
Sample records for ciliate tetrahymena pyriformis

  1. Galvanotactic behavior of Tetrahymena pyriformis under electric fields

    International Nuclear Information System (INIS)

    Tetrahymena pyriformis, a eukaryotic ciliate, swims toward a cathode in straight or cross-shaped microchannels under an applied electric field, a behavioral response called cathodal galvanotaxis. In straight channel experiments, a one-dimensional electric field was applied, and the galvanotactic swimming behavior of Tetrahymena pyriformis was observed and described in detail while the polarity of this field is switched. In most individual cases, the cell would immediately switch its direction toward the cathode; however, exceptional cases have been observed where cells exhibit a turning delay or do not turn after a polarity switch. In cross-channel experiments, feedback control using vision-based tracking was used to steer a cell in the microchannel intersection using a two-dimensional electric field generated by four electrodes placed at four ends of the cross channel. The motivation for this work is to study the swimming behavior of Tetrahymena pyriformis as a microrobot under the control of electric fields. (paper)

  2. Tetrahymena pyriformis in the ciliate mobility test. Validation and description of a testing procedure for the registration of harmful substances in the air as well as the effects of cigarette smoke on the human respiratory ciliated epithelium. (United States)

    Gräf, W; Gräf, H; Wenz, M


    The damage of the human respiratory ciliated epithelium or its ciliar activity caused by mixtures of harmful substances in the air and cigarette smoke is a considerable parameter for the judgment of acute harmful influences on the human respiratory tract. As an immediate measuring or a quantitative statement about the influence on cilia in vivo at human beings is extremely difficult and problematic, a convenient model experimental system in form of the so called ciliate mobility test (CMT) has been used. In this connection the influence on cilia of the protozan single-celled organism Tetrahymena pyriformis, regarding its average speed of locomotion has been taken as standard. The proof, that the cilia are identical in morphological and functional respect at the human ciliated epithelium and at T. pyriformis has been reached by electron optical comparative representation and bibliographical known substances, influencing cilia (theophylline, bromhexine, ambroxol, terpin hydrate, mercaptoethanesulfonat-sodium, amrinon, salbutamol, tetracosactid-hexaacetate, histamine, and phenol). With regard to the comparability and applicability to the human respiratory ciliated epithelium we have been able to gain statements by means of the CMT. By constructing a special reaction vessel the influence of harmful gases at a thin layer of ciliate culture suspension (1 cm) for a standardised exposure time (1 hour) has been made possible and with that a model for the comparability with the conditions of the human respiratory ciliated epithelium has been created. A number of harmful gases, that are relevant in the air hygiene (CO, CO2, N2, N2O, NO2, O3, SO2) as well as cigarette smoke at active smokers (primary stream smoke) and the inhalation of the smoke of other people's cigarettes has been tested. It turned out, that especially NO2 (nitric oxide) shows a high ciliar toxicity, while the controversially discussed ozone (O3) has not resulted in detraction of cilia. CO, N2O and SO2 have

  3. Toxic Effect of a Pesticide, Diflubenzuron on Freshwater Microinvertebrate (Tetrahymena pyriformis)

    Institute of Scientific and Technical Information of China (English)



    The impact of diflubenzuron (DFB) on Tetrahymena pyriformis, a ciliated protiste was studied. The treatment with DFB at concentrations of 10 and 20 μg/mL could appreciably reduce the growth of the protiste. The surveillance of protozoa′s respiratory metabolism with polarography technique showed a sensitive inhibition of its oxygen consumption, and at 20 μg/mL concentration the oxygen consumption was increased. For any malformation of morphology and perturbation in swimming trajectory, the neutral red coloration was done. This technique (neutral red) showed that there was a toxic effect of DFB on T. pyriformis, especially at the highest concentration;this toxicity was translated by rotatory swimming in same place and the increasing of coloration quantity in digestive vacuoles. Fig 5, Ref 15

  4. QSAR Study of Halogen Phenols Toxicity to Tetrahymena Pyriformis

    Institute of Scientific and Technical Information of China (English)

    PENY Yan-Fen; LIU Tian-Bao


    Structural parameters of 22 halogen phenols were computed at four levels using Hartree-Fock and DFT methods. Based on the experimental data of the acute toxicity to Tetrahymena pyriformis (-lgEC50), three-parameter (energy of the lowest unoccupied molecular orbital (ELUMO), the molecular volume (V), and the lowest negative charge (Qmin)) dependent equations were developed using structural parameters as theoretical descriptors. Especially, -lgEC50 dependent equation calculated at the B3LYP/6-31G** level is more advantageous than the others in view of their correlation and predictive abilities. This dependent equation was validated by variance inflation factors (VIF) and t-test methods. Upon comparison, the predictive abilities of our work are all more advantageous than those calculated from the semi-empirical PM3 method.

  5. Bio-effect of modified multi-wall carbon nanotubes on tetrahymena pyriformis

    International Nuclear Information System (INIS)

    Multi-walled carbon nanotubes (MWNTs) irradiated with γ-rays were chemically modified with glucosamine and decylamine, respectively. The cytotoxicity of Tetrahymena pyriformis exposed to irradiated MWNTs, MWNTs modified with glucosamine and decylamine (denoted by G-MWNTs and D-MWNTs) was carried out. The results indicated that MWNTs modified with different functional groups exhibited different bioactivity to Tetrahymena pyriformis. D-MWNTs showed a significant toxicity to Tetrahymena pyriformis, and the viability of cells reduced to 46.2%. And G-MWNTs promoted significantly the growth of cells, with the viability being up to 308%. More interestingly, it was shown that the toxicity and bioactivity of modified MWNTs to cells was changed along with the contents of functional groups bound on the surface of MWNTs. The studies may supply a possible strategy for enhancing or reducing the toxicity of MWNTs to meet certain applications in biological and medical field. (authors)

  6. QSAR studies for the acute toxicity of nitrobenzenes to the Tetrahymena pyriformis

    Directory of Open Access Journals (Sweden)

    Wang Dan-Dan


    Full Text Available Quantitative structure-activity relationship (QSAR models play a key role in finding the relationship between molecular structures and the toxicity of nitrobenzenes to Tetrahymena pyriformis. In this work, genetic algorithm, along with partial least square (GA-PLS was employed to select optimal subset of descriptors that have significant contribution to the toxicity of nitrobenzenes to Tetrahymena pyriformis. A set of five descriptors, namely G2, HOMT, G(Cl…Cl, Mor03v and MAXDP, was used for the prediction of the toxicity of 45 nitrobenzene derivatives and then were used to build the model by multiple linear regression (MLR method. It turned out that the built model, whose stability was confirmed using the leave-one-out validation and external validation test, showed high statistical significance (R2=0.963, Q2LOO=0.944. Moreover, Y-scrambling test indicated there was no chance correlation in this model.

  7. QSTR with extended topochemical atom (ETA) indices. 14. QSAR modeling of toxicity of aromatic aldehydes to Tetrahymena pyriformis

    Energy Technology Data Exchange (ETDEWEB)

    Roy, Kunal, E-mail: [Drug Theoretics and Cheminformatics Laboratory, Division of Medicinal and Pharmaceutical Chemistry, Department of Pharmaceutical Technology, Jadavpur University, Kolkata 700 032 (India); Das, Rudra Narayan [Drug Theoretics and Cheminformatics Laboratory, Division of Medicinal and Pharmaceutical Chemistry, Department of Pharmaceutical Technology, Jadavpur University, Kolkata 700 032 (India)


    Aldehydes are a toxic class of chemicals causing severe health hazards. In this background, quantitative structure-toxicity relationship (QSTR) models have been developed in the present study using Extended Topochemical Atom (ETA) indices for a large group of 77 aromatic aldehydes for their acute toxicity against the protozoan ciliate Tetrahymena pyriformis. The ETA models have been compared with those developed using various non-ETA topological indices. Attempt was also made to include the n-octanol/water partition coefficient (log K{sub o/w}) as an additional descriptor considering the importance of hydrophobicity in toxicity prediction. Thirty different models were developed using different chemometric tools. All the models have been validated using internal validation and external validation techniques. The statistical quality of the ETA models was found to be comparable to that of the non-ETA models. The ETA models have shown the important effects of steric bulk, lipophilicity, presence of electronegative atom containing substituents and functionality of the aldehydic oxygen to the toxicity of the aldehydes. The best ETA model (without using log K{sub o/w}) shows encouraging statistical quality (Q{sub int}{sup 2}=0.709,Q{sub ext}{sup 2}=0.744). It is interesting to note that some of the topological models reported here are better in statistical quality than previously reported models using quantum chemical descriptors.

  8. QSAR Study of Nitrobenzenes' Toxicity to Tetrahymena Pyriformis Using Semi-empirical Quantum Chemical Methods

    Institute of Scientific and Technical Information of China (English)

    YAN Xiu-Fen; XIAO He-Ming


    The molecular geometries and electronic structures of 30 nitrobenzenes have been calculated by using semi-empirical MO AM1 and PM3 methods.EHOMO,ELUMO,ENHOMO,ENLUMO,AE,QNO2,QC and V were selected as the structural descriptors.The acute toxicity (-logIC50) of nitrobenzenes to tetrahymena pyriformis along with the above eight structural parameters was used to establish the quantitative structure-activity relationships (QSARs).The results indicate that the established model based on AM1 method is superior to that on PM3 method not only for the stability but also for the predictive powers of the model.Based on AM1 parameters,a further classifying discussion was presented for the study of nitrobenzene toxic mechanism.The results show that the substituents,nitro group and halogen substituents on the aromatic ring are crucial to the chemicals' toxicity.For nitrobenzenes without halogen or other substituent,the reduction of nitro group is the main route.However,for those with halogen substituents,their next lowest unoccupied molecular orbital may take part in the toxic action betweeen the chemicals and macromolecules,and ENLUMO has the most important effect on these chemicals' toxicity.

  9. QSAR Studies on the Toxicity of Nitrobenzenes to Population Growth of Tetrahymena Pyriformis

    Institute of Scientific and Technical Information of China (English)


    The IGC50(50% inhibitory growth concentration) values of 27 nitrobenzenes were determined for the population growth endpoint of Tetrahymena pyriformis. The toxicity order of the observed compounds was found to be as follows: dinitro compounds>mononitro compounds, dichloronitrobenzenes>monochloronitrobenzenes, meta-substituted nitrobenzenes>ortho-/para-substituted nitrobenzenes(NT, NPh, NAnis) except for the dinitrobenzenes and nitroanilines(DNB, NAn). Quantitative structure activity relationships(QSARs) were developed with the logarithm of the reciprocal of IGC50[lg(IGC50)-1] in mole liter as dependent variable and six molecular descriptors lgP, 1XⅤ, I, 1Ka, ∑σ- and ELUMO as independent variables. Via multiple regression analysis, one best equation was obtained:lg(IGC50)-1=3.029+0.860∑σ-+0.341In=27, r=0.924, r2=0.854, s=0.265, f=70.44, Pr>f=0.000 1The equation was used to estimate IGC50 for five analogues.

  10. Building up a QSAR model for toxicity toward Tetrahymena pyriformis by the Monte Carlo method: A case of benzene derivatives. (United States)

    Toropova, Alla P; Schultz, Terry W; Toropov, Andrey A


    Data on toxicity toward Tetrahymena pyriformis is indicator of applicability of a substance in ecologic and pharmaceutical aspects. Quantitative structure-activity relationships (QSARs) between the molecular structure of benzene derivatives and toxicity toward T. pyriformis (expressed as the negative logarithms of the population growth inhibition dose, mmol/L) are established. The available data were randomly distributed three times into the visible training and calibration sets, and invisible validation sets. The statistical characteristics for the validation set are the following: r(2)=0.8179 and s=0.338 (first distribution); r(2)=0.8682 and s=0.341 (second distribution); r(2)=0.8435 and s=0.323 (third distribution). These models are built up using only information on the molecular structure: no data on physicochemical parameters, 3D features of the molecular structure and quantum mechanics descriptors are involved in the modeling process. PMID:26851376

  11. Vacuum ultraviolet photolysis of diclofenac and the effects of its treated aqueous solutions on the proliferation and migratory responses of Tetrahymena pyriformis

    Energy Technology Data Exchange (ETDEWEB)

    Arany, Eszter [Research Group of Environmental Chemistry, Institute of Chemistry, University of Szeged, H-6720 Szeged, Rerrich Béla tér 1 (Hungary); Láng, Júlia [Department of Genetics, Cell- and Immunobiology, Semmelweis University, H-1089 Budapest, Nagyvárad tér 4 (Hungary); Somogyvári, Dávid [Research Group of Environmental Chemistry, Institute of Chemistry, University of Szeged, H-6720 Szeged, Rerrich Béla tér 1 (Hungary); Láng, Orsolya [Department of Genetics, Cell- and Immunobiology, Semmelweis University, H-1089 Budapest, Nagyvárad tér 4 (Hungary); Alapi, Tünde [Research Group of Environmental Chemistry, Institute of Chemistry, University of Szeged, H-6720 Szeged, Rerrich Béla tér 1 (Hungary); Department of Inorganic and Analytical Chemistry, University of Szeged, H-6720 Szeged, Dóm tér 7 (Hungary); Ilisz, István [Department of Inorganic and Analytical Chemistry, University of Szeged, H-6720 Szeged, Dóm tér 7 (Hungary); and others


    The effects of dissolved O{sub 2}, phosphate buffer and the initial concentration of diclofenac on the vacuum ultraviolet photolysis of this contaminant molecule were studied. Besides kinetic measurements, the irradiated, multicomponent samples were characterized via the proliferation and migratory responses (in sublethal concentrations) of the bioindicator eukaryotic ciliate Tetrahymena pyriformis. The results suggest that hydroxyl radicals, hydrogen atoms and hydroperoxyl radicals may all contribute to the degradation of diclofenac. The aromatic by-products of diclofenac were presumed to include a hydroxylated derivative, 1-(8-chlorocarbazolyl)acetic acid and 1-(8-hydroxycarbazolyl)acetic acid. The biological activity of photoexposed samples reflected the chemical transformation of diclofenac and was also dependent on the level of dissolved O{sub 2}. The increase in toxicity of samples taken after different irradiation times did not exceed a factor of two. Our results suggest that the combination of vacuum ultraviolet photolysis with toxicity and chemotactic measurements can be a valuable method for the investigation of the elimination of micropollutants. - Highlights: • The radical-scavenging effect of phosphates seems to be negligible. • Only higher concentrations of HO{sub 2}{sup ·} contribute to the degradation of diclofenac. • Toxicity of VUV-treated samples decreases with increasing rate of mineralization. • Dissolved O{sub 2} enhances the mineralization of diclofenac by affecting the radical set. • Treated samples retain the chemorepellent character of the parent compound.

  12. Vacuum ultraviolet photolysis of diclofenac and the effects of its treated aqueous solutions on the proliferation and migratory responses of Tetrahymena pyriformis

    International Nuclear Information System (INIS)

    The effects of dissolved O2, phosphate buffer and the initial concentration of diclofenac on the vacuum ultraviolet photolysis of this contaminant molecule were studied. Besides kinetic measurements, the irradiated, multicomponent samples were characterized via the proliferation and migratory responses (in sublethal concentrations) of the bioindicator eukaryotic ciliate Tetrahymena pyriformis. The results suggest that hydroxyl radicals, hydrogen atoms and hydroperoxyl radicals may all contribute to the degradation of diclofenac. The aromatic by-products of diclofenac were presumed to include a hydroxylated derivative, 1-(8-chlorocarbazolyl)acetic acid and 1-(8-hydroxycarbazolyl)acetic acid. The biological activity of photoexposed samples reflected the chemical transformation of diclofenac and was also dependent on the level of dissolved O2. The increase in toxicity of samples taken after different irradiation times did not exceed a factor of two. Our results suggest that the combination of vacuum ultraviolet photolysis with toxicity and chemotactic measurements can be a valuable method for the investigation of the elimination of micropollutants. - Highlights: • The radical-scavenging effect of phosphates seems to be negligible. • Only higher concentrations of HO2· contribute to the degradation of diclofenac. • Toxicity of VUV-treated samples decreases with increasing rate of mineralization. • Dissolved O2 enhances the mineralization of diclofenac by affecting the radical set. • Treated samples retain the chemorepellent character of the parent compound

  13. Monoxidative cyclization of squalene by Tetrahymena pyriformis. The incorporation of a 3β-hydrogen (deuterium) atom intotetrahymanol

    International Nuclear Information System (INIS)

    The biosynthesis of the triterpene tetrahymanol by the protozoan Tetrahymena pyriformis which involves a nonoxidative cyclization of squalene is discussed. The nonoxidative biosynthesis of tetrahymanol was rationalized in terms of an enzyme -mediated proton attack on a terminal double bond of squilene. The proton attack on the 2,3-double bond could then generate a cation and the ensuing flow of electrons would cause cyclization, resulting in the C-21 cation. The C-21 cation could then be stabilized through the acquisition of a hydroxyl moiety from the water of the medium. The results from the mass spectrometric analysis of D1- and 18O-tetrahymanol indicate that, overall, the biosynthesis of tetrahymanol from squalene by enzymes of Tetrahymena pyriformis is equivalent to the acquisition by squalene of a molecule of water. A single crystal X-ray structure determination of tetrahymanol was carried out and it was found that tetrahymanol has the all trans-anti chair conformation. The stereochemistry i tetrahymnol of the hydrogen atom introduced in the course of the enzymatic cyclization of squalene is also considered. From the deuterium NMR spectrum of the biosynthetic [2H1] -tetrahymanol follows that the hydrogen (deuterium) atom incorporated in the biosynthesis of tetrahymanol from squalene assumes the 3β-stereochemistry in the triterpene. This result was corraborated by an investigation of the infrared spectra of the relevant compounds. (A.G.)

  14. Vanadate affects nuclear division and induces aberrantly-shaped cells during subsequent cytokinesis in Tetrahymena

    DEFF Research Database (Denmark)

    Nilsson, Jytte R.

    cellebiology,endocytosis,monsters,nuclear elongation,sodium orthovanadate,Tetrahymena pyriformis,proliferation......cellebiology,endocytosis,monsters,nuclear elongation,sodium orthovanadate,Tetrahymena pyriformis,proliferation...

  15. A Rab-based view of membrane traffic in the ciliate Tetrahymena thermophila


    Turkewitz, Aaron P.; Bright, Lydia J


    Biologists have long recognized that some single-celled organisms show striking morphological and behavioral complexity, and details of the genetic underpinnings can be mined from the trove of newly-sequenced genomes. Ciliates, among which Tetrahymena thermophila and Paramecium tetraurelia have received most attention, provide clear examples of a lineage in which, as in animal cells, the core pathways of membrane traffic have undergone dramatic expansion and elaboration to facilitate multiple...

  16. A Comparative Study of Two Quantum Chemical Descriptors in Predicting Toxicity of Aliphatic Compounds towards Tetrahymena pyriformis

    Directory of Open Access Journals (Sweden)

    Altaf Hussain Pandith


    Full Text Available Quantum chemical parameters such as LUMO energy, HOMO energy, ionization energy (I, electron affinity (A, chemical potential (μ, hardness (η electronegativity (χ, philicity (ωα, and electrophilicity (ω of a series of aliphatic compounds are calculated at the B3LYP/6-31G(d level of theory. Quantitative structure-activity relationship (QSAR models are developed for predicting the toxicity (pIGC50 of 13 classes of aliphatic compounds, including 171 electron acceptors and 81 electron donors, towards Tetrahymena pyriformis. The multiple linear regression modeling of toxicity of these compounds is performed by using the molecular descriptor log P (1-octanol/water partition coefficient in conjunction with two other quantum chemical descriptors, electrophilicity (ω and energy of the lowest unoccupied molecular orbital (ELUMO. A comparison is made towards the toxicity predicting the ability of electrophilicity (ω versus ELUMO as a global chemical reactivity descriptor in addition to log P. The former works marginally better in most cases. There is a slight improvement in the quality of regression by changing the unit of IGC50 from mg/L to molarity and by removing the racemates and the diastereoisomers from the data set.

  17. Preferential Feeding by the Ciliates Chilodonella and Tetrahymena spp. and Effects of These Protozoa on Bacterial Biofilm Structure and Composition▿


    Dopheide, Andrew; Lear, Gavin; Stott, Rebecca; Lewis, Gillian


    Protozoa are important components of microbial food webs, but protozoan feeding preferences and their effects in the context of bacterial biofilms are not well understood. The feeding interactions of two contrasting ciliates, the free-swimming filter feeder Tetrahymena sp. and the surface-associated predator Chilodonella sp., were investigated using biofilm-forming bacteria genetically modified to express fluorescent proteins. According to microscopy, both ciliates readily consumed cells from...

  18. Bee algorithm and adaptive neuro-fuzzy inference system as tools for QSAR study toxicity of substituted benzenes to Tetrahymena pyriformis. (United States)

    Zarei, Kobra; Atabati, Morteza; Kor, Kamalodin


    A quantitative structure-activity relationship (QSAR) was developed to predict the toxicity of substituted benzenes to Tetrahymena pyriformis. A set of 1,497 zero- to three-dimensional descriptors were used for each molecule in the data set. A major problem of QSAR is the high dimensionality of the descriptor space; therefore, descriptor selection is one of the most important steps. In this paper, bee algorithm was used to select the best descriptors. Three descriptors were selected and used as inputs for adaptive neuro-fuzzy inference system (ANFIS). Then the model was corrected for unstable compounds (the compounds that can be ionized in the aqueous solutions or can easily metabolize under some conditions). Finally squared correlation coefficients were obtained as 0.8769, 0.8649 and 0.8301 for training, test and validation sets, respectively. The results showed bee-ANFIS can be used as a powerful model for prediction of toxicity of substituted benzenes to T. pyriformis. PMID:24638918

  19. The Condensin Complex Is Essential for Amitotic Segregation of Bulk Chromosomes, but Not Nucleoli, in the Ciliate Tetrahymena thermophila† (United States)

    Cervantes, Marcella D.; Coyne, Robert S.; Xi, Xiaohui; Yao, Meng-Chao


    The macronucleus of the binucleate ciliate Tetrahymena thermophila contains fragmented and amplified chromosomes that do not have centromeres, eliminating the possibility of mitotic nuclear division. Instead, the macronucleus divides by amitosis with random segregation of these chromosomes without detectable chromatin condensation. This amitotic division provides a special opportunity for studying the roles of mitotic proteins in segregating acentric chromatin. The Smc4 protein is a core component of the condensin complex that plays a role in chromatin condensation and has also been associated with nucleolar segregation, DNA repair, and maintenance of the chromatin scaffold. Mutants of Tetrahymena SMC4 have remarkable characteristics during amitosis. They do not form microtubules inside the macronucleus as normal cells do, and there is little or no bulk DNA segregation during cell division. Nevertheless, segregation of nucleoli to daughter cells still occurs, indicating the independence of this process and bulk DNA segregation in ciliate amitosis. PMID:16738332

  20. Purification and partial characterization of glyceraldehyde-3-phosphate dehydrogenase from the ciliate Tetrahymena thermophila

    Institute of Scientific and Technical Information of China (English)

    Nadia Errafiy; Abdelaziz Soukri


    In the present study,we purified the glycolytic enzymeglyceraldehyde-3-phosphate dehydrogenase (GAPDH)which is involved in cellular energy production and has important housekeeping functions,from the ciliate Tetrahymena thermophila using a three-step procedure.The enzyme was purified ~68 folds by ammonium sulfate precipitation,followed by two steps of column chromatography (DEAE-cellulose and Mono-S).The purified enzyme is a homotetramer with a molecular weight of ~120 kDa.Isoelectric focusing analysis showed the presence of only one basic GAPDH isoform with an isoelectric point of 8.8.Western blot analysis showed a single 32-kDa band corresponding to the enzyme subunit using a monospecific polyclonal antibody against the T.thermophila GAPDH.The maximum of enzyme activity occurred at pH 8.0 and at 30-35℃.The apparent Km values for both NAD+ and D-glyceraldehyde-3-phosphate were 0.102±0.012 and 0.360 + 0.018 mM,respectively.The maximal velocity (Vmax) was 39.40 + 2.95 U/mg.The T.thermophila GAPDH is inhibited by oxidative and nitrosative stress reagents.

  1. Macronuclear genome sequence of the ciliate Tetrahymena thermophila, a model eukaryote.

    Directory of Open Access Journals (Sweden)

    Jonathan A Eisen


    Full Text Available The ciliate Tetrahymena thermophila is a model organism for molecular and cellular biology. Like other ciliates, this species has separate germline and soma functions that are embodied by distinct nuclei within a single cell. The germline-like micronucleus (MIC has its genome held in reserve for sexual reproduction. The soma-like macronucleus (MAC, which possesses a genome processed from that of the MIC, is the center of gene expression and does not directly contribute DNA to sexual progeny. We report here the shotgun sequencing, assembly, and analysis of the MAC genome of T. thermophila, which is approximately 104 Mb in length and composed of approximately 225 chromosomes. Overall, the gene set is robust, with more than 27,000 predicted protein-coding genes, 15,000 of which have strong matches to genes in other organisms. The functional diversity encoded by these genes is substantial and reflects the complexity of processes required for a free-living, predatory, single-celled organism. This is highlighted by the abundance of lineage-specific duplications of genes with predicted roles in sensing and responding to environmental conditions (e.g., kinases, using diverse resources (e.g., proteases and transporters, and generating structural complexity (e.g., kinesins and dyneins. In contrast to the other lineages of alveolates (apicomplexans and dinoflagellates, no compelling evidence could be found for plastid-derived genes in the genome. UGA, the only T. thermophila stop codon, is used in some genes to encode selenocysteine, thus making this organism the first known with the potential to translate all 64 codons in nuclear genes into amino acids. We present genomic evidence supporting the hypothesis that the excision of DNA from the MIC to generate the MAC specifically targets foreign DNA as a form of genome self-defense. The combination of the genome sequence, the functional diversity encoded therein, and the presence of some pathways missing from

  2. Molecular Characterization of a Copper Metallothionein Gene From a Ciliate Tetrahymena farahensis. (United States)

    Zahid, Muhammad Tariq; Shakoori, Farah Rauf; Zulifqar, Soumble; Ahmed, Ishtiaq; Al-Ghanim, Khalid; Mehboob, Shahid; Shakoori, Abdul Rauf


    A new copper metallothionein (TfCuMT) gene has been identified from a locally isolated ciliate Tetrahymena farahensis. It contains 327 nucleotides encoding a peptide chain of 108 amino acids and belongs to class MTT2 and subfamily 7b. Amplification from both gDNA and mRNA confirmed the intronless nature of this gene. Like most of the metallohtioneins, cysteine residues contribute nearly 30% content with the specific CKC motifs. Structural repeats present in peptide sequence of TfCuMT indicate internal duplication of gene at some stage of gene evolution. The predicted model of copper metallothionein protein showed that copper ions are mainly chelated by thiol sulfur of cysteine residues and are embedded in the folds of polypeptide chain. For in vivo expression of TfCuMT in Escherichia coli host cells the classical stop codons, which coded for glutamine in the ciliate were mutated to CAA and CAG through site directed mutagenesis. The mutated gene showed higher expression in pET28a expression vector compared with pET21a. Optimum expression was obtained after 6-8 h of 0.1 mM IPTG induction. Stability of His tagged TfCuMT in 5% SDS was low, with half-life of about 104 min. Presence of 1.0 μM copper increased the expression level by 1.65-fold. Presence of 100 μM Cysteine in culture medium caused 2.4-fold increase in expression level. His tagged TfCuMT was purified through affinity chromatography using NTN-His binding resin in the presence of 0.1 M imidazole and NaCl. The modeled structure of the TfCuMT showed a cleft for Cu binding with correct orientation of Cys residues in the motif CKC. J. Cell. Biochem. 117: 1843-1854, 2016. © 2016 Wiley Periodicals, Inc. PMID:26754785

  3. Comparative Proteome Bioinformatics: Identification of Phosphotyrosine Signaling Proteins in the Unicellular Protozoan Ciliate Tetrahymena

    DEFF Research Database (Denmark)

    Gammeltoft, Steen; Christensen, Søren Tvorup; Joachimiak, Marcin;


    Tetrahymena, bioinformatics, cilia, evolution, signaling, TtPTK1, PTK, Grb2, SH-PTP 2, Plcy, Src, PTP, PI3K, SH2, SH3, PH......Tetrahymena, bioinformatics, cilia, evolution, signaling, TtPTK1, PTK, Grb2, SH-PTP 2, Plcy, Src, PTP, PI3K, SH2, SH3, PH...

  4. Experimental identification and analysis of macronuclear non-coding RNAs from the ciliate Tetrahymena thermophila

    DEFF Research Database (Denmark)

    Andersen, Kasper Langebjerg; Nielsen, Henrik


    expressed during vegetative growth or sexual reorganization. In order to get an overview of medium-sized (40-500¿nt) RNAs expressed from the Tetrahymena genome, we created a size-fractionated cDNA library from macronuclear RNA and analyzed 80 RNAs, most of which were previously unknown. The most abundant...... class was small nucleolar RNAs (snoRNAs), many of which are formed by an unusual maturation pathway. The modifications guided by the snoRNAs were analyzed bioinformatically and experimentally and many Tetrahymena-specific modifications were found, including several in an essential, but not conserved...

  5. The CNA1 Histone of the Ciliate Tetrahymena thermophila Is Essential for Chromosome Segregation in the Germline MicronucleusD⃞ (United States)

    Cervantes, Marcella D.; Xi, Xiaohui; Vermaak, Danielle; Yao, Meng-Chao; Malik, Harmit S.


    Ciliated protozoans present several features of chromosome segregation that are unique among eukaryotes, including their maintenance of two nuclei: a germline micronucleus, which undergoes conventional mitosis and meiosis, and a somatic macronucleus that divides by an amitotic process. To study ciliate chromosome segregation, we have identified the centromeric histone gene in the Tetrahymena thermophila genome (CNA1). CNA1p specifically localizes to peripheral centromeres in the micronucleus but is absent in the macronucleus during vegetative growth. During meiotic prophase of the micronucleus, when chromosomes are stretched to twice the length of the cell, CNA1p is found localized in punctate spots throughout the length of the chromosomes. As conjugation proceeds, CNA1p appears initially diffuse, but quickly reverts to discrete dots in those nuclei destined to become micronuclei, whereas it remains diffuse and is gradually lost in developing macronuclei. In progeny of germline CNA1 knockouts, we see no defects in macronuclear division or viability of the progeny cells immediately following the knockout. However, within a few divisions, progeny show abnormal mitotic segregation of their micronucleus, with most cells eventually losing their micronucleus entirely. This study reveals a strong dependence of the germline micronucleus on centromeric histones for proper chromosome segregation. PMID:16251352

  6. Zygotic Expression of the Double-Stranded RNA Binding Motif Protein Drb2p Is Required for DNA Elimination in the Ciliate Tetrahymena thermophila ▿


    Motl, Jason A.; Chalker, Douglas L.


    Double-stranded RNA binding motif (DSRM)-containing proteins play many roles in the regulation of gene transcription and translation, including some with tandem DSRMs that act in small RNA biogenesis. We report the characterization of the genes for double-stranded RNA binding proteins 1 and 2 (DRB1 and DRB2), two genes encoding nuclear proteins with tandem DSRMs in the ciliate Tetrahymena thermophila. Both proteins are expressed throughout growth and development but exhibit distinct peaks of ...

  7. Uptake, localization and clearance of quantum dots in ciliated protozoa Tetrahymena thermophila

    International Nuclear Information System (INIS)

    Protozoa as phagocytizing cells have been shown to integrate engineered nanoparticles (NPs), while the mechanism, dynamics and extent of such uptake are unclear. Here our fluorescence microscopy data showed that CdSe/ZnS quantum dots (QDs) with primary size of 12 nm were readily phagocytized into the food vacuoles of Tetrahymena thermophila in a time- and dose-dependent manner. Twenty hours after the exposure to QDs in sublethal concentration the clearance of the QDs from the cells was incomplete suggesting that phagocytosis of QDs into food vacuoles was not the only pathway of uptake by T. thermophila. This was further proven by the results that the inhibition of phagocytosis did not block the internalization of QDs into protozoans. This study provides a new insight into uptake and cellular trafficking of subtoxic concentrations of nanoparticles that may, due to prolonged retention times in the cells, pose risks by potentially becoming available to higher trophic levels. - Highlights: • Tetrahymena thermophila internalized QDs in a dose- and time-dependent manner. • The egested QDs were not significantly biodegraded in the food vacuoles. • In addition to phagocytosis QDs entered protozoa by alternative uptake pathways. • The clearance of the QDs from the cells was incomplete after 20 h in fresh medium. • The prolonged retention time of nontoxic NPs in protozoa could increase their transfer in food chain. - In addition to phagocytosis, quantum dots (QDs) entered protozoans by alternative pathways which did not lead to complete clearance of the QDs from the cells

  8. Comparative studies on the photosensitizing potency of 5-methoxypsoralen and 8-methoxypsoralen as measured by cytolysis in Paramecium caudatam and Tetrahymena pyriformis, and growth inhibition and survival in Candida albicans

    International Nuclear Information System (INIS)

    The photosensitizing potencies of 5-methoxypsoralen and 8-methoxypsoralen were investigated using the following biological end-points for lethality: (i) cytolysis in the protozoans Paramecium caudatum and Tetrahymena pyriformis, (ii) inhibition of growth in the yeast Candida albicans and (iii) survival as measured by colony counts in Candida albicans. In all cases, 5-methoxypsoralen proved to be the more potent photosensitizing agent. The preliminary action spectra of the 2 compounds for growth inhibition in C. albicans were similar and showed maximal spectral efficiency in the 320-340 nm waveband. The molecular basis for the described end-points is unknown. Although it is well known that 5-methoxypsoralen and 8-methoxypsoralen readily photoreact with DNA, it is considered that photoreaction with protein should also be given serious consideration as the possible lethal event. The superior effect of 5-methoxypsoralen is in accordance with some of the physical and photochemical properties of this molecule, but this result is at variance with other studies in different test systems that have been used to compare the photobiological efficacy of these 2 compounds. (author)

  9. Complete sequence of the extrachromosomal rDNA molecule from the ciliate Tetrahymena thermophila strain B1868VII

    DEFF Research Database (Denmark)

    Engberg, J; Nielsen, Henrik


    The recent development of rDNA vectors for transformation of Tetrahymena combined with improved microinjection technology should lead to a renewed interest in this organism. In particular, the rDNA itself constitutes an attractive system for biochemical studies. The rDNA is amplified to a level of...

  10. Genome-wide identification and evolution of ATP-binding cassette transporters in the ciliate Tetrahymena thermophila: A case of functional divergence in a multigene family

    Directory of Open Access Journals (Sweden)

    Yuan Dongxia


    Full Text Available Abstract Background In eukaryotes, ABC transporters that utilize the energy of ATP hydrolysis to expel cellular substrates into the environment are responsible for most of the efflux from cells. Many members of the superfamily of ABC transporters have been linked with resistance to multiple drugs or toxins. Owing to their medical and toxicological importance, members of the ABC superfamily have been studied in several model organisms and warrant examination in newly sequenced genomes. Results A total of 165 ABC transporter genes, constituting a highly expanded superfamily relative to its size in other eukaryotes, were identified in the macronuclear genome of the ciliate Tetrahymena thermophila. Based on ortholog comparisons, phylogenetic topologies and intron characterizations, each highly expanded ABC transporter family of T. thermophila was classified into several distinct groups, and hypotheses about their evolutionary relationships are presented. A comprehensive microarray analysis revealed divergent expression patterns among the members of the ABC transporter superfamily during different states of physiology and development. Many of the relatively recently formed duplicate pairs within individual ABC transporter families exhibit significantly different expression patterns. Further analysis showed that multiple mechanisms have led to functional divergence that is responsible for the preservation of duplicated genes. Conclusion Gene duplications have resulted in an extensive expansion of the superfamily of ABC transporters in the Tetrahymena genome, making it the largest example of its kind reported in any organism to date. Multiple independent duplications and subsequent divergence contributed to the formation of different families of ABC transporter genes. Many of the members within a gene family exhibit different expression patterns. The combination of gene duplication followed by both sequence divergence and acquisition of new patterns of

  11. Several RNase T2 enzymes function in induced tRNA and rRNA turnover in the ciliate Tetrahymena

    DEFF Research Database (Denmark)

    Andersen, Kasper Langebjerg; Collins, Kathleen


    RNase T2 enzymes are produced by a wide range of organisms and have been implicated to function in diverse cellular processes, including stress-induced anticodon loop cleavage of mature tRNAs to generate tRNA halves. Here we describe a family of eight RNase T2 genes (RNT2A-RNT2H) in the ciliate...

