteína recombinante BbFlaA de B. bacilliformis, determinándose un protocolo de expresión y de purificación de rBbFlaA para la producción de esta proteína. Así también, el antígeno rBbFlaA es reconocido por anticuerpos de sueros de

  9. Descripción morfoagronómica de materiales de plátano (Musa AAB, ABB y banano (Musa AAA cultivados en San Andrés Isla Morpho-agronomic Description of Plantain (Musa AAB, ABB and Banana (Musa AAA Materials Grown in San Andres Island

    Directory of Open Access Journals (Sweden)

    Oscar Javier Parra Pachón

    2009-10-01

    Full Text Available Durante el primer semestre de 2005 se estudiaron los cultivares de plátano y banano en fincas y parcelas de 15 agricultores típicos participantes en programas conjuntos de la Secretaría de Agricultura y Pesca de San Andrés Isla y de la Universidad Nacional de Colombia sede Caribe. A partir de descriptores de INIBAP, IPGRI y CIRAD y revisiones bibliográficas.se describen morfológicamente los materiales de Musa cultivados en la Isla, así como las prácticas de los productores isleños, Se identificaron cuatro clones del subgrupo plátano (Musa AAB: un Hartón (‘Horse’ y tres Dominico-Hartón (‘Tallo Negro’, ‘Tallo Blanco’ y ‘Cincuenta’ del subgrupo ABB se hallaron un material de Bluggoe (‘Boscó’ y un Felipita. El subgrupo banano AAA presentó dos materiales Gros Michel (denominados Común y Chino y uno de banano (Rojo. El plátano tiene gran importancia para los agricultores de la Isla, siendo el Boscó el clon más aceptado entre consumidores por su adaptación a las condiciones edafológicas y climáticas. El banano es menos cultivado; ya que los suelos, el clima y las enfermedades como sigatoka negra, condicionaron el desarrollo de clones. El trabajo sugiere prácticas de fácil implementación que podrían aumentar la producción en los sistemas de huerto mixto tropical que predominan en la Isla.During the first semester, 2005 we studied the plantain and banana cultivars in small farms of 15 volunteer regular producers, who were participating in joint programs of the Agriculture and Fisheries Secretariat of San Andres Island and the Colombian National University Caribbean Headquarters. We described morphologically the Musa cultivars identified in the island, as well as agricultural practices of the island producers, using the INIBAP, IPGRI and CIRAD (1996 descriptors and bibliographical reviews. We identified four clones within the plantain sub-group Musa AAB: a Horn type and three French-Horn; and within the ABB

  10. Variabilidad genética y morfológica y estructuración poblacional en Alstroemeria hookeri subsp. hookeri (Alstroemeriaceae, endémica de Chile Genetic and morphological variation and population structure in Alstroemeria hookeri subsp. hookeri (Alstroemeriaceae, endemic to Chile

    Directory of Open Access Journals (Sweden)

    EDUARDO RUIZ

    2010-12-01

    Full Text Available El género Alstroemeria es exclusivamente sudamericano y consta de 82 taxa distribuyéndose, principalmente en Chile y Brasil. La gran importancia económica que han adquirido las Alstroemerias chilenas como plantas ornamentales ha despertado gran interés en la variabilidad morfológica de las flores y variabilidad genética en especies con potencial valor económico. Una de ellas es Alstroemeria hookeri que posee cuatro subespecies, de las cuales, la subespecie tipo, es endémica de las regiones del Maule y Biobio. Su distribución geográfica consiste de dos rangos, separados por la Cordillera de la Costa. Así, existen poblaciones costeras, creciendo, entre los 5-20 m de altura en las provincias de Arauco, Concepción, Nuble y Cauquenes y poblaciones del interior creciendo entre los 100-150 m de altura, en las provincias de Biobio y Nuble. Evidencias preliminares señalan diferencias fenotípicas entre poblaciones costeras y del interior, relacionadas con el color y forma de los tépalos. Por esta razón, se realizó un estudio morfológico comparativo en el rango completo de distribución de esta subespecie y estudiar su genética poblacional, especialmente los niveles de estructuración poblacional. Se analizaron 33 caracteres florales, mediante métodos de ordenación. El estudio morfológico indica una tendencia a separar las poblaciones en dos grupos, coincidiendo con los extremos de la variación morfológica y con ambos rangos de distribución, existiendo caracteres que aportan a ello. Los índices de variabilidad genética fueron determinados usando 17 loci aloenzimáticos. Además, se estimaron los valores de estructuración poblacional y se realizó un análisis de AMOVA. Se estimaron valores de distancia genética de Nei, entre todos los pares de poblaciones para construir un dendrograma que refleje las relaciones de similitud genética. Los resultados indican altos valores de estructuración entre poblaciones y baja variabilidad