  12. Zygotic Expression of the Double-Stranded RNA Binding Motif Protein Drb2p Is Required for DNA Elimination in the Ciliate Tetrahymena thermophila ▿ (United States)

    Motl, Jason A.; Chalker, Douglas L.


    Double-stranded RNA binding motif (DSRM)-containing proteins play many roles in the regulation of gene transcription and translation, including some with tandem DSRMs that act in small RNA biogenesis. We report the characterization of the genes for double-stranded RNA binding proteins 1 and 2 (DRB1 and DRB2), two genes encoding nuclear proteins with tandem DSRMs in the ciliate Tetrahymena thermophila. Both proteins are expressed throughout growth and development but exhibit distinct peaks of expression, suggesting different biological roles. In support of this, we show that expression of DRB2 is essential for vegetative growth while DRB1 expression is not. During conjugation, Drb1p and Drb2p localize to distinct nuclear foci. Cells lacking all DRB1 copies are able to produce viable progeny, although at a reduced rate relative to wild-type cells. In contrast, cells lacking germ line DRB2 copies, which thus cannot express Drb2p zygotically, fail to produce progeny, arresting late into conjugation. This arrest phenotype is accompanied by a failure to organize the essential DNA rearrangement protein Pdd1p into DNA elimination bodies and execute DNA elimination and chromosome breakage. These results implicate zygotically expressed Drb2p in the maturation of these nuclear structures, which are necessary for reorganization of the somatic genome. PMID:22021239

  13. Ciliates Expel Environmental Legionella-Laden Pellets To Stockpile Food


    Hojo, Fuhito; Sato, Daisuke; Matsuo, Junji; Miyake, Masaki; Nakamura, Shinji; Kunichika, Miyuki; Hayashi, Yasuhiro; Yoshida, Mitsutaka; Takahashi, Kaori; Takemura, Hiromu; Kamiya, Shigeru; Yamaguchi, Hiroyuki


    When Tetrahymena ciliates are cultured with Legionella pneumophila, the ciliates expel bacteria packaged in free spherical pellets. Why the ciliates expel these pellets remains unclear. Hence, we determined the optimal conditions for pellet expulsion and assessed whether pellet expulsion contributes to the maintenance of growth and the survival of ciliates. When incubated with environmental L. pneumophila, the ciliates expelled the pellets maximally at 2 days after infection. Heat-killed bact...

  14. Stalking the wild Tetrahymena. (United States)

    Katz, Laura A; Turkewitz, Aaron P


    We live on a microbial planet. Microorganisms dominate in terms of numbers of lineages, numbers of organisms, biomass and evolutionary innovations. Yet much remains to be learned about our microbial neighbours. We have gotten to know a few species that have been transformed into 'laboratory rats' (i.e. model organisms), but even here our understanding of the natural history of these lineages remains inadequate as there are few data from populations living in natural habitats. Zufall et al. (2013) move beyond this trend by providing insights into the natural history of Tetrahymena thermophila, a ciliate that has been used in many studies of cellular and molecular biology. Characterization of T. thermophila sampled from numerous ponds across this ciliate's range in Eastern North America reveals the following: (i) considerable differentiation among isolates, with the greatest diversity among lineages in New England, and (ii) a relatively small effective population size for this model ciliate. Such population data are fundamental for inferences about the origins of the numerous remarkable features of T. thermophila. PMID:23476937

  15. Cytological analysis of Tetrahymena thermophila. (United States)

    Winey, Mark; Stemm-Wolf, Alexander J; Giddings, Thomas H; Pearson, Chad G


    Since their first detection in pond water, large ciliates such as Tetrahymena thermophila, have captivated school children and scientists alike with the elegance of their swimming and the beauty of their cortical organization. Indeed, cytology - simply looking at cells - is an important component of most areas of study in cell biology and is particularly intriguing in the large, complex Tetrahymena cell. Cytological analysis of Tetrahymena is critical for the study of the microtubule cytoskeleton, membrane trafficking, complex nuclear movements and interactions, and the cellular remodeling during conjugation, to name a few topics. We briefly review previously reported cytological techniques for both light and electron microscopy, and point the reader to resources to learn about those protocols. We go on to present new and emerging technologies for the study of these marvelous cells. These include the use of fluorescent-protein tagging to localize cellular components in live cells, as well as for tracking the dynamic behavior of proteins using pulse labeling and fluorescence recovery after photobleaching. For electron microscopy, cellular and antigenic preservation has been improved with the use of cryofixation and freeze-substitution. The technologies described here advance Tetrahymena cell biology to the cutting-edge of cytological analysis. PMID:22444152

  16. DNA rearrangements directed by non-coding RNAs in ciliates


    Mochizuki, Kazufumi


    Extensive programmed rearrangement of DNA, including DNA elimination, chromosome fragmentation, and DNA descrambling, takes place in the newly developed macronucleus during the sexual reproduction of ciliated protozoa. Recent studies have revealed that two distant classes of ciliates use distinct types of non-coding RNAs to regulate such DNA rearrangement events. DNA elimination in Tetrahymena is regulated by small non-coding RNAs that are produced and utilized in an RNAi-related process. It ...

  17. Comparative study of infection with Tetrahymena of different ornamental fish species

    DEFF Research Database (Denmark)

    Sharon, G.; Leibowitz, M. Pimenta; Chettri, Jiwan Kumar;


    Tetrahymena is a ciliated protozoan that can infect a wide range of fish species, although it is most commonly reported in guppies (Poecilia reticulata). The aim of this study was to compare the susceptibility to infection with Tetrahymena of five different ornamental fish species from two....... These two super orders are phylogenetically distant from each other. Infection with Tetrahymena resulted in parasite invasion of internal organs, skin and muscle in all fish species. A relatively strong inflammatory response was observed in infected goldfish and koi, with negligible response in fish species...

  18. Tetrahymena thermophila, a unicellular eukaryote with separate germline and somatic genomes (United States)

    Orias, Eduardo; Cervantes, Marcella D.; Hamilton, Eileen P.


    Tetrahymena thermophila is a ciliate -- a unicellular eukaryote. Remarkably, every cell maintains differentiated germline and somatic genomes: one silent, the other expressed. Moreover, the two genomes undergo diverse processes, some as extreme as life and death, simultaneously in the same cytoplasm. Conserved eukaryotic mechanisms have been modified in ciliates to selectively deal with the two genomes. We describe research in several areas of Tetrahymena biology, including meiosis, amitosis, genetic assortment, selective nuclear pore transport, somatic RNAi-guided heterochromatin formation, DNA excision and programmed nuclear death by autophagy, which has enriched and broadened knowledge of those mechanisms. PMID:21624459

  19. Phylogenetic evidence for the acquisition of ribosomal RNA introns subsequent to the divergence of some of the major Tetrahymena groups

    DEFF Research Database (Denmark)

    Sogin, M L; Ingold, A; Karlok, M;


    Previous work has demonstrated the presence of a self-splicing intron in the large subunit ribosomal RNA coding region in some strains of the ciliate protozoan Tetrahymena. Sequence comparisons of the intron regions from six Tetrahymena species showed these to fall into three homology groups. In an...... attempt to evaluate the evolutionary origins of the intervening sequences, we have now determined complete small subunit ribosomal RNA gene sequences from 13 species of Tetrahymena and the absolute number of nucleotide differences between the sequences was used to construct a phylogenetic tree. This...

  20. Ciliate protozoa

    International Nuclear Information System (INIS)

    Gruby and Delafond discovered the rumen protozoa in 1843 and suggested that their digestive activity was the primary means by which ruminants could survive on an all-plant diet. However, subsequent studies have clearly shown that bacteria actually play a prominent role in the fermentation of plant materials, and fungi are also involved. The rumen ciliates range in size from 18 to 500 μm and can be enumerated and identified microscopically at relatively low magnifications. On the basis of cell morphology, they have been classified into at least five families containing 24 different genera. Although new species are still being reported yearly, the last summary was compiled in 1992 by Williams and Coleman and listed 257 separate species. Ciliate protozoa belonging to different families are found in most other herbivorous mammals. This includes those animals in which fermentation occurs in the hindgut, such as the horse, elephant, rhinoceros and capybara, as well as in the non-ruminant foregut fomenters, i.e. camelids, hippopotamus and kangaroo. These ciliates can be enumerated and identified using the methods and techniques presented in this chapter, presuming appropriate procedures are used for obtaining representative samples from the animal

  1. The mitochondrial genomes of the ciliates Euplotes minuta and Euplotes crassus

    Directory of Open Access Journals (Sweden)

    Huynh Minh


    Full Text Available Abstract Background There are thousands of very diverse ciliate species from which only a handful mitochondrial genomes have been studied so far. These genomes are rather similar because the ciliates analysed (Tetrahymena spp. and Paramecium aurelia are closely related. Here we study the mitochondrial genomes of the hypotrichous ciliates Euplotes minuta and Euplotes crassus. These ciliates are only distantly related to Tetrahymena spp. and Paramecium aurelia, but more closely related to Nyctotherus ovalis, which possesses a hydrogenosomal (mitochondrial genome. Results The linear mitochondrial genomes of the hypotrichous ciliates Euplotes minuta and Euplotes crassus were sequenced and compared with the mitochondrial genomes of several Tetrahymena species, Paramecium aurelia and the partially sequenced mitochondrial genome of the anaerobic ciliate Nyctotherus ovalis. This study reports new features such as long 5'gene extensions of several mitochondrial genes, extremely long cox1 and cox2 open reading frames and a large repeat in the middle of the linear mitochondrial genome. The repeat separates the open reading frames into two blocks, each having a single direction of transcription, from the repeat towards the ends of the chromosome. Although the Euplotes mitochondrial gene content is almost identical to that of Paramecium and Tetrahymena, the order of the genes is completely different. In contrast, the 33273 bp (excluding the repeat region piece of the mitochondrial genome that has been sequenced in both Euplotes species exhibits no difference in gene order. Unexpectedly, many of the mitochondrial genes of E. minuta encoding ribosomal proteins possess N-terminal extensions that are similar to mitochondrial targeting signals. Conclusion The mitochondrial genomes of the hypotrichous ciliates Euplotes minuta and Euplotes crassus are rather different from the previously studied genomes. Many genes are extended in size compared to mitochondrial

  2. Kontinuierliche Co-Kultur von Tetrahymena thermophila und Pseudomonas putida in einem Bioreaktor


    Hauptmann, Ulla


    Im Rahmen der vorliegenden Arbeit wurde ein mikrobielles Ökosystem in einem kontinuierlich betriebenen gerührten Bioreaktor (CSTR) im Labormaßstab etabliert und seine Wachstumskinetik untersucht. In diesem in vitro Räuber-Beute-System wurden der Ciliat Tetrahymena thermophila und das Bakterium Pseudomonas putida über einen Zeitraum von mehr als 400 Stunden gemeinsam kultiviert. Die Interaktion von Bakterien und Protozoen stellt einen elementaren Prozess in der Ökologie nahezu jedes G...

  3. A Domesticated PiggyBac Transposase Interacts with Heterochromatin and Catalyzes Reproducible DNA Elimination in Tetrahymena


    Alexander Vogt; Kazufumi Mochizuki


    The somatic genome of the ciliated protist Tetrahymena undergoes DNA elimination of defined sequences called internal eliminated sequences (IESs), which account for ∼30% of the germline genome. During DNA elimination, IES regions are heterochromatinized and assembled into heterochromatin bodies in the developing somatic nucleus. The domesticated piggyBac transposase Tpb2p is essential for the formation of heterochromatin bodies and DNA elimination. In this study, we demonstrate that the activ...

  4. Lipid substrate specificity of phosphatidylethanolamine N-methyltransferase of Tetrahymena

    International Nuclear Information System (INIS)

    The ciliate protozoan Tetrahymena thermophila forms about 60% of its phosphatidylcholine by methylation of phosphatidylethanolamine with S-adenosylmethionine using the enzyme phosphatidylethanolamine N-methyltransferase. Analogues of ethanolamine or of ethanolamine phosphate are incorporated into the phospholipids of Tetrahymena when cells are cultured in their presence. These compounds, 3-amino-1-propanol, 2-aminoethylphosphonate, 3-aminopropylphosphonate and N,N-dimethylaminoethylphosphonate replace from 50 to 75% of the ethanolamine phosphate in phosphatidylethanolamine. However, analysis of the phospholipids of lipid-altered Tetrahymena showed that none of the phosphatidylethanolamine analogues had been converted to the corresponding phosphatidylcholine analogue. No incorration of [14C-CH3]methionine into the phosphatidylcholine analogues could be demonstrated in vivo, nor was label from [3H-CH3]S-adenosylmethionine incorporated in virto. Thus, only phosphatidylethanolamine and its monomethyl and dimethyl derivatives have been found to be substrates for the phosphatidylethanoiamine N-methyltransferase. The enzyme therefore requires a phospholipid substrate containing an ester linkage between the alkylamine and phosphorus, with the amino group required to be β to the alcohol

  5. The bifunctional dihydrofolate reductase thymidylate synthase of Tetrahymena thermophila provides a tool for molecular and biotechnology applications


    Tiedtke Arno; Bockau Ulrike; Herrmann Lutz; Hartmann Marcus WW; Weide Thomas


    Abstract Background Dihydrofolate reductase (DHFR) and thymidylate synthase (TS) are crucial enzymes in DNA synthesis. In alveolata both enzymes are expressed as one bifunctional enzyme. Results Loss of this essential enzyme activities after successful allelic assortment of knock out alleles yields an auxotrophic marker in ciliates. Here the cloning, characterisation and functional analysis of Tetrahymena thermophila's DHFR-TS is presented. A first aspect of the presented work relates to dest...

  6. Multiple genes of apparent algal origin suggest ciliates may once have been photosynthetic. (United States)

    Reyes-Prieto, Adrian; Moustafa, Ahmed; Bhattacharya, Debashish


    Plantae (as defined by Cavalier-Smith, 1981) plastids evolved via primary endosymbiosis whereby a heterotrophic protist enslaved a photosynthetic cyanobacterium. This "primary" plastid spread into other eukaryotes via secondary endosymbiosis. An important but contentious theory in algal evolution is the chromalveolate hypothesis that posits chromists (cryptophytes, haptophytes, and stramenopiles) and alveolates (ciliates, apicomplexans, and dinoflagellates) share a common ancestor that contained a red-algal-derived "secondary" plastid. Under this view, the existence of several later-diverging plastid-lacking chromalveolates such as ciliates and oomycetes would be explained by plastid loss in these lineages. To test the idea of a photosynthetic ancestry for ciliates, we used the 27,446 predicted proteins from the macronuclear genome of Tetrahymena thermophila to query prokaryotic and eukaryotic genomes. We identified 16 proteins of possible algal origin in the ciliates Tetrahymena and Paramecium tetraurelia. Fourteen of these are present in other chromalveolates. Here we compare and contrast the likely scenarios for algal-gene origin in ciliates either via multiple rounds of horizontal gene transfer (HGT) from algal prey or symbionts, or through endosymbiotic gene transfer (EGT) during a putative photosynthetic phase in their evolution. PMID:18595706

  7. Role of apoptosis-inducing factor (AIF in programmed nuclear death during conjugation in Tetrahymena thermophila

    Directory of Open Access Journals (Sweden)

    Endoh Hiroshi


    Full Text Available Abstract Background Programmed nuclear death (PND, which is also referred to as nuclear apoptosis, is a remarkable process that occurs in ciliates during sexual reproduction (conjugation. In Tetrahymena thermophila, when the new macronucleus differentiates, the parental macronucleus is selectively eliminated from the cytoplasm of the progeny, concomitant with apoptotic nuclear events. However, the molecular mechanisms underlying these events are not well understood. The parental macronucleus is engulfed by a large autophagosome, which contains numerous mitochondria that have lost their membrane potential. In animals, mitochondrial depolarization precedes apoptotic cell death, which involves DNA fragmentation and subsequent nuclear degradation. Results We focused on the role of mitochondrial apoptosis-inducing factor (AIF during PND in Tetrahymena. The disruption of AIF delays the normal progression of PND, specifically, nuclear condensation and kilobase-size DNA fragmentation. AIF is localized in Tetrahymena mitochondria and is released into the macronucleus prior to nuclear condensation. In addition, AIF associates and co-operates with the mitochondrial DNase to facilitate the degradation of kilobase-size DNA, which is followed by oligonucleosome-size DNA laddering. Conclusions Our results suggest that Tetrahymena AIF plays an important role in the degradation of DNA at an early stage of PND, which supports the notion that the mitochondrion-initiated apoptotic DNA degradation pathway is widely conserved among eukaryotes.

  8. Rapid biotransformation of arsenic by a model protozoan Tetrahymena thermophila

    International Nuclear Information System (INIS)

    Arsenic biomethylation and biovolatilization are thought to be two important metabolic pathways in aquatic and soil environments. Tetrahymena thermophila is a genus of free-living ciliated protozoan that is widely distributed in freshwater environments around the world. In this study, we studied arsenic accumulation, speciation, efflux, methylation and volatilization in this unicellular eukaryote exposed to various concentrations of arsenate. Our results show that T. thermophila accumulated 187 dry weight of arsenic when exposed to 40 μM for 48 h, with MMAs(V) (monomethylarsenate) and DMAs(V) (dimethylarsenate) as the dominant species, accounting for 66% of the total arsenic. Meanwhile, arsenate, arsenite, MMAs(V) and DMAs(V) were detected in the culture medium; the last three were released by the cells. The production of volatile arsenic increased with increasing external As(V) concentrations and exposure time. To our knowledge, this is the first study on arsenic metabolism, particularly biomethylation and biovolatilization, in protozoa. - Tetrahymena thermophila can rapidly methylate arsenic, and produce volatile arsenicals.

  9. Rapid biotransformation of arsenic by a model protozoan Tetrahymena thermophila

    Energy Technology Data Exchange (ETDEWEB)

    Yin Xixiang [Key Lab of Urban Environment and Health, Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361021 (China); State Key Lab of Urban and Regional Ecology, Research Center for Eco-environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Zhang Yongyu; Yang Jun [Key Lab of Urban Environment and Health, Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361021 (China); Zhu Yongguan, E-mail: [Key Lab of Urban Environment and Health, Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361021 (China); State Key Lab of Urban and Regional Ecology, Research Center for Eco-environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China)


    Arsenic biomethylation and biovolatilization are thought to be two important metabolic pathways in aquatic and soil environments. Tetrahymena thermophila is a genus of free-living ciliated protozoan that is widely distributed in freshwater environments around the world. In this study, we studied arsenic accumulation, speciation, efflux, methylation and volatilization in this unicellular eukaryote exposed to various concentrations of arsenate. Our results show that T. thermophila accumulated 187{sup -1} dry weight of arsenic when exposed to 40 {mu}M for 48 h, with MMAs(V) (monomethylarsenate) and DMAs(V) (dimethylarsenate) as the dominant species, accounting for 66% of the total arsenic. Meanwhile, arsenate, arsenite, MMAs(V) and DMAs(V) were detected in the culture medium; the last three were released by the cells. The production of volatile arsenic increased with increasing external As(V) concentrations and exposure time. To our knowledge, this is the first study on arsenic metabolism, particularly biomethylation and biovolatilization, in protozoa. - Tetrahymena thermophila can rapidly methylate arsenic, and produce volatile arsenicals.

  10. Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. (United States)

    Yan, Guan-Xiong; Dang, Huai; Tian, Miao; Zhang, Jing; Shodhan, Anura; Ning, Ying-Zhi; Xiong, Jie; Miao, Wei


    Although the role of cyclins in controlling nuclear division is well established, their function in ciliate meiosis remains unknown. In ciliates, the cyclin family has undergone massive expansion which suggests that diverse cell cycle systems exist, and this warrants further investigation. A screen for cyclins in the model ciliate Tetrahymena thermophila showed that there are 34 cyclins in this organism. Only 1 cyclin, Cyc17, contains the complete cyclin core and is specifically expressed during meiosis. Deletion of CYC17 led to meiotic arrest at the diakinesis-like metaphase I stage. Expression of genes involved in DNA metabolism and chromosome organization (chromatin remodeling and basic chromosomal structure) was repressed in cyc17 knockout matings. Further investigation suggested that Cyc17 is involved in regulating spindle pole attachment, and is thus essential for chromosome segregation at meiosis. These findings suggest a simple model in which chromosome segregation is influenced by Cyc17. PMID:27192402

  11. Phosphorylation-Dependent Targeting of Tetrahymena HP1 to Condensed Chromatin. (United States)

    Yale, Katerina; Tackett, Alan J; Neuman, Monica; Bulley, Emily; Chait, Brian T; Wiley, Emily


    The evolutionarily conserved proteins related to heterochromatin protein 1 (HP1), originally described in Drosophila, are well known for their roles in heterochromatin assembly and gene silencing. Targeting of HP1 proteins to specific chromatin locales is mediated, at least in part, by the HP1 chromodomain, which binds to histone H3 methylated at lysine 9 that marks condensed regions of the genome. Mechanisms that regulate HP1 targeting are emerging from studies with yeast and metazoans and point to roles for posttranslational modifications. Here, we report that modifications of an HP1 homolog (Hhp1) in the ciliate model Tetrahymena thermophila correlated with the physiological state and with nuclear differentiation events involving the restructuring of chromatin. Results support the model in which Hhp1 chromodomain binds lysine 27-methylated histone H3, and we show that colocalization with this histone mark depends on phosphorylation at a single Cdc2/Cdk1 kinase site in the "hinge region" adjacent to the chromodomain. These findings help elucidate important functional roles of reversible posttranslational modifications of proteins in the HP1 family, in this case, regulating the targeting of a ciliate HP1 to chromatin regions marked with methylated H3 lysine 27. IMPORTANCE Compacting the genome to various degrees influences processes that use DNA as a template, such as gene transcription and replication. This project was aimed at learning more about the cellular mechanisms that control genome compaction. Posttranslational modifications of proteins involved in genome condensation are emerging as potentially important points of regulation. To help elucidate protein modifications and how they affect the function of condensation proteins, we investigated the phosphorylation of the chromatin protein called Hhp1 in the ciliated protozoan Tetrahymena thermophila. This is one of the first functional investigations of these modifications of a nonhistone chromatin

  12. Selecting One of Several Mating Types through Gene Segment Joining and Deletion in Tetrahymena thermophila (United States)

    Cervantes, Marcella D.; Hamilton, Eileen P.; Xiong, Jie; Lawson, Michael J.; Yuan, Dongxia; Hadjithomas, Michalis; Miao, Wei; Orias, Eduardo


    The unicellular eukaryote Tetrahymena thermophila has seven mating types. Cells can mate only when they recognize cells of a different mating type as non-self. As a ciliate, Tetrahymena separates its germline and soma into two nuclei. During growth the somatic nucleus is responsible for all gene transcription while the germline nucleus remains silent. During mating, a new somatic nucleus is differentiated from a germline nucleus and mating type is decided by a stochastic process. We report here that the somatic mating type locus contains a pair of genes arranged head-to-head. Each gene encodes a mating type-specific segment and a transmembrane domain that is shared by all mating types. Somatic gene knockouts showed both genes are required for efficient non-self recognition and successful mating, as assessed by pair formation and progeny production. The germline mating type locus consists of a tandem array of incomplete gene pairs representing each potential mating type. During mating, a complete new gene pair is assembled at the somatic mating type locus; the incomplete genes of one gene pair are completed by joining to gene segments at each end of germline array. All other germline gene pairs are deleted in the process. These programmed DNA rearrangements make this a fascinating system of mating type determination. PMID:23555191

  13. Whole Genome Sequencing Identifies a Novel Factor Required for Secretory Granule Maturation in Tetrahymena thermophila (United States)

    Kontur, Cassandra; Kumar, Santosh; Lan, Xun; Pritchard, Jonathan K.; Turkewitz, Aaron P.


    Unbiased genetic approaches have a unique ability to identify novel genes associated with specific biological pathways. Thanks to next generation sequencing, forward genetic strategies can be expanded to a wider range of model organisms. The formation of secretory granules, called mucocysts, in the ciliate Tetrahymena thermophila relies, in part, on ancestral lysosomal sorting machinery, but is also likely to involve novel factors. In prior work, multiple strains with defects in mucocyst biogenesis were generated by nitrosoguanidine mutagenesis, and characterized using genetic and cell biological approaches, but the genetic lesions themselves were unknown. Here, we show that analyzing one such mutant by whole genome sequencing reveals a novel factor in mucocyst formation. Strain UC620 has both morphological and biochemical defects in mucocyst maturation—a process analogous to dense core granule maturation in animals. Illumina sequencing of a pool of UC620 F2 clones identified a missense mutation in a novel gene called MMA1 (Mucocyst maturation). The defects in UC620 were rescued by expression of a wild-type copy of MMA1, and disrupting MMA1 in an otherwise wild-type strain phenocopies UC620. The product of MMA1, characterized as a CFP-tagged copy, encodes a large soluble cytosolic protein. A small fraction of Mma1p-CFP is pelletable, which may reflect association with endosomes. The gene has no identifiable homologs except in other Tetrahymena species, and therefore represents an evolutionarily recent innovation that is required for granule maturation. PMID:27317773

  14. Protozoa: a novel Campylobacter reservoir? (United States)

    In previous in vitro studies we found that Campylobacter jejuni remained viable for longer periods of time when they were cultivated in the presence of Tetrahymena pyriformis (ciliate) and Acanthamoeba castellanii (amoeba) than when they were in an independent planktonic state. Increased survival t...

  15. The reverse transcriptase component of the Tetrahymena telomerase ribonucleoprotein complex


    Collins, Kathleen; Gandhi, Leena


    Telomerase is a eukaryotic reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. We describe here the identification of a Tetrahymena telomerase protein with reverse transcriptase motifs, p133. This subunit is associated with the previously identified Tetrahymena telomerase RNA and the telomerase proteins p80 and p95 in immunoprecipitation assays. Therefore, all four known Tetrahymena telomerase compon...

  16. Biased assembly of the nuclear pore complex is required for somatic and germline nuclear differentiation in Tetrahymena. (United States)

    Iwamoto, Masaaki; Koujin, Takako; Osakada, Hiroko; Mori, Chie; Kojidani, Tomoko; Matsuda, Atsushi; Asakawa, Haruhiko; Hiraoka, Yasushi; Haraguchi, Tokuko


    Ciliates have two functionally distinct nuclei, a somatic macronucleus (MAC) and a germline micronucleus (MIC) that develop from daughter nuclei of the last postzygotic division (PZD) during the sexual process of conjugation. Understanding this nuclear dimorphism is a central issue in ciliate biology. We show, by live-cell imaging of Tetrahymena, that biased assembly of the nuclear pore complex (NPC) occurs immediately after the last PZD, which generates anterior-posterior polarized nuclei: MAC-specific NPCs assemble in anterior presumptive MACs but not in posterior presumptive MICs. MAC-specific NPC assembly in the anterior nuclei occurs much earlier than transport of Twi1p, which is required for MAC genome rearrangement. Correlative light-electron microscopy shows that addition of new nuclear envelope (NE) precursors occurs through the formation of domains of redundant NE, where the outer double membrane contains the newly assembled NPCs. Nocodazole inhibition of the second PZD results in assembly of MAC-specific NPCs in the division-failed zygotic nuclei, leading to failure of MIC differentiation. Our findings demonstrate that NPC type switching has a crucial role in the establishment of nuclear differentiation in ciliates. PMID:25788697

  17. Morpho-anatomy of the leaf and stem of Eugenia pyriformis


    Lorene Armstrong; Márcia do Rocio Duarte; Obdulio Gomes Miguel


    Eugenia pyriformis Cambess., known as uvaia, is a species of Myrtaceae native to Brazil. Its leaves are used in folk medicine to treat gout because they possess the property of inhibiting xanthine oxidase, an enzyme involved in the conversion of xanthine into uric acid. The objective of this work was to study the leaf and stem morpho-anatomy of E. pyriformis, in order to contribute to what is known about the Brazilian flora, and this medicinal plant and potential vegetal drug. Samples of matu...

  18. The glycolytic pathway of Trimastix pyriformis is an evolutionary mosaic

    Directory of Open Access Journals (Sweden)

    Silberman Jeffrey D


    Full Text Available Abstract Background Glycolysis and subsequent fermentation is the main energy source for many anaerobic organisms. The glycolytic pathway consists of ten enzymatic steps which appear to be universal amongst eukaryotes. However, it has been shown that the origins of these enzymes in specific eukaryote lineages can differ, and sometimes involve lateral gene transfer events. We have conducted an expressed sequence tag (EST survey of the anaerobic flagellate Trimastix pyriformis to investigate the nature of the evolutionary origins of the glycolytic enzymes in this relatively unstudied organism. Results We have found genes in the Trimastix EST data that encode enzymes potentially catalyzing nine of the ten steps of the glycolytic conversion of glucose to pyruvate. Furthermore, we have found two different enzymes that in principle could catalyze the conversion of phosphoenol pyruvate (PEP to pyruvate (or the reverse reaction as part of the last step in glycolysis. Our phylogenetic analyses of all of these enzymes revealed at least four cases where the relationship of the Trimastix genes to homologs from other species is at odds with accepted organismal relationships. Although lateral gene transfer events likely account for these anomalies, with the data at hand we were not able to establish with confidence the bacterial donor lineage that gave rise to the respective Trimastix enzymes. Conclusion A number of the glycolytic enzymes of Trimastix have been transferred laterally from bacteria instead of being inherited from the last common eukaryotic ancestor. Thus, despite widespread conservation of the glycolytic biochemical pathway across eukaryote diversity, in a number of protist lineages the enzymatic components of the pathway have been replaced by lateral gene transfer from disparate evolutionary sources. It remains unclear if these replacements result from selectively advantageous properties of the introduced enzymes or if they are neutral

  19. The bifunctional dihydrofolate reductase thymidylate synthase of Tetrahymena thermophila provides a tool for molecular and biotechnology applications

    Directory of Open Access Journals (Sweden)

    Tiedtke Arno


    Full Text Available Abstract Background Dihydrofolate reductase (DHFR and thymidylate synthase (TS are crucial enzymes in DNA synthesis. In alveolata both enzymes are expressed as one bifunctional enzyme. Results Loss of this essential enzyme activities after successful allelic assortment of knock out alleles yields an auxotrophic marker in ciliates. Here the cloning, characterisation and functional analysis of Tetrahymena thermophila's DHFR-TS is presented. A first aspect of the presented work relates to destruction of DHFR-TS enzyme function in an alveolate thereby causing an auxotrophy for thymidine. A second aspect is to knock in an expression cassette encoding for a foreign gene with subsequent expression of the target protein. Conclusion This system avoids the use of antibiotics or other drugs and therefore is of high interest for biotechnological applications.

  20. Effects of protein kinase C activators and staurosporine on protein kinase activity, cell survival, and proliferation in Tetrahymena thermophila

    DEFF Research Database (Denmark)

    Straarup, EM; Schousboe, P; Hansen, HQ;


    Autocrine factors prevent cell death in the ciliate Tetrahymena thermophila, a unicellular eukaryote, in a chemically defined medium. At certain growth conditions these factors are released at a sufficient concentration by > 500 cells ml-1 to support cell survival and proliferation. The protein...... kinase C activators phorbol 12-myristate 13-acetate (PMA) or 1-oleyl 2-acetate glycerol (OAG) when added to 250 cells ml-1 supported cell survival and proliferation. In the presence of the serine and threonine kinase inhibitor staurosporine the cells died both at 250 cells ml-1 in cultures supplemented...... with either PMA or OAG, or at 2,500 cells ml-1. At 500 cells ml-1 PMA induced the in vivo phosphorylation of at least six proteins. The myelin basic protein fragment 4-14 was phosphorylated in vitro in crude extracts of a culture of 250,000 cells ml-1. Both the in vivo and the in vitro phosphorylation...

  1. Spliceosomal small nuclear RNAs of Tetrahymena thermophila and some possible snRNA-snRNA base-pairing interactions

    DEFF Research Database (Denmark)

    Orum, H; Nielsen, Henrik; Engberg, J


    We have identified and characterized the full set of spliceosomal small nuclear RNAs (snRNAs; U1, U2, U4, U5 and U6) from the ciliated protozoan Tetrahymena thermophila. With the exception of U4 snRNA, the sizes of the T. thermophila snRNAs are closely similar to their metazoan homologues. The T....... thermophila snRNAs all have unique 5' ends, which start with an adenine residue. In contrast, with the exception of U6, their 3' ends show some size heterogeneity. The primary sequences of the T. thermophila snRNAs contain the sequence motifs shown, or proposed, to be of functional importance in other...... organisms. Furthermore, secondary structures closely similar to phylogenetically proven models can be inferred from the T. thermophila data. Analysis of the snRNA sequences identifies three potential snRNA-snRNA base-pairing interactions, all of which are consistent with available phylogenetic data. Two of...

  2. The Ciliate Colpoda: "Instant" Protozoan (United States)

    Smith, Anne Muller; Giese, Arthur C.


    Describes the characteristics of Colpoda, a ciliated protozoan which is able to survive in a dry, encysted state for long periods of time. Outlines the procedures for culturing the organism and producing cyst preparations, and recommends its use in the high school biology laboratory. (JR)

  3. Biochemical and molecular characterisation of Tetrahymena thermophila extracellular cysteine proteases


    Tiedtke Arno; Aldag Ingo; Erkelenz Michael; Herrmann Lutz; Hartmann Marcus WW


    Abstract Background Over the last decades molecular biologic techniques have been developed to alter the genome and proteome of Tetrahymena thermophila thereby providing the basis for recombinant protein expression including functional human enzymes. The biotechnological potential of Tetrahymena has been proved in numerous publications, demonstrating fast growth, high biomass, fermentation in ordinary bacterial/yeast equipment, up-scalability, existence of cheap and chemical defined media. Fo...

  4. Optimal swimming of model ciliates (United States)

    Michelin, Sebastien; Lauga, Eric


    In order to swim at low Reynolds numbers, microorganisms must undergo non-time-reversible shape changes. In ciliary locomotion, this symmetry breaking is achieved through the actuation of many flexible cilia distributed on the surface of the organism. Experimental studies have demonstrated the collective synchronization of neighboring cilia (metachronal waves), whose exact origin is still debated. Here we consider the hydrodynamic energetic cost of ciliary locomotion and consider an axisymmetric envelope model with prescribed tangential surface displacements. We show that the periodic strokes of this model ciliated swimmer that minimize the energy dissipation in the surrounding fluid achieve symmetry-breaking at the organism level through the propagation of wave patterns similar to metachronal waves. We analyze the properties of the optimal strokes, in particular the impact on the swimming performance introduced by a restriction on maximum cilia tip displacement due to the finite cilia length.

  5. Ciliate communities consistently associated with coral diseases (United States)

    Sweet, M. J.; Séré, M. G.