  11. Biología poblacional de huirales submareales de Macrocystis integrifolia y Lessonia trabeculata (Laminariales, Phaeophyceae en un ecosistema de surgencia del norte de Chile: variabilidad interanual y El Niño 1997-1998 Population biology of the subtidal kelps Macrocystis integrifolia and Lessonia trabeculata (Laminariales, Phaeophyceae in an upwelling ecosystem of northern Chile: interannual variability and El Niño 1997-1998

    Directory of Open Access Journals (Sweden)

    J.M. ALONSO VEGA

    2005-03-01

    ábitat submareales favoreciendo la productividad del ensamble de huiros. Sin embargo, un repentino cambio en los patrones espacio-temporales de Tetrapygus niger (erizo negro, el pastoreador bentónico más conspicuo del norte de Chile, produjo la extinción local de M. integrifolia y la compresión del rango de distribución batimétrica de L. trabeculata. Efectos cascada abajo (mortalidad de carnívoros bentónicos durante El Niño 1997-1998 y cascada arriba (intensidad y frecuencia de surgencia en este ecosistema submareal costero parecen regular la interacción huiros-herbívoros en el área de estudio. La principal fuente productora de propágulos para el reestablecimiento del ensamble proviene de esporofitos fértiles que configuran parches aislados de baja densidad de M. integrifolia ubicados dentro de la pradera de L. trabeculata, aunque huiros flotando a la deriva y "bancos de semilla" de estados latentes microscópicos podrían actuar como estrategias complementarias. En el Pacífico Sudamericano temperado, eventos oceanográficos que actúan a distintas escalas espacio-temporales y procesos biológicos estocásticos de baja frecuencia (cambios en la abundancia de pastoreadores que actúan a escala local, generan variabilidad interanual en la dinámica de las poblaciones de huiros a largo plazo. Además, el efecto interactivo entre centros de surgencia permanente y la periodicidad temporal oscilatoria de eventos oceanográficos que generan anomalías térmicas positivas (El Niño y negativas (La Niña modifican el arreglo espacial de las poblaciones submareales de huiros en el gradiente latitudinal

  12. Food habits of two syntopic canids, the maned wolf (Chrysocyon brachyurus and the crab-eating fox (Cerdocyon thous, in southeastern Brazil Hábitos alimentarios de dos cánidos sintópicos, el aguara guazú (Chrysocyon brachyurus y el zorro del monte (Cerdocyon thous, en el sudeste de Brasil

    Directory of Open Access Journals (Sweden)