    Incidences of coral disease are increasing. Most studies which focus on diseases in these organisms routinely assess variations in bacterial associates. However, other microorganism groups such as viruses, fungi and protozoa are only recently starting to receive attention. This study aimed at assessing the diversity of ciliates associated with coral diseases over a wide geographical range. Here we show that a wide variety of ciliates are associated with all nine coral diseases assessed. Many of these ciliates such as Trochilia petrani and Glauconema trihymene feed on the bacteria which are likely colonizing the bare skeleton exposed by the advancing disease lesion or the necrotic tissue itself. Others such as Pseudokeronopsis and Licnophora macfarlandi are common predators of other protozoans and will be attracted by the increase in other ciliate species to the lesion interface. However, a few ciliate species (namely Varistrombidium kielum, Philaster lucinda, Philaster guamense, a Euplotes sp., a Trachelotractus sp. and a Condylostoma sp.) appear to harbor symbiotic algae, potentially from the coral themselves, a result which may indicate that they play some role in the disease pathology at the very least. Although, from this study alone we are not able to discern what roles any of these ciliates play in disease causation, the consistent presence of such communities with disease lesion interfaces warrants further investigation.

  6. Mating of the stichotrichous ciliate Oxytricha trifallax induces production of a class of 27 nt small RNAs derived from the parental macronucleus.

    Directory of Open Access Journals (Sweden)

    Alan M Zahler

    Full Text Available Ciliated protozoans possess two types of nuclei; a transcriptionally silent micronucleus, which serves as the germ line nucleus, and a transcriptionally active macronucleus, which serves as the somatic nucleus. The macronucleus is derived from a new diploid micronucleus after mating, with epigenetic information contributed by the parental macronucleus serving to guide the formation of the new macronucleus. In the stichotrichous ciliate Oxytricha trifallax, the macronuclear DNA is highly processed to yield gene-sized nanochromosomes with telomeres at each end. Here we report that soon after mating of Oxytricha trifallax, abundant 27 nt small RNAs are produced that are not present prior to mating. We performed next generation sequencing of Oxytricha small RNAs from vegetative and mating cells. Using sequence comparisons between macronuclear and micronuclear versions of genes, we found that the 27 nt RNA class derives from the parental macronucleus, not the developing macronucleus. These small RNAs are produced equally from both strands of macronuclear nanochromosomes, but in a highly non-uniform distribution along the length of the nanochromosome, and with a particular depletion in the 30 nt telomere-proximal positions. This production of small RNAs from the parental macronucleus during macronuclear development stands in contrast to the mechanism of epigenetic control in the distantly related ciliate Tetrahymena. In that species, 28-29 nt scanRNAs are produced from the micronucleus and these micronuclear-derived RNAs serve as epigenetic controllers of macronuclear development. Unlike the Tetrahymena scanRNAs, the Oxytricha macronuclear-derived 27 mers are not modified by 2'O-methylation at their 3' ends. We propose models for the role of these "27macRNAs" in macronuclear development.

  7. Morpho-anatomy of the leaf and stem of Eugenia pyriformis

    Directory of Open Access Journals (Sweden)

    Lorene Armstrong


    Full Text Available Eugenia pyriformis Cambess., known as uvaia, is a species of Myrtaceae native to Brazil. Its leaves are used in folk medicine to treat gout because they possess the property of inhibiting xanthine oxidase, an enzyme involved in the conversion of xanthine into uric acid. The objective of this work was to study the leaf and stem morpho-anatomy of E. pyriformis, in order to contribute to what is known about the Brazilian flora, and this medicinal plant and potential vegetal drug. Samples of mature leaves and young stems were fixed and sectioned by freehand, or embedded in glycol methacrylate and sectioned with a microtome, and then stained. In addition, microchemical tests and scanning electron microscopy were performed. The leaf is simple, symmetric, elliptic-lanceolate, with an acute apex and base, and an entire margin. The epidermis is uniseriate and coated with a moderately thick cuticle. The stomata are anomocytic and inserted at the same level as the adjacent cells. Unicellular non-glandular trichomes are abundant on the abaxial surface. The mesophyll is dorsiventral. In transverse section, the midrib is plano-convex and the petiole is circular, and both of these structures have a single bicollateral vascular bundle. In the stem, the vascular cylinder consists of external phloem, xylem and internal phloem, traversed by narrow rays. Phenolic compounds, druses and prismatic crystals of calcium oxalate are also present in the leaf and stem.

  8. Genomic organization and developmental fate of adjacent repeated sequences in a foldback DNA clone of Tetrahymena thermophila

    International Nuclear Information System (INIS)

    DNA sequence elimination and rearrangement occurs during the development of somatic cell lineages of eukaryotes and was first discovered over a century ago. However, the significance and mechanism of chromatin elimination are not understood. DNA elimination also occurs during the development of the somatic macronucleus from the germinal micronucleus in unicellular ciliated protozoa such as Tetrahymena thermophila. In this study foldback DNA from the micronucleus was used as a probe to isolate ten clones. All of those tested (4/4) contained sequences that were repetitive in the micronucleus and rearranged in the macronucleus. Inverted repeated sequences were present in one clone. This clone, pTtFBl, was subjected to a detailed analysis of its developmental fate. Subregions were subcloned and used as probes against Southern blots of micronuclear and macronuclear DNA. DNA was labeled with [33P]-labeled dATP. The authors found that all subregions defined repeated sequence families in the micronuclear genome. A minimum of four different families was defined, two of which are retained in the macronucleus and two of which are completely eliminated. The inverted repeat family is retained with little rearrangement. Two of the families, defined by subregions that do not contain parts of the inverted repeat are totally eliminated during macronuclear development-and contain open reading frames. The significance of retained inverted repeats to the process of elimination is discussed

  9. Phosphorylation of an HP1-like protein is a prerequisite for heterochromatin body formation in Tetrahymena DNA elimination. (United States)

    Kataoka, Kensuke; Noto, Tomoko; Mochizuki, Kazufumi


    Multiple heterochromatic loci are often clustered into a higher order nuclear architecture called a heterochromatin body in diverse eukaryotes. Although phosphorylation of Heterochromatin Protein 1 (HP1) family proteins regulates heterochromatin dynamics, its role in heterochromatin bodies remains unknown. We previously reported that dephosphorylation of the HP1-like protein Pdd1p is required for the formation of heterochromatin bodies during the process of programmed DNA elimination in the ciliated protozoan Tetrahymena Here, we show that the heterochromatin body component Jub4p is required for Pdd1p phosphorylation, heterochromatin body formation, and DNA elimination. Moreover, our analyses of unphosphorylatable Pdd1p mutants demonstrate that Pdd1p phosphorylation is required for heterochromatin body formation and DNA elimination, whereas it is dispensable for local heterochromatin assembly. Therefore, both phosphorylation and the following dephosphorylation of Pdd1p are necessary to facilitate the formation of heterochromatin bodies. We suggest that Jub4p-mediated phosphorylation of Pdd1p creates a chromatin environment that is a prerequisite for subsequent heterochromatin body assembly and DNA elimination. PMID:27466409

  10. Dispersal of the parasitic ciliate Lambornella clarki: implications for ciliates in the biological control of mosquitoes.


    Egerter, D E; Anderson, J R; Washburn, J O


    Lambornella clarki (Ciliophora: Tetrahymenidae), an endoparasite of Aedes sierrensis (Diptera: Culicidae), is dispersed by infected adult mosquitoes. Invasion of the ovaries induces parasitically castrated females to exhibit oviposition behavior and thereby actively disperse ciliates through deposition into water. Oviposition behavior of infected females is prolonged and mimics that of normal gravid females in their first gonotropic cycle. Adults of both sexes also passively disperse ciliates...

  11. Are freshwater pelagic ciliates important bacterivores?

    Czech Academy of Sciences Publication Activity Database

    Šimek, Karel; Jezbera, Jan; Macek, Miroslav; Nedoma, Jiří; Dolan, J. R.

    Innsbruck : Institute for Limnology of the Austrian Academy of Sciences, 2003. s. 36. [Assessing the Variability in Aquatic Microbial Populations: Facts and Fiction. 16.02.2003-20.02.2003, Mondsee] Institutional research plan: CEZ:AV0Z6017912 Keywords : flagellate and ciliate bacterivory * freshwater plankton Subject RIV: EH - Ecology, Behaviour

  12. Biodiversity patterns of soil ciliates along salinity gradients. (United States)

    Zhao, Feng; Xu, Kuidong


    We evaluated ciliate diversity in saline soils with a salinity range from 6.5 to 65psu by the morphological method of the Ludox-quantitative protargol stain (QPS) and the molecular techniques of ciliate-specific clone library and denaturing gradient gel electrophoresis. No active ciliates could be detected with the Ludox-QPS method, while high molecular diversity of ciliates was found. The highest ciliate molecular diversity was obtained from the soil at salinity of 8.9psu, moderate diversity was found at salinity of 6.5psu, and the diversity sharply decreased at salinity of 50.5psu. By contrast, the number of ciliate classes clearly decreased with increasing soil salinity: six, five, four and two classes from sites with salinity of 6.5psu, 8.9psu, 29.5psu and 50.5psu, respectively. Ciliate diversity pattern is different from that of bacteria, whose diversity is also high in extremely saline environments. Meanwhile, the composition of ciliate community was significantly different along salinity gradient. Colpodea and Oligohymenophorea were diverse in soils at salinity less than 29.5psu, while absent in soils with salinity above 50.5psu. BIOENV analysis indicated soil salinity and water content were the main factors regulating the distribution of ciliates in saline soils. PMID:26773903

  13. Dynamics of Tetrahymena macronuclear lamina during cell division

    Institute of Scientific and Technical Information of China (English)



    During mitosis,the nuclear lamina in higher eukaryotic cells undergoes a distinctly morphological change.It breaks down into lamin polymers or monomers at prophase.At telophase,the lamins reassemble around the condensed chromatin to form the layer of lamina.Using antiserum to mammalian lamins,we studied the dynamics of lamina during cell division in the macronuleus of Tetrahymena shanghaiensis,which divided in the way of amitosis.In contrast to those in higher animal cells,the typical perinuclear lamin distribution in the macronucleus persisted throughout the whole cell cycle.It was further found that in some synchronized cells,the lamin distribution bisplayed an unusual pattern consisting of a series of spots within the macronucleus.Using South-western hybridization,we found that the purified 66 KD lamin in Tetrahymena showed specific affinity with the telomere DNA sequence in the same species.Therefore,we propose that pattern of immunofluorescence may be due to the interaction of lamin protein with the nucleoli and the condensed chromatins in the macronucleus.

  14. Netrin-1 Peptide Is a Chemorepellent in Tetrahymena thermophila

    Directory of Open Access Journals (Sweden)

    Heather Kuruvilla


    Full Text Available Netrin-1 is a highly conserved, pleiotropic signaling molecule that can serve as a neuronal chemorepellent during vertebrate development. In vertebrates, chemorepellent signaling is mediated through the tyrosine kinase, src-1, and the tyrosine phosphatase, shp-2. Tetrahymena thermophila has been used as a model system for chemorepellent signaling because its avoidance response is easily characterized under a light microscope. Our experiments showed that netrin-1 peptide is a chemorepellent in T. thermophila at micromolar concentrations. T. thermophila adapts to netrin-1 over a time course of about 10 minutes. Netrin-adapted cells still avoid GTP, PACAP-38, and nociceptin, suggesting that netrin does not use the same signaling machinery as any of these other repellents. Avoidance of netrin-1 peptide was effectively eliminated by the addition of the tyrosine kinase inhibitor, genistein, to the assay buffer; however, immunostaining using an anti-phosphotyrosine antibody showed similar fluorescence levels in control and netrin-1 exposed cells, suggesting that tyrosine phosphorylation is not required for signaling to occur. In addition, ELISA indicates that a netrin-like peptide is present in both whole cell extract and secreted protein obtained from Tetrahymena thermophila. Further study will be required in order to fully elucidate the signaling mechanism of netrin-1 peptide in this organism.

  15. Genetic evidence for a mitochondriate ancestry in the 'amitochondriate' flagellate Trimastix pyriformis.

    Directory of Open Access Journals (Sweden)

    Vladimir Hampl

    Full Text Available Most modern eukaryotes diverged from a common ancestor that contained the alpha-proteobacterial endosymbiont that gave rise to mitochondria. The 'amitochondriate' anaerobic protist parasites that have been studied to date, such as Giardia and Trichomonas harbor mitochondrion-related organelles, such as mitosomes or hydrogenosomes. Yet there is one remaining group of mitochondrion-lacking flagellates known as the Preaxostyla that could represent a primitive 'pre-mitochondrial' lineage of eukaryotes. To test this hypothesis, we conducted an expressed sequence tag (EST survey on the preaxostylid flagellate Trimastix pyriformis, a poorly-studied free-living anaerobe. Among the ESTs we detected 19 proteins that, in other eukaryotes, typically function in mitochondria, hydrogenosomes or mitosomes, 12 of which are found exclusively within these organelles. Interestingly, one of the proteins, aconitase, functions in the tricarboxylic acid cycle typical of aerobic mitochondria, whereas others, such as pyruvate:ferredoxin oxidoreductase and [FeFe] hydrogenase, are characteristic of anaerobic hydrogenosomes. Since Trimastix retains genetic evidence of a mitochondriate ancestry, we can now say definitively that all known living eukaryote lineages descend from a common ancestor that had mitochondria.

  16. Genetic evidence for a mitochondriate ancestry in the 'amitochondriate' flagellate Trimastix pyriformis. (United States)

    Hampl, Vladimir; Silberman, Jeffrey D; Stechmann, Alexandra; Diaz-Triviño, Sara; Johnson, Patricia J; Roger, Andrew J


    Most modern eukaryotes diverged from a common ancestor that contained the alpha-proteobacterial endosymbiont that gave rise to mitochondria. The 'amitochondriate' anaerobic protist parasites that have been studied to date, such as Giardia and Trichomonas harbor mitochondrion-related organelles, such as mitosomes or hydrogenosomes. Yet there is one remaining group of mitochondrion-lacking flagellates known as the Preaxostyla that could represent a primitive 'pre-mitochondrial' lineage of eukaryotes. To test this hypothesis, we conducted an expressed sequence tag (EST) survey on the preaxostylid flagellate Trimastix pyriformis, a poorly-studied free-living anaerobe. Among the ESTs we detected 19 proteins that, in other eukaryotes, typically function in mitochondria, hydrogenosomes or mitosomes, 12 of which are found exclusively within these organelles. Interestingly, one of the proteins, aconitase, functions in the tricarboxylic acid cycle typical of aerobic mitochondria, whereas others, such as pyruvate:ferredoxin oxidoreductase and [FeFe] hydrogenase, are characteristic of anaerobic hydrogenosomes. Since Trimastix retains genetic evidence of a mitochondriate ancestry, we can now say definitively that all known living eukaryote lineages descend from a common ancestor that had mitochondria. PMID:18167542

  17. Proteomic analyses of early response of unicellular eukaryotic microorganism Tetrahymena thermophila exposed to TiO2 particles. (United States)

    Rajapakse, K; Drobne, D; Kastelec, D; Kogej, K; Makovec, D; Gallampois, C; Amelina, H; Danielsson, G; Fanedl, L; Marinsek-Logar, R; Cristobal, S


    Key biological functions involved in cell survival have been studied to understand the difference between the impact of exposure to TiO2 nanoparticles (TiO2-NPs) and their bulk counterparts (bulk-TiO2). By selecting a unicellular eukaryotic model organism and applying proteomic analysis an overview of the possible impact of exposure could be obtained. In this study, we investigated the early response of unicellular eukaryotic protozoan Tetrahymena thermophila exposed to TiO2-NPs or bulk-TiO2 particles at subtoxic concentrations for this organism. The proteomic analysis based on 2DE + nLC-ESI-MS/MS revealed 930 distinct protein spots, among which 77 were differentially expressed and 18 were unambiguously identified. We identified alterations in metabolic pathways, including lipid and fatty acid metabolism, purine metabolism and energetic metabolism, as well as salt stress and protein degradation. This proteomic study is consistent with our previous findings, where the early response of T. thermophila to subtoxic concentrations of TiO2 particles included alterations in lipid and fatty acid metabolism and ion regulation. The response to the lowest TiO2-NPs concentration differed significantly from the response to higher TiO2-NPs concentration and both bulk-TiO2 concentrations. Alterations on the physiological landscape were significant after exposure to both nano- and bulk-TiO2; however, no toxic effects were evidenced even at very high exposure concentrations. This study confirms the relevance of the alteration of the lipid profile and lipid metabolism in understanding the early impact of TiO2-NPs in eukaryotic cells, for example, phagocytosing cells like macrophages and ciliated cells in the respiratory epithelium. PMID:26524663

  18. Photoletter to the editor: Subcutaneous ciliated Mullerian cyst. (United States)

    Keisling, Matthew; Marinovich, Adrian; Burkey, Brooke


    Cutaneous ciliated cysts are benign lesions occurring primarily on the lower extremity of girls and young women. We present a case of a cutaneous ciliated Mullerian cyst arising in the lower leg of a 14-year-old girl, with brief discussion of etiology and diagnosis. This is a rare entity with approximately 50 cases in the literature. PMID:26848322

  19. Reality-and-Desire in Ciliates (United States)

    Brijder, Robert; Hoogeboom, Hendrik Jan

    The theory of gene assembly in ciliates has a number of similarities with the theory of sorting by reversal. Both theories model processes that are based on splicing, and have a fixed begin and end product. The main difference is the type of splicing operations used to obtain the end product from the begin product. In this overview paper, we show how the concept of breakpoint graph, known from the theory of sorting by reversal, can be used in the theory of gene assembly. Our aim is to present the material in an intuitive and informal manner to allow for an efficient introduction into the subject.

  20. Evaluate the potential environmental toxicity of quantum dots on ciliated protozoa by microcalorimetry

    Energy Technology Data Exchange (ETDEWEB)

    Xiao, Qi [College of Chemistry and Life Science, Guangxi Teachers Education University, Nanning 530001 (China); State Key Laboratory of Virology, College of Chemistry and Molecular Sciences, Wuhan University, Wuhan 430072 (China); Huang, Shan, E-mail: [College of Chemistry and Life Science, Guangxi Teachers Education University, Nanning 530001 (China); State Key Laboratory of Virology, College of Chemistry and Molecular Sciences, Wuhan University, Wuhan 430072 (China); Su, Wei [College of Chemistry and Life Science, Guangxi Teachers Education University, Nanning 530001 (China); Li, Peiyuan [College of Pharmacy, Guangxi Traditional Chinese Medical University, Nanning 530001 (China); Liang, Zuocui; Ou, Jianzhen; Ma, Jianqiang [College of Chemistry and Life Science, Guangxi Teachers Education University, Nanning 530001 (China); Liu, Yi, E-mail: [State Key Laboratory of Virology, College of Chemistry and Molecular Sciences, Wuhan University, Wuhan 430072 (China)


    Highlights: Black-Right-Pointing-Pointer The toxic effects of QDs to T. thermophila BF{sub 5} using a TAM air microcalorimeter. Black-Right-Pointing-Pointer QDs were acutely toxic for T. thermophila BF{sub 5} growth in a dose-dependent manner. Black-Right-Pointing-Pointer The toxicity of different ligands-capped QDs on T. thermophila BF{sub 5} was investigated. Black-Right-Pointing-Pointer QDs could be ingested by cells and affect the morphology of T. thermophila BF{sub 5}. - Abstract: In the present study, we evaluated the toxic effects of mercaptoacetic acid (MAA)-capped CdSe QDs and CdSe/ZnS QDs to particle-ingesting model ciliated protozoa Tetrahymena thermophila BF{sub 5} (T. thermophila BF{sub 5}) by using a TAM air isothermal microcalorimeter. These results suggested that both MAA-CdSe QDs and MAA-CdSe/ZnS QDs were indeed acutely toxic for T. thermophila BF{sub 5} growth in a dose-dependent manner, and the toxicities of both MAA-CdSe QDs and MAA-CdSe/ZnS QDs increased dramatically after UV irradiation due to the liberation of more toxic Cd{sup 2+}, which indicated that the toxicity of MAA-CdSe/ZnS QDs was less than that of MAA-CdSe QDs. Furthermore, the toxicity of different ligands-capped CdSe/ZnS QDs on T. thermophila BF{sub 5} was also investigated. The uptake of MAA-CdSe/ZnS QDs and adenosine 5 Prime -monophosphate (AMP)-CdSe/ZnS QDs by cells and the morphological change during the process of T. thermophila BF{sub 5} growth incubated with these QDs were further studied by fluorescence inverted microscopy.

  1. Generation and analysis of expressed sequence tags from the ciliate protozoan parasite Ichthyophthirius multifiliis

    Directory of Open Access Journals (Sweden)

    Arias Covadonga


    Full Text Available Abstract Background The ciliate protozoan Ichthyophthirius multifiliis (Ich is an important parasite of freshwater fish that causes 'white spot disease' leading to significant losses. A genomic resource for large-scale studies of this parasite has been lacking. To study gene expression involved in Ich pathogenesis and virulence, our goal was to generate expressed sequence tags (ESTs for the development of a powerful microarray platform for the analysis of global gene expression in this species. Here, we initiated a project to sequence and analyze over 10,000 ESTs. Results We sequenced 10,368 EST clones using a normalized cDNA library made from pooled samples of the trophont, tomont, and theront life-cycle stages, and generated 9,769 sequences (94.2% success rate. Post-sequencing processing led to 8,432 high quality sequences. Clustering analysis of these ESTs allowed identification of 4,706 unique sequences containing 976 contigs and 3,730 singletons. These unique sequences represent over two million base pairs (~10% of Plasmodium falciparum genome, a phylogenetically related protozoan. BLASTX searches produced 2,518 significant (E-value -5 hits and further Gene Ontology (GO analysis annotated 1,008 of these genes. The ESTs were analyzed comparatively against the genomes of the related protozoa Tetrahymena thermophila and P. falciparum, allowing putative identification of additional genes. All the EST sequences were deposited by dbEST in GenBank (GenBank: EG957858–EG966289. Gene discovery and annotations are presented and discussed. Conclusion This set of ESTs represents a significant proportion of the Ich transcriptome, and provides a material basis for the development of microarrays useful for gene expression studies concerning Ich development, pathogenesis, and virulence.

  2. Evaluate the potential environmental toxicity of quantum dots on ciliated protozoa by microcalorimetry

    International Nuclear Information System (INIS)

    Highlights: ► The toxic effects of QDs to T. thermophila BF5 using a TAM air microcalorimeter. ► QDs were acutely toxic for T. thermophila BF5 growth in a dose-dependent manner. ► The toxicity of different ligands-capped QDs on T. thermophila BF5 was investigated. ► QDs could be ingested by cells and affect the morphology of T. thermophila BF5. - Abstract: In the present study, we evaluated the toxic effects of mercaptoacetic acid (MAA)-capped CdSe QDs and CdSe/ZnS QDs to particle-ingesting model ciliated protozoa Tetrahymena thermophila BF5 (T. thermophila BF5) by using a TAM air isothermal microcalorimeter. These results suggested that both MAA-CdSe QDs and MAA-CdSe/ZnS QDs were indeed acutely toxic for T. thermophila BF5 growth in a dose-dependent manner, and the toxicities of both MAA-CdSe QDs and MAA-CdSe/ZnS QDs increased dramatically after UV irradiation due to the liberation of more toxic Cd2+, which indicated that the toxicity of MAA-CdSe/ZnS QDs was less than that of MAA-CdSe QDs. Furthermore, the toxicity of different ligands-capped CdSe/ZnS QDs on T. thermophila BF5 was also investigated. The uptake of MAA-CdSe/ZnS QDs and adenosine 5′-monophosphate (AMP)-CdSe/ZnS QDs by cells and the morphological change during the process of T. thermophila BF5 growth incubated with these QDs were further studied by fluorescence inverted microscopy.

  3. Social information from immigrants: multiple immigrant-based sources of information for dispersal decisions in a ciliate. (United States)

    Jacob, Staffan; Chaine, Alexis S; Schtickzelle, Nicolas; Huet, Michèle; Clobert, Jean


    1. Dispersal is increasingly recognized as being an informed process, based on information organisms obtain about the landscape. While local conditions are often found to drive dispersal decisions, local context is not always a reliable predictor of conditions in neighbouring patches, making the use of local information potentially useless or even maladaptive. In this case, using social information gathered by immigrants might allow adjusting dispersal decisions without paying the costs of prospecting. However, this hypothesis has been largely neglected despite its major importance for ecological and evolutionary processes. 2. We investigated three fundamental questions about immigrant-informed dispersal: Do immigrants convey information that influences dispersal, do organisms use multiple cues from immigrants, and is immigrant-informed dispersal genotype dependent? 33. Using Tetrahymena thermophila ciliates in microcosms, we manipulated the number of immigrants arriving, the density of congeners, the resource quality in neighbouring patches, matrix characteristics and the level of cooperation of individuals in the neighbouring populations. 4. We provide the first experimental evidence that immigrants convey a number of different cues about neighbouring patches and matrix (patch quality, matrix characteristics and cooperation in neighbouring populations) in this relatively simple organism. Furthermore, we demonstrate genotype-dependent immigrant-informed dispersal decisions about patch quality and matrix characteristics. 5. Multiple cues from immigrants and genotype-dependent use of cues have major implications for theoretical metapopulation dynamics and the potential for local adaptation. PMID:25902764

  4. Experimental and modeling evidence of appendicularian-ciliate interactions

    DEFF Research Database (Denmark)

    Lombard, Fabien; Eloire, Damien; Gobet, Angelique;


    Interactions between appendicularians and ciliates were observed over the life span of Oikopleura dioica in laboratory cultures and clarified with the use of mathematical modeling and microscopic observations. Complex interactions including competition, parasitism, predation, and histophagy occur...

  5. Studies on experimental culture of a marine ciliate Fabrea salina

    Digital Repository Service at National Institute of Oceanography (India)

    Rattan, R.; Ansari, Z.A; Chatterji, A

    Studies were conducted on the culture of a marine ciliate, Fabrea salina in the laboratory condition. Three types of inert feed; commercial yeast, fermented wheat bran and fermented rise bran were tested to study their suitability as artificial feed...

  6. Checkpoint Activation of an Unconventional DNA Replication Program in Tetrahymena. (United States)

    Sandoval, Pamela Y; Lee, Po-Hsuen; Meng, Xiangzhou; Kapler, Geoffrey M


    The intra-S phase checkpoint kinase of metazoa and yeast, ATR/MEC1, protects chromosomes from DNA damage and replication stress by phosphorylating subunits of the replicative helicase, MCM2-7. Here we describe an unprecedented ATR-dependent pathway in Tetrahymena thermophila in which the essential pre-replicative complex proteins, Orc1p, Orc2p and Mcm6p are degraded in hydroxyurea-treated S phase cells. Chromosomes undergo global changes during HU-arrest, including phosphorylation of histone H2A.X, deacetylation of histone H3, and an apparent diminution in DNA content that can be blocked by the deacetylase inhibitor sodium butyrate. Most remarkably, the cell cycle rapidly resumes upon hydroxyurea removal, and the entire genome is replicated prior to replenishment of ORC and MCMs. While stalled replication forks are elongated under these conditions, DNA fiber imaging revealed that most replicating molecules are produced by new initiation events. Furthermore, the sole origin in the ribosomal DNA minichromosome is inactive and replication appears to initiate near the rRNA promoter. The collective data raise the possibility that replication initiation occurs by an ORC-independent mechanism during the recovery from HU-induced replication stress. PMID:26218270

  7. Community Structure and Biodiversity of Soil Ciliates at Dongzhaigang Mangrove Forest in Hainan Island, China


    Jing Li; Qingyu Liao; Mei Li; Jinhong Zhang; Nora Fungyee Tam; Runlin Xu


    The distribution of soil ciliates in three different habitats within a typical mangrove forest in Dongzhaigang, Hainan, China was investigated. The abundance, biodiversity, and community similarity of ciliates in fresh and air-dried soil with different, physical/chemical properties were analyzed. Three Classes, 11 Orders, 34 Genera, and 70 species of ciliates were found with the first dominant group being Hypotrichida. Ciliate biodiversities followed Site B < Site A < Site C in both fresh and...

  8. Estudos morfoanatômico, fitoquímico e de atividades biológicas de folha e caule de Eugenia Pyriformis Cambess., Myrtaceae.


    Armstrong, Lorene


    Resumo: A especie Eugenia pyriformis Cambess., conhecida popularmente como uvaia, e uma Myrtaceae nativa do Brasil. Suas folhas sao utilizadas na medicina popular para o tratamento de gota, pois possui a propriedade de baixar os niveis de acido urico. Este trabalho teve como objetivo realizar estudos morfoanatomico, fitoquimico e de atividades biologicas de folha e caule da especie, acrescentando dados ao conhecimento dessa planta medicinal e potencial droga vegetal. O material vegetal foi co...

  9. Nucleic acids and protein synthesizing mechanisms of mitochondria. Progress report, 1977--1978. [Tetrahymena protein synthesis and genetics

    Energy Technology Data Exchange (ETDEWEB)

    Suyama, Y.


    Progress is reported on endonuclease mapping of Tetrahymena mtDNA; biosynthesis of mitochondrial tRNA; studies on structure and biosynthesis of tRNA charging enzymes; and characterizations of mitochondrial ribosome constituent proteins and RNAs.

  10. The Effects of Oil Pollution on Free-living Ciliates




    For the first time the effects of oil pollution on free-living ciliates at community level and also at cellular level were studied at the same time. The effects of various oil concentrations from two oil fields (Sangachal and Guneshli) on psammophile and periphyton ciliates were studied. As a result, the parameters using the oil pollution biotesting with the help of these test systems were determined. Oil from the Guneshli oil field was determined to be more toxic. The effects of oil pollutio...

  11. Act together - implications of symbioses in aquatic ciliates

    DEFF Research Database (Denmark)

    Dziallas, Claudia; Allgaier, Martin; Monaghan, Michael T.;


    ecosystems, which are often highly variable, harsh, and nutrient-deficient habitats. It is therefore not surprising that symbioses are widespread in both marine and freshwater environments. Symbioses in aquatic ciliates are good model systems for exploring symbiont-host interactions. Many ciliate species are......Mutual interactions in the form of symbioses can increase the fitness of organisms and provide them with the capacity to occupy new ecological niches. The formation of obligate symbioses allows for rapid evolution of new lifeforms including multitrophic consortia. Microbes are important components...

  12. The C-terminal domain of Tetrahymena thermophila telomerase holoenzyme protein p65 induces multiple structural changes in telomerase RNA


    Akiyama, Benjamin M.; Loper, John; Najarro, Kevin; Stone, Michael D.


    The C-terminal domain of Tetrahymena thermophila telomerase holoenzyme protein p65 induces multiple structural changes in telomerase RNA. Telomerase holoenzyme proteins are required to fold telomerase RNA into its active conformation. In this study, the Stone laboratory employed a combination of single-molecule FRET and RNase protection mapping to demonstrate that the C-terminal domain of the Tetrahymena telomerase holoenzyme protein p65 is essential for its RNA folding activity. RNase probin...

  13. Características y Propiedades Germinativas de las Semilla de Abarco (Cariniana pyriformis Miers

    Directory of Open Access Journals (Sweden)

    Betancur P. Gilberto


    almacenamiento, la temperatura más apropiada y que mostró diferencias significativas con los otros tratamientos fue 4°C. No se encontraron diferencias significativas en el desarrollo inicial de plántulas de abarco sometidas a diferentes condiciones de exposición solar. Se encontraron diferencias significativas entre los diferentes períodos de almacenamiento./Abstract The research was carried out in the laboratory and nursery of the School of Agricultural Sciences, Universidad Nacional, located in Medellín. Basically, the following aspects were studied: a Characteristics of the fruit, seeds and seedlings of abarco (Cariniana pyriformis; b Search for an adequate treatment against fungi attack on seeds; c To find adequate storage conditions for the seeds, in such a way, that its germinative potency loss would not be significant after a long storage period; and d Study the behavior of the seedlings under different conditions of exposition to sunlight. To study the efficiency of sanitary treatments, four different chemical products were applied to seeds placed in Petri dishes. The infected seeds were counted after 12 and 24 days. A completely random design was used. In the two trials carried out for storage conditions of abarco seeds, lots of seeds were stored under different conditions and during different periods; they were later on allowed to germinate and, counted. The experimental design for trial I was a completely randomized one in a factorial design of 2 x 3 x 3, and fortrial TI, completely randomized with a factorial design of 2 x 3. In the experiment dealing with different conditions of sunlight, seeds were planted in germination beds, the seedling being transplanted lo pots later on, and then placed in different sites, under varying degrees of sun exposure. The design utilized was also completely randomized. The results showed that the best treatment was formaldehyde 4% for 3 minutes. No significant differences were found in relation to dry storage in

  14. 2-Aminoethylphosphonic acid concentrations in some rumen ciliate protozoa.


    Whitelaw, F G; Bruce, L. A.; Eadie, J M; Shand, W J


    The concentration of 2-aminoethylphosphonic acid has been measured in seven genera of rumen ciliate protozoa. Expressed as milligrams per gram of total nitrogen, 2-aminoethylphosphonic acid concentrations ranged from 17.2 in Ophryoscolex spp. to 72.4 in Eremoplastron spp.

  15. Tipification of oligotrophic lakes using the ciliate assemblage structure

    Czech Academy of Sciences Publication Activity Database

    Macek, Miroslav; Lugo-Vázquez, A.; Šimek, Karel

    Messina: Istituto per l Ambiente Marino Costiero, 2002 - (Giuliano, L.; Yakimov, M.). s. L112 [Symposium on Aquatic Microbial Ecology SAME-8 /8./. 25.10.2002-30.10.2002, Taormina] Institutional research plan: CEZ:AV0Z6017912 Keywords : tipification * oligotrophic lakes * ciliate assemblage Subject RIV: DA - Hydrology ; Limnology

  16. Specific RNA residue interactions required for enzymatic functions of Tetrahymena telomerase.


    Gilley, D; Blackburn, E H


    The ribonucleoprotein enzyme telomerase is a specialized reverse transcriptase that synthesizes telomeric DNA by copying a template sequence within the telomerase RNA. Here we analyze the actions of telomerase from Tetrahymena thermophila assembled in vivo with mutated or wild-type telomerase RNA to define further the roles of particular telomerase RNA residues involved in essential enzymatic functions: templating, substrate alignment, and promotion of polymerization. Position 49 of the telom...

  17. LIA4 Encodes a Chromoshadow Domain Protein Required for Genomewide DNA Rearrangements in Tetrahymena thermophila


    Horrell, Scott A.; Chalker, Douglas L.


    Extensive DNA elimination occurs as part of macronuclear differentiation during Tetrahymena sexual reproduction. The identification of sequences to excise is guided by a specialized RNA interference (RNAi) machinery that targets the methylation of histone H3 lysine 9 (K9) and K27 on chromatin associated with these internal eliminated sequences (IESs). This modified chromatin is reorganized into heterochromatic subnuclear foci, which is a hallmark of their subsequent elimination. Here, we demo...

  18. Involvement of a putative intercellular signal-recognizing G protein-coupled receptor in the engulfment of Salmonella by the protozoan Tetrahymena

    Directory of Open Access Journals (Sweden)

    P.N. Agbedanu


    Full Text Available In an effort to investigate the molecular basis of protozoa engulfment-mediated hypervirulence of Salmonella in cattle, we evaluated protozoan G protein-coupled receptors (GPCRs as transducers of Salmonella engulfment by the model protozoan Tetrahymena. Our laboratory previously demonstrated that non-pathogenic protozoa (including Tetrahymena engulf Salmonella and then exacerbate its virulence in cattle, but the mechanistic details of the phenomenon are not fully understood. GPCRs were investigated since these receptors facilitate phagocytosis of particulates by Tetrahymena, and a GPCR apparently modulates bacterial engulfment for the pathogenic protozoan Entamoeba histolytica. A database search identified three putative Tetrahymena GPCRs, based on sequence homologies and predicted transmembrane domains, that were the focus of this study. Salmonella engulfment by Tetrahymena was assessed in the presence of suramin, a non-specific GPCR inhibitor. Salmonella engulfment was also assessed in Tetrahymena in which expression of putative GPCRs was knocked-down using RNAi. A candidate GPCR was then expressed in a heterologous yeast expression system for further characterization. Our results revealed that Tetrahymena were less efficient at engulfing Salmonella in the presence of suramin. Engulfment was reduced concordantly with a reduction in the density of protozoa. RNAi-based studies revealed that knock-down of one the Tetrahymena GPCRs caused diminished engulfment of Salmonella. Tetrahymena lysates activated this receptor in the heterologous expression system. These data demonstrate that the Tetrahymena receptor is a putative GPCR that facilitates bacterial engulfment by Tetrahymena. Activation of the putative GPCR seemed to be related to protozoan cell density, suggesting that its cognate ligand is an intercellular signaling molecule.

  19. On computational properties of gene assembly in ciliates

    Directory of Open Access Journals (Sweden)

    Vladimir Rogojin


    Full Text Available Gene assembly in stichotrichous ciliates happening during sexual reproduction is one of the most involved DNA manipulation processes occurring in biology. This biological process is of high interest from the computational and mathematical points of view due to its close analogy with such concepts and notions in theoretical computer science as permutation and linked list sorting and string rewriting. Studies on computational properties of gene assembly in ciliates represent a good example of interdisciplinary research contributing to both computer science and biology. We review here a number of general results related both to the development of different computational methods enhancing our understanding on the nature of gene assembly, as well as to the development of new biologically motivated computational and mathematical models and paradigms. Those paradigms contribute in particular to combinatorics, formal languages and computability theories.

  20. Social biases determine spatiotemporal sparseness of ciliate mating heuristics


    Clark, Kevin B


    Ciliates become highly social, even displaying animal-like qualities, in the joint presence of aroused conspecifics and nonself mating pheromones. Pheromone detection putatively helps trigger instinctual and learned courtship and dominance displays from which social judgments are made about the availability, compatibility, and fitness representativeness or likelihood of prospective mates and rivals. In earlier studies, I demonstrated the heterotrich Spirostomum ambiguum improves mating compet...

  1. The role of ciliate protozoa in the rumen


    Newbold, Charles J.; de la Fuente, Gabriel; Belanche, Alejandro; Ramos-Morales, Eva; McEwan, Neil R.


    First described in 1843, Rumen protozoa with their striking appearance were assumed to be important for the welfare of their host. However, despite contributing up to 50% of the bio-mass in the rumen, the role of protozoa in rumen microbial ecosystem remains unclear. Phylogenetic analysis of 18S rDNA libraries generated from the rumen of cattle, sheep, and goats has revealed an unexpected diversity of ciliated protozoa although variation in gene copy number between species makes it difficult ...

  2. Ciliated epithelial cell lifespan in the mouse trachea and lung


    Rawlins, Emma L.; Brigid L M Hogan


    The steady-state turnover of epithelial cells in the lung and trachea is highly relevant to investigators who are studying endogenous stem cells, manipulating gene expression in vivo, or using viral vectors for gene therapy. However, the average lifetime of different airway epithelial cell types has not previously been assessed using currently available genetic techniques. Here, we use Cre/loxP genetic technology to indelibly label a random fraction of ciliated cells throughout the airways of...

  3. Ciliate Paramecium is a natural reservoir of Legionella pneumophila


    Kenta Watanabe; Ryo Nakao; Masahiro Fujishima; Masato Tachibana; Takashi Shimizu; Masahisa Watarai


    Legionella pneumophila, the causative agent of Legionnaires’ disease, replicates within alveolar macrophages and free-living amoebae. However, the lifestyle of L. pneumophila in the environment remains largely unknown. Here we established a novel natural host model of L. pneumophila endosymbiosis using the ciliate Paramecium caudatum. We also identified Legionella endosymbiosis-modulating factor A (LefA), which contributes to the change in life stage from endosymbiosis to host lysis, enabling...

  4. Acute toxicity of heavy metals towards freshwater ciliated protists

    International Nuclear Information System (INIS)

    The acute toxicity of five heavy metals to four species of freshwater ciliates (Colpidium colpoda, Dexiotricha granulosa, Euplotes aediculatus, and Halteria grandinella) was examined in laboratory tests. After exposing the ciliates to soluble compound of cadmium, copper, chromium, lead, and nickel at several selected concentrations, the mortality rate was registered and the LC5 values (with 95% confidence intervals) were calculated. Large differences appeared in sensitivities of the four species to the metals. H. grandinella showed the highest sensitivity for cadmium (0.07 mg l-1, LC5) and lead (0.12 mg l-1, LC5), whilst E. aediculatus showed the highest sensitivity for nickel (0.03 mg l-1, LC5). The comparison with data obtained with other species indicate that Halteria grandinella and Euplotes aediculatus are excellent and convenient bioindicator for evaluating the toxicity of waters and wastewaters polluted by heavy metals. The short time (24 h) and simplicity of the test procedure enable this test to be used in laboratory studies. - Ciliated protozoa are suitable bioindicators of heavy metal pollution in freshwater environments

  5. Effect of ciliates on nitrification and nitrifying bacteria in Baltic Sea sediments


    Prast, M.; Bischof, Adrian A.; Waller, Uwe; Amann, R.; Berninger, U.-G.


    Nitrification in aquatic sediments is catalyzed by bacteria. While many autecological studies on these bacteria have been published, few have regarded them as part of the benthic microbial food web. Ciliates are important as grazers on bacteria, but also for remineralization of organic matter. We tested the hypothesis that ciliates can affect nitrification. Experiments with Baltic Sea sediments in laboratory flumes, with or without the addition of cultured ciliates, were conducted. We found i...

  6. Mitochondrial import of only one of three nuclear-encoded glutamine tRNAs in Tetrahymena thermophila.


    Rusconi, C P; Cech, T R


    The mitochondrial genome of Tetrahymena does not appear to encode enough tRNAs to perform mitochondrial protein synthesis. It has therefore been proposed that nuclear-encoded tRNAs are imported into the mitochondria. T.thermophila has three major glutamine tRNAs: tRNA(Gln)(UUG), tRNA(Gln)(UUA) and tRNA(Gln)(CUA). Each of these tRNAs functions in cytosolic translation. However, due to differences between the Tetrahymena nuclear and mitochondrial genetic codes, only tRNA(Gln)(UUG) has the capac...

  7. Fate of pathogenic Bacillus cereus spores after ingestion by protist grazers

    DEFF Research Database (Denmark)

    Winding, Anne; Santos, Susana; Hendriksen, Niels Bohse; Jakobsen, Hans

    evolution of Bacillus cereus group bacteria (e.g. B. cereus, B. anthracis, B. thuringiensis) as a pathogen. It has been hypothesized that the spore stage protects against digestion by predating protists. Indeed, B. thuringiensis spores have been shown to be readily ingested by ciliated protists but failed...... to be digested (Manasherob et al 1998 AEM 64:1750-). Here we report how diverse protist grazers grow on both vegetative cells and spores of B. cereus and how the bacteria survive ingestion and digestion, and even proliferate inside the digestive vacuoles of ciliated protists. The survival ability of...... B. cereus was initially investigated in microcosms inoculated with pure cultures of the protists Acanthamoeba castellanii, Tetrahymena pyriformis and Cercomonas sp. as grazers. Individual protist cultures were fed with fluorescently labelled (CellTracker™RedCMTPX) B. cereus spores or vegetative...

  8. Sequence requirements for self-splicing of the Tetrahymena thermophila pre-ribosomal RNA.


    Price, J V; Kieft, G L; Kent, J R; Sievers, E L; Cech, T R


    The sequence requirements for splicing of the Tetrahymena pre-rRNA have been examined by altering the rRNA gene to produce versions that contain insertions and deletions within the intervening sequence (IVS). The altered genes were transcribed and the RNA tested for self-splicing in vitro. A number of insertions (8-54 nucleotides) at three locations had no effect on self-splicing activity. Two of these insertions, located at a site 5 nucleotides preceding the 3'-end of the IVS, did not alter ...

  9. Sequence comparison of the rDNA introns from six different species of Tetrahymena

    DEFF Research Database (Denmark)

    Nielsen, Henrik; Engberg, J


    We have studied the sequence variation of the rDNA intron among six species of Tetrahymena. From these data, the intron appears to be relatively well conserved in evolution. We have evaluated the sequence variations among the most distant of these species in relation to the secondary structure...... involving compensating base pair changes. Interestingly, one of these is found in a region that is known to be dispensable in the in vitro splicing reaction suggesting differences between the in vivo and in vitro reactions. One of the single nucleotide deletions is found in the so-called "internal guide...

  10. Act together – implications of symbioses in aquatic ciliates

    Directory of Open Access Journals (Sweden)

    Claudia eDziallas


    Full Text Available Mutual interactions in form of symbioses can increase the fitness of organisms and provide them with the capacity to occupy new ecological niches. The formation of obligate symbioses allows for rapid evolution of new life forms including multitrophic consortia. Microbes are important components of many known endosymbioses and their short generation times and strong potential for genetic exchange may be important drivers of speciation. Hosts provide endo- and ectosymbionts with stable, nutrient-rich environments and protection from environmental stresses. This is of particular importance in aquatic ecosystems, which are often highly variable, harsh and nutrient-deficient habitats. Thus it is not surprising that symbioses are widespread in both marine and freshwater environments. Symbioses in aquatic ciliates are good model systems for exploring symbiont-host interactions. Many ciliate species are globally distributed and have been intensively studied in the context of plastid evolution. Their relatively large cell size offers an ideal habitat for numerous microorganisms with different functional traits including commensalism and parasitism. Phagocytosis facilitates the formation of symbiotic relationships, particularly since some ingested microorganisms can escape the digestion. For example, photoautotrophic algae and methanogens represent endosymbionts that greatly extend the biogeochemical functions of their hosts. Consequently, symbiotic relationships between protists and prokaryotes are widespread and often result in new ecological functions of symbiotic communities. This enables ciliates to thrive under a wide range of environmental conditions including ultraoligotrophic or anoxic habitats. We summarize the current understanding of this exciting research topic to identify the many areas in which knowledge is lacking and to stimulate future research by providing an overview on new methodologies and by formulating a number of emerging

  11. Social biases determine spatiotemporal sparseness of ciliate mating heuristics. (United States)

    Clark, Kevin B


    Ciliates become highly social, even displaying animal-like qualities, in the joint presence of aroused conspecifics and nonself mating pheromones. Pheromone detection putatively helps trigger instinctual and learned courtship and dominance displays from which social judgments are made about the availability, compatibility, and fitness representativeness or likelihood of prospective mates and rivals. In earlier studies, I demonstrated the heterotrich Spirostomum ambiguum improves mating competence by effecting preconjugal strategies and inferences in mock social trials via behavioral heuristics built from Hebbian-like associative learning. Heuristics embody serial patterns of socially relevant action that evolve into ordered, topologically invariant computational networks supporting intra- and intermate selection. S. ambiguum employs heuristics to acquire, store, plan, compare, modify, select, and execute sets of mating propaganda. One major adaptive constraint over formation and use of heuristics involves a ciliate's initial subjective bias, responsiveness, or preparedness, as defined by Stevens' Law of subjective stimulus intensity, for perceiving the meaningfulness of mechanical pressures accompanying cell-cell contacts and additional perimating events. This bias controls durations and valences of nonassociative learning, search rates for appropriate mating strategies, potential net reproductive payoffs, levels of social honesty and deception, successful error diagnosis and correction of mating signals, use of insight or analysis to solve mating dilemmas, bioenergetics expenditures, and governance of mating decisions by classical or quantum statistical mechanics. I now report this same social bias also differentially affects the spatiotemporal sparseness, as measured with metric entropy, of ciliate heuristics. Sparseness plays an important role in neural systems through optimizing the specificity, efficiency, and capacity of memory representations. The present

  12. The role of ciliate protozoa in the rumen


    Charles James Newbold; Gabriel ede la Fuente; Alejandro eBelanche; Eva eRamos-Morales; Neil eMcEwan


    First described in 1843, Rumen protozoa with their striking appearance were assumed to be important for the welfare of their host. However, despite contributing up to 50% of the bio-mass in the rumen, the role of protozoa in rumen microbial ecosystem remains unclear.Phylogenetic analysis of 18S rDNA libraries generated from the rumen of cattle, sheep, and goats has revealed an unexpected diversity of ciliated protozoa although variation in gene copy number between species makes it difficult t...


    Institute of Scientific and Technical Information of China (English)

    张武昌; 王荣


    The ciliate community in the Bohai Sea (China) was studied from23 September to 7 October 1998. A hurricane struck the study area between the two grid station investigations, which were six days apart. Six tintinnid species(Favella panamensis, Leptotintinnus nordqvisti, Tintinnopsis butschlii, T. karajacensis, T. Radix and Wangiella dicollaria) were identified. Total cililate abundance in the surface layer ranged from 20 to 770 ind/l. In the first grid investigation, Tintinnopsis karajacensis dominated in the warm, low salinity waters at the Huanghe River mouth. Aloricate ciliate sp.1 dominated in the cold, high salinity waters in the northwest of the study area and the Bohai Strait. In the second grid investigation, T. Karajacensis almost disappeared. The abundance of aloricate ciliate sp.1 decreased drastically. The aloricate ciliate sp.2 dominatedat the Bohai Strait. The change of ciliate abundance may be due to the disturbance of hurricane.``

  14. Community Structure and Biodiversity of Soil Ciliates at Dongzhaigang Mangrove Forest in Hainan Island, China

    International Nuclear Information System (INIS)

    The distribution of soil ciliates in three different habitats within a typical mangrove forest in Dongzhaigang, Hainan, China was investigated. The abundance, biodiversity, and community similarity of ciliates in fresh and air-dried soil with different, physical/chemical properties were analyzed. Three Classes, 11 Orders, 34 Genera, and 70 species of ciliates were found with the first dominant group being Hypotrichida. Ciliate bio diversities followed Site B 42-), but negatively with ph and total potassium (TK). Site A and Site B and Site B and Site C showed the highest similarity in fresh and dried samples, respectively. The ubiquitous characteristics of ciliate distribution suggested their important role in food webs and nutrient cycling. The presence of Colpodida was linked with mangrove plants.

  15. Müllerian-type, cutaneous ciliated cyst in the gluteal cleft mimicking a pilonidal cyst. (United States)

    Oh, Jin Sol; Bhalla, Varun K; Needham, Lance; Sharma, Suash; Pipkin, Walter L; Hatley, Robyn M; Howell, Charles G


    A cutaneous ciliated cyst is a rare entity found predominantly in the lower extremities and perineal region of young females. Although initially described by Hess in 1890, the present day term, "cutaneous ciliated cyst," was proposed by Farmer in 1978 and includes a wide array of cyst types. Despite their typical female predominance and location, many have described cutaneous ciliated cysts in males and atypical locations. In addition, Mullerian cysts in the posterior mediastinum and the retroperitoneum have been reported. To date, only 40 cases have been reported in the literature of a Mullerian-type, cutaneous ciliated cyst. Here, we report a case of 13-year-old female with one in the gluteal cleft, initially presenting as a pilonidal cyst. We also discuss the differential diagnosis of pediatric sacrococcygeal lesions and pathogenesis of a Mullerian-type, cutaneous ciliated cyst. PMID:23913265

  16. Ecological functions of ciliated protozoa in marine ecosystem:effects on accumulation of ambient ammonia

    Institute of Scientific and Technical Information of China (English)

    Xu Henglong; Song Weibo; Zhu Mingzhuang; Wang Mei; Ma Honggang; Hu Xiaozhong


    Effects of ciliated protozoa, Euplotes vannus and Uronema marinum, on accumulation of ammonia in marine waters are detected using experimental ecological method, in order to reveal the contributions and functions of ciliates to the marine ecosystem. During experiments, the concentrations of ammonia-N, and the densities of ciliates and bacteria are measured. The results reveal that ciliates can change the procedure of ammonia accumulation by their grazing activity, and maintain ambient ammonium at low levels through interrupting the stationary phase of bacteria population growth and enhancing their growth and metabolism. The present work confirms that ciliates, as bacteria-predators, play positive roles in maintaining and improving water quality in marine ecosystems, especially in intensive mariculture biotopes.

  17. DYF-1 Is required for assembly of the axoneme in Tetrahymena thermophila. (United States)

    Dave, Drashti; Wloga, Dorota; Sharma, Neeraj; Gaertig, Jacek


    In most cilia, the axoneme can be subdivided into three segments: proximal (the transition zone), middle (with outer doublet microtubules), and distal (with singlet extensions of outer doublet microtubules). How the functionally distinct segments of the axoneme are assembled and maintained is not well understood. DYF-1 is a highly conserved ciliary protein containing tetratricopeptide repeats. In Caenorhabditis elegans, DYF-1 is specifically needed for assembly of the distal segment (G. Ou, O. E. Blacque, J. J. Snow, M. R. Leroux, and J. M. Scholey. Nature. 436:583-587, 2005). We show that Tetrahymena cells lacking an ortholog of DYF-1, Dyf1p, can assemble only extremely short axoneme remnants that have structural defects of diverse natures, including the absence of central pair and outer doublet microtubules and incomplete or absent B tubules on the outer microtubules. Thus, in Tetrahymena, DYF-1 is needed for either assembly or stability of the entire axoneme. Our observations support the conserved function for DYF-1 in axoneme assembly or stability but also show that the consequences of loss of DYF-1 for axoneme segments are organism specific. PMID:19581442

  18. The effects of different fertilizers on the ciliate communities of forests

    International Nuclear Information System (INIS)

    The influence of lime, mineral fertilizers and different composts on the ciliate communities (Protozoa: Ciliophora) of very acidified spruce forests were tested. In succession culture experiments species range, total numbers, abundance and dominance structure of the ciliate communities showed continued changes over a 90 day period. This method offers the opportunity not only to diagnose, but also to quantify effects of soil treatments. Investigations at the ARINUS-site Schluchsee (Black Forest) showed the following results: Liming led to a greater change in the ciliate communities than fertilization with magnesium-sulphate and ammonia-sulphate. Liming and treatment with compost, made from household garbage, and compost, made from chopped wood on the Beimerstetten site (Swabian Alb) led also to remarkably changes in the ciliate communities. The total ciliate numbers of the household garbage area were very low. In contrast, the ciliate community of the chopped wood compost areas were characterized by a great species number and high abundances of spirotrichuous ciliates, especially Halteria grandinella. (orig./UWA)

  19. First report of ciliate (Protozoa) epibionts on deep-sea harpacticoid copepods (United States)

    Sedlacek, Linda; Thistle, David; Fernandez-Leborans, Gregorio; Carman, Kevin R.; Barry, James P.


    We report the first observations of ciliate epibionts on deep-sea, benthic harpacticoid copepods. One ciliate epibiont species belonged to class Karyorelictea, one to subclass Suctoria, and one to subclass Peritrichia. Our samples came from the continental rise off central California (36.709°N, 123.523°W, 3607 m depth). We found that adult harpacticoids carried ciliate epibionts significantly more frequently than did subadult copepodids. The reason for the pattern is unknown, but it may involve differences between adults and subadult copepodids in size or in time spent swimming. We also found that the ciliate epibiont species occurred unusually frequently on the adults of two species of harpacticoid copepod; a third harpacticoid species just failed the significance test. When we ranked the 57 harpacticoid species in our samples in order of abundance, three species identified were, as a group, significantly more abundant than expected by chance if one assumes that the abundance of the group and the presence of ciliate epibionts on them were uncorrelated. High abundance may be among the reasons a harpacticoid species carries a ciliate epibiont species disproportionately frequently. For the combinations of harpacticoid species and ciliate epibiont species identified, we found one in which males and females differed significantly in the proportion that carried epibionts. Such a sex bias has also been reported for shallow-water, calanoid copepods.

  20. Climate scaling behaviour in the dynamics of the marine interstitial ciliate community (United States)

    Varotsos, Costas A.; Mazei, Yuri A.; Burkovsky, Igor; Efstathiou, Maria N.; Tzanis, Chris G.


    The present paper uses characteristics of the marine interstitial ciliate community in the White Sea intertidal sandflat during the period of 1991-2011, in order to study its long-term dynamics, investigating in particular whether it exhibits scaling behaviour into its fluctuations, which is a characteristic feature of the climate system. To this aim, a recently proposed version of the detrended fluctuation analysis is herewith employed which has been successfully applied to a wide range of simulated and physiologic time series in recent years. In case that the fluctuations of the ciliate community present self-similarity processes, an ideal field test for the currently proposed biological models will be established, allowing to evaluate their reliability. Indeed, we show for the first time that different ciliate species exhibit long-range power-law persistent correlations. This means that ciliate fluctuations in different intervals are positively correlated, obeying a power-law behaviour. Although the origin of power-law temporal evolution of ciliates should be further investigated, this finding is probably associated with the self-organized criticality of ciliates. It should be noted that the long-range correlations obtained do not imply the presence of specific cycles but rather the existence of dynamic links between long-term and short-term temporal evolution. The scaling behaviour found in marine interstitial ciliate community should be taken into account in the investigation of their response to the present or future climate change.

  1. Diverse modes of reproduction in the marine free-living ciliate Glauconema trihymene

    Directory of Open Access Journals (Sweden)

    Zufall Rebecca A


    Full Text Available Abstract Background Most free-living ciliates reproduce by equal fission or budding during vegetative growth. In certain ciliates, reproduction occurs inside the cyst wall, viz. reproductive cysts, but more complex reproductive strategies have generally been thought to be confined to parasitic or symbiotic species, e.g. Radiophrya spp. Results In addition to equal fission, asymmetric binary division and reproductive cysts were discovered in the free-living bacterivorous scuticociliate Glauconema trihymene Thompson, 1966. Asymmetric division is an innate physiological state that can be induced by sufficient food, and the higher the food concentration, the longer the asymmetric division persists. During asymmetric division, nuclear and somatic structures divide with transiently arrested cytokinesis and variable positioning of macronuclei. Phylogenetic analysis, based on the small subunit of ribosomal DNA (SSU rDNA sequences, showed that the G. trihymene isolate studied here nests with typical scuticociliates and is paraphyletic to both the symbiotic apostome and astome ciliates, some of which also produce progeny by asymmetric division. Conclusions The asymmetric division in G. trihymene has no precedent among undisturbed free-living ciliates. The coexistence of multiple modes of reproduction may represent a previously undescribed reproductive strategy for ciliates living on food patches in coastal waters. This may also be indicative of similar reproductive strategies among other polyphenic ciliates, which have not been intensively studied. Asymmetric division provides a special opportunity for studying ciliates' phenotypic plasticity and may also illuminate the origins of multicellularity.

  2. An intramolecular recombination mechanism for the formation of the rRNA gene palindrome of Tetrahymena thermophila.


    Butler, D. K.; Yasuda, L E; Yao, M C


    Large palindromic DNAs are found in a wide variety of eukaryotic cells. In Tetrahymena thermophila, a large palindrome is formed from a single rRNA gene (rDNA) during nuclear differentiation. We present evidence that a key step in the formation of the rDNA palindrome of T. thermophila involves homologous intramolecular recombination. Heteroduplex micronuclear rDNA molecules were constructed in vitro and microinjected into developing macronuclei, where they formed palindromes. Analysis of the ...

  3. Ciliated cells in vitamin A-deprived cultured hamster tracheal epithelium do divide

    International Nuclear Information System (INIS)

    The pseudostratified tracheal epithelium, composed of a heterogeneous phenotypically varying cell population, was studied with respect to the in vitro cell proliferative activity of differentiated epithelial cells. Ciliated tracheal epithelial cells so far have been considered to be terminally differentiated, nonproliferating cells. Tracheal organ cultures obtained from vitamin A-deprived Syrian Golden hamsters were cultured in a vitamin A-deficient, serum-free, hormone-supplemented medium. In vitamin A-deprived tracheal epithelium treated with physiologically active all-trans retinol and low cigarette-smoke condensate concentrations it is possible to stimulate the cell proliferation of both basal and columnar cells. Therefore, the probability of finding proliferating columnar cells was increased compared with the in vivo and the vitamin A-deprived situation in which cell proliferative activity is relatively low. In the presence of cigarette-smoke condensate in a noncytotoxic concentration, basal, small mucous granule, ciliated, and indifferent tracheal epithelial cells incorporated [methyl-3H]-thymidine into the DNA during the S phase. The finding that ciliated cells were labeled was supported by serial sections showing the same labeled ciliated cell in two section planes separated by 2 to 3 micron, without labeled epithelial cells next to the ciliated cell. Furthermore, a ciliated tracheal epithelial cell incorporating [methyl-3H]thymidine into DNA was also seen in tracheal cultures of vitamin A-deprived hamsters treated with all-trans retinol in a physiologic concentration

  4. Ciliated protozoa of two antarctic lakes: analysis by quantitative protargol staining and examination of artificial substrates (United States)

    Kepner, R. L. Jr; Wharton, R. A. Jr; Coats, D. W.; Wharton RA, J. r. (Principal Investigator)


    Planktonic and artificial substrate-associated ciliates have been identified in two perennially ice-covered antarctic lakes of the McMurdo Dry Valleys. Abundances estimated by quantitative protargol staining ranged from < 5 to 31690 cells l-1, levels that are comparable to those previously obtained using other methods. Nineteen ciliate taxa were identified from these lakes, with the most frequently encountered genera being Plagiocampa, Askenasia, Monodinium, Sphaerophrya and Vorticella. The taxonomic findings compare favorably with those of previous investigators; however four previously unreported genera were observed in both Lakes Fryxell and Hoare. The variability in the depth distributions of ciliates in Lake Fryxell is explained in terms of lake physicochemical properties and ciliate prey distributions, while factors related to temporal succession in the Lake Hoare assemblage remain unexplained. Local marine or temperate zone freshwater habitats are a more likely source than the surrounding dry valleys soils for present ciliate colonists in these lakes. Although the taxonomic uncertainties require further examination, our results suggest that ciliate populations in these antarctic lakes undergo significant fluctuations and are more diverse than was previously recognized.

  5. Ciliated hepatic foregut cyst in a patient with renal cell carcinoma

    International Nuclear Information System (INIS)

    Ciliated hepatic foregut cyst is a rare condition almost always found incidentally on a computerized tomography scan or at autopsy. Rarely, portal vein compression can be a presenting finding. The cysts are usually unilocular and occur with greater frequency in males. There is a predilection for the left lobe. The cysts average 3 cm in size. We present in this case report a ciliated hepatic foregut cyst found incidentally in the setting of renal carcinoma. The patient was a man known to have a large renal mass, assumed to be cancer, and a liver mass suspicious for metastatic disease. This liver mass was cystic and upon further analysis showed ciliated epithelial lining. We describe the gross and histological appearance, as well as a brief discussion of ciliated hepatic foregut cysts. We report the first case of a patient with coexisting renal cell carcinoma and a ciliated hepatic foregut cyst. While this may represent a coincidental finding, a possibility of a neoplastic or non-neoplastic disorder associated with ciliated hepatic foregut cysts can not be completely ruled out

  6. snRNA and Heterochromatin Formation Are Involved in DNA Excision during Macronuclear Development in Stichotrichous Ciliates


    Juranek, Stefan A.; Rupprecht, Sina; Postberg, Jan; Lipps, Hans J.


    Several models for specific excision of micronucleus-specific DNA sequences during macronuclear development in ciliates exist. While the template-guided recombination model suggests recombination events resulting in specific DNA excision and reordering of macronucleus-destined sequences (MDS) guided by a template, there is evidence that an RNA interference-related mechanism is involved in DNA elimination in holotrichous ciliates. We describe that in the stichotrichous ciliate Stylonychia, snR...

  7. First report of predation of Giardia sp. cysts by ciliated protozoa and confirmation of predation of Cryptosporidium spp. oocysts by ciliate species. (United States)

    Siqueira-Castro, Isabel Cristina Vidal; Greinert-Goulart, Juliane Araújo; Bonatti, Tais Rondello; Yamashiro, Sandra; Franco, Regina Maura Bueno


    Ciliated protozoa are important components of the microbial food web in various habitats, especially aquatic environments. These organisms are useful bioindicators for both environmental quality assessment and the wastewater purification process. The pathogenic parasitic protozoan species Giardia and Cryptosporidium represent a significant concern for human health, being responsible for numerous disease outbreaks worldwide. The predation of cysts and oocysts in 15 ciliate species from water and sewage samples collected in Campinas, São Paulo, Brazil were verified under laboratory conditions. The ciliated protozoan species were selected based on their mode of nutrition, and only bacterivorous and suspension-feeders were considered for the experiments. The species Blepharisma sinuosum, Euplotes aediculatus, Sterkiella cavicola, Oxytricha granulifera, Vorticella infusionum, Spirostomum minus, and Stentor coeruleus ingested cysts and oocysts, the resistance forms of Giardia spp. and Cryptosporidium spp., respectively. This is the first time that the ingestion of Giardia cysts by ciliated protozoa has been reported. These findings may contribute to a better understanding of the biological removal of these pathogens from aquatic environments. PMID:27098881

  8. High cryptic soil ciliate (Ciliophora, Hypotrichida) diversity in Australia. (United States)

    Kumar, Santosh; Foissner, Wilhelm


    The diversity and distribution of soil ciliates from Australia is poorly known. Thus, we studied eight taxa, using the non-flooded Petri dish culture method, live observation, silver impregnation, detailed morphometrics, ontogenesis, and reinvestigation of type slides. At first glance, the Australian taxa looked very similar to described species, however, detailed investigations resulted in the identification of six cryptic species: Afroamphisiella multinucleata minima nov. subspec., Cladotricha similis nov. spec., Erimophrya similis nov. spec., Heterogonostomum salinarum nov. gen., nov. spec., Pseudohemisincirra arabica australiensis nov. subspec., and Pattersoniella (Pattersoniellides) australiensis nov. subgen., nov. spec. This new subgenus is unique among all described hypotrichs in having reduced some anterior paroral dikinetids the fibrillar associates of which are, however, still present. Only two of the eight taxa are possibly cosmopolitans: Apourosomoida halophilaFoissner et al., 2002 and Urosoma karinaeFoissner, 1987. This supports the moderate endemicity model, i.e., that a third of protists have a restricted distribution (Foissner, Chao and Katz 2008). PMID:26844781

  9. Tintinnid ciliates of Amundsen Sea (Antarctica plankton communities

    Directory of Open Access Journals (Sweden)

    John R. Dolan


    Full Text Available The Amundsen Sea has been described as one of the most productive and dynamic pelagic systems in Antarctica and is one of the least studied. Based on samples from 15 stations in the Amundsen Sea, we describe for the first time the composition of the tintinnid ciliate assemblage of the microzooplankton. We compared the species compositions of coastal polynya sites, where the phytoplankton communities are dominated by Phaeocystis, to those of the offshore deep water sites, which are dominated by diatoms. We found a total of 15 species. Polynya sites were dominated by a few species of tintinnids, mostly those endemic to the Southern Ocean. In contrast, the deep-water sites contained many widespread tintinnid species, which are known from a wide variety of systems as well as other areas of the Southern Ocean. We examined polymorphism known to characterize the Antarctic tintinnid species Cymatocylis affinis/convallaria and Codonellopsis gaussi. We found that the types or forms found appeared unrelated to the type of microplankton community, defined by the identity of the dominant phytoplankton taxa. However, the number of different morphotypes found at a site appeared related to the overall concentration of the species, suggesting that different morphologies, previously considered distinct species, may simply be developmental stages.

  10. Ciliate Paramecium is a natural reservoir of Legionella pneumophila (United States)

    Watanabe, Kenta; Nakao, Ryo; Fujishima, Masahiro; Tachibana, Masato; Shimizu, Takashi; Watarai, Masahisa


    Legionella pneumophila, the causative agent of Legionnaires’ disease, replicates within alveolar macrophages and free-living amoebae. However, the lifestyle of L. pneumophila in the environment remains largely unknown. Here we established a novel natural host model of L. pneumophila endosymbiosis using the ciliate Paramecium caudatum. We also identified Legionella endosymbiosis-modulating factor A (LefA), which contributes to the change in life stage from endosymbiosis to host lysis, enabling escape to the environment. We isolated L. pneumophila strains from the environment, and they exhibited cytotoxicity toward P. caudatum and induced host lysis. Acidification of the Legionella-containing vacuole (LCV) was inhibited, and enlarged LCVs including numerous bacteria were observed in P. caudatum infected with L. pneumophila. An isogenic L. pneumophila lefA mutant exhibited decreased cytotoxicity toward P. caudatum and impaired the modification of LCVs, resulting in the establishment of endosymbiosis between them. Our results suggest that L. pneumophila may have a mechanism to switch their endosymbiosis in protistan hosts in the environment.

  11. Origins of learned reciprocity in solitary ciliates searching grouped 'courting' assurances at quantum efficiencies. (United States)

    Clark, Kevin B


    Learning to reciprocate socially valued actions, such as cheating and cooperation, marks evolutionary advances in animal intelligence thought unequalled by even colonial microbes known to secure respective individual or group fitness tradeoffs through genetic and epigenetic processes. However, solitary ciliates, unique among microbes for their emulation of simple Hebbian-like learning contingent upon feedback between behavioral output and vibration-activated mechanosensitive Ca(2+) channels, might be the best candidates to learn to reciprocate necessary preconjugant touches perceived during complex 'courtship rituals'. Testing this hypothesis here with mock social trials involving an ambiguous vibration source, the large heterotrich ciliate Spirostomum ambiguum showed it can indeed learn to modify emitted signals about mating fitness to encourage paired reproduction. Ciliates, improving their signaling expertise with each felt vibration, grouped serial escape strategies gesturing opposite 'courting' assurances of playing 'harder to get' or 'easier to get' into separate, topologically invariant computational networks. Stored strategies formed patterns of action or heuristics with which ciliates performed fast, quantum-like distributed modular searches to guide future replies of specific fitness content. Heuristic-guided searches helped initial inferior repliers, ciliates with high initial reproductive costs, learn to sensitize their behavioral output and opportunistically compete with presumptive mating 'rivals' advertising higher quality fitness. Whereas, initial superior repliers, ciliates with low initial reproductive costs, learned with the aid of heuristics to habituate their behavioral output and sacrifice net reproductive payoffs to cooperate with presumptive 'suitors', a kind of learned altruism only before attributed to animal social intelligences. The present findings confirm that ciliates are highly competent decision makers capable of achieving paired

  12. Involvement of Crawling and Attached Ciliates in the Aggregation of Particles in Wastewater Treatment Plants

    Directory of Open Access Journals (Sweden)

    Lucía Arregui


    Full Text Available The biological community in activated sludge wastewater plants is organized within this ecosystem as bioaggregates or flocs, in which the biotic component is embedded in a complex matrix comprised of extracellular polymeric substances mainly of microbial origin. The aim of this work is to study the role of different floc-associated ciliates commonly reported in wastewater treatment plants-crawling Euplotes and sessile Vorticella- in the formation of aggregates. Flocs, in experiments with ciliates and latex beads, showed more compactation and cohesion among particles than those in the absence of ciliates. Ciliates have been shown to contribute to floc formation through different mechanisms such as the active secretion of polymeric substances (extrusomes, their biological activities (movement and feeding strategies, or the cysts formation capacity of some species. Staining with lectins coupled to fluorescein showed that carbohydrate of the matrix contained glucose, manose, N-acetyl-glucosamine and galactose. Protein fraction revealed over the latex beads surfaces could probably be of bacterial origin, but nucleic acids represented an important fraction of the extracellular polymeric substances of ciliate origin.