    ADRIANA DE ARRUDA BUENO

    2004-03-01

    Full Text Available The maned wolf (Chrysocyon brachyurus and the crab-eating fox (Cerdocyon thous are two South American canids with large overlap in their geographic distribution. However, there are few data on the comparative ecology of these species. The aim of this research was to quantify the diet of these two canids living in syntopy at three levels: frequency of occurrence, minimum number of individuals preyed and estimated biomass ingested. Additionally, seasonality in the consumption of major groups of food items and aspects of prey size distribution were assessed. The study took place in the Experimental Station of Itapetininga, São Paulo State, Brazil. General results showed that both canids are omnivorous in accordance with other studies. By occurrences, the wolves consumed vegetal and animal food in similar proportions, whereas the foxes consumed more animals, mainly insects. In contrast, both canids ingested mainly animal food if biomass is considered. The maned wolf consumed more wolf's fruit (Solanum lycocarpum and small mammals in the dry season, and miscellaneous fruits during the wet season. The crab-eating fox also ingested more miscellaneous fruits in the wet season, but the insects were mostly consumed during dry months. The crab-eating fox is more generalist than the maned wolf, but the wolf seems better able to handle distinct prey types. The distribution of prey sizes suggested separate food niches: while the maned wolf consumed a larger spectrum of prey sizes, especially small vertebrates between 10.1 and 100.0 g, the crab-eating fox consumed smaller prey, mainly insects between 0.01 and 0.1 gEl aguara guazú (Chrysocyon brachyurus y el zorro del monte (Cerdocyon thous son dos cánidos sudamericanos cuyas distribuciones geográficas se sobreponen extensamente. Sin embargo, hay pocos datos sobre la ecología comparativa de estas especies. El objetivo de esta investigación fue cuantificar la dieta de estos dos cánidos en sintopia en

  13. Current floristic and phytogeographic knowledge of Mexican Bromeliaceae

    Directory of Open Access Journals (Sweden)

    Adolfo Espejo Serna

    1998-09-01

    the fact that there is a lack of sufficient collections; however, we suppose that several species are surely endangered.Se presenta el estado del conocimiento florístico-fitogeográfico que se tiene actualmente sobre los representantes silvestres de la familia Bromeliaceae para México. Hasta el momento se tienen registrados a nivel nacional 22 géneros representados por 326 especies. Ursulaea género con 2 especies es endémico al país, en tanto que Hechtia tiene su centro principal de radiación en México, ya que 48 de sus 50 especies se presentan en la República Mexicana, siendo 43 de ellas, (91.5 %, endémicas. Los géneros con mayor número de especies son Tillandsia (175 spp, Hechtia (48 spp y Pitcairnia (46 spp. Se presenta un análisis comparativo de las Bromeliáceas mexicanas con las de otras regiones de América, con base en tratamientos para la familia recientemente publicados, particularmente para el área mesoamericana, Venezuela, Ecuador y las Guyanas. Los resultados de dicho análisis nos permiten concluir que la flora bromeliológica presente en cada área es distinta y que se observa un decremento en el valor del índice de Simpson en relación con la lejanía de las áreas con respecto a México. Asimismo el análisis general de las especies presentes en los diversos tipos de vegetación, muestra una clara preferencia de las mismas por los bosques de coníferas y de encinos seguidos por los bosques tropicales caducifolios. También es significativa su representación en otros tipos de vegetación como los bosques mesófilos y los bosques tropicales perennifolios. Generalmente las especies de Bromeliáceas mexicanas presentan poblaciones escasas y esparcidas y en muchos casos se las encuentra en riscos y acantilados en áreas muy restringidas. En lo relativo a la distribución geográfica de los géneros mexicanos, el 77.27 % son neotropicales, el 4.54 % son sudamericanos y el porcentaje restantes pertence a taxa mexicanos y centroamericanos. El

  14. South Pacific quasi-stationary waves and anomalously cold summers in the northernmost Antarctic Peninsula Ondas cuasi-estacionarias en el Pacífico sur y veranos fríos anómalos en el extremo norte de la Península Antártica

    Directory of Open Access Journals (Sweden)