  13. Epithelial Cell Culture from Human Adenoids: A Functional Study Model for Ciliated and Secretory Cells

    Directory of Open Access Journals (Sweden)

    Claudia González


    Full Text Available Background. Mucociliary transport (MCT is a defense mechanism of the airway. To study the underlying mechanisms of MCT, we have both developed an experimental model of cultures, from human adenoid tissue of ciliated and secretory cells, and characterized the response to local chemical signals that control ciliary activity and the secretion of respiratory mucins in vitro. Materials and Methods. In ciliated cell cultures, ciliary beat frequency (CBF and intracellular Ca2+ levels were measured in response to ATP, UTP, and adenosine. In secretory cultures, mucin synthesis and secretion were identified by using immunodetection. Mucin content was taken from conditioned medium and analyzed in the presence or absence of UTP. Results. Enriched ciliated cell monolayers and secretory cells were obtained. Ciliated cells showed a basal CBF of 10.7 Hz that increased significantly after exposure to ATP, UTP, or adenosine. Mature secretory cells showed active secretion of granules containing different glycoproteins, including MUC5AC. Conclusion. Culture of ciliated and secretory cells grown from adenoid epithelium is a reproducible and feasible experimental model, in which it is possible to observe ciliary and secretory activities, with a potential use as a model to understand mucociliary transport control mechanisms.

  14. Toxicity of aromatic compounds to Tetrahymena estimated by microcalorimetry and QSAR

    Energy Technology Data Exchange (ETDEWEB)

    Li Xi, E-mail: [Department of Chemistry, School of Science, Wuhan University of Technology, Wuhan 430070 (China); Zhang Tian; Min Xinmin; Liu Peng [Department of Chemistry, School of Science, Wuhan University of Technology, Wuhan 430070 (China)


    The toxicity of six organic aromatic chemicals to Tetrahymena growth metabolism was studied by microcalorimetry. The growth constant k, inhibitory ratio I, and half-inhibiting concentration IC{sub 50} were calculated. The results suggested that the order of toxicity was aniline > nitrobenzene > chlorobenzene > toluene > benzene > phenol. Based on the molecular descriptors, the QSAR equation is obtained by multiple linear regression analysis: log IC{sub 50} = -3.360 - 1.545 E{sub HOMO} - 0.6850 {Delta}E - 0.3019 log K{sub OW} (R = 0.8643, n = 6, s = 0.202, F = 0.739, Sig. = 0.041, R{sub CV}{sup 2}=0.624). The equation indicates that the toxic action is a two-step process: the pass of the chemicals through the cell membrane (described by log K{sub OW}) and the electron-transfer reaction of the chemicals with biomolecules (described by E{sub HOMO} and {Delta}E). The substituents on aromatic ring are crucial to the toxicity of the compounds and the reaction between the chemicals and biological macromolecules is important.

  15. Conjugation in Tetrahymena: Ultrastructure of the meiotic prophase of the micronucleus. (United States)

    Suganuma, Y; Yamamoto, H


    The early conjugation process of Tetrahymena thermopbila was studied with particular attention to the fine structure of the "crescent" micronucleus. The stationary macro- and micronuclei are tied together by the fused outer nuclear membrane. Inside the micronucleus, thick chromatin threads form a dense network. The micronucleus becomes detached from the concavity of the macronucleus and swells and loosened chromatin threads form fine threads. Most threads are gathered together in the center to form a large chromatin body, but some threads remain partly dispersed along the periphery. The micronucleus is elongated by extended microtubules below the nuclear membrane. Chromatin threads that are anchored to structures considered to be precursors of kinetochores (PKI) are present in the area that is proximal to the joint region of a conjugant as well as to the inner nuclear membrane at the distal end. These extend together with the microtubules and become dispersed. The PKIs extend their own microtubles to the proximal end, pulling the chromatin threads back into the distal area. In the fully extended U-shaped micronucleus, PKI-microtubules have disappeared, and kinetochores (KI) are located in the vicinity of the inner nuclear membrane. The chromatin threads have become detached from the KI and have reassembled to form a dense network in the distal area. PMID:23195344

  16. Toxicity of aromatic compounds to Tetrahymena estimated by microcalorimetry and QSAR

    International Nuclear Information System (INIS)

    The toxicity of six organic aromatic chemicals to Tetrahymena growth metabolism was studied by microcalorimetry. The growth constant k, inhibitory ratio I, and half-inhibiting concentration IC50 were calculated. The results suggested that the order of toxicity was aniline > nitrobenzene > chlorobenzene > toluene > benzene > phenol. Based on the molecular descriptors, the QSAR equation is obtained by multiple linear regression analysis: log IC50 = -3.360 - 1.545 EHOMO - 0.6850 ΔE - 0.3019 log KOW (R = 0.8643, n = 6, s = 0.202, F = 0.739, Sig. = 0.041, RCV2=0.624). The equation indicates that the toxic action is a two-step process: the pass of the chemicals through the cell membrane (described by log KOW) and the electron-transfer reaction of the chemicals with biomolecules (described by EHOMO and ΔE). The substituents on aromatic ring are crucial to the toxicity of the compounds and the reaction between the chemicals and biological macromolecules is important.

  17. Quantitative structure-activity relationships for the toxicity of nitrobenzenes to Tetrahymena thermophila. (United States)

    Xu, Jing-Bo; Jing, Ti-Song; Pauli, W; Berger, S


    In this study IGC50 (50% inhibitory growth concentration) values of 26 nitrobenzenes were determined for population growth endpoint of Tetrahymena thermophila. The toxicity order of the observed compounds has been found as follows: dinitro compounds > mono-nitro compounds; dichloronitrobenzenes > monochloronitrobenzenes; and meta-substituted nitrobenzenes > ortho-/para-substituted nitrobenzenes (NT, NPh, NAnis) except for the dinitrobenzenes and nitroanilines (DNB, NAn). Quantitative structure activity relationships (QSARs) were developed using log of the inverse of the IGC50 (logIGC50(-1)) in mole liter as the dependent variable and six molecular descriptors--logP, 1X(V), I, K alpha, sigma sigma- and E(LUMO) as the independent variables. Through multiplicate regression analysis, one best equation was obtained: log IGC50(-1) = 2.93 + 0.830sigma sigma- + 0.350I, n = 26, r = 0.923, r2 = 0.852, s = 0.265, f = 66.4 The equation was used to estimate IGC50 for seven analogues. PMID:12046656

  18. Action of palmatine on Tetrahymena thermophila BF5 growth investigated by microcalorimetry. (United States)

    Kong, Wei-Jun; Zhao, Yan-Ling; Xiao, Xiao-He; Li, Zu-Lun; Ren, Yong-Shen


    Using a thermal activity monitor (TAM) air isothermal microcalorimeter with ampoule mode, the thermo-genic curves of the metabolism of Tetrahymena thermophila BF(5) growth at 28 degrees C were obtained and the action of palmatine on it was investigated. Meanwhile, the biomass change during the process of T. thermophila BF(5) growth coexisted with palmatine was studied by a haemacytometer. The results showed that a low concentration (50 microg/mL) of palmatine began to inhibit the growth of T. thermophila BF(5), and when the concentration of palmatine reached 600 microg/mL, T. thermophila BF(5) could not grow at all. The relationship between the growth rate constant (k) and the concentration c was almost linear with the correlation coefficient of 0.9957, showing the strong toxic action of palmatine on T. thermophila BF(5) growth. The biomass during T. thermophila BF(5) growth decreased obviously by the addition of palmatine at different concentrations. The investigation of biomass agreed well with the results obtained by means of microcalorimetry. PMID:19286310

  19. Ciliated foregut cyst of the gallbladder: a case report and literature review (United States)

    Cho, Jihyoung


    Ciliated foregut cyst of gallbladder is a very rare benign cystic lesion. A 39-year-old woman was referred to our hospital after abdominal ultrasonography revealed a cystic lesion of gallbladder. On abdominal ultrasonography and computed tomography, a unilocular cystic lesion was found at right upper quadrant with attachment to the gallbladder neck. The gallbladder with cystic lesion was resected through laparoscopic cholecystectomy. The cystic lesion revealed a unilocular cyst with ciliated cuboidal or columnar epithelium and abundant goblet cells. Pathologic examination is essential to distinguish from other cystic lesions of the gallbladder and avoid unnecessary additional treatment. In the current case report, we presented the clinico-pathologic findings of the ciliated foregut cyst of the gallbladder and review of literature.

  20. Population dynamics of active and total ciliate populations in arable soil amended with wheat

    DEFF Research Database (Denmark)

    Ekelund, F.; Frederiksen, Helle B.; Ronn, R.


    population may be encysted. The factors governing the dynamics of active and encysted cells in the soil are not well understood. Our objective was to determine the dynamics of active and encysted populations of ciliates during the decomposition of freshly added organic material. We monitored, in soil...... mathematical modeling. Following the addition of fresh organic material, bacterial numbers increased more than 1,400-fold. There was a temporary increase in the number of active ciliates, followed by a rapid decline, although the size of the bacterial prey populations remained high. During this initial burst...

  1. Ciliated Foregut Cyst of the Gallbladder: A Case Report with US and CT Findings

    International Nuclear Information System (INIS)

    A ciliated foregut cyst arising from the gall bladder is very rare with only a few reports to date. In our case, an ultrasonogram (US) showed a well-demarcated hypoechoic mass containing internal hyperechoic material in the fundus of the gallbladder. The CT scans showed a poorly enhancing round soft tissue mass in the gallbladder wall lined by an enhancing intact mucosal layer. We report here on a very rare form of the ciliated foregut cyst arising from the gall bladder including ultrasound and CT image results

  2. Ciliated Foregut Cyst of the Gallbladder: A Case Report with US and CT Findings

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jun Ho; Jeon, Yong Sun; Lee, Jung Il; Han, Jee Young; Lee, Kyung Hee; Cho, Soon Gu [Inha University Hospital, Incheon (Korea, Republic of)


    A ciliated foregut cyst arising from the gall bladder is very rare with only a few reports to date. In our case, an ultrasonogram (US) showed a well-demarcated hypoechoic mass containing internal hyperechoic material in the fundus of the gallbladder. The CT scans showed a poorly enhancing round soft tissue mass in the gallbladder wall lined by an enhancing intact mucosal layer. We report here on a very rare form of the ciliated foregut cyst arising from the gall bladder including ultrasound and CT image results.

  3. Taxonomic list of ciliated protist (Protozoa: Ciliophora in Cojimar river, Havana, Cuba

    Directory of Open Access Journals (Sweden)

    Isabel de la Caridad Ymas González


    Full Text Available The taxonomic composition of ciliated protozoan’s communities from Cojimar river (Havana city was determinated, over the study period. Samples were collected from six stations located along the river. The samples were cultured in Petri dishes and were main-tained in environmental temperature and natural ilumination. Species identification was made taking into account morphological characters and Levine’s et al.(1980 taxonomic classification was used. It were identified 49 species of ciliated protozoans, which are the first records for the locality. The species are distri-buted in three classes, ten orders, eighteen families and twenty-six genera.

  4. Hyperparasitism of trichodinid ciliates on monogenean gill flukes of two marine fish. (United States)

    Colorni, A; Diamant, A


    Two unusual cases of hyperparasitism of trichodinid ciliates on monogenean gill flukes are described from southern Israel (Red Sea). The first case occurred in cultured European sea bass Dicentrarchus labrax infected by Diplectanum aequans, while the second was observed in a feral devil firefish Pterois miles infected by Haliotrema sp. In both cases, the trichodinids heavily co-infested the host fish gills. The flukes were completely coated by the ciliates, which gave them a cobblestone appearance, but no damage to their tegument was apparent. Both cases are most likely a result of accidental hyperparasitism, brought about by perturbed environmental conditions. PMID:16060271

  5. Radiation chemistry of liquor: Pt. 4

    International Nuclear Information System (INIS)

    The effect of the concentrate of liquor made from dried sweet potato on the proliferation of tetrahymena pyriformis has been studied. The toxicity of d-2,3-butanediol and ethanol have also been investigated by the tetrahymena pyriformis and it has been found that they did not produce the effect on the propagation of the cell up to 250 and 1000 ppm, separately. The unirradiated concentrate of the different batch liquors all appear more or less inhibition on the proliferation of tetrahymena pyriformis. The effect is more remarkable for the concentrate of the irradiated liquors and is strengthened as increase of adsorbed dose. It shows that the toxicity of the concentrate of the irradiated liquor to tetrahymena pyriformis may be related to the quality of the dried sweet potato used and the formation of radiolytic products with higher boiling point

  6. ATP-binding cassette transporter enhances tolerance to DDT in Tetrahymena. (United States)

    Ning, YingZhi; Dang, Huai; Liu, GuangLong; Xiong, Jie; Yuan, DongXia; Feng, LiFang; Miao, Wei


    The reuse of dichlorodiphenyltrichloroethane (DDT) as an indoor residual spray was permitted by the World Health Organization in 2007, and approximately 14 countries still use DDT to control disease vectors. The extensive exposure of insects to DDT has resulted in the emergence of DDT resistance, especially in mosquitoes, and the mechanism for this resistance in mosquitoes has been widely reported. Spraying can also introduce DDT directly into surface water, and DDT can subsequently accumulate in microorganisms, but the mechanism for the resistance to DDT degradation in microorganisms is unclear. Using whole-genome microarray analysis, we detected an abcb15 gene that was up-regulated in a specific manner by DDT treatment in T. thermophile. The deduced ABCB15 peptide sequence had two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs) to form the structure TMD-NBD-TMD-NBD, and each NBD contained three conserved motifs: Walker-A, C-loop, and Walker-B, which indicated the T. thermophila abcb15 was a typical ABC transporter gene. The expression of ABCB15 fused with a C-terminal green fluorescent protein was found to be on the periphery of the cell, suggesting that ABCB15 was a membrane pump protein. In addition, cells with abcb15 partially knocked down (abcb15-KD) grew slower than wild-type cells in the presence of 256 mg L(-1) DDT, indicating the tolerance of abcb15-KD strain to DDT exposure was decreased. Thus, we suggest that in Tetrahymena, the membrane pump protein encoded by ABCT gene abcb15 can enhance the tolerance to DDT and protect cells from this exogenous toxin by efficiently pumping it to the extracellular space. PMID:25260902

  7. 8-Methoxypsoralen DNA interstrand cross-linking of the ribosomal RNA genes in Tetrahymena thermophila. Distribution, repair and effect on rRNA synthesis

    DEFF Research Database (Denmark)

    Fengquin, X; Nielsen, Henrik; Zhen, W;


    The distribution and repair of 8-methoxypsoralen-DNA interstrand cross-links in the ribosomal RNA genes (rDNA) in Tetrahymena thermophila have been studied in vivo by Southern blot analysis. It is found that the cross-links at a density of < or = 1/2 x 10(4) base pairs (bp) are distributed equall...

  8. Microcalorimetric Investigation of Influence of Fungicide SYP-L190 on Growth Metabolism of Tetrahymena thermophila and Bacillus thuringiensis

    Institute of Scientific and Technical Information of China (English)

    LI Hui-Rong; KU Zong-Jun; QIN Cai-Qin; ZHANG Zhong-Hai; LIU Yi


    Flumorph (SYP-L190) is a new systemic fungicide with good protective,curative and antisporulant activities but no phytotoxicity to certain plants.Its performance on the environmental ecosystem is unknown.Tetrahymena thermophila and Bacillus thuringiensis are two of biological indicators for the aquatic and soil environmental ecosystem respectively.Microcalorimetric technique based on the heat output was applied to evaluate the influence of fungicide flumorph (SYP-L190) on the two microorganisms.The thermogenic curves and corresponding thermodynamic and thermokinetic parameters were obtained.SYP-L 190 at a concentration of 50-100 μg·mL-1 had 5%-10% inhibitory ratios aganist Tetrahymena thermophila and was used as a protection reagent,while at a concentration of 100-200 μg·mL-1 SYP-L190 had 10%-20% inhibitory ratios and was used as a therapy reagent.The metabolic thermogenic curves of Bacillus thuringiensis contained bacterial growth phase and sporulation phase.The SYP-L190 at a concentration of 0-200 μg·mL-1 had no influence on bacterial growth phase,but led to a little lag of the sporulation phase with a constant heat output.Hormesis was obviously observed in present study.

  9. Isolation and in vitro cultivation of the fibrolytic rumen ciliate Eremoplastron (Eudiplodinium) dilobum. (United States)

    Miltko, Renata; Pietrzak, Marta; Bełżecki, Grzegorz; Wereszka, Krzysztof; Michałowski, Tadeusz; Hackstein, Johannes H P


    The rumen ciliate Eremoplastron dilobum was isolated from sheep rumen fluid and cultivated in vitro as a species population. Four different salt solutions were used to prepare the culture media. However, only the "Artificial rumen fluid" composed of (g/L): K2HPO4-3.48, NaHCO3-2.1, NaCl-0.76, CaCl2×6H2O-0.33, CH3COONa-6.12, MgCl2×6H2O-0.3, Na2HPO4-1.71, NaHPO4×H2O-1.01 and distilled water enabled cultivation of this species for over 56 weeks. The protozoa were able to grow in a medium consisting of culture salt solution and powdered meadow hay (0.6mg/ml per d). The addition of wheat gluten did not increase the population density of E. dilobum whereas the supplemented crystalline cellulose and/or barley flour improved the growth of ciliates (Pdensity of the ciliate population. The recommended food consisted of meadow hay, wheat gluten, crystalline cellulose and barley flour when supplied in the proportions of 0.6, 0.16, 0.12 and 0.12mg/mL per day. We observed morphological variation of the ciliates, involving partial or complete reduction of the caudal lobes. PMID:25660229

  10. Ciliated Adenosquamous Carcinoma: Expanding the Phenotypic Diversity of Human Papillomavirus-Associated Tumors. (United States)

    Radkay-Gonzalez, Lisa; Faquin, William; McHugh, Jonathan B; Lewis, James S; Tuluc, Madalina; Seethala, Raja R


    This study describes a unique subset of ciliated, human papillomavirus (HPV) related, adenosquamous carcinomas (AsqCA) of the head and neck that in contrast to most AsqCA, often show areas with lower grade cytonuclear features. They are comprised of largely non-keratinizing squamous cell carcinoma components with cystic change, gland formation, mucin production, and cilia in tumor cells. Seven cases of ciliated AsqCA were retrieved. Site distribution was as follows: palatine tonsil-3/7, base of tongue-1/7, and neck (unknown primary site)-3/7. Despite the occasional resemblance to mucoepidermoid carcinoma (MEC), the tumors showed focal keratinizing morphology and atypia, and all tumors were negative for MAML2 rearrangements. Oropharyngeal and neck tumors were uniformly p16 positive and showed punctate staining by in situ hybridization for high risk HPV DNA. There were two distant metastases (lung), and one tumor related death. Thus, ciliated AsqCA are HPV-associated lesions that pose unique pitfalls, closely mimicking MEC and other salivary gland tumors. These tumors add to the list of those which defy the dogma that ciliated epithelium always equates to a benign process. PMID:26411881

  11. Modeling the distribution of ciliate protozoa in the reticulo-rumen using linear programming

    NARCIS (Netherlands)

    Hook, S.E.; Dijkstra, J.; Wright, A.G.; McBride, B.W.; France, J.


    The flow of ciliate protozoa from the reticulo-rumen is significantly less than expected given the total density of rumen protozoa present. To maintain their numbers in the reticulo-rumen, protozoa can be selectively retained through association with feed particles and the rumen wall. Few mathematic

  12. Ciliates and their picophytoplankton-feeding activity in a high altitude warm-monomictic saline lake

    Czech Academy of Sciences Publication Activity Database

    Peštová, D.; Macek, Miroslav; Pérez, M. E. M.


    Roč. 44, č. 1 (2008), s. 13-25. ISSN 0932-4739 Institutional research plan: CEZ:AV0Z60170517 Keywords : ciliates * autotrophic picoplankton * feeding rates Subject RIV: EH - Ecology, Behaviour Impact factor: 1.000, year: 2008

  13. Ciliated muconodular papillary tumors of the lung: a clinicopathologic analysis of 10 cases. (United States)

    Kamata, Tsugumasa; Yoshida, Akihiko; Kosuge, Tomoo; Watanabe, Shun-Ichi; Asamura, Hisao; Tsuta, Koji


    Ciliated muconodular papillary tumors (CMPTs) are rare peripheral nodules of the lung first described in 2002. Because of their rarity and nonstandardized diagnostic terminology, CMPTs have been poorly recognized among pathologists. To better characterize these lesions, we undertook a detailed clinicopathologic and immunohistochemical study of 10 archival cases. Ten CMPTs occurred in 7 men and 3 women with a median age of 62 years. All were small peripheral nonendobronchial nodules with a mean diameter of 1.0 cm. All but 1 tumor were incidentally detected by computed tomography-based screening, all of which were radiologically interpreted as adenocarcinomas. Although limited surgery treated all but 1 CMPT, they followed a benign course with no recurrence at a mean follow-up of 43 months (range: 2 to 88 mo). Histologically, CMPTs showed glandular and/or papillary architecture, comprising a vaguely organized mixture of nonatypical ciliated columnar cells, mucous cells, and basal cells, often enveloped by copious intra-alveolar mucin. Micropapillary tufts of ciliated cells and seemingly discontinuous growth along alveolar walls were occasionally present, mimicking adenocarcinomas. Ciliated cells and basal cells were immunopositive for TTF-1 and p40, respectively, whereas mucous cells lacked HNF4α expression. CMPTs are rare, likely benign, underrecognized processes of the lung that should be distinguished from adenocarcinomas. PMID:25803171

  14. Multiple genes of apparent algal origin suggest ciliates may once have been photosynthetic


    Reyes-Prieto, Adrian; Moustafa, Ahmed; Bhattacharya, Debashish


    Plantae (sensu Cavalier-Smith 1981) [1] plastids evolved via primary endosymbiosis whereby a heterotrophic protist enslaved a photosynthetic cyanobacterium. This 'primary' plastid spread into other eukaryotes via secondary endosymbiosis. An important but contentious theory in algal evolution is the chromalveolate hypothesis that posits chromists (cryptophytes, haptophytes, and stramenopiles) and alveolates (ciliates, apicomplexans, and dinoflagellates) share a common ancestor that contained a...

  15. Bottom-up versus top-down effects on ciliate community composition in four eutrophic lakes (China). (United States)

    Li, Jing; Chen, Feizhou; Liu, Zhengwen; Zhao, Xiuxia; Yang, Kun; Lu, Wenxuan; Cui, Kai


    Previous studies have shown that ciliate plankton is generally controlled by food resources (e.g., algae) and predators (e.g., metazooplankton). Among lakes with similar trophic levels but different distributions of phyto- and metazooplankton, the main forces acting on ciliate assemblages may be different. We investigated the relationship between ciliate communities and bottom-up versus top-down variables based on a survey of four subtropical eutrophic lakes (China). Two of the lakes (Chaohu, Taihu) are located on the Mid-lower Yangtze Plain near sea level, and the other two (Dianchi, Xingyunhu) on the Yunnan-Kweichow Plateau at 1700m above sea level. Blooms of cyanobacteria developed during summer in Lakes Chaohu and Taihu and throughout the year in Lakes Dianchi and Xingyunhu. Ciliate functional feeding groups differed significantly between lakes. The results of canonical correspondence analysis (CCA) and variation partitioning showed that cyanobacteria significantly influence ciliate species, whereas 'edible' algae (cryptophytes, diatoms) and cladocerans were the important variables in explaining the ciliate community structure of Lakes Dianchi and Xingyunhu compared with Lakes Taihu and Chaohu. Our results highlight the importance of consistent cyanobacterial blooms in shaping the ciliate community in subtropical eutrophic shallow lakes by interacting with top-down and bottom-up factors. PMID:26773905

  16. Bose-Einstein condensates form in heuristics learned by ciliates deciding to signal 'social' commitments. (United States)

    Clark, Kevin B


    Fringe quantum biology theories often adopt the concept of Bose-Einstein condensation when explaining how consciousness, emotion, perception, learning, and reasoning emerge from operations of intact animal nervous systems and other computational media. However, controversial empirical evidence and mathematical formalism concerning decoherence rates of bioprocesses keep these frameworks from satisfactorily accounting for the physical nature of cognitive-like events. This study, inspired by the discovery that preferential attachment rules computed by complex technological networks obey Bose-Einstein statistics, is the first rigorous attempt to examine whether analogues of Bose-Einstein condensation precipitate learned decision making in live biological systems as bioenergetics optimization predicts. By exploiting the ciliate Spirostomum ambiguum's capacity to learn and store behavioral strategies advertising mating availability into heuristics of topologically invariant computational networks, three distinct phases of strategy use were found to map onto statistical distributions described by Bose-Einstein, Fermi-Dirac, and classical Maxwell-Boltzmann behavior. Ciliates that sensitized or habituated signaling patterns to emit brief periods of either deceptive 'harder-to-get' or altruistic 'easier-to-get' serial escape reactions began testing condensed on initially perceived fittest 'courting' solutions. When these ciliates switched from their first strategy choices, Bose-Einstein condensation of strategy use abruptly dissipated into a Maxwell-Boltzmann computational phase no longer dominated by a single fittest strategy. Recursive trial-and-error strategy searches annealed strategy use back into a condensed phase consistent with performance optimization. 'Social' decisions performed by ciliates showing no nonassociative learning were largely governed by Fermi-Dirac statistics, resulting in degenerate distributions of strategy choices. These findings corroborate

  17. Refined annotation and assembly of the Tetrahymena thermophila genome sequence through EST analysis, comparative genomic hybridization, and targeted gap closure

    Directory of Open Access Journals (Sweden)

    Lee Suzanne R


    Full Text Available Abstract Background Tetrahymena thermophila, a widely studied model for cellular and molecular biology, is a binucleated single-celled organism with a germline micronucleus (MIC and somatic macronucleus (MAC. The recent draft MAC genome assembly revealed low sequence repetitiveness, a result of the epigenetic removal of invasive DNA elements found only in the MIC genome. Such low repetitiveness makes complete closure of the MAC genome a feasible goal, which to achieve would require standard closure methods as well as removal of minor MIC contamination of the MAC genome assembly. Highly accurate preliminary annotation of Tetrahymena's coding potential was hindered by the lack of both comparative genomic sequence information from close relatives and significant amounts of cDNA evidence, thus limiting the value of the genomic information and also leaving unanswered certain questions, such as the frequency of alternative splicing. Results We addressed the problem of MIC contamination using comparative genomic hybridization with purified MIC and MAC DNA probes against a whole genome oligonucleotide microarray, allowing the identification of 763 genome scaffolds likely to contain MIC-limited DNA sequences. We also employed standard genome closure methods to essentially finish over 60% of the MAC genome. For the improvement of annotation, we have sequenced and analyzed over 60,000 verified EST reads from a variety of cellular growth and development conditions. Using this EST evidence, a combination of automated and manual reannotation efforts led to updates that affect 16% of the current protein-coding gene models. By comparing EST abundance, many genes showing apparent differential expression between these conditions were identified. Rare instances of alternative splicing and uses of the non-standard amino acid selenocysteine were also identified. Conclusion We report here significant progress in genome closure and reannotation of Tetrahymena

  18. Colonization of periphytic ciliated protozoa on an artificial substrate in mariculture waters with notes on responses to environmental factors

    Institute of Scientific and Technical Information of China (English)

    Jiqiu Li; Henglong Xu; Xiaofeng Lin; Weibo Song


    Colonization of periphytic ciliates and their usefulness for monitoring water quality were evaluated using the glass slide method in two enclosed mariculture ponds used to culture crab larva and in a natural seawater reservoir. The results revealed that (1) the ciliate species composition and colonizing process differed between the culturing ponds and the natural reservoir and (2) the dominant ciliate species showed a greater distribution in terms of both the abundance and the occurrence frequency. This study also demonstrated that structural parameters were strongly related to water conditions. For example, the abundance was positively associated with NO-3-N and soluble reactive phosphate (P < 0.05), whereas the species number, species diversity and evenness were negatively correlated with nutrients (e.g. NO-3N and NH3-N) and temperature (P < 0.05). These findings support the evidence that periphytic ciliates are useful bioindicators of water quality in enclosed mariculture ecosystems.

  19. Marine ciliate community in relation to eutrophication of coastal waters in the Yellow Sea

    Institute of Scientific and Technical Information of China (English)

    XU Kuidong; CHOI Joong Ki; LEI Yanli; YANG Eun Jin


    We assessed the potential of marine ciliate community as an indicator to coastal water quality using water samples collected from four stations in the Yellow Sea in the summer 2000. The four stations were characterized by different levels of pollution. The ciliate communities consisted primarily of tintinnids and aloricate ciliates that were <30 μm. A total of 78 species were classified: 55 species at Station 2, 51 species each at Stations 1 and 4, and 47 species at Station 3. The mean number of species at each site was 29.2±2.0 (Station 1), 28.5±2.9 (Station 2), 27.8±1.7 (Station 3), and 24.5±2.3 (Station 4). The abundance was highly variable: 19 331±11 187 ind./L at Station 1, 7 960±5 639 ind./L at Station 2, 29 015± 12 999 ind./L at Station 3, and 8 190±4 658 ind./L at Station 4. Our results suggest that neither the simple chemical analysis (e.g. chemical oxygen demand, dissolved inorganic nitrogen, and phosphate) nor the eutrophication/pollution index adequately described the water quality at the four stations. The same was true of the number of species and their abundance, both of which had no correlation with the chemical indices. In contrast, Margalef's diversity index values (3.12 at Station 2, 2.89 at Station 1, and 2.64 at Stations 3 and 4) generally discriminated the water quality status of the four stations. The difference in water quality among the stations was strongly supported by the pattern of species richness (i.e. the total number of species) of ciliates at each station. Our evaluation was consistent with the results of long-term water quality monitoring at the four stations. With increasing eutrophication, we observed also a compositional and functional shift in the ciliate assemblages from algivorous oligotrich/choreotrich to nonselective-omnivorous gymnostomatids to bacterivorous-detrivorous scuticociliatids. Thus, ciliates may be used to indicate the coastal water quality status of a given site.

  20. Inter-annual ciliate distribution variation within the late stratification oxycline in a monomictic lake, Lake Alchichica (Mexico)


    Ximena Sánchez Medina; Miroslav Macek; Fernando Bautista-Reyes; Andrea Perz; Patricia Bonilla Lemus; Mario Chávez Arteaga


    noxia, and ciliates might play a very important role in the plankton community budget there. We analysed changes in the composition and biomass of the ciliate assemblage and other microbial loop components throughout the oxycline just at the end of stratification in a warm-monomictic lake, Lake Alchichica, Mexico (four samplings: 2006-2008, 2010); the results were compared with those obtained from another lake from the region, La Preciosa, sampled in 2010. Bacteria, autotrophic picoplankton (...

  1. The coupling of oligotrich ciliate populations and hydrography in the East China Sea: spatial and temporal variations (United States)

    Chiang, Kuo-Ping; Lin, Chiu-Yi; Lee, Chung-Hsien; Shiah, Fuh-Kwo; Chang, Jeng


    Variations in the spatial and temporal distribution of oligotrich ciliate populations in the East China Sea were investigated during four cruises of the R/V Ocean Researcher I between December 1997 and October 1998. Over the entire continental shelf, a seasonal cycle was found with a distinct 3-5-fold increase in the abundance of oligotrich ciliates in summer. This increase appeared to be induced by the tremendous summertime runoff from the Changjiang. A radial-type spatial distribution pattern also was observed in summer, with population densities higher toward the Changjiang plume but highest of all in the margins of the plume. In spring and fall, the spatial distribution of the oligotrich ciliates was closely correlated to the abundance of cyanobacterium Synechococcus. In summer in the plume region, mixotrophic ciliates accounted for over 50% of the total ciliate population, compared to less than 30% outside the plume or that in other seasons. We propose a model in which these ciliates constitute part of the pathway through which the particulate and dissolved organic carbon in the runoff water is incorporated into the oceanic food web.

  2. Preparation and biological effect of nucleotide-capped CdSe/ZnS quantum dots on Tetrahymena thermophila. (United States)

    Xiao, Qi; Qiu, Ting; Huang, Shan; Liu, Yi; He, Zhike


    In this paper, we described the preparation and characterization of different types of modified CdSe/ZnS quantum dots (QDs) and explored the biological effects of QDs with different surface modifications on the whole growth of unicellular protozoan Tetrahymena thermophila BF(5) using a thermal activity monitor air isothermal microcalorimeter. Our results demonstrated that adenosine 5'-monophosphate (AMP) showed stronger interaction with QDs than other types of nucleotide. AMP-QDs could stimulate the growth of T. thermophila while mercaptoacetic acid-capped CdSe/ZnS quantum dots inhibited it. In addition, the population density determination and fluorescence imaging of T. thermophila BF(5) also confirmed the results obtained from microcalorimetry. It is believed that this approach will provide a more convenient methodology for the kinetics and thermodynamics of microorganism when coexisting with QDs in real time, and all of which are very significant to understanding the effect of QDs to organism. PMID:22161288

  3. Sulfide assimilation by ectosymbionts of the sessile ciliate, Zoothamnium niveum

    DEFF Research Database (Denmark)

    Røy, Hans; Vopel, Kay; Huettel, Marcus;


    We investigated the constraints on sulfide uptake by bacterial ectosymbionts on the marine peritrich ciliate Zoothamnium niveum by a combination of experimental and numerical methods. Protists with symbionts were collected on large blocks of mangrove-peat. The blocks were placed in a flow cell wi...... filtering organs. Electronic supplementary material  The online version of this article (doi: 10.1007/s00227-008-1117-6 ) contains supplementary material, which is available to authorized users.......We investigated the constraints on sulfide uptake by bacterial ectosymbionts on the marine peritrich ciliate Zoothamnium niveum by a combination of experimental and numerical methods. Protists with symbionts were collected on large blocks of mangrove-peat. The blocks were placed in a flow cell with...



    Juranek, Stefan; Jonsson, Franziska; Maercker, Christian; Lipps, Hans


    While the telomeres of higher eukaryotic cells show heterogenity in their length no such length heterogenity is observed in the macronuclear DNA of hypotrichous ciliates. Since the analysis of the telomere structure of replicating DNA molecules might give an insight in the mechanisms of telomere length regulation Stylonychia cell cultures were synchronized, the replicating DNA was labeled with BrdU and isolated by immuno-precipitation. The 3as well as the 5-end of these replicating DNA was la...

  5. Bioassay of genotoxic effects of environmental particles in a feeding ciliate.


    Smith-Sonneborn, J; Palizzi, R A; McCann, E A; Fisher, G L


    The ciliated protozoan, Paramecium, can be used to quantitate cytotoxic and genotoxic effects of ingested complex environmental particles. Cytotoxicity is quantitated by the increased proportion of treated versus control cells which do not retain their capacity for normal cell replication. Genotoxic effects are assessed by the increased fraction of nonviable offspring from treated versus control parent cells after the self-fertilization process of autogamy. Since these cells ingest nonnutrien...

  6. Ciliates learn to diagnose and correct classical error syndromes in mating strategies

    Directory of Open Access Journals (Sweden)

    Kevin Bradley Clark


    Full Text Available Preconjugal ciliates learn classical repetition error-correction codes to safeguard mating messages and replies from corruption by rivals and local ambient noise. Because individual cells behave as memory channels with Szilárd engine attributes, these coding schemes also might be used to limit, diagnose, and correct mating-signal errors due to noisy intracellular information processing. The present study, therefore, assessed whether heterotrich ciliates effect fault-tolerant signal planning and execution by modifying engine performance, and consequently entropy content of codes, during mock cell-cell communication. Socially meaningful serial vibrations emitted from an ambiguous artificial source initiated ciliate behavioral signaling performances known to advertise mating fitness with varying courtship strategies. Microbes, employing calcium-dependent Hebbian-like decision making, learned to diagnose then correct error syndromes by recursively matching Boltzmann entropies between signal planning and execution stages via power or refrigeration cycles. All eight serial contraction and reversal strategies incurred errors in entropy magnitude by the execution stage of processing. Absolute errors, however, subtended expected threshold values for single bit-flip errors in three-bit replies, indicating coding schemes protected information content throughout signal production. Ciliate preparedness for vibrations selectively and significantly affected the magnitude and valence of Szilárd engine performance during modal and nonmodal strategy corrective cycles. But entropy fidelity for all replies mainly improved across learning trials as refinements in engine efficiency. Fidelity neared maximum levels for only modal signals coded in resilient three-bit repetition error-correction sequences. Together, these findings demonstrate microbes can elevate survival/reproductive success by learning to implement classical fault-tolerant information processing in

  7. Propulsion of swimming microrobots inspired by metachronal waves in ciliates: from biology to material specifications


    Palagi, Stefano; Jager, Edwin; Mazzolai, Barbara; Beccai, Lucia


    The quest for swimming microrobots originates from possible applications in medicine, especially involving navigation in bodily fluids. Swimming microorganisms have become a source of inspiration because their propulsion mechanisms are effective in the low-Reynolds number regime. In this study, we address a propulsion mechanism inspired by metachronal waves, i.e. the spontaneous coordination of cilia leading to the fast swimming of ciliates. We analyse the biological mechanism (referring to i...

  8. Taxonomic list of ciliated protist (Protozoa: Ciliophora) in Cojimar river, Havana, Cuba


    Isabel de la Caridad Ymas González; Dania Prieto Trueba


    The taxonomic composition of ciliated protozoan’s communities from Cojimar river (Havana city) was determinated, over the study period. Samples were collected from six stations located along the river. The samples were cultured in Petri dishes and were main-tained in environmental temperature and natural ilumination. Species identification was made taking into account morphological characters and Levine’s et al.(1980) taxonomic classification was used. It were identified 49 sp...

  9. Mutagenicity of the organic compounds in the pond water with Cl2 evaluated with tricocyst test of Tetrahymena pyriformis%应用四膜虫刺泡发射评价加氯水体中有机浓集物的致突变性

    Institute of Scientific and Technical Information of China (English)

    吴伟; 胡庚东; 火村英; 瞿建宏; 章敏



  10. Myosin Id is required for planar cell polarity in ciliated tracheal and ependymal epithelial cells. (United States)

    Hegan, Peter S; Ostertag, Eric; Geurts, Aron M; Mooseker, Mark S


    In wild type (WT) tracheal epithelial cells, ciliary basal bodies are oriented such that all cilia on the cell surface beat in the same upward direction. This precise alignment of basal bodies and, as a result, the ciliary axoneme, is termed rotational planar cell polarity (PCP). Rotational PCP in the multi-ciliated epithelial cells of the trachea is perturbed in rats lacking myosin Id (Myo1d). Myo1d is localized in the F-actin and basal body rich subapical cortex of the ciliated tracheal epithelial cell. Scanning and transmission electron microscopy of Myo1d knock out (KO) trachea revealed that the unidirectional bending pattern is disrupted. Instead, cilia splay out in a disordered, often radial pattern. Measurement of the alignment axis of the central pair axonemal microtubules was much more variable in the KO, another indicator that rotational PCP is perturbed. The asymmetric localization of the PCP core protein Vangl1 is lost. Both the velocity and linearity of cilia-driven movement of beads above the tracheal mucosal surface was impaired in the Myo1d KO. Multi-ciliated brain ependymal epithelial cells exhibit a second form of PCP termed translational PCP in which basal bodies and attached cilia are clustered at the anterior side of the cell. The precise asymmetric clustering of cilia is disrupted in the ependymal cells of the Myo1d KO rat. While basal body clustering is maintained, left-right positioning of the clusters is lost. PMID:26446290

  11. Methods for the cultivation of ciliated protozoa from the large intestine of horses. (United States)

    Bełżecki, Grzegorz; Miltko, Renata; Michałowski, Tadeusz; McEwan, Neil R


    This paper describes cultivation methods for ciliates from the digestive tract of horses. Members of three different genera were successfully grown in vitro for short periods of time. However, only cells belonging to the genus Blepharocorys, which resides in the horse's large intestine, were maintained for longer periods. This Blepharocorys culture was successfully grown in vitro after inoculation of freshly excreted horse faeces in culture medium containing a population of bacteria. The ciliates survived for over six months, and the density of their population varied between 1.7 × 10(3) and 2.4 × 10(3) cells mL(-1). Favourable conditions for the prolonged cultivation of this ciliate were observed when the medium was prepared by mixing horse faeces and 'caudatum' salt solution in a 1:1 V/V ratio together with food (60% powdered meadow hay, 16% wheat gluten, 12% barley flour and 12% microcrystalline cellulose) supplied as 0.20 mg mL(-1) culture per day. PMID:26684192

  12. Ciliated foregut cyst in the triangle of Calot: the first report. (United States)

    Al Beteddini, Osama S; Amra, Nasir K; Sherkawi, Emad


    Ciliated foregut cysts are rare anomalies arising from remnants of aberrant embryological development. Around 100 reports on the presence of these congenital masses in the tracheobronchial tree, mediastinum, liver, pancreas and, rarely, the gallbladder have been described. In this article, the case of a 33-year-old woman, who was operated for a laparoscopic cholecystectomy, is presented. During the dissection of the triangle of Calot, a cystic mass, attached to the common hepatic duct, was discovered incidentally. This cyst was dissected off the hepatic duct, and no communication between both structures was found. The histopathological diagnosis was consistent with a ciliated foregut cyst. The postoperative course was uneventful. After reviewing the literature on this pathological entity, we found that this is the first report of a ciliated foregut cyst that is located in the triangle of Calot and found separate from the biliary structures, the gallbladder and the liver. We present a review of the literature on this entity, discussing diagnostic measures and therapeutic options. PMID:26943696

  13. Declines in both redundant and trace species characterize the latitudinal diversity gradient in tintinnid ciliates. (United States)

    Dolan, John R; Yang, Eun Jin; Kang, Sung-Ho; Rhee, Tae Siek


    The latitudinal diversity gradient is a well-known biogeographic pattern. However, rarely considered is how a cline in species richness may be reflected in the characteristics of species assemblages. Fewer species may equal fewer distinct ecological types, or declines in redundancy (species functionally similar to one another) or fewer trace species, those occurring in very low concentrations. We focused on tintinnid ciliates of the microzooplankton in which the ciliate cell is housed inside a species-specific lorica or shell. The size of lorica oral aperture, the lorica oral diameter (LOD), is correlated with a preferred prey size and maximum growth rate. Consequently, species of a distinct LOD are distinct in key ecologic characteristics, whereas those of a similar LOD are functionally similar or redundant species. We sampled from East Sea/Sea of Japan to the High Arctic Sea. We determined abundance distributions of biological species and also ecological types by grouping species in LOD size-classes, sets of ecologically similar species. In lower latitudes there are more trace species, more size-classes and the dominant species are accompanied by many apparently ecologically similar species, presumably able to replace the dominant species, at least with regard to the size of prey exploited. Such redundancy appears to decline markedly with latitude in assemblages of tintinnid ciliates. Furthermore, the relatively small species pools of the northern high latitude assemblages suggest a low capacity to adapt to changing conditions. PMID:26990873

  14. Effect of adrenergic stimulation on clearance from small ciliated airways in healthy subjects. (United States)

    Svartengren, K; Philipson, K; Svartengren, M; Camner, P


    Mucociliary transport is an important clearance mechanism of larger airways, but in the smallest ciliated airways (bronchioles) it may be less effective. The present study aimed at investigating whether clearance from the bronchioles in subjects with healthy airways was stimulated by an adrenergic agonist (terbutaline sulphate). Tracheobronchial clearance was studied twice in 10 healthy subjects after inhalation of 6-micron (aerodynamic diameter) monodisperse Teflon particles labeled with 111In. At one exposure, oral treatment with terbutaline sulphate, known to stimulate clearance in large airways, began immediately after inhalation of the particles. The other exposure was a control measurement. The particles were inhaled at an extremely slow flow, 0.05 L/s, which gave deposition mainly in the small ciliated airways (bronchioles). Lung retention was measured at 0, 24, 48, and 72 h. Clearance was significant every 24 h for both exposures (p terbutaline sulphate, the subjects' pulse rates tended to be higher, but clearance rates did not increase. We found, as expected, no significant correlation between lung retention and lung function in either exposure. This study shows that an adrenergic agonist does not significantly influence overall clearance from the bronchiolar region in healthy subjects. This suggests that mucociliary transport does not significantly contribute to clearance from the smallest ciliated airways. Other mechanisms may be more important for the transportation of mucus from these airways. PMID:9555573

  15. Unfolding Thermodynamics of Cysteine-Rich Proteins and Molecular Thermal-Adaptation of Marine Ciliates

    Directory of Open Access Journals (Sweden)

    Giorgia Cazzolli


    Full Text Available Euplotes nobilii and Euplotes raikovi are phylogenetically closely allied species of marine ciliates, living in polar and temperate waters, respectively. Their evolutional relation and the sharply different temperatures of their natural environments make them ideal organisms to investigate thermal-adaptation. We perform a comparative study of the thermal unfolding of disulfide-rich protein pheromones produced by these ciliates. Recent circular dichroism (CD measurements have shown that the two psychrophilic (E. nobilii and mesophilic (E. raikovi protein families are characterized by very different melting temperatures, despite their close structural homology. The enhanced thermal stability of the E. raikovi pheromones is realized notwithstanding the fact that these proteins form, as a rule, a smaller number of disulfide bonds. We perform Monte Carlo (MC simulations in a structure-based coarse-grained (CG model to show that the higher stability of the E. raikovi pheromones is due to the lower locality of the disulfide bonds, which yields a lower entropy increase in the unfolding process. Our study suggests that the higher stability of the mesophilic E. raikovi phermones is not mainly due to the presence of a strongly hydrophobic core, as it was proposed in the literature. In addition, we argue that the molecular adaptation of these ciliates may have occurred from cold to warm, and not from warm to cold. To provide a testable prediction, we identify a point-mutation of an E. nobilii pheromone that should lead to an unfolding temperature typical of that of E. raikovi pheromones.

  16. A Domesticated piggyBac Transposase Plays Key Roles in Heterochromatin Dynamics and DNA Cleavage during Programmed DNA Deletion in Tetrahymena thermophila


    Cheng CY; Vogt A; Mochizuki K.; Yao MC


    Transposons comprise large fractions of eukaryotic genomes and provide genetic reservoirs for the evolution of new cellular functions. We identified TPB2, a homolog of the piggyBac transposase gene that is required for programmed DNA deletion in Tetrahymena. TPB2 was expressed exclusively during the time of DNA excision, and its encoded protein Tpb2p was localized in DNA elimination heterochromatin structures. Notably, silencing of TPB2 by RNAi disrupts the final assembly of these heterochrom...

  17. The Zinc Finger Protein Zfr1p Is Localized Specifically to Conjugation Junction and Required for Sexual Development in Tetrahymena thermophila


    Xu, Jing; Tian, Huaru; Wang, Wei; Liang, Aihua


    Conjugation in Tetrahymena thermophila involves a developmental program consisting of three prezygotic nuclear divisions, pronuclear exchange and fusion, and postzygotic and exconjugant stages. The conjugation junction structure appears during the initiation of conjugation development, and disappears during the exconjugant stage. Many structural and functional proteins are involved in the establishment and maintenance of the junction structure in T. thermophila. In the present study, a zinc f...

  18. Expression of Tetrahymena snRNA gene variants including a U1 gene with mutations in the 5' splice site recognition sequence

    DEFF Research Database (Denmark)

    Eugen-Olsen, J; Hagemeister, J J; Hellung-Larsen, P


    The expression of U1, U2 and U5 snRNA gene variants has been studied under different physiological states of Tetrahymena. Variants of all three snRNA genes are expressed. Among the snRNAs detected is U1-3, a variant with 66 mutations compared to the normal U1 snRNA. Three of these mutations affec...... the 5' splice site recognition sequence. The U1-3 snRNA is present in a few hundred copies per cell. The expression of Tetrahymena snRNA genes is independent of the physiological state of the cell.......The expression of U1, U2 and U5 snRNA gene variants has been studied under different physiological states of Tetrahymena. Variants of all three snRNA genes are expressed. Among the snRNAs detected is U1-3, a variant with 66 mutations compared to the normal U1 snRNA. Three of these mutations affect...

  19. Effects of Seasonality and Dispersal on the Ciliate Community Inhabiting Bromeliad Phytotelmata in Riparian Vegetation of a Large Tropical River. (United States)

    Buosi, Paulo R B; Cabral, Adalgisa F; Utz, Laura R P; Vieira, Ludgero C G; Velho, Luiz F M


    This study evaluated the influence of rainfall amount on the abundance, species richness, and species occurrence and abundance distribution of the ciliate community associated with the bromeliad Aechmea distichantha. The plants were collected from a rock wall of about 10-km long at the left bank of Paraná River. We assessed the effects of both spatial and temporal variables on the community attributes, as well as whether plants geographically closer have a similar abundance distribution and species composition. The ciliate community was substantially distinct between both hydrological periods, with greater values of species richness and abundance in the rainy period. No spatial structuring (differences in the species occurrence and abundance distribution among strata) or geographical similarity (similarity in ciliate species composition among the plants) was found. Multiple regression analysis showed a positive relationship only between the ciliate abundances and water volumes for both periods. Although few of the formulated predictions were confirmed, our study provides valuable information on the ecological aspects of the ciliate community inhabiting bromeliad phytotelmata. PMID:25963550


    Institute of Scientific and Technical Information of China (English)

    龚骏; 马宏伟; 宋微波


    The living morphology, nuclear apparatus, infraciliature and silverline system o f the poorly-known ciliate Pseudocohnilembus hargisi Evans & Thompson, 1964 , collected from a shrimp culture pond in Qingdao, China, were examined by obser vation of the live specimen; and by the pyridinated carbonate method and Chatton -Lwoff technique. The main characteristics: 13-14 (usually 13) longitudinal or slightly spirally arranged somatic kineties; single contractile vacuole with usually 2 ( 1-2) pores at posterior ends of the fourth and fifth somatic kineties to the rig ht of the buccal cavity. Several related congeners were compared and morphometri cally tabulated.

  1. Using Sorting by Reversal: Breakpoint Graph for Gene Assembly in Ciliates (United States)

    Brijder, Robert; Jan Hoogeboom, Hendrik


    The theory of gene assembly in ciliates has much in common with the theory of sorting by reversal. Both model processes that are based on splicing, and have a fixed begin and end product. The main difference is the type of splicing operations used to obtain the end product from the begin product. In this overview paper we show that the concept of breakpoint graph, known from the theory of sorting by reversal, has many uses in the theory of gene assembly. Our aim is to present the material in an intuitive and informal manner to allow for an efficient introduction into the subject.

  2. Natural variation in methane emission of sheep fed on a lucerne pellet diet is unrelated to rumen ciliate community type. (United States)

    Kittelmann, Sandra; Pinares-Patiño, Cesar S; Seedorf, Henning; Kirk, Michelle R; McEwan, John C; Janssen, Peter H


    Only limited information is available on the roles of different rumen ciliate community types, first described by Eadie in 1962, in enteric methane (CH4) formation by their ruminant hosts. If the different types were differentially associated with CH4 formation, then ciliate community typing could be used to identify naturally high and low CH4-emitting animals. Here we measured the CH4 yields [g CH4 (kg feed dry matter intake, DMI)- 1] of 118 sheep fed a standard pelleted lucerne diet at two different times, at least 2 weeks apart. There were significant differences (P sheep selected as high [16.7 ± 1.5 g CH4 (kg DMI)- 1] and low emitters [13.3 ± 1.5 g CH4 (kg DMI)- 1]. A rumen sample was collected after each of the two measurements, and ciliate composition was analysed using barcoded 454 Titanium pyrosequencing of 18S rRNA genes. The genera found, in order of mean relative abundance, were Epidinium, Entodinium, Dasytricha, Eudiplodinium, Polyplastron, Isotricha and Anoplodinium-Diplodinium, none of which was significantly correlated with the CH4 emissions ranking associated with the rumen sample. Ciliate communities naturally assembled into four types (A, AB, B and O), characterized by the presence and absence of key genera. There was no difference in CH4 yield between sheep that harboured different ciliate community types, suggesting that these did not underlie the natural variation in CH4 yields. Further research is needed to unravel the nature of interactions between ciliate protozoa and other rumen micro-organisms, which may ultimately lead to contrasting CH4 emission phenotypes. PMID:26813792

  3. Microcalorimetric investigation of the toxic action of Cr(VI) on the metabolism of Tetrahymena thermophila BF(5) during growth. (United States)

    Zheng, Dan; Liu, Yi; Zhang, Yue; Chen, Xiao-Juan; Shen, Yun-Fen


    Tetrahymena thermophila BF(5) produce heat by metabolism and movement. Using a TAM air isothermal microcalorimeter, the power-time curves of the metabolism of T. thermophila BF(5) during growth were obtained and the action on them by the addition of Cr(VI) were studied. The morphological change with Cr(VI) coexisted and biomass change during the process of T. thermophila BF(5) growth were studied by light microscope. Chromium has been regarded as an essential trace element for life. However, hexavalent chromium is a known carcinogen, mutagen, cytotoxicant and strong oxidizing agent. Cr(VI) of different concentration have different effects on T. thermophila BF(5) growth with the phenomenon of low dose stimulation (0-3×10(-5)molL(-1)) and high dose inhibition (3×10(-5) to 2.4×10(-4)molL(-1)). The relationship between the growth rate constant (k) and c is a typical U-shaped curve, which is a characteristic of hormesis. T. thermophila BF(5) cannot grow at all when the concentration of Cr(VI) is up to 2.4×10(-4)molL(-1). The microscopic observations agree well with the results obtained by means of microcalorimetry. And T. thermophila BF(5) had obviously morphological changes by the addition of Cr(VI). PMID:21783697

  4. Effects of triclosan and triclocarban on the growth inhibition, cell viability, genotoxicity and multixenobiotic resistance responses of Tetrahymena thermophila. (United States)

    Gao, Li; Yuan, Tao; Cheng, Peng; Bai, Qifeng; Zhou, Chuanqi; Ao, Junjie; Wang, Wenhua; Zhang, Haimou


    The information about adverse effects of emerging contaminants on aquatic protozoa is very scarce. The growth inhibition effect, cell viability, genotoxicity and multixenobiotic resistance (MXR) responses of two commonly used antimicrobial agents, triclosan (TCS) and triclocarban (TCC) to protozoan Tetrahymena thermophila were investigated in this study. The results revealed that TCS and TCC can inhibit the growth of T. thermophila with 24h EC50 values of 1063 and 295μgL(-1), respectively. The impairment of plasma membrane was observed after 2h exposure of TCS or TCC at the level of mg/L. Furthermore, it is noticeable that at environmentally relevant concentration (1.0μgL(-1)), both TCS and TCC can lead to statistically significant DNA damage in T. thermophila, while the inhibition of growth and change of cell viability cannot be observed. Our results firstly provide the evidence for genotoxic effects of TCS and TCC on the freshwater protozoan. Additionally, both TCS and TCC were found to inhibit the efflux transporter activities, with the inhibitory potencies of 39% and 40% (using verapamil as a model inhibitor), respectively. Particularly, TCC could significantly down-regulate the expression of MXR related gene Abcb15, which encodes the membrane efflux protein that acting as P-gp in T. thermophila. The results raise the awareness of potential aquatic ecological and human health risks from the exposure of TCS and TCC, as they might potentiate the toxic effects by chemosensitizing with co-existing toxicants. PMID:26246462

  5. Evaluation of Enrichment Protocols for Bacterial Endosymbionts of Ciliates by Real-Time PCR. (United States)

    Castelli, Michele; Lanzoni, Olivia; Rossi, Leonardo; Potekhin, Alexey; Schrallhammer, Martina; Petroni, Giulio


    Large-scale studies on obligate bacterial endosymbionts may frequently require preliminary purification and enrichment protocols, which are often elaborate to set up and to evaluate, especially if the host organism is a protist. The purpose of this study was to develop a real-time PCR-based strategy and employ it for assessing two of such enrichment protocols for Holospora caryophila, hosted by the ciliate Paramecium. Four SSU rRNA gene-targeted real-time PCR assays were designed, which allowed to compare the amount of H. caryophila to other organisms, namely the host, its food bacterium (Raoultella planticola), and free-living bacteria present in the culture medium. By the use of the real-time PCR assays in combination, it was possible to conclude that the "cell fractionation" protocol was quite successful in the enrichment of the symbiont, while the "Percoll gradient" protocol will need further refinements to be fully repeatable. The proposed approach has the potential to facilitate and encourage future studies on the yet underexplored field of bacterial endosymbionts of ciliates and other protists. It can also find valuable applications for experimental questions other than those tested, such as fast and precise assessment of symbiont abundance in natural populations and comparison among multiple coexisting symbionts. PMID:26894821

  6. An annotated and revised checklist of pleurostome ciliates (Protista: Ciliophora: Litostomatea) from Slovakia, Central Europe. (United States)

    Vďačný, Peter; Rajter, L'ubomír


    Pleurostomatids are predatory ciliates, living especially in the periphyton and benthos of various freshwater and marine habitats. In the present work, we provide an annotated and revised checklist of this ciliate group from the territory of Slovakia. Altogether 29 pleurostome species belonging to five genera have been reported there: Acineria incurvata, Ac. punctata, Ac. uncinata, Amphileptus claparedii, Am. falcatus, Am. fusiformis, Am. parafusidens, Am. pleurosigma, Am. procerus, Am. punctatus, A. rotundus, Litonotus alpestris, Li. anguilla, Li. carinatus, Li. crystallinus, Li. cygnus, Li. fasciola, Li. fusidens, Li. hirundo, Li. lamella, Li. minisculus, Li. muscorum, Li. obtusus, Li. triqueter, Li. varsaviensis, Loxophyllum helus, Lo. meleagris, Lo. rostratum, and Siroloxophyllum utriculariae. We have catalogued these records providing the following data for each species: (1) author(s) and date of publication; (2) name(s) of the species as appeared in the publication(s) followed by chronologically listed references including relevant page(s) in literature; (3) nomenclatural and taxonomic notes if needed; (4) main morphological characters; (5) morphological data on Slovak populations if available; and (6) all faunistic records. PMID:24870102

  7. Structures, Biological Activities and Phylogenetic Relationships of Terpenoids from Marine Ciliates of the Genus Euplotes

    Directory of Open Access Journals (Sweden)

    Fernando Dini


    Full Text Available In the last two decades, large scale axenic cell cultures of the marine species comprising the family Euplotidae have resulted in the isolation of several new classes of terpenoids with unprecedented carbon skeletons including the (i euplotins, highly strained acetylated sesquiterpene hemiacetals; (ii raikovenals, built on the bicyclo[3.2.0]heptane ring system; (iii rarisetenolides and focardins containing an octahydroazulene moiety; and (iv vannusals, with a unique C30 backbone. Their complex structures have been elucidated through a combination of nuclear magnetic resonance spectroscopy, mass spectrometry, molecular mechanics and quantum chemical calculations. Despite the limited number of biosynthetic experiments having been performed, the large diversity of ciliate terpenoids has facilitated the proposal of biosynthetic pathways whereby they are produced from classical linear precursors. Herein, the similarities and differences emerging from the comparison of the classical chemotaxonomy approach based on secondary metabolites, with species phylogenesis based on genetic descriptors (SSU-rDNA, will be discussed. Results on the interesting ecological and biological properties of ciliate terpenoids are also reported.

  8. ATP4 and ciliation in the neuroectoderm and endoderm of Xenopus embryos and tadpoles

    Directory of Open Access Journals (Sweden)

    Peter Walentek


    Full Text Available During gastrulation and neurulation, foxj1 expression requires ATP4a-dependent Wnt/β-catenin signaling for ciliation of the gastrocoel roof plate (Walentek et al. Cell Rep. 1 (2012 516–527. and the mucociliary epidermis (Walentek et al. Dev. Biol. (2015 of Xenopus laevis embryos. These data suggested that ATP4a and Wnt/β-catenin signaling regulate foxj1 throughout Xenopus development. Here we analyzed whether foxj1 expression was also ATP4a-dependent in other ciliated tissues of the developing Xenopus embryo and tadpole. We found that in the floor plate of the neural tube ATP4a-dependent canonical Wnt signaling was required for foxj1 expression, downstream of or in parallel to Hedgehog signaling. In the developing tadpole brain, ATP4-function was a prerequisite for the establishment of cerebrospinal fluid flow. Furthermore, we describe foxj1 expression and the presence of multiciliated cells in the developing tadpole gastrointestinal tract. Our work argues for a general requirement of ATP4-dependent Wnt/β-catenin signaling for foxj1 expression and motile ciliogenesis throughout Xenopus development.

  9. Primary and secondary structures of Tetrahymena and aphid 5.8S rRNAs: structural features of 5.8S rRNA which interacts with the 28S rRNA containing the hidden break.


    Fujiwara, H.; H. Ishikawa


    The Tetrahymena 5.8S rRNA is 154 nucleotides long, the shortest so far reported except for the split 5.8S rRNAs of Diptera (m5.8S plus 2S rRNA). In this molecule several nucleotides are deleted in the helix e (GC-rich stem) region. Upon constructing the secondary structure in accordance with "burp-gun" model, the Tetrahymena 5.8S rRNA forms a wide-open "muzzle" of the terminal regions due to both extra nucleotides and several unpaired bases. The aphid 5.8S rRNA consists of 161 nucleotides and...

  10. First record of protozoan parasites, Tetrahymena rostrata and Callimastix equi from the edible oyster in Sundarbans region of West Bengal, India. (United States)

    Biswas, Tanima; Bandyopadhyay, Probir Kumar


    Several protozoan parasites have been found infecting the edible oysters, hence deteriorating the meat quality. Protozoan parasites such as, Tetrahymena rostrata and Callimastix equi infested the edible oyster in Sundarbans region, West Bengal, India, are first record from this region. Due to filter feeding habit of the organisms, oysters provides excellent ecological services in regard to efficient cleaning of infectious agents from surrounding water as a potential measure to improve water quality. However, these environmental benefits are associated with public heath risks from contaminated oysters intended for human consumption. PMID:27605821

  11. Seasonal and spatial dynamics of a ciliate assemblage in a warm-monomictic Lake Alchichica (Puebla, Mexico)

    Czech Academy of Sciences Publication Activity Database

    Macek, Miroslav; Peštová, D.; Pérez, M. E. M.


    Roč. 18, č. 1 (2008), s. 25-35. ISSN 0188-8897. [International Meeting Mex. Soc. Planktology /7./. Morelia, Michoacán, 30.05.2006-02.06.2006] Institutional research plan: CEZ:AV0Z60170517 Keywords : ciliates * athalassohaline lake * anoxic Subject RIV: EH - Ecology, Behaviour Impact factor: 0.132, year: 2008

  12. Factors involved in the distribution pattern of ciliates in the water column of a transparent alpine lake


    SONNTAG, BETTINA; Summerer, Monika; Sommaruga, Ruben


    Abstract The recurrent depth preference of three ciliate species (two prostomatids and one haptorid) in a transparent alpine lake indicates the existence of niche partitioning among them involving potential factors such as avoidance of high UVR levels and zooplankton predation, as well as competition for food resources. (Sonntag, Bettina) (Summerer, Monika) (Sommaruga, Ruben) University...

  13. Composition and distribution of planktonic ciliates in the southern South China Sea during late summer: Comparison between surface and 75 m deep layer (United States)

    Liu, Huaxue; Shen, Pingping; Li, Chunhou; Chen, Zuozhi; Qi, Zhanhui; Huang, Honghui


    Ciliates are very important components in most marine ecosystem. They are trophic link between the microbial food web and grazing food chain. In this study, ciliates were collected from 11 sites in the southern South China Sea (SCS) during August 25 to September 28, 2011. Their composition and distribution at the surface and 75 m deep depth of the ocean were studied. A total of 30 species belonging to 22 genera were identified, and 22 species of 15 genera were Tintinnids. Eutintinnus fraknoii and E. stramentus were the most common species. The other dominants were strombidiids ciliates including Strombidium conicum and S. globosaneum, which were followed by the tide form, Mesodinium pulex. Ciliates abundance ranged from 46 ind L-1 to 368 ind L-1 in the open sites, 46-368 ind L-1 at surface and 73-198 ind L-1 at 75 m deep layer. In the Yongshu reef, ciliates abundance ranged from 167 ind L-1 to 365 ind L-1 in the water column, similar to that in Sanya coral reef waters. Ciliates composition showed obvious difference between surface and 75 m deep layer at station S2 ( P deep layer, salinity was negatively related to mixed layer depth ( P < 0.05), but positively to chlorophyll a concentration ( P < 0.05), indicating that the change of vertical mixing in water column influenced vertical distribution of ciliates in the southern SCS.

  14. Spatiotemporal variation in community structure of marine benthic ciliates in the Yellow Sea during and after macroalgal and giant jellyfish blooms (United States)

    Zhou, Bailing; Xu, Kuidong


    The annual bloom of the green macroalgal Ulva prolifera from May through July since 2008 and another of giant jellyfish Nemopilema nomurai from June through September have been frequent events in the Yellow Sea. However, the patterns of benthic ciliate communities during and after the blooms are still not known. In combination with analyses of benthic environmental factors, we investigated the distribution and community composition of benthic ciliates in the Yellow Sea in July and November 2011. In July, ciliates had high standing crops and diversity in the northern Yellow Sea, and in the inshore area off the southern Shandong Peninsula, where large numbers of green macroalgae accumulated. In November, the abundance, biomass and diversity of ciliates were high in the sea areas off the Shandong Peninsula and Changjiang estuary, where a large quantity of jellyfish occurred in August. Neither the abundance nor the biomass had significant difference between seasons, or between different compartments of the Yellow Sea. The species number, and both Margalef and Shannon-Wiener indices of ciliates were all significantly higher in November than in July. In both seasons, prostomateans and karyorelicteans consistently constituted the first and second most important ciliate groups in biomass; and carnivorous ciliates constituted the primary feeding type in terms of biomass as well as species richness, followed by bacterivores, algivores and omnivores. Compared with that in June 2007 when no macroalgae occurred, the percentage of small-sized bacterivores (e.g. Metacystis spp., Euplotes spp. and scuticociliates) increased in July 2011. The proportion of carnivorous ciliates increased in November, and this increased dominance of carnivorous ciliates may be a response to the increase in predominance of heterotrophic nanoflagellates, which might in turn be ascribed to an effect of green macroalgal and giant jellyfish blooms in the Yellow Sea.

  15. Tolerance of ciliated protozoan Paramecium bursaria (Protozoa, Ciliophora) to ammonia and nitrites (United States)

    Xu, Henglong; Song, Weibo; Lu, Lu; Alan, Warren


    The tolerance to ammonia and nitrites in freshwater ciliate Paramecium bursaria was measured in a conventional open system. The ciliate was exposed to different concentrations of ammonia and nitrites for 2h and 12h in order to determine the lethal concentrations. Linear regression analysis revealed that the 2h-LC50 value for ammonia was 95.94 mg/L and for nitrite 27.35 mg/L using probit scale method (with 95% confidence intervals). There was a linear correlation between the mortality probit scale and logarithmic concentration of ammonia which fit by a regression equation y=7.32 x 9.51 ( R 2=0.98; y, mortality probit scale; x, logarithmic concentration of ammonia), by which 2 h-LC50 value for ammonia was found to be 95.50 mg/L. A linear correlation between mortality probit scales and logarithmic concentration of nitrite is also followed the regression equation y=2.86 x+0.89 ( R 2=0.95; y, mortality probit scale; x, logarithmic concentration of nitrite). The regression analysis of toxicity curves showed that the linear correlation between exposed time of ammonia-N LC50 value and ammonia-N LC50 value followed the regression equation y=2 862.85 e -0.08 x ( R 2=0.95; y, duration of exposure to LC50 value; x, LC50 value), and that between exposed time of nitrite-N LC50 value and nitrite-N LC50 value followed the regression equation y=127.15 e -0.13 x ( R 2=0.91; y, exposed time of LC50 value; x, LC50 value). The results demonstrate that the tolerance to ammonia in P. bursaria is considerably higher than that of the larvae or juveniles of some metozoa, e.g. cultured prawns and oysters. In addition, ciliates, as bacterial predators, are likely to play a positive role in maintaining and improving water quality in aquatic environments with high-level ammonium, such as sewage treatment systems.

  16. Tolerance of ciliated protozoan Paramecium bursaria (Protozoa,Ciliophora) to ammonia and nitrites

    Institute of Scientific and Technical Information of China (English)


    The tolerance to ammonia and nitrites in freshwater ciliate Paramecium bursaria was measured in a conventional open system. The ciliate was exposed to different concentrations of ammonia and nitrites for 2h and 12h in order to determine the lethal concentrations. Linear regression analysis revealed that the 2h-LC50 value for ammonia was 95.94 mg/L and for nitrite 27.35 mg/L using probit scale method (with 95% confidence intervals). There was a linear correlation between the mortality probit scale and logarithmic concentration of ammonia which fit by a regression equation y=7.32x-9.51 (R2=0.98; y, mortality probit scale; x, logarithmic concentration of ammonia), by which 2 h-LC50 value for ammonia was fotnd to be 95.50 mg/L. A linear correlation between mortality probit scales and logarithmic concentration of nitrite is also followed the regression equation y=2.86x+0.89 (R2=0.95; y, mortality probit scale; x, logarithmic concentration of nitrite). The regression analysis of toxicity curves showed that the linear correlation between exposed time of ammonia-N LC50 value and ammonia-N LC50 value followed the regression equation y=2862.85e-0.0ax (R2=0.95; y, duration of exposure to LC50 value; x, LC50 value), and that between exposed time of nitrite-N LC50 value and nitrite-N LC50 value followed the regression equation y = 127.15e-0.13x (R2=0.91; y, exposed time of LC50 value; x, LC50 value). The results demonstrate that the tolerance to ammonia in P. bursaria is considerably higher than that of the larvae or juveniles of some metozoa, e.g. cultured prawns and oysters. In addition, ciliates, as bacterial predators, are likely to play a positive role in maintaining and improving water quality in aquatic environments with high-level ammonium, such as sewage treatment systems.

  17. Ciliated Median Raphe Cyst of Perineum Presenting as Perianal Polyp: A Case Report with Immunohistochemical Study, Review of Literature, and Pathogenesis

    Directory of Open Access Journals (Sweden)

    Jayesh Sagar


    Full Text Available Median raphe cyst is a very rare, benign congenital lesion occurring mainly on the ventral aspect of the penis, but can develop anywhere in the midline between the external urethral meatus and anus. We report a case of median raphe cyst in the perineum presenting as a perianal polyp in a 65-year-old, English white male with exceptionally rare ciliated epithelium. According to our knowledge, this is the third such case of ciliated median raphe cyst in the English literature. This case, also the first case of ciliated median raphe cyst in the perineum location, focuses on pathogenesis of median raphe cyst.

  18. Thermodynamic Stability of Psychrophilic and Mesophilic Pheromones of the Protozoan Ciliate Euplotes

    Directory of Open Access Journals (Sweden)

    Kurt Wüthrich


    Full Text Available Three psychrophilic protein pheromones (En-1, En-2 and En-6 from the polar ciliate, Euplotes nobilii, and six mesophilic pheromones (Er-1, Er-2, Er-10, Er-11, Er-22 and Er-23 from the temperate-water sister species, Euplotes raikovi, were studied in aqueous solution for their thermal unfolding and refolding based on the temperature dependence of their circular dichroism (CD spectra. The three psychrophilic proteins showed thermal unfolding with mid points in the temperature range 55–70 °C. In contrast, no unfolding was observed for any of the six mesophilic proteins and their regular secondary structures were maintained up to 95 °C. Possible causes of these differences are discussed based on comparisons of the NMR structures of the nine proteins.