    Alfredo J Costa

    2012-12-01

    presente trabajo tiene como objetivo analizar la circulación troposférica en el Hemisferio Sur (HS asociada a veranos (Dic-Feb anómalamente fríos (VAF en el período 1981-2010 sobre el extremo norte de la Península Antártica (PA mostrando que el verano de 2010 es singularmente frío, razón por la cual este verano es estudiado por separado. De ahí que el verano de 2010 es comparado con la composición de los VAFs previos a 2010. Se utiliza el criterio del cuartil para identificar VAFs y un flujo de actividad de onda para perturbaciones estacionarias cuasi-geostróficas (CG embebidas en un flujo básico que varía zonalmente como herramienta de diagnóstico para estudiar la propagación de trenes de ondas desde el Pacífico. Los VAFs previos a 2010 se caracterizan por un tren de ondas cuasi-estacionarias (OCE - del tipo patrón PSA (Pacífico-Sudamericano - extendido barotrópicamente en tropósfera hasta baja estratósfera, propagándose sobre el Pacífico Sur desde una región de convección anómala sobre Nueva Zelanda. Este tren de ondas da lugar a un centro ciclónico estacionario anómalo al noroeste de la PA. La componente anómala inducida de viento del Este junto a anomalías de alta nubosidad se encuentran asociadas a los VAFs sobre el norte de la PA. El singular verano de 2010 no sólo muestra un centro ciclónico estacionario anómalo al noroeste de la PA sino que también muestra uno anticiclónico en latitudes medias sobre el sudeste del Pacífico Sur. Desde ahí, hay propagación de OCE, localizada regionalmente, atravesando el sur de Sudamérica ya que no se observa una estructura de onda del tipo PSA sobre el Pacífico Sur. La propagación emana desde una zona de anomalías positivas de latemperatura de superficie del mar (TSM en el Pacífico Sur a través de la generación local de baroclinicidad del flujo medio. De ahí que esta propagación de OCE está asociada a actividad transiente anómala. A su vez, estas anomalías en la TSM podrían estar

  15. Maduración del fruto de feijoa (Acca sellowiana Berg en los clones 41 (Quimba y 8-4 a temperatura ambiente en condiciones de la Sabana de Bogotá

    Directory of Open Access Journals (Sweden)

    Rodríguez Mariela

    2006-06-01

    Hidden="false" UnhideWhenUsed="false" QFormat="true" Name="Intense Emphasis" />

    Con el propósito de seleccionar los mejores frutos de feijoa (Acca sellowiana Berg para exportación, se realizó un estudio de maduración con los frutos de los clones 41 (Quimba y 8-4, mantenidos a temperatura promedio de 16,3 oC y HR promedio de 65,1%. El clon 8-4 fue evaluado por 14 d y el clon 41 (Quimba por 18 d. Diariamente se registraron las variables intensidad

  16. Diversity of the marine picocyanobacteria Prochlorococcus and Synechococcus assessed by terminal restriction fragment length polymorphisms of 16S-23S rRNA internal transcribed spacer sequences Diversidad de las picocianobacterias marinas Prochlorococcus y Synechococcus por medio de polimorfismos de longitud de fragmentos de restricción terminal en secuencias del espaciador transcrito interno del ARNr 16S - 23S

    Directory of Open Access Journals (Sweden)

    PARIS LAVIN

    2008-12-01

    distribution of these organisms.Con el fin de evaluar la utilización de secuencias del espaciador interno transcrito (ITS en estudios de genética de población de cianobacterias marinas, se amplificó y clonó la secuencia del gen ARNr 16S junto a la region espadadora 16S-23S ARNr de seis cepas de Prochlorococcus y Synechococcus. Se analizaron los amplicones del ITS por electroforesis en gel de gradiente de desnaturalización (DGGE y por polimorfismos de longitud de fragmentos de restricción terminal (T-RFLP. Al aplicar los métodos estándares de estas técnicas, se obtuvo más de una banda o fragmento de restricción terminal (T-RF por cepa o secuencia clonada. Informes en la literatura han sugerido que estas anomalías podrían ser atribuidas a la formación de estructuras secundarias. Por consiguiente, la estructura secundaria de las secuencias de ITS de las cepas de Prochlorococcus y Synechococcus fue modelada a las diferentes temperaturas que se utilizaron durante la reacción en cadena de polimerasa (PCR. Dicho modelamiento predijo la existencia de bucles que podrían persistir incluso durante la temperatura de extensión. Es probable que estos bucles generen productos de PCR con fragmentos incompletos y hebras simples. En este trabajo se modificó el procedimiento del método de T-RFLP añadiendo el partidor marcado en los últimos dos ciclos. Esto resultó, para la mayoría de los casos, la obtención de un solo fragmento de restricción por ribotipo. La aplicación de esta técnica a una muestra del medio ambiente obtenida frente al norte de Chile, demostró que es posible identificar la presencia, y determinar la abundancia relativa, de varios linajes filogenéticos de los géneros Prochlorococcus y Synechococcus que habitan la zona eufótica. El análisis filogenético de las secuencias de ITS obtenidos por clonación y secuenciación de ADN a partir de la misma muestra confirmó la presencia de los diferentes genotipos. Con la modificación propuesta, el m