  19. New Record of Two Marine Ciliates (Ciliophora: Spirotrichea in South Korea

    Directory of Open Access Journals (Sweden)

    Kang-San Kim


    Full Text Available Two marine hypotrichous ciliates, Anteholosticha petzi and Ponturostyla enigmatica, were collected from the Yellow Sea and the Korea Strait, respectively, and described using live observation and protargol-impregnated specimens. Furthermore, the nuclear small subunit ribosomal RNA gene of each was sequenced and compared to previously annotated sequences retrieved from the GenBank. Anteholosticha petzi is characterized by 3 frontal cirri (FC, 2 frontoterminal cirri (FTC, 8-12 transverse cirri (TC, 1 buccal cirrus (BC, 9-12 midventral pairs (MP, 3 bipolar dorsal kineties (DK, and 3 types of colorless cortical granules. Ponturostyla enigmatica is characterized by 8 FC, 5 ventral cirri (VC, 5-7 TC, 6-7 marginal rows (MR on each side, 4 complete and 2-3 partial DK, and greenish cortical granules. This is the first identification and description of these 2 species, A. petzi and P. enigmatica, in South Korea.

  20. Epibiotic ciliates Scyphidia sp. and diatoms on Tigriopus fulvus (Copepoda: Harpacticoida exoskeleton

    Directory of Open Access Journals (Sweden)

    Luigi Pane


    Full Text Available Several microorganisms – epibionts – can adhere to living supports taking advantage for their survival, feeding and movement. Epibiosis occurs particularly in aquatic environments, on both benthic and planktonic organisms, among which copepods and cladocerans represent an important living support. The harpacticoid copepod Tigriopus fulvus, living in the splashpools of rocky coasts, was studied to recognize the occurrence of epibionts on the exoskeleton surface using scanning electon microscopy techniques. The first evidence of ciliate Scyphidia sp. on Tigriopus fulvus has been described and the occurrence of algae Cocconeis sp. has been observed as well. Epibionts were found to adhere to antennae, a site linked to the exploitation of water currents carrying food particles to mouthparts and to swimming legs. The reason of the occurrence on swimming legs is less clear and needs further observations. Pertinent results are described and discussed and the influence of epibionts on life cycle and behavior of Tigriopus fulvus is considered.

  1. Nuclear Architecture and Patterns of Molecular Evolution Are Correlated in the Ciliate Chilodonella uncinata. (United States)

    Maurer-Alcalá, Xyrus X; Katz, Laura A


    The relationship between nuclear architecture and patterns of molecular evolution in lineages across the eukaryotic tree of life is not well understood, partly because molecular evolution is traditionally explored as changes in base pairs along a linear sequence without considering the context of nuclear position of chromosomes. The ciliate Chilodonella uncinata is an ideal system to address the relationship between nuclear architecture and patterns of molecular evolution as the somatic macronucleus of this ciliate is composed of a peripheral DNA-rich area (orthomere) and a DNA-poor central region (paramere) to form a "heteromeric" macronucleus. Moreover, because the somatic chromosomes of C. uncinata are highly processed into "gene-sized" chromosomes (i.e., nanochromosomes), we can assess fine-scale relationships between location and sequence evolution. By combining fluorescence microscopy and analyses of transcriptome data from C. uncinata, we find that highly expressed genes have the greatest codon usage bias and are enriched in DNA-poor regions. In contrast, genes with less biased sequences tend to be concentrated in DNA abundant areas, at least during vegetative growth. Our analyses are consistent with recent work in plants and animals where nuclear architecture plays a role in gene expression. At the same time, the unusual localization of nanochromosomes suggests that the highly structured nucleus in C. uncinata may create a "gene bank" that facilitates rapid changes in expression of genes required only in specific life history stages. By using "nonmodel" organisms like C. uncinata, we can explore the universality of eukaryotic features while also providing examples of novel properties (i.e., the presence of a gene bank) that build from these features. PMID:27189988

  2. Population dynamics of marine ciliate Euplotes vannus (Protozoa, Ciliophora) in different artificial seawaters

    Institute of Scientific and Technical Information of China (English)

    XU Henglong; ZHU Mingzhuang; JIANG Yong; GAO Shan; MIN Gi-Sik; AL-RASHEID Khaled A.S.


    To study population dynamics of marine ciliates in different artificial seawaters (ASW), the population growth dynamics of a common marine ciliate Euplotes vannus were investigated using beef extract media and rice media for five types of ASW and natural seawater (NSW). The results show that: (1) the population growth rate was in the order of NSW>Flack ASW>Nakamula ASW>Schmadz ASW>Oshima ASW>Subow ASW and was considerably higher in rice media than in beef extract media (apart from Subow ASW); (2) the maximum density of E. vannus in stationary phase in each treatment was ranked as Flack ASW>Nakamula ASW>Schmadz ASW>NSW>Oshima ASW>Subow ASW, and was again higher in rice media than in beef extract media (except for Subow ASW); (3) the exponential and stationary phases were longer in rice media than in beef extract media; (4) strains of E. vannus that had been domesticated for >1 year in ASW grew significantly slower, with lower maximum density and longer stationary phase than those isolated and maintained in NSW. It was demonstrated that: (1) E. vannus may grow well in Flack, Nakamula and Schmads ASW compared with NSW (mainly in terms of growth rate); and (2) Oshima ASW is the preferred choice for stock cultures of E. vannus, but the ASWs Flack, Nakamula and Schmadz are preferred for mass culture. These findings suggest that these three ASWs are effective for the cultivation of marine protozoa for experimental studies on ecology, toxicology and molecular biology.

  3. Ciliated muconodular papillary tumor of the lung: a newly defined low-grade malignant tumor with CT findings reminiscent of adenocarcinoma. (United States)

    Hata, Yoshinobu; Yuasa, Rena; Sato, Fumitomo; Otsuka, Hajime; Goto, Hidenori; Isobe, Kazutoshi; Mitsuda, Aki; Wakayama, Megumi; Shibuya, Kazutoshi; Takagi, Keigo; Watanabe, Yoshiyuki


    A ciliated muconodular papillary tumor has been reported to be a peripheral low-grade malignant tumor, consisting of ciliated columnar cells and goblet cells with basaloid cell proliferation. Although ciliated muconodular papillary tumors have not yet been classified according to the World Health Organization classification, they can pose diagnostic and therapeutic problems. Here we report a resected case of ciliated muconodular papillary tumor with computed tomography findings reminiscent of adenocarcinoma, showing a small irregular nodule adjacent to the intersegment pulmonary vein. There was no uptake of F-18 fluorodeoxyglucose positron emission tomography. The patient underwent surgical resection, and a lobectomy was performed because intraoperative needle biopsy suggested neoplastic proliferation. No EGFR mutations were detected. No recurrence was noted during 24-month follow-up after lobectomy. PMID:23275641

  4. Notes on Soil Ciliates (Protozoa, Ciliophora) from The Netherlands, with Description of Keronopsis schminkei nov. spec. and Apobryophyllum schmidingeri nov. spec.


    Foissner, Wilhelm; AL-RASHEID, Khaled


    Fifty-six ciliate taxa, including three new species, were found in two soil samples from the Hoge Veluwe National Park in The Netherlands. A literature search showed that The Netherlands, Belgium and Denmark are terra incognita with respect to soil ciliates: only about 100 species have been recorded. Likely, a much greater number, including many undescribed species, can be found on more detailed investigations. Two of the three new species are described in detail. Keronopsis schminkei nov. sp...

  5. Bioassessment of water quality status using a potential bioindicator based on functional groups of planktonic ciliates in marine ecosystems. (United States)

    Xu, Henglong; Yong, Jiang; Xu, Guangjian


    The feasibility of a potential ecological indicator based on functional groups of planktonic ciliates for bioassessment of water quality status were studied in a bay, northern Yellow Sea. Samples were biweekly collected at five stations with different water quality status during a 1-year period. The multivariate approach based on "bootstrap-average" analysis was used to summarize the spatial variation in functional structure of the samples. The functional patterns represented a significant spatial variability, and were significantly correlated with the changes of nutrients (mainly nitrate nitrogen, NO3-N), alone or in combination with dissolve oxygen and salinity among five stations. The functional diversity represented a clear spatial variation among five stations, and was found to be significantly related to the nutrient NO3-N. According to the results, we suggest that the ecological parameter based on functional groups of planktonic ciliates may be used as a potential bioindicator of water quality status in marine ecosystems. PMID:27318762

  6. Blooms of a benthic ciliate, Maristentor dinoferus (Heterotrichea: Maristentoridae, on coral reefs of Guam, Mariana Islands. (Note

    Directory of Open Access Journals (Sweden)

    Schefter, M.


    Full Text Available Maristentor dinoferus is visible in situ with the naked eye; it forms aggregations at several scales: individuals form dynamic clusters within colonies that are normally widely scattered, but in recurrent blooms during the dry seasons of 2005 through 2007, colonies often formed close together in patches (metapopulations. Patches were extremely abundant in Guam, both in Apra Harbor and on the outer coast. This is the first time that long-term changes in a benthic ciliate population have been documented in situ and that multi-scale patchiness has been reported for a benthic ciliate. Colonies were mapped and monitored; some patches over 1 m diameter were recorded. Since 2008, the distribution has again consisted of scattered colonies, as it did from 1999–2004.

  7. Can the halophilic ciliate Fabrea salina be used as a bio-control of microalgae blooms in solar salterns? (United States)

    Hong, Hyun Pyo; Choi, Joong Ki


    The microlage Dunaliella salina, a major producer in salterns, is a serious problem for salt production. In this study we tried to assess if Fabrea salina can control D. salina. By parameterising numerical and functional response (growth and grazing vs prey abundance, respectively) at 90 psu and 30°C, where the ciliate is abundant and grows well, we developed a predator-prey model. The model is used to explore how change in microalga growth rate affect the dynamics, and the functional response is used in combination with field data to assess the potential impact of F. salina on D. salina. Over the 20 d simulation the ciliate controlled the prey population under all prey growth rates; although once D. salina were exhausted below the threshold level, F. salina died due to starvation, allowing the alga to increase in abundance, resulting in one or two predatorprey cycle, depending on prey growth rate. In general, the model predicted trends observed by others in the field, suggesting that it provided a good prediction of what may occur under the conditions we examined. Likewise we show that the ciliate can have a high impact on microalgal populations in the field. Finally, a literature review indicated that F. salina could be a good competitor with other protozoa and metazoan in salterns, depending on salinity and temperature, which requires further study and attention. In summary, we encourage continued studies on this unique ciliate on solar salterns and suggest that it may be useful in the bio-control of micoalgae.

  8. Associative behaviour and antagonism of bovine rumen ciliate (Protista, Ciliophora from Zona da Mata, Minas Gerais State, Brazil

    Directory of Open Access Journals (Sweden)

    Marta D'Agosto


    Full Text Available Aiming at obtaining the community profile and verifying the occurrence of antagonism and association among ciliates, samples of rumen content were analysed in 100 bovines soon after their death. The animals were killed at the Juiz de Fora Municipal slaughter house (Juiz de Fora, Minas Gerais State, Brazil between August 1996 and May 1997. Ciliates occurred, respectively, in the following percents and samples number: Entodinium Stein, 1859 (50,48; 100, Diplodinium Schuberg, 1888 (5,59; 98, Eudiplodinium Dogiel, 1927 (6,91; 97, Ostracodinium Dogiel, 1927 (9,68; 95, hotricha Stein, 1859 (4,15; 93, Dasytricha Schuberg, 1888 (3,31; 93, Metadi nium Awerinzew & Mutafowa, 1914 (3,06; 90, Eremoplastron Kofoid & MacLennan. 1932 (7,39; 87, Epidinium Crawley, 1923 (5,31; 73, Charonina Strand, 1928 (1,33; 65, Eodinium Kofoid & MacLennan, 1932 (1,49; 59, Diploplastron Kofoid & MacLennan, 1932 (0,88; 24, Elytroplastron Kofoid & MacLennan, 1932 (0,36; 16, Polyplastron Dogiel, 1927 (0,04; 03 and Buetschlia Schuberg, 1888 (0,02; 01. When the antagonistic behaviour and the association were analyzed, it was observed that Eudiplodinium was detected in the absence of Polyplastron and in the presence of Epidinium in 94% and 73% of the samples, respectively. These data confirm the antagonism and the coexistence among particular populations of rumen ciliates and allowed the identification of 94% of the samples examined as being of profile type B, none of type A and 3% of mixed A-B community and of type O. It is suggested the use of the term community profile instead of population profile, as the respective types involve associations of various ciliate populations.

  9. The behaviour of both Listeria monocytogenes and rat ciliated ependymal cells is altered during their co-culture


    Fadaee-Shohada, Mina J.; Hirst, Robert A; Andrew Rutman; Roberts, Ian S.; Chris O'Callaghan; Andrew, Peter W.


    BACKGROUND: Ciliated ependymal cells line the cerebral ventricles and aqueducts separating the infected CSF from the brain parenchyma in meningitis. PRINCIPAL FINDINGS: Investigation of the interaction of Listeria monocytogenes with cultured rat brain ependymal cells showed that certain strains reduced the beat frequency of the cilia but all the strains studied significantly reduced the ciliary beat amplitude (the linear distance travelled by the tip of each cilium per beat cycle). CONCLUSION...

  10. The extracellular matrix protein artichoke is required for integrity of ciliated mechanosensory and chemosensory organs in Drosophila embryos. (United States)

    Andrés, Marta; Turiégano, Enrique; Göpfert, Martin C; Canal, Inmaculada; Torroja, Laura


    Sensory cilia are often encapsulated by an extracellular matrix (ECM). In Caenorhabditis elegans, Drosophila melanogaster, and vertebrates, this ECM is thought to be directly involved in ciliary mechanosensing by coupling external forces to the ciliary membrane. Drosophila mechano- and chemosensory cilia are both associated with an ECM, indicating that the ECM may have additional roles that go beyond mechanosensory cilium function. Here, we identify Artichoke (ATK), an evolutionarily conserved leucine-rich repeat ECM protein that is required for normal morphogenesis and function of ciliated sensilla in Drosophila. atk is transiently expressed in accessory cells in all ciliated sensory organs during their late embryonic development. Antibody stainings show ATK protein in the ECM that surrounds sensory cilia. Loss of ATK protein in atk null mutants leads to cilium deformation and disorientation in chordotonal organs, apparently without uncoupling the cilia from the ECM, and consequently to locomotion defects. Moreover, impaired chemotaxis in atk mutant larvae suggests that, based on ATK protein localization, the ECM is also crucial for the correct assembly of chemosensory receptors. In addition to defining a novel ECM component, our findings show the importance of ECM integrity for the proper morphogenesis of ciliated organs in different sensory modalities. PMID:24496014

  11. Insights into bioassessment of marine pollution using body-size distinctness of planktonic ciliates based on a modified trait hierarchy. (United States)

    Xu, Henglong; Jiang, Yong; Xu, Guangjian


    Based on a modified trait hierarchy of body-size units, the feasibility for bioassessment of water pollution using body-size distinctness of planktonic ciliates was studied in a semi-enclosed bay, northern China. An annual dataset was collected at five sampling stations within a gradient of heavy metal contaminants. Results showed that: (1) in terms of probability density, the body-size spectra of the ciliates represented significant differences among the five stations; (2) bootstrap average analysis demonstrated a spatial variation in body-size rank patterns in response to pollution stress due to heavy metals; and (3) the average body-size distinctness (Δz(+)) and variation in body-size distinctness (Λz(+)), based on the modified trait hierarchy, revealed a clear departure pattern from the expected body-size spectra in areas with pollutants. These results suggest that the body-size diversity measures based on the modified trait hierarchy of the ciliates may be used as a potential indicator of marine pollution. PMID:27105728

  12. Ecological functions of ciliated protozoa in marine ecosystem: effects of ammonium on the population growth of Euplotes vannus

    Institute of Scientific and Technical Information of China (English)

    Xu Henglong; Song Weibo; Zhu Mingzhuang; Wang Mei; Ma Honggang; Xu Xiaozhong


    The effects of ammonium on the population growth of the marine ciliate, Euplotes vannus, were examined using ecotoxicological method. It is showed that ammonium exerts inhibitory effects on the growth of the ciliate populations in a concentration-dependent way. Statistical analysis reveals that the population growth dynamics exposed to ammonium-N concentration over 100mg/L are significantly different from that in the control at P<0.05 level. Linear regression determined that the 24h, 36h, 48h, 60h, 72h and 84h IC50 values of ammonium-N are 19.68, 201.51, 167.49, 47.86, 50.43 and 43.11 concentration over 100mg/L, respectively (P<0.05; pH 8.2; salinity 28 ppt; temperature, 25℃). The results indicate that the tolerance to ammonium in E. vannus is considerably higher than that of the larvae or juveniles of some metozoa, such as cultured prawns and oysters. Therefore, it is believed that the high tolerance to ammonium is necessary for ciliated protozoa to play positive roles in maintaining and improving water quality in marine ecosystems, especially in the intensive aquaculture waters with high-level ammonium. In addition, the correlation between IC50 values and exposure time was discussed.

  13. Connecting alveolate cell biology with trophic ecology in the marine plankton using the ciliate Favella as a model. (United States)

    Echevarria, Michael L; Wolfe, Gordon V; Strom, Suzanne L; Taylor, Alison R


    Planktonic alveolates (ciliates and dinoflagellates), key trophic links in marine planktonic communities, exhibit complex behaviors that are underappreciated by microbiologists and ecologists. Furthermore, the physiological mechanisms underlying these behaviors are still poorly understood except in a few freshwater model ciliates, which are significantly different in cell structure and behavior than marine planktonic species. Here, we argue for an interdisciplinary research approach to connect physiological mechanisms with population-level outcomes of behaviors. Presenting the tintinnid ciliate Favella as a model alveolate, we review its population ecology, behavior, and cellular/molecular biology in the context of sensory biology and synthesize past research and current findings to construct a conceptual model describing the sensory biology of Favella. We discuss how emerging genomic information and new technical methods for integrating research across different levels of biological organization are paving the way for rapid advance. These research approaches will yield a deeper understanding of the role that planktonic alveolates may play in biogeochemical cycles, and how they may respond to future ocean conditions. PMID:25039294

  14. Genome structure drives patterns of gene family evolution in ciliates, a case study using Chilodonella uncinata (Protista, Ciliophora, Phyllopharyngea). (United States)

    Gao, Feng; Song, Weibo; Katz, Laura A


    In most lineages, diversity among gene family members results from gene duplication followed by sequence divergence. Because of the genome rearrangements during the development of somatic nuclei, gene family evolution in ciliates involves more complex processes. Previous work on the ciliate Chilodonella uncinata revealed that macronuclear β-tubulin gene family members are generated by alternative processing, in which germline regions are alternatively used in multiple macronuclear chromosomes. To further study genome evolution in this ciliate, we analyzed its transcriptome and found that (1) alternative processing is extensive among gene families; and (2) such gene families are likely to be C. uncinata specific. We characterized additional macronuclear and micronuclear copies of one candidate alternatively processed gene family-a protein kinase domain containing protein (PKc)-from two C. uncinata strains. Analysis of the PKc sequences reveals that (1) multiple PKc gene family members in the macronucleus share some identical regions flanked by divergent regions; and (2) the shared identical regions are processed from a single micronuclear chromosome. We discuss analogous processes in lineages across the eukaryotic tree of life to provide further insights on the impact of genome structure on gene family evolution in eukaryotes. PMID:24749903

  15. Acute Toxicities of Potassium Permanganate, Formalin, and Lugol's Iodine Solution to a Marine Ciliate,Pleuronema coronatum ( Ciliophora, Scuticociliatida)

    Institute of Scientific and Technical Information of China (English)

    QIU Yantao; SONG Weibo


    Acute toxicities of potassium permanganate, formalin, and Lugol's iodine solution to a commonly occurred ma-rine ciliate Pleuronema coronatum (Ciliophora, Scuticociliatida) were measured. Linear regression analysis of the resultshighlighted the close relationships between doses of the medicines and mortalities of the organisms, thus providing a capabili-ty to predict toxicity effects from the dose. Toxic effects of the medicines on the ciliates were described in the present paper,and the median lethal concentrations (LC50 values) were given. Results of measurements indicated that 2 h-LC50 and 12 h-LC50 values of formalin on P. coronatum were 59.00 × 10-6 and 43.57 × 10 6, while those of Lugol's solutions were 90.13 and67.84 × 10 6 respectively. The tolerance of P. coronatum to formalin is apparently lower than that to Lugol' s iodine solutionand potassium permanganate is a suitable medicine to kill ciliates in short time.

  16. The trophic role and impact of plankton ciliates in the microbial web structure of a tropical polymictic lake dominated by filamentous cyanobacteria

    Directory of Open Access Journals (Sweden)

    Alfonso Esquivel


    Full Text Available The recent interest in the plankton structures and dynamics in tropical and subtropical lakes has revealed important trends that set these lakes apart from temperate lakes, and one of the main differences is the enhanced importance of the microbial food web with respect to net plankton. Ciliates are a key component of subtropical and tropical microbial webs because of their role as dominant picoplankton grazers and their ability to channel picoplankton production to the uppermost trophic levels. Plankton ciliates have been found to play a crucial role in the survival of fish larvae in lakes that share several features with Lake Catemaco, a eutrophic tropical Mexican lake. Therefore, the plankton ciliate composition, abundance, and biomass of Lake Catemaco were studied to assess their role in the microbial food web. The data were obtained from surface and bottom water samples collected at eleven points during three surveys in 2011 and an additional survey in 2013, with the surveys covering the local climatic seasons. The most abundant components of the plankton ciliate assemblages were small prostomatids (Urotricha spp., choreotrichs (Rimostrombidium spp., cyclotrichs (Mesodinium and Askenasia, and scuticociliates (Cyclidium, Cinetochilum, Pleuronema, and Uronema. Other important ciliates in terms of abundance and/or biomass were haptorids (Actinobolina, Belonophrya, Monodinium, Paradileptus, and Laginophrya, Halteria, oligotrichs (Limnostrombidium and Pelagostrombidium, Linostomella, Bursaridium, Cyrtolophosis, and Litonotus. The ciliate abundance averaged 57 cells mL-1 and ranged from 14 to 113 cells mL-1. The mean ciliate biomass was 71 µg C L-1 and ranged from 10 to 202 µg C L-1. Differences were not detected in ciliate abundance or biomass between the sampling points or sampling depths (surface to bottom; however, significant differences were observed between seasons for both variables. Nano-sized filamentous cyanobacteria were the most

  17. Association of DNA with nuclear matrix in in vitro assembled nuclei induced by rDNA from Tetrahymena shanghaiensis in Xenopus egg extracts

    Institute of Scientific and Technical Information of China (English)



    The nuclei assembled from exogenous DNA or chromatin in egg extracts resemble their in vivo counterparts in many aspects.However,the distribution pattern of DNA in these nuclei remains unknown.We introduced rDNA from the macronuclei of Tetrahymena into Xenopus cellfree extracts to examine the association of specific DNA sequences with nuclear matrix(NM) in the nuclei assembled in vitro.Our previous works showed the 5'NTS(nontranscription sequences) of the rDNA specifically bind to the NM system in the macronuclei.We show now the rDNA could induce chromatin assembly and nuclear formation in Xenopus cell-free system.When we extracted the NM system and compared the binding affinity of different regions of rDNA with the NM system,we found that the 5'NTS still hold their binding affinity with insoluble structure of the assembled nuclei in the estracts of Xenopus eggs.

  18. 抗癌药卡培他滨对四膜虫的生态毒性研究%Toxicity of Capecitabine to Protozoa TetrahymenaThermophila

    Institute of Scientific and Technical Information of China (English)

    何忠; 高礼; 白琦锋; 袁涛


    水环境抗癌药残留的生态毒性效应是当前环境领域研究热点。本文以四膜虫为模式生物,研究了抗癌药卡培他滨(CAP)对四膜虫的毒性作用。结果表明,0.25-16μMCAP对四膜虫的生长抑制无显著影响。CAP对罗丹明B在四膜虫体内积累的试验结果显示CAP对四膜虫的多药耐药性(MDR)的影响亦不显著。研究结果提示,要进一步探索敏感物种和敏感分子指标,同时考虑CAP代谢产物的生态毒性,为科学认识和评价抗癌药生态风险积累基础数据。%The toxic effects of capecitabine to model organism protozoa Tetrahymenathermophila were evaluated.The results showed that 0.25-16 μM CAP had no significant effect on the growth of Tetrahymena thermophile.The accumulation test of Rhodamine B in Tetrahymena thermophile showed that CAP has little influence on its multidrug resistance.It was suggested that more attention should be paid to explore sensitive species and sensitive molecular indicator and consider ecotoxicity of the metabolite of CAP.This study accumulates datafor the ecological risk assessments and scientific understandings of the pollutant.

  19. Trichodina modesta: an exotic ciliate in the Neotropical region parasitizing an unusual host. (United States)

    Valladão, Gustavo Moraes Ramos; Giannecchini, Luiz Gustavo; Martins, Maurício Laterça; de Pádua, Santiago Benites


    In this study, an important ornamental fish, Betta splendens (Osphronemidae), from three different Brazilian states was examined for parasitic infestations. Smears with parasites were impregnated with silver nitrate or stained using Giemsa for taxonomic evaluation. A disc-shaped trichodinid with a body diameter of 39.7 ± 3.3 µm, adhesive disc diameter of 32.9 ± 3.1 µm and denticulate ring diameter of 19.5 ± 2.0 µm was found. The morphological characteristics resembled those of Trichodina modesta Lom, 1970, a species that shows clear host specificity for Cypriniformes. Until now, its occurrence was restricted to the Eurasian region. In the present study, a new host for T. modesta is reported and therefore the first occurrence of this species in the Americas. The parasite was possibly introduced into the Neotropical region through the exotic fish trade, especially of Cypriniformes used by aquarists. The distribution of this ciliate is discussed and a checklist of localities and hosts for the species is provided. PMID:26154956

  20. Morphology, ontogeny, and phylogeny of two brackish urostylid ciliates (Protist, Ciliophora, Hypotricha). (United States)

    Chen, Xumiao; Miao, Miao; Ma, Honggang; Al-Rasheid, Khaled A S; Xu, Kuidong; Lin, Xiaofeng


    The diversity of hypotrichous ciliates has encouraged numerous researchers to use a combination of morphological, morphogenetic, and phylogenetic data to provide a better understanding of the evolutionary relationships within this complex group. In this study, we investigate the morphology and morphogenesis of Pseudourostyla subtropica sp. nov., isolated from mangrove wetland. The new species can be distinguished from its congeners by the huge body size, many more adoral membranelles and marginal cirral rows, and numerous macronuclear nodules. In addition, we provide a morphological characterization of a population of Pseudourostyla nova Wiackowski 1988 from an estuarine habitat. The main events during binary fission of P. subtropica sp. nov. and the Chinese population of P. nova are also revealed to be conservative. The morphological, ontogenetic, and phylogenetic analyses based on the SSU rDNA sequences corroborate the monophyly of Pseudourostyla Borror, 1972, which corresponds well with previous research. The phylogenetic analyses also show that Pseudourostyla and Hemicycliostyla Stokes, 1886, both of which are assigned to the family Pseudourostylidae based on morphological and morphogenetic data, in fact fall into separated clades. The approximately unbiased tests, however, do not reject the possibility that the family Pseudourostylidae is a monophyletic lineage. PMID:25040093

  1. Space station image captures a red tide ciliate bloom at high spectral and spatial resolution. (United States)

    Dierssen, Heidi; McManus, George B; Chlus, Adam; Qiu, Dajun; Gao, Bo-Cai; Lin, Senjie


    Mesodinium rubrum is a globally distributed nontoxic ciliate that is known to produce intense red-colored blooms using enslaved chloroplasts from its algal prey. Although frequent enough to have been observed by Darwin, blooms of M. rubrum are notoriously difficult to quantify because M. rubrum can aggregate into massive clouds of rusty-red water in a very short time due to its high growth rates and rapid swimming behavior and can disaggregate just as quickly by vertical or horizontal dispersion. A September 2012 hyperspectral image from the Hyperspectral Imager for the Coastal Ocean sensor aboard the International Space Station captured a dense red tide of M. rubrum (10(6) cells per liter) in surface waters of western Long Island Sound. Genetic data confirmed the identity of the chloroplast as a cryptophyte that was actively photosynthesizing. Microscopy indicated extremely high abundance of its yellow fluorescing signature pigment phycoerythrin. Spectral absorption and fluorescence features were related to ancillary photosynthetic pigments unique to this organism that cannot be observed with traditional satellites. Cell abundance was estimated at a resolution of 100 m using an algorithm based on the distinctive yellow fluorescence of phycoerythrin. Future development of hyperspectral satellites will allow for better enumeration of bloom-forming coastal plankton, the associated physical mechanisms, and contributions to marine productivity. PMID:26627232

  2. Electrochemical study of the interaction between Eu3+ and ciliate Euplotes octocarinatus centrin

    International Nuclear Information System (INIS)

    A new species was formed when protein P23 (one segment of ciliate Euplotes octocarinatus centrin) was added to a solution of Eu3+. The interaction between P23 and Eu3+ was investigated by cyclic voltammetry, pulse voltammetry and electrochemical impedance spectroscopy in 10 mM N-2-hydroxyethylpiperazine-N-2-ethanesulfonic acid (HEPES) buffer (pH 7.4) using a pyrolytic graphite electrode. The formal potential (Eo') of Eu3+ shifted from -0.61 to -0.84 V (versus saturated calomel electrode) after P23 was added to the Eu3+ solution. The diffusion coefficient (D), the charge-transfer coefficient (α) and the electron transfer standard rate constant (ks) were obtained in the absence and the presence of P23. The affinity constant of Eu3+ and P23 was determined to be (1.89 ± 0.51) x 104 M-1. The electrochemical investigation of europium bound to the protein provided useful data for the studies of calcium-binding proteins.

  3. Genealogical analyses of multiple loci of litostomatean ciliates (Protista, Ciliophora, Litostomatea). (United States)

    Vd'ačný, Peter; Bourland, William A; Orsi, William; Epstein, Slava S; Foissner, Wilhelm


    The class Litostomatea is a highly diverse ciliate taxon comprising hundreds of free-living and endocommensal species. However, their traditional morphology-based classification conflicts with 18S rRNA gene phylogenies indicating (1) a deep bifurcation of the Litostomatea into Rhynchostomatia and Haptoria+Trichostomatia, and (2) body polarization and simplification of the oral apparatus as main evolutionary trends in the Litostomatea. To test whether 18S rRNA molecules provide a suitable proxy for litostomatean evolutionary history, we used eighteen new ITS1-5.8S rRNA-ITS2 region sequences from various free-living litostomatean orders. These single- and multiple-locus analyses are in agreement with previous 18S rRNA gene phylogenies, supporting that both 18S rRNA gene and ITS region sequences are effective tools for resolving phylogenetic relationships among the litostomateans. Despite insertions, deletions and mutational saturations in the ITS region, the present study shows that ITS1 and ITS2 molecules can be used to infer phylogenetic relationships not only at species level but also at higher taxonomic ranks when their secondary structure information is utilized to aid alignment. PMID:22789763

  4. Novel Discovery of Two Heterotrichid Ciliates, Climacostomum virens and Fabrea salina (Ciliophora: Heterotrichea: Heterotrichida in Korea

    Directory of Open Access Journals (Sweden)

    Kim, Ji Hye


    Full Text Available Two heterotrichid ciliates, Climacostomum virens (Ehrenberg, 1838 Stein, 1859 from brackish water and freshwater, and Fabrea salina Henneguy, 1890 from a solar saltern, were collected in Korea. They are novelly investigated in Korea by means of live observation, protargol staining and nuclear small subunit (SSU rRNA gene sequencing. Climacostomum virens is characterized by pouch-like body shape, body length of $200-370{\\mu}m$ 수식 이미지 in vivo, conspicuous cytopharyngeal tube, macronuclei ribbon-like shape, and one to four in number, with or without symbiont algae in cytoplasm, 34-66 somatic kineties, 67-113 adoral zone of membranelles, 8-42 peristomial kineties, 24-37 apical membranelles. SSU rDNA sequence size is 1,591 bp and GC contents 48.52%. Fabrea salina is also characterized by scoop-like body shape with proboscis, body length of $190-240{\\mu}m$ 수식 이미지 in vivo, one to two rod-shaped macronuclei, oval micronuclei, grayish green cortical granules, 104-186 somatic kineties, 4-8 preoral kineties, 7-19 peristomial kineties and fragmented paroral membrane. SSU rDNA sequence size is 1,598 bp and GC contents 47.50%.

  5. Propulsion of swimming microrobots inspired by metachronal waves in ciliates: from biology to material specifications

    International Nuclear Information System (INIS)

    The quest for swimming microrobots originates from possible applications in medicine, especially involving navigation in bodily fluids. Swimming microorganisms have become a source of inspiration because their propulsion mechanisms are effective in the low-Reynolds number regime. In this study, we address a propulsion mechanism inspired by metachronal waves, i.e. the spontaneous coordination of cilia leading to the fast swimming of ciliates. We analyse the biological mechanism (referring to its particular embodiment in Paramecium caudatum), and we investigate the contribution of its main features to the swimming performance, through a three-dimensional finite-elements model, in order to develop a simplified, yet effective artificial design. We propose a bioinspired propulsion mechanism for a swimming microrobot based on a continuous cylindrical electroactive surface exhibiting perpendicular wave deformations travelling longitudinally along its main axis. The simplified propulsion mechanism is conceived specifically for microrobots that embed a micro-actuation system capable of executing the bioinspired propulsion (self-propelled microrobots). Among the available electroactive polymers, we select polypyrrole as the possible actuation material and we assess it for this particular embodiment. The results are used to appoint target performance specifications for the development of improved or new electroactive materials to attain metachronal-waves-like propulsion. (paper)

  6. Inter-annual ciliate distribution variation within the late stratification oxycline in a monomictic lake, Lake Alchichica (Mexico

    Directory of Open Access Journals (Sweden)

    Ximena Sánchez Medina


    Full Text Available noxia, and ciliates might play a very important role in the plankton community budget there. We analysed changes in the composition and biomass of the ciliate assemblage and other microbial loop components throughout the oxycline just at the end of stratification in a warm-monomictic lake, Lake Alchichica, Mexico (four samplings: 2006-2008, 2010; the results were compared with those obtained from another lake from the region, La Preciosa, sampled in 2010. Bacteria, autotrophic picoplankton (APP and flagellates were analysed using epifluorescence microscopy. Ciliates were evaluated either in DAPI stained samples (looking for pigmented organelles and/or ingested phototrophs or in quantitative protargol stain (QPS permanent preparations, where they were identified at the genus or species level. The end of the stratification period in Lake Alchichica was characterized by almost uniform heterotrophic picoplankton (HPP numbers (106 cells mL-1 throughout the water column. Meanwhile, APP showed epilimnetic and/or metalimnetic maxima of 105 cells mL-1 followed by an order of magnitude drop in the hypolimnion. A very important peak (105 cells mL-1 of the autotrophic or mixotrophic flagellate Pyramimonas sp. was observed repeatedly above and within the oxycline of Lake Alchichica. Ciliate biomass maxima were found around the oxycline and in the above-bottom layer. The top of the oxycline was dominated by Euplotes spp. and Spirostomum teres fine- to coarse-filter feeders (feeding upon APP, nanodiatoms and algae. Raptorial haptorids (in particular, Phialina sp. were the second most important group, generally occupying the layer below euplotids, followed by Holophrya and Prorodon facultative anaerobic prostomes. Sometimes, strictly anaerobic Caenomorpha sp. was found to be important in the anoxic hypolimnion. Minute picoplankton feeding species (both APP and heterotrophic bacteria feeders were important throughout the water column: in the epilimnion

  7. Ciliate Nassula sp. grazing on a microcystin-producing cyanobacterium (Planktothrix agardhii): impact on cell growth and in the microcystin fractions

    Energy Technology Data Exchange (ETDEWEB)

    Combes, Audrey; Dellinger, Marc [' Molecules de communication et adaptation des microorganismes' , UMR 7245 CNRS-MNHN, Museum national d' Histoire naturelle, CP 39, 57 rue Cuvier, F-75231 Paris Cedex 05 (France); Cadel-six, Sabrina [' Unite Caracterisation des Toxines' - Laboratoire de securite des aliments de Maisons-Alfort - ANSES, F-94701 Maisons Alfort Cedex (France); Amand, Severine [' Molecules de communication et adaptation des microorganismes' , UMR 7245 CNRS-MNHN, Museum national d' Histoire naturelle, CP 39, 57 rue Cuvier, F-75231 Paris Cedex 05 (France); Comte, Katia, E-mail: [' Molecules de communication et adaptation des microorganismes' , UMR 7245 CNRS-MNHN, Museum national d' Histoire naturelle, CP 39, 57 rue Cuvier, F-75231 Paris Cedex 05 (France)


    The proliferation of microcystins (MCs)-producing cyanobacteria (MCs) can have detrimental effects on the food chain in aquatic environments. Until recently, few studies had focused on the fate of MCs in exposed organisms, such as primary consumers of cyanobacteria. In this study, we investigate the impact of an MC-producing strain of the cyanobacterium Planktothrix agardhii on the growth and physiology of a Nassula sp. ciliate isolated from a non-toxic cyanobacterial bloom. We show that this Nassula sp. strain was able to consume and grow while feeding exclusively on an MC-producing cyanobacterium over a prolonged period of time (8 months). In short-term exposure experiments (8 days), ciliates consuming an MC-producing cyanobacterial strain displayed slower growth rate and higher levels of antioxidant enzymes than ciliates feeding on two non-MC-producing strains. Three high-performance methods (LC/MS, LC/MS-MS and ELISA) were used to quantify the free and bound MCs in the culture medium and in the cells. We show that ciliate grazing led to a marked decrease in free MCs (methanol extractable) in cells, the MCs were therefore no longer found in the surrounding culture medium. These findings suggest that MCs may have undergone redistribution (free vs bound MCs) or chemical degradation within the ciliates.