  17. COMPORTAMIENTO BIOQUIMICO Y DEL INTERCAMBIO GASEOSO DEL LULO (Solanum quitoense Lam. A PLENA EXPOSICIÓN SOLAR EN EL BOSQUE HÚMEDO MONTANO BAJO DEL ORIENTE ANTIOQUEÑO COLOMBIANO BIOCHEMICAL BEHAVIOR AND GASS EXCHANGE OF LULO (Solanum quitoense LAM. UNDER FULL SUNSHINE CONDITIONS IN THE LOW MOUNTAIN RAIN FORESTS OF EASTERN ANTIOQUIA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Clara Inés Medina Cano

    2006-06-01

    Full Text Available En el estudio se incluyeron las accesiones de lulo NM, con espinas (CE de la forma botánica septentrionale (adaptado al sotobosque y; SV80, sin espinas (SE, del taxón quitoense (con selección antrópica para adaptación a mayor exposición solar. El lulo CE presentó mayores contenidos de proteína total y actividad de Rubisco y PEPcarboxilasa, en comparación con el material SE. Las cantidades de clorofila a, b, total y a/b, al transplante (fase vegetativa, V, fueron superiores respecto a las del período productivo (P: desde los 252 días después del transplante; pero, en la etapa P se apreció mayor concentración de las clorofilas a y total en el ecotipo SE para los estratos superior y medio del dosel, aunque con igual cantidad de la a al del genotipo CE en el tercio inferior. Sin embargo, en la clorofila b la población CE superó a la SE en la fase V. Durante la etapa P, el mayor tenor se obtuvo en la capa inferior del clon CE; en tanto que en el ecotipo SE, no hubo diferencias entre los estratos. Esta respuesta fue similar en la relación clorofila a/b. En el período V, los genotipos presentaron altos valores de fotosíntesis (F, lo cual es consecuencia del comportamiento de lo anteriormente analizado. Al inicio de la etapa R, la F decayó significativamente, para ambos ecotipos sin mostrar diferencias entre estratos; pero al final, tanto en septentrionale como en quitoense, las dos capas superiores del dosel presentaron F, mientras que la franja inferior estaba en proceso respiratorio. La transpiración (T reveló una tendencia a la baja en la época V y comienzos de la R, sin diferencias entre estratos en el material CE, pero el genotipo SE expresó una mayor T en los estratos medio e inferior. En la etapa R, se pudo observar en el material CE aumento en la T, con diferencias significativas entre el estrato medio y los otros; el lulo SE mostró mayores valores de T en los estratos medio e inferior. El alto tenor de clorofila a y b

  18. Queratinocitos derivados de piel humana modificados por el vector retroviral FOCH 29-NeoR

    Directory of Open Access Journals (Sweden)

    Luz Marina Restrepo

    2000-02-01

    células (banco.

    Posteriormente, los queratinocitos en cultivo serán modificados con el vector retroviral anfotrópico FOCH 29-NeoR ya sea por cocultivo con la línea productora del virus Clon 26, o por infección con sobrenadante filtrado (0.45mm producido por la misma, en presencia de polybren.

    La eficiencia de la transducción se determinará mediante reacción en cadena de la polimerasa (PCR con el ADN de las células post transducción, con cebadores específicos del gen de resistencia a la neomicina (NeoR; se incluirán tanto controles negativos (células no transducidas como positivos (plásmidos que contienen el gen NeoR o células de la línea productora del virus. Para demostrar funcionalmente la expresión del gen vectorizado se harán ensayos de resistencia a la G418 (500-1000 mg/ml.

    Confirmar que el vector FOCH29-NeoR transluce eficientemente los queratinocitos, permitirá utilizarlo posteriormente para vectorizar genes de interés para el tratamiento de algunas enfermedades de la piel o bien factores de crecimiento tales como el factor de crecimiento epidérmico (EGF y el factor de crecimiento derivado de plaquetas (PDGF, potenciadores de los procesos de epitelialización.

    Este trabajo sentará las bases para el desarrollo paulatino de esta tecnología en nuestro medio.

  19. Estudo sobre o melhoramento da laranja "Baía" III: Conclusão

    Directory of Open Access Journals (Sweden)

    F. G. Brieger

    1941-09-01

    Full Text Available 1. The present paper represents the final report of the experiment about the constancy in a clon of the orange "Baianinha" which has been studied during the past four years. 2. The trees were obtained by grafting buds taken from one tree, 17-2, of the "Asilo" in Piracicaba, on non-selected seedling root stock of sour orange. 3. The fruits were collected separately for each tree and their diameter (in mm determined. The test "within-between" showed clearly that the variation between the means of trees and within trees are of a totally different order, the former being about 10 times bigger than the latter. 4. Thus it was necessary to use other tests in order to be able to find out whether the trees form a uniform sample or not. A X²-test was carried out for the mean diameters of the 217 trees included in the experiment in 1937 and demonstrated the existence of an accentuated heterogeneity. The same method however could not be applied in the analysis of later years in view of the reduced number of trees. It was necessary therefore to device another test for the data of these years with 44 or 43 trees each only. In carrying out this "test of seguence" the mean diameters were arranged according to their magnitude and were given accordingly numbers of order. The probability was then calculated with which a tree may obtain by chance and in successive years such numbers of order as registered (quadro V. Fuller details are given in the test of this paper and shall be published elsewhere as well. The results of this test were in accordance with those obtained with the X²-test. 5. The trees do not form a uniform sample as explained above. Two types of heterogeneity exist: a The variation between trees is of an entirely different order as the variation within trees, with of 7,2 to 16,5 (guadro III. It may be remembered that ft (Brieger is identical with Vf (Snedecor and e z (Fisher. b The variation between trees is highly heterogeneous as shown by the x2

  20. Optimización de un medio de cultivo para plantas micropropagadas de Dioscorea alata L.

    Directory of Open Access Journals (Sweden)

    Misterbino Borges García

    2011-07-01

    Full Text Available Título en ingles: Optimization of a culture medium for micropropagated plants of  Dioscorea alata L. Resumen La propagación de material de ñame de buena calidad es esencial para incrementar la producción sostenible de este cultivo. El presente trabajo tuvo como propósito optimizar el medio de cultivo de micropropagación de Dioscorea  alata L. clon Caraqueño a través de los siguientes objetivos: determinar el efecto de diferentes antioxidantes (carbón activado 0,5 g/L-1 ; carbón activado 1,0 g/L-1; cisteína 10 mg/L-1, 20 mg/L-1 y 30 mg/L-1 y concentraciones de sales de Murashige y Skoog (MS (25, 50, 75 y 100 % en el medio de cultivo durante el establecimiento y la multiplicación de las plantas in vitro, y evaluar la utilización de distintas combinaciones de ácido naftalenacético (0,01; 0,1 mg/L-1 y bencilaminopurina (0,01; 0,1 mg/L-1 en el mejor medio de cultivo de multiplicación obtenido en el experimento anterior. A los 35 días se seleccionaron 40 plantas in vitro, a las cuales se les determinaron las siguientes variables: longitud en cm del vástago; número de nudos de novo por explantes; número de hojas por explante y porcentaje de fenolización. Se evaluó además, en el experimento con los reguladores de crecimiento, el número   de raíces y longitud de la raíz de mayor tamaño. Se aplicó un diseño experimental completamente aleatorio con análisis de varianza bifactorial y clasificación simple. Se realizó la prueba de comparación de medias de Tukey para un nivel de significación del 5%. Los resultados  obtenidos mostraron que las sales MS al 75%  de su concentración, el carbón activado (0,5 g/L-1 o la cisteína (10 mg/L-1, en combinación con los reguladores de crecimiento ANA/BAP (0,01/0,01 mg/L-1 en el medio de cultivo MS, incrementaron los indicadores de desarrollo de las plantas in vitro tales como número de nudos de novo (3,5, longitud del vástago (4,1 cm, número de hojas (3,8, número de ra

  1. Evaluation of genotoxic activity of maleic hydrazide, ethyl methane sulfonate, and N-nitroso diethylamine in Tradescantia Evaluación de la genotoxicidad de hidrazida málica, N-nitroso dietilamina, y etil metano sulfonato, en núcleos de Tradescantia, por medio de la prueba del cometa

    Directory of Open Access Journals (Sweden)

    Carlos Alvarez-Moya

    2001-12-01

    , highly sensitive, and faster than the pink mutation test. The English version of this paper is available too at: http://www.insp.mx/salud/index.html Objetivo. Evaluar la genotoxicidad de N-nitroso dietilamina (NDEA, hidrazida málica (MH y etil metano sulfonato (EMS, en núcleos de Tradescantia (clona 4430 por medio de la prueba del cometa y de la prueba de mutación rosa, en los pelos estaminales de la misma planta. Material y métodos. Las plantas de Tradescantia (clon 4430 fueron obtenidas del Laboratorio de Citogenética y Mutagénesis del Centro de ciencias de la Atmósfera de la Universidad Nacional Autónoma de México, tratadas con NDEA a 1, 5, 10 mM, MH a 1, 5, 10 mM y EMS a 15, 30 y 45 mM, y utilizadas en la prueba de mutación rosa y en la del cometa, en núcleos celulares de los pelos estaminales. En la primera, la lectura de los pelos estaminales se realizó de acuerdo con el método de Underbrink. En otros estudios, que han aplicado la prueba del cometa en plantas, existe la necesidad de romper la pared celular y separar los núcleos por gradiente de centrifugación; en este caso, los núcleos de las células de los pelos estaminales fueron extraídos por aplastamiento sin aplicar un procedimiento especial para romper la pared, colectados por filtración en una malla de nylon y sometidos a la prueba del cometa. La prueba t de Student se usó para analizar los datos obtenidos. Resultados. Ambas pruebas presentaron una gran sensibilidad a los mutágenos estudiados y hubo una relación evidente dosis-eventos rosa / longitud de la cauda. Aunque la prueba de mutación rosa en Tradescantia fue muy sensible a MH y EMS, no se detectaron dosis bajas de NDEA; en cambio, la prueba del cometa en la misma planta permite detectar fácilmente la actividad de todos los agentes estudiados. Conclusión. La prueba del cometa en los núcleos de las células de los pelos estaminales de Tradescantia es una útil herramienta para los estudios de monitoreo. Además, es simple

  2. CARACTERIZACIÓN FISICOQUÍMICA DE MATERIALES REGIONALES DE CACAO COLOMBIANO CARACTERIZAÇÃO FISICOQUIMICA DE MATERIAIS REGIONAIS DO CACAO COLOMBIAN PHYSICOCHEMICAL CHARACTERIZATION OF REGIONAL MATERIALS OF COCOA COLOMBIAN

    Directory of Open Access Journals (Sweden)

    JANETH AIDÉ PEREA

    2011-06-01

    suas características físico-químicas. Espera-se que esses parâmetros sejam usados como diferenciadores. Identificado principais macronutrientes (gordura e composição de ácidos graxos, proteína, cinzas e fibras e micronutrientes de potássio, magnésio, fósforo, ferro e zinco, além de os parâmetros pH escala física, e acidez. Verificou-se que os doze materiais apresentaram diferenças significativas entre eles, mas destacar a seleção de materiais CORPOICA Colombia (SCC41 e FEDECACAO El Carmen (FEC-2 para ter níveis elevados de todas as variáveis. Em relação ao conteúdo de micronutrientes, confirma-se que o cacau é uma importante fonte de potássio, magnésio e fósforo, mas pobre em ferro e zinco.Cocoa is a product with great advantages derived from the necessity to replace the internal demand and to increase the chocolate factory product exports; however, the low productivity of the hybrid plantations of cocoa, has affected the economic development of the sector, thus, the investigation in the country is focused in the search of productive, resistant materials to diseases and with acceptable qualities of grain in national and international markets. In this project two universal materials, a Creole cocoa and nine clon materials were evaluated as far as their physical and chemical characteristics. It is anticipated that these to serve like being differentiating parameters. The main macronutrients (fat and fatty acid composition, protein, ash and fiber and the microelements potassium, magnesium, phosphorus, iron and zinc were determined, in addition to the physical parameters husk, pH and acidity. It was found that the twelve materials present significant differences to each other, but emphasize the materials Selección Colombia Corpoica (SCC41 and Fedecacao El Carmen (FEC-2 to present high levels of all the evaluated variables. With respect to the content of micronutrients, it is confirmed that the cocoa is significant source of potassium, magnesium

  3. Rasgos morfoestructurales de la llanura amazónica del Perú: efecto de la Neotectónica sobre los cambios fluviales y la delimitación de las provincias morfológicas

    Directory of Open Access Journals (Sweden)

    1992-01-01

    del cratón sudamericano. Los ríos con fuerte dinámica fluvial (Marañón, Ucayali y Tapiche tienen aguas blancas (limosas provenientes de los Andes. Las áreas interfluviales son drenadas por ríos pequeños de aguas negras (con ácidos orgánicos, como el Pacaya y el Samiria. El patrón subadaptado de estos ríos de aguas negras se interpreta por la presencia anterior de cursos de aguas blancas en estas partes. La posición que ocupan los ríos subadaptados de aguas negras en la Depresión Ucamara sugiere una migración del Marañón hacia al Norte (50km y del Ucayali hacia el Sureste (100km durante la época reciente, probablemente el Holoceno. Se describe los grandes pantanos y lagos de la Depresión Ucamara, y se discute sus relaciones con el patrón estructural del basamento. Se discuten varios ejemplos de campo característicos y se intenta definir el efecto relativo de las deformaciones neotectónicas sobre el drenaje fluvial y las actuales morfoestructuras. MORPHOSTRUCTURAL TRENDS OF THE AMAZONIAN REGIONS OF PERU: THE EFFECT OF NEOTECTONICS ON FLUVIAL CHANGES AND UPLAND WETLAND BOUNDARIES. The Amazonian regions of Peru are discussed within the context of current knowledge on recent Andean tectonics and their impact on river drainage. The main morphostructural provinces are the foothills or Subandean Zone, which are bordered on the east by large depressions in the Marañon Basin of northeastern Peru, the Madre de Dios region of southern Peru and further to the east the Brazilian craton (Iquitos Geanticline. The structural framework of the Subandean Zone consists of the Subandean Thrust and Fold Belt (STFB West which crops out mostly in the Upper Foothills, and the Subandean Tilted Block Zone (STBZ East which is concentrated mainly in the Lower Foothills. The main rivers which cross the STFB are antecedent or superimposed, but the secondary drainage channels conform to these structures and are subsequent. The STBZ river basins run parallel to the structural

  4. Caracterización fisicoquímica del crecimiento y desarrollo de los frutos de feijoa (Acca sellowiana Berg en los clones 41 (Quimba y 8-4

    Directory of Open Access Journals (Sweden)

    Rodríguez Mariela

    2006-06-01

    Hidden="false" UnhideWhenUsed="false" QFormat="true" Name="Intense Emphasis" />

    La feijoa (Acca sellowiana Berg se cultiva en la region andina colombiana, sin embargo, no se tiene reportes del crecimiento y desarrollo de los frutos de clones importantes como el clon 41 (Quimba y el clon 8-4. En este estudio se evaluaron los cambios fisicos desde la antesis hasta la madurez fisiologica, mientras que los cambios bioquimicos se evaluaron en la ultima etapa