  8. Effects of a radiosensitizer and radiation on the ciliated mucous membrane

    International Nuclear Information System (INIS)

    Fractionated irradiation (2 Gy/F, TD:2-20 Gy) in vivo on the ciliated epithelium of the rabbit's trachea, caused measurable physiological alternations ten consecutive days after completion of irradiation with an initial heightening of the ciliary activity after 2 and 4 Gy, followed by a dose-dependent decrease. On scanning electron microscopy-pictures, knobs were observed on the cilia with the number being related to the dose. The addition of misonidazole potentiated the effects described above, with an enhancement ratio ( physiologically) of 1.2 and an enhancement ratio (morphologically) of 1.6. Furthermore, administration of misonidazole to the rabbits caused an increased vascularity in the subepithelial layer of the trachea, directly correlated to an oedema in the same region. Single doses (2,2.5,5,10,15,20,25, and 30 Gy) were given to the trachea in vivo and daily investigation of the ciliary beating and morphologic examinations of the tissue were made for ten days. The ciliary activity showed a dose-dependent reduction of about 50% after 30 Gy. A development of damage, in relation to the dose, was observed in the cilia. The changes were blebs, swollen tips, bent and curved tips, and broken cilia clustered together. During in vitro irradiation with 10 Gy Single Dose, an increase of the ciliary activity to about 25 % of its original value was observed without any morphological changes, while in vivo irradiation and examinations during 10 days thereafter, showed three different phases, day 1-3: Stimulation phase, day 4-8: Damage-phase, day 9-10: Repair-phase. The ciliary epithelium offers an exceptional system for the study of early radiobiological effects, since mutual comparisons can be made between physiology and morphology. (Author)

  9. Proteomic approach to reveal the proteins associated with encystment of the ciliate Euplotes encysticus.

    Directory of Open Access Journals (Sweden)

    Jiwu Chen

    Full Text Available In order to identify and reveal the proteins related to encystment of the ciliate Euplotes encysticus, we analyzed variation in the abundance of the proteins isolated from the resting cyst comparing with proteins in the vegetative cell. 2-D electrophoresis, MALDI-TOF MS techniques and Bioinformatics were used for proteome separation, quantification and identification. The comparative proteomics studies revealed 26 proteins with changes on the expression in the resting cysts, including 12 specific proteins and 14 differential proteins. 12 specific proteins and 10 out of the 14 differential proteins were selected and identified by MALDI-TOF MS. The identified specific proteins with known functions included type II cytoskeletal 1, keratin, Nop16 domain containing protein, protein arginine n-methyltransferase, epsilon-trimethyllysine hydroxylase and calpain-like protein. The identified differential proteins with known functions included Lysozyme C, keratinocyte growth factor, lysozyme homolog AT-2, formate acetyltransferase, alpha S1 casein and cold-shock protein. We discussed the functions of these proteins as well as their contribution in the process of encystment. These identified proteins covered a wide range of molecular functions, including gene regulation, RNA regulation, proteins degradation and oxidation resistance, stress response, material transport and cytoskeleton organization. Therefore, differential expression of these proteins was essential for cell morphological and physiological changes during encystment. This suggested that the peculiar proteins and differential proteins might play important roles in the process of the vegetative cells transforming into the resting cysts. These observations may be novel findings that bring new insights into the detailed mechanisms of dormancy.

  10. 红椿育苗密度研究%Cultivation Density of Toona ciliate

    Institute of Scientific and Technical Information of China (English)

    吴际友; 黄明军; 陈明皋; 程勇; 廖德志; 李艳; 刘球; 王旭军


    为了探讨2年生红椿苗最佳的育苗密度,开展了红椿育苗密度试验研究,结果表明:随着育苗密度增加,苗木的苗高和地径均减小,苗木的质量下降。因此,确定合理的育苗密度是培育优质红椿苗并取得最佳育苗效益的关键。研究表明:二年生的红椿苗木如只生产Ⅰ级苗,则合适的育苗密度为30株/m2;如Ⅰ、Ⅱ级苗均用于生产造林,则合适的育苗密度为40株/m2。%ln order to discuss the optimum seedling density of Toona ciliate, different seedling densities were studied. The results showed that seeding height and basal diameter decreased and quality of the seedlings declined with the increase of seedling density. The reasonable density of seedlings is key to cultivate high-quality seedlings and achieve the best seedling efficiency. The optimum density was 30 plants/m2 for the first class seedlings of biennial seedlings, and the optimum density of l and ll seedlings for production afforestation was 40 plants/m2.

  11. Further insights into the phylogeny of two ciliate classes Nassophorea and Prostomatea (Protista, Ciliophora). (United States)

    Zhang, Qianqian; Yi, Zhenzhen; Fan, Xinpeng; Warren, Alan; Gong, Jun; Song, Weibo


    The Nassophorea and Prostomatea are two of the key classes in understanding the morphological diversification and higher classification of the phylum Ciliophora. However, their phylogenetic relationships with other ciliate groups within the subphylum Intramacronucleata remain elusive. In this study, we investigated the small and large subunit (SSU and LSU) rRNA gene-based phylogeny of these groups with sequences of additional taxa including several key species. The results show that: (1) the class Nassophorea remains polyphyletic, with the microthoracids clustering with the Phyllopharyngea, whereas the nassulids represent a basal group of the CONthreeP superclade in the SSU tree; (2) the Prostomatea is not depicted as a monophyletic group in phylogenetic trees, and the monophyly of this class is marginally rejected by statistical tree topology tests; (3) the nassulid genus Parafurgasonia is more closely related to the family Colpodidiidae than to Furgasonia; (4) Paranassula, which was previously thought to be a nassulid, is phylogenetically related to the oligohymenophorean peniculids in both the SSU and LSU trees; (5) the microthoracid genus Discotricha does not group with the other microthoracids in either SSU or LSU trees; (6) the family Plagiocampidae is closely related to the prostome parasite Cryptocaryon irritans and to the family Urotrichidae in the order Prorodontida; and (7) the family Placidae, represented by Placus salinus, is sister to the family Holophryidae in the order Prorodontida. Based on the present data, we consider the genus Discotricha to be an unclassified taxon within the CONthreeP. We also propose resurrecting the order Paranassulida and classifying it within the subclass Peniculia, class Oligohymenophorea. Primary and secondary structure signatures for higher taxa within Phyllopharyngea and Nassophorea are supplied. PMID:24075983

  12. Improvement of silver impregnation technique (Protargol to obtain morphological features of protists ciliates, flagellates and opalinates

    Directory of Open Access Journals (Sweden)

    SILVA-NETO I. D. da


    Full Text Available The research on ciliates, flagelates and opalinates have been widespread by the utilization of techniques employing silver impregnation (Protargol, modified by several authors. However, these are time consuming and its results are variable. The present work is a variant of the technique described by Tuffrau (1964, 1967 showing some adaptations made in our laboratory. The organisms can be preserved by different fixatives (alcoholic Bouin, Stieve's fluid, 2.5% glutaraldehyde and others and then rinsed in destilled water followed by a fast clarification by 3% sodium hypochloride. If the organism is very sensitive to hypochloride, 4% sodium lauryl sulfate may be used and then washed 3 times in distilled water. The protista can be adhered to the glass slides with Mayer's glycerinated-albumin (1 glycerin vol. to 1 or 2 albumin vol., diluted in water at a proportion of 1:10 Cv/v., or with 1% polylysine followed by fast washes with distilled water. After the slide preparation, they were covered with a layer of 0,8% Silver proteinate. Right after that, the slide has to be placed in a glass tray lined with moist tissue and covered to prevent the proteinate to dry. The tray was placed in a incubator at 40º-50ºC for 30 minutes. The slides are rinsed for 1 minute. with warm (35ºC distilled water. The development of the material should be done with 0.4% hydroquinone with a maximum incubation time of 1 minute. It should be developed gradually, controlling the silver impregnation intensity by observation under optical microscope. Next, rinse in distilled water for 1 minute, and then, fix in 2,5% Sodium thiosulfate. Rinse the slide for two minutes before dehydrating it in an alcoholic serial 50-100º. Finally rinse the slides in xylene. Mount the slides with Entellan MerckTM or Canada balsam.

  13. Gene expression in a paleopolyploid: a transcriptome resource for the ciliate Paramecium tetraurelia

    Directory of Open Access Journals (Sweden)

    Kapusta Aurélie


    Full Text Available Abstract Background The genome of Paramecium tetraurelia, a unicellular model that belongs to the ciliate phylum, has been shaped by at least 3 successive whole genome duplications (WGD. These dramatic events, which have also been documented in plants, animals and fungi, are resolved over evolutionary time by the loss of one duplicate for the majority of genes. Thanks to a low rate of large scale genome rearrangement in Paramecium, an unprecedented large number of gene duplicates of different ages have been identified, making this organism an outstanding model to investigate the evolutionary consequences of polyploidization. The most recent WGD, with 51% of pre-duplication genes still in 2 copies, provides a snapshot of a phase of rapid gene loss that is not accessible in more ancient polyploids such as yeast. Results We designed a custom oligonucleotide microarray platform for P. tetraurelia genome-wide expression profiling and used the platform to measure gene expression during 1 the sexual cycle of autogamy, 2 growth of new cilia in response to deciliation and 3 biogenesis of secretory granules after massive exocytosis. Genes that are differentially expressed during these time course experiments have expression patterns consistent with a very low rate of subfunctionalization (partition of ancestral functions between duplicated genes in particular since the most recent polyploidization event. Conclusions A public transcriptome resource is now available for Paramecium tetraurelia. The resource has been integrated into the ParameciumDB model organism database, providing searchable access to the data. The microarray platform, freely available through NimbleGen Systems, provides a robust, cost-effective approach for genome-wide expression profiling in P. tetraurelia. The expression data support previous studies showing that at short evolutionary times after a whole genome duplication, gene dosage balance constraints and not functional change are

  14. Preliminary insights into the impact of dietary starch on the ciliate, Neobalantidium coli, in captive chimpanzees.

    Directory of Open Access Journals (Sweden)

    Kateřina Schovancová

    Full Text Available Infections caused by the intestinal ciliate Neobalantidium coli are asymptomatic in most hosts. In humans and captive African great apes clinical infections occasionally occur, manifested mainly by dysentery; however, factors responsible for development of clinical balantidiasis have not been fully clarified. We studied the effect of dietary starch on the intensities of infection by N. coli in two groups of captive chimpanzees. Adult chimpanzees infected by N. coli from the Hodonín Zoo and from the Brno Zoo, Czech Republic, were fed with a high starch diet (HSD (average 14.7% of starch for 14 days, followed by a five-day transition period and subsequently with a period of low starch diet (LoSD (average 0.1% of starch for another 14 days. We collected fecal samples during the last seven days of HSD and LoSD and fixed them in 10% formalin. We quantified trophozoites of N. coli using the FLOTAC method. The numbers of N. coli trophozoites were higher during the HSD (mean ± SD: 49.0 ± 134.7 than during the LoSD (3.5 ± 6.8. A generalized linear mixed-effects model revealed significantly lower numbers of the N. coli trophozoites in the feces during the LoSD period in comparison to the HSD period (treatment contrast LoSD vs. HSD: 2.7 ± 0.06 (SE, z = 47.7; p<<0.001. We conclude that our data provide a first indication that starch-rich diet might be responsible for high intensities of infection of N. coli in captive individuals and might predispose them for clinically manifested balantidiasis. We discuss the potential nutritional modifications to host diets that can be implemented in part to control N. coli infections.

  15. A mesocosm study of the changes in marine flagellate and ciliate communities in a crude oil bioremediation trial. (United States)

    Gertler, Christoph; Näther, Daniela J; Gerdts, Gunnar; Malpass, Mark C; Golyshin, Peter N


    Protozoan grazers play an important role in controlling the density of crude-oil degrading marine communities as has been evidenced in a number of microcosm experiments. However, small bioreactors contain a low initial titre of protozoa and the growth of hydrocarbon-depleting bacteria is accompanied by the fast depletion of mineral nutrients and oxygen, which makes microcosms rather unsuitable for simulating the sequence of events after the oil spill in natural seawater environment. In the present study, the population dynamics of marine protozoan community have been analysed in a 500 l mesocosm experiment involving bioaugmented oil booms that contained oil sorbents and slow-release fertilisers. A significant increase in numbers of marine flagellates and ciliates on biofilms of oil-degrading microbes was microscopically observed as early as 8 days after the start of the experiment, when protozoa exhibited a population density peak making up to 3,000 cells ml(-1). Further, the protozoan density varied throughout the experiment, but never dropped below 80 cells ml(-1). An 18S rRNA gene-based fingerprinting analysis revealed several changes within the eukaryotic community over the whole course of the experiment. Initial growth of flagellates and small ciliates was followed by a predominance of larger protozoa. According to microscopic observations and SSU rRNA molecular analyses, most predominant were the ciliates belonging to Euplotidae and Scuticociliatia. This is the first study to characterise the eukaryotic communities specifically in a large-scale oil bioremediation trial using both microscopy-based and several molecular techniques. PMID:20393846

  16. Potential risk of Mesodinium rubrum bloom in aquaculture area of Dapeng'ao cove, China: diurnal changes in the ciliate community structure in the surface water

    Directory of Open Access Journals (Sweden)

    Huaxue Liu


    Full Text Available Diurnal changes in the structure of the ciliate community in surface waters were studied in the aquaculture area of Dapeng'ao cove,China. Two periods of heavy rainfall occurred during the study period, intensifying water column stratification and influencing the water'sproperties. A total of 21 ciliate taxa from 15 genera were identified; the dominant species was Mesodinium rubrum. The maximumabundance of M. rubrum reached 3.92 × 104 indiv. dm-3,contributing 95.1% (mean value to the total ciliate abundance.Diurnal changes in M. rubrum abundance were highly variable, the driving force probably being irradiance and food availability.The results suggest that M. rubrum may form blooms in aquaculture areas when there is a suitable physical regime with enriched nutrients,which is potentially harmful to the fish-farming industry.


    Institute of Scientific and Technical Information of China (English)

    龚骏; 马宏伟; 宋微波


    The living morphology, nuclear apparatus, infraciliature and silverline system of the poorly-known ciliate Pseudocohnilembus hargisi Evans & Thompson, 1964, collected from a shrimp culture pond in Qingdao, China, were examined by observation of the live specimen ; and by the pyridinated carbonate method and Chatton-Lwoff technique. The main characteristics: 13 - 14 (usually 13) longitudinal or slightly spirally arranged somatic kineties; single contractile vacuole with usually 2 ( 1 - 2) pores at posterior ends of the fourth and fifth somatic kineties to the fight of the buccal cavity. Several related congeners were compared and morphometrically tabulated.

  18. Cultivation-independent analysis reveals a shift in ciliate 18S rRNA gene diversity in a polycyclic aromatic hydrocarbon-polluted soil


    Lara, Enrique; Berney, Cédric; Harms, Hauke; Chatzinotas, Antonis


    Using cultivation-independent methods the ciliate communities of a clay-rich soil with a 90-year record of pollution by polycyclic aromatic hydrocarbons (PAH) (4.5 g kg−1 PAH) were compared with that of a nonpolluted soil collected in its vicinity and with similar properties. A ciliate-specific set of 18S rRNA gene targeting primers was designed and used to amplify DNA extracted from both soils (surface and 20 cm depth). Four clone libraries were generated with PCR products that covered an 18...

  19. Ciliated Median Raphe Cyst of Perineum Presenting as Perianal Polyp: A Case Report with Immunohistochemical Study, Review of Literature, and Pathogenesis


    Jayesh Sagar; Bethani Sagar; Patel, Adam F.; Shak, D.K.


    Median raphe cyst is a very rare, benign congenital lesion occurring mainly on the ventral aspect of the penis, but can develop anywhere in the midline between the external urethral meatus and anus. We report a case of median raphe cyst in the perineum presenting as a perianal polyp in a 65-year-old, English white male with exceptionally rare ciliated epithelium. According to our knowledge, this is the third such case of ciliated median raphe cyst in the English literature. This case, also th...

  20. Distribution of ciliates in relation to environmental factors along the coastline of the Gulf of Gabes, Tunisia (United States)

    Kchaou, Nouha; Elloumi, Jannet; Drira, Zaher; Hamza, Asma; Ayadi, Habib; Bouain, Abderrahmen; Aleya, Lotfi


    We studied the seasonal distribution of the ciliate community coupled with environmental factors along the coast at three stations sampled (from March 2006 to February 2007) in the Gulf of Gabes (Tunisia, Eastern Mediterranean Sea). A total of 56 species belonging to 11 orders, were identified. Harbor of Gabes station was more diversified (45 species) than both Tabia (26 species) and Karboub (31 species) stations. The ciliate assemblage was numerically dominated by Spirotrichea in Tabia (82% of the total abundance), in the Harbor of Gabes (86% of the total abundance), whereas, in Karboub, Spirotrichea represented only 40% of the total abundance. The unexpected lower quantitative importance of Spirotrichea in Karboub station was apparently the result of the high salt concentration found in water samples throughout the study, probably originating from the saline area surrounding Karboub station, known as Sabkha. The distribution of species in the nearshore of the Gulf of Gabes seemed most likely influenced by the combined effects of temperature, salinity and hydrographic conditions.

  1. Fate of engineered cerium oxide nanoparticles in an aquatic environment and their toxicity toward 14 ciliated protist species. (United States)

    Zhang, Wei; Pu, Zhichao; Du, Songyan; Chen, Yongsheng; Jiang, Lin


    The potential environmental impacts of engineered cerium oxide nanoparticles (CeO2 NPs) on aquatic organisms have remained largely unknown. Therefore, the laboratory study featured herein was performed to determine the fate of CeO2 NPs in an aquatic environment and their toxicity towards 14 different ciliated protist species at a specified population level. An investigation of 48 h aggregation kinetics in the Dryl's solution showed the CeO2 NPs to be relatively stable. The pH values in three test medium were too far away from PZC, which explained the stability of CeO2 NPs. CeO2 NPs generally elicited more toxicity with increasing NP concentration, following certain dose-response relationships. Nano-CeO2 resulted in greater toxicity in a particle state than when added as bulk material. LC50 values showed a negative correlation with the surface-to-volume ratio for these protists, suggesting that surface adsorption of CeO2 NPs might contribute to the observed toxicity. Additionally, acute toxic responses of 14 ciliated protist species to CeO2 NPs were not significantly phylogenetically conserved. The results of these observations provide a better insight into the potential risks of CeO2 NPs in an aquatic environment. PMID:26986089

  2. Non-invasive detection and quantification of the parasitic ciliate Ichthyophthirius multifiliis by real-time PCR. (United States)

    Jousson, Olivier; Pretti, Carlo; Di Bello, Domenica; Cognetti-Varriale, Anna M


    The main parasitic threat to freshwater fish is the ciliate Ichthyophthirius multifiliis. We developed a real-time PCR assay using SYBR Green intercalating fluorescent dye for rapid detection and quantification of I. multifiliis. This non-invasive assay was based on the quantification of I. multifiliis free-swimming stages from filtered water samples, and thus made it possible to preserve host individuals. An alignment of 18S rDNA sequences of I. multifiliis and related species of the ciliate order Hymenostomatida was used to design amplification primers specifically targeting the I. multifiliis 18S rDNA gene. Different standard curves consisting of 2-fold serial dilutions of DNA extracted from 20, 60, 100 and 1000 I. multifiliis cells were constructed. The assay was able to detect less than 0.5 cell equivalent and showed a strong linearity (R2 = 0.984). Water samples were collected from 2 tanks containing heavily infected and apparently uninfected Carassius auratus specimens and were used to test this technique. Positive signals were obtained from water samples collected from both tanks, with a deduced concentration ranging from 3 to 58 I. multifiliis cells l(-1). The assay can detect low concentrations of the parasite in water, presumably corresponding to an early phase of the disease. It may, thus, be a valuable tool in assisting in the monitoring and control of ichthyophthiriasis in aquaculture. PMID:16119894

  3. OCT-based quantification of flow velocity, shear force, and power generated by a biological ciliated surface (Conference Presentation) (United States)

    Huang, Brendan K.; Khokha, Mustafa K.; Loewenberg, Michael; Choma, Michael A.


    In cilia-driven fluid flow physiology, quantification of flow velocity, shearing force, and power dissipation is important in defining abnormal ciliary function. The capacity to generate flow can be robustly described in terms of shearing force. Dissipated power can be related to net ATP consumption by ciliary molecular motors. To date, however, only flow velocity can be routinely quantified in a non-invasive, non-contact manner. Additionally, traditional power-based metrics rely on metabolic consumption that reflects energy consumption not just from cilia but also from all active cellular processes. Here, we demonstrate the estimation of all three of these quantities (flow velocity, shear force, and power dissipation) using only optical coherence tomography (OCT). Specifically, we develop a framework that can extract force and power information from vectorial flow velocity fields obtained using OCT-based methods. We do so by (a) estimating the viscous stress tensor from flow velocity fields to estimate shearing force and (b) using the viscous stress tensor to estimate the power dissipation function to infer total mechanical power. These estimates have the advantage of (a) requiring only a single modality, (b) being non-invasive in nature, and (c) being reflective of only the net power work generated by a ciliated surface. We demonstrate our all-optical approach to the estimation of these parameters in the Xenopus animal model system under normal and increased viscous loading. Our preliminary data support the hypothesis that the Xenopus ciliated surface can increase force output under loading conditions.

  4. The response of the ciliated epithelium during and after exposure to ionizing radiation

    International Nuclear Information System (INIS)

    Irradiation of the ciliated tissues of the body gives undesirable sideefects. In vitro irradiation (10 Gy) of the rabbit's trachea shows that 1.5 Gy of indirectly ionizing radiation (50 kV and 6 MV X-ray 60Co-gamma 1.25 MeV) causes a 20 per cent increase of the ciliary beat frequency lasting 5-10 seconds, followed by a decline to normal ciliary activity during the ensuing course of irradiation. Electron radiation (4 MeV) proved to be three times more effective than photon radiation in regard to the physiological response of the cilia to ionizing radiation. This finding led to introduction of the concept Relative Physiological Efficiency (RPE) in this study, complementing the Relative Biological Efficiency (RBE) concept. This momentary increase in frequency can be caused by a radiation-induced increased hydrolysis of the ATP available in the cilia. The ciliary activity was 20 per cent lower than normal at 45 min following irradiation (10 Gy, 50 kV X-ray), whereupon it increased to 12 per cent above normal activity at two hours after initial irradiation. At re-irradiation (10 Gy, 50 kV X-ray) administered two hours after initial irradiation, the cilia showed a constant rate of activity. In vivo irradiation (10 Gy, 160 kV X-ray) of the trachea of the rabbit caused a heightened activity (10%) during the first three days after irradiation, indicating a stimulation of the ATP-synthesis. During days 4 to 8 after irradiation, the ciliary epithelium's morphology was damaged resulting in reduced transport ability. Repair took place during days 9 and 10 after irradiation, i.e. the function of the ciliary epithelium appeared to be restored. The membrane potential of the ciliary cell, registered during irradiation (10 Gy, 50 kV X-ray) showed no changes, which supports the assumption that the increased ciliary beat frequency recorded during irradiation can be due to rapid radiation-induced biochemical changes that are connected to the motility of the cilia. (author)

  5. Structure of planktonic ciliates community (Protist, Ciliophora from an urban lake of southern Brazil - doi: 10.4025/actascibiolsci.v35i4.18579

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Machado Velho


    Full Text Available This study examined temporal and spatial (vertical variations of composition, richness and abundance of the planktonic ciliates community in an urban and eutrophic lake, as well as identified the limnological factors involved in determining the patterns observed. To this end, samples of ciliates and measures of limnological variables were taken at different depths and hydrological periods. 35 ciliate species were identified, among which 14 species occurred in all periods and strata, being Prostomatida the most specious, followed by Gymnostomatida, Oligotrichida, Peritrichida, and Scuticociliatida. The patterns found for composition, abundance and species richness evidenced a vertical and temporal variation of these attributes. However, in general the composition and species richness have varied more along the vertical gradient than between periods, whereas for the abundance, only temporal differences could be detected. Results observed herein indicated that benthic species seem to be mainly influenced by the amount of organic matter, phosphorus and ammonia, while planktonic ones, abundant at the surface, were mainly associated with higher dissolved oxygen concentrations. In this way, seasonal and vertical variations of limnological characteristics were decisive for the patterns of occurrence and abundance of ciliate species.

  6. The effect of low- and high-fiber diets on the population of entodiniomorphid ciliates Troglodytella abrassarti in captive chimpanzees (Pan troglodytes)

    Czech Academy of Sciences Publication Activity Database

    Petrželková, Klára Judita; Schovancová, Kateřina; Profousová, Ilona; Kišidayová, S.; Váradyová, Z.; Pekár, S.; Kamler, Jiří; Modrý, David


    Roč. 74, č. 7 (2012), s. 669-675. ISSN 0275-2565 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional support: RVO:68081766 ; RVO:60077344 Keywords : entodiniomorphid ciliate * chimpanzee * fiber * starch Subject RIV: EG - Zoology Impact factor: 2.459, year: 2012

  7. Ciliary-propelling mechanism, effect of temperature and viscosity on swimming speed, and adaptive significance of ‘jumping’ in the ciliate Mesodinium rubrum

    DEFF Research Database (Denmark)

    Riisgård, Hans Ulrik; Larsen, Poul Scheel


    Beating cilia are important organelles, not only for water pumping in many active filter-feeding organisms, but also for the swimming activity of ciliates and other aquatic organisms that use cilia for propulsion. The present study concerns the effect of temperature-dependent viscosity of the amb...

  8. A Review of Some Basic Parasite Diseases in Culture Fisheries Flagellids, Dinoflagellides and Ichthyophthriasis, Ichtyobodiasis, Coccidiosis Trichodiniasis, Heminthiasis, Hirudinea Infestation, Crustacean Parsite and Ciliates


    J.F.N. Abowei; O.F. Briyai; S.E. Bassey


    A review some basic parasite diseases in fish: flagellids, dinoflagellides and ichthyophthriasis in African fish was carried out to educate fish culturist and the private sector on some challenges faced in culture fisheries. Some common parasite diseases: Ichtyobodiasis, Coccidiosis, Ichtyopthiariasis, Trichodiniasis, Heminthiasis, Crustacean parasite, Hirudinea infestation, Flagellates and Ciliates, Taxonomy and diagnosis, Life cycle and biology, Epizootiology, pathology, control, Infections...

  9. A distinct pathway for tetrahymanol synthesis in bacteria (United States)

    Banta, Amy B.; Wei, Jeremy H.; Welander, Paula V.


    Tetrahymanol is a polycyclic triterpenoid lipid first discovered in the ciliate Tetrahymena pyriformis whose potential diagenetic product, gammacerane, is often used as a biomarker for water column stratification in ancient ecosystems. Bacteria are also a potential source of tetrahymanol, but neither the distribution of this lipid in extant bacteria nor the significance of bacterial tetrahymanol synthesis for interpreting gammacerane biosignatures is known. Here we couple comparative genomics with genetic and lipid analyses to link a protein of unknown function to tetrahymanol synthesis in bacteria. This tetrahymanol synthase (Ths) is found in a variety of bacterial genomes, including aerobic methanotrophs, nitrite-oxidizers, and sulfate-reducers, and in a subset of aquatic and terrestrial metagenomes. Thus, the potential to produce tetrahymanol is more widespread in the bacterial domain than previously thought. However, Ths is not encoded in any eukaryotic genomes, nor is it homologous to eukaryotic squalene-tetrahymanol cyclase, which catalyzes the cyclization of squalene directly to tetrahymanol. Rather, heterologous expression studies suggest that bacteria couple the cyclization of squalene to a hopene molecule by squalene-hopene cyclase with a subsequent Ths-dependent ring expansion to form tetrahymanol. Thus, bacteria and eukaryotes have evolved distinct biochemical mechanisms for producing tetrahymanol.

  10. Evidence for synergism of the antimicrobial peptide piscidin 2 with antiparasitic and antioomycete drugs. (United States)

    Zahran, E; Noga, E J


    Piscidins are potent, broad-spectrum, host-produced antimicrobial peptides (AMPs) that appear to constitute the most common AMP family in teleost fish. Here, we show that piscidin 2 has potent activity against the water mould Saprolegnia, one of the most important pathogens of freshwater fish. The minimum oomyceticidal concentration (MOC₁₀₀) of piscidin 2 against zoospores of three pathogenic isolates of Saprolegnia ranged from 12.5 to 25.0 μg mL⁻¹. This piscidin concentration is well within levels that have been estimated to be present in at least some fish (1-32.5 μg mL⁻¹). In the presence of either copper or malachite green, two drugs commonly used to treat water moulds, there was evidence for partial synergism (PSYN) with piscidin 2. There was also evidence for PSYN after exposure of the ciliate parasite Tetrahymena pyriformis to piscidin 2 plus copper. Our data provide further evidence that piscidins may be an important host defence against skin and gill pathogens and that the piscidin levels in host tissue might influence the success of drug treatments. PMID:21091726

  11. Wastewater viruses and their elimination during treatment of polluted effluents

    International Nuclear Information System (INIS)

    Viruses are a biological pollution in wastewaters. Their elimination results from treatment processes of polluted effluents in the sewage treatment plant or in the lagooning pilot plant. Bacteriophages are regarded as viruses models and as indicators of faecal contamination. In an experimental study, two pilot plants laboratories have been used (natural lagooning and activated sludge pilot) to follow and evaluate the elimination rate of somatic coliphage X-174 or the ARN F-specific one MS2. The two phages removal, ranging to 99 % in the two systems, are related with previous values on enteric viruses. The main factors of viral removal and inactivation (adsorption to solid matters, microbial activities, solar radiations, dissolved matters) have been studied too. Adsorption of infectious particles to solid matters is a very significant process. This was obtained in the pilot plant laboratory experiment and in in vitro study (X-174 or MS2 in the presence of the kaolinite or the montmorillonite). Otherwise, 12 hours of solar rays exposition were efficient ro inactivate nearly the whole phagic suspension. The ciliate protozoan Tetrahymena pyriformis does not seem to have an important role for elimination of phages (X-174 and MS2)

  12. Introducing Spectral Structure Activity Relationship (S-SAR Analysis. Application to Ecotoxicology

    Directory of Open Access Journals (Sweden)

    Ana-Maria Lacrămă


    Full Text Available A novel quantitative structure-activity (property relationship model, namelySpectral-SAR, is presented in an exclusive algebraic way replacing the old-fashionedmulti-regression one. The actual S-SAR method interprets structural descriptors as vectorsin a generic data space that is further mapped into a full orthogonal space by means of theGram-Schmidt algorithm. Then, by coordinated transformation between the data andorthogonal spaces, the S-SAR equation is given under simple determinant form for anychemical-biological interactions under study. While proving to give the same analyticalequation and correlation results with standard multivariate statistics, the actual S-SARframe allows the introduction of the spectral norm as a valid substitute for the correlationfactor, while also having the advantage to design the various related SAR models throughthe introduced “minimal spectral path” rule. An application is given performing a completeS-SAR analysis upon the Tetrahymena pyriformis ciliate species employing its reportedeco-toxicity activities among relevant classes of xenobiotics. By representing the spectralnorm of the endpoint models against the concerned structural coordinates, the obtainedS-SAR endpoints hierarchy scheme opens the perspective to further design the eco-toxicological test batteries with organisms from different species.

  13. [Physiological and biochemical activity of bacteria during germination of cucumber seeds and impact of ciliates Colpoda steinii on this process]. (United States)

    Chobotarova, V V; Bega, Z T; Kurdish, I K


    It is shown that the bacteria Bacillus subtilis B-7023 IMV produce indole-3-acetic acid and amino acids in the liquid medium Knoop. Processing cucumber seed suspension containing 10(7) cfu/ml as bacilli, and Azotobacter vinelandii IMV V-7076, resulted in a decrease in the length of the roots of plants. Reduction of bacterial load bacilli to 10(6) cfu/ml followed by reduction of indole-3-acetic acid in the medium, and to an increase in the length of roots, shoots and total plant mass. During the cultivation of Bacillus subtilis IMV V-7023 with ciliates Colpoda steinii reduced the amount of free forms of auxin in the medium to 5.5 times, and the related--to trace amounts. The content of histidine, phenylalanine, tyrosine, methionine and lysine significantly reduced. PMID:26036028

  14. Influence of Magnetic Field and Slip on Jeffrey Fluid in a Ciliated Symmetric Channel with Metachronal Wave Pattern

    Directory of Open Access Journals (Sweden)

    N Akbar


    Full Text Available The instinct system of cilia motion with magnetic field and slip for Jeffrey fluid model in a symmetric channel is examined. The problem of two-dimensional fluid motion in a symmetric channel with ciliated walls is considered. The structures of ciliary motion are stubborn by the sovereignty of viscid possessions above inertial properties by the long-wavelength and low Reynolds approximation. Exact solutions for the longitudinal pressure gradient, temperature and velocities are obtained. The pressure gradient and volume flow rate for different values of the flow parameters are also discussed. The flow property for the Jeffrey fluid is presented graphically as a function of the cilia and metachronal wave velocity.

  15. Complementary Notes on a‘Well-known' Marine Heterotrichous Ciliate, Folliculinopsis producta (Wright, 1859) Fraure-Fremiet,1936 (Protozoa, Ciliophora)

    Institute of Scientific and Technical Information of China (English)

    JI Daode; LIN Xiaofeng; SONG Weibo


    The living morphology and infraciliature of a heterotrichous ciliate, Folliculinopsis producta (Wright, 1859)Fraure-Fremiet, 1936, which was collected from the north coast of China, were investigated by in vivo observation and protargol impregnation techniques. As a new contribution, a redescription is presented: large Folliculinopsis of green to dark green in color, 800-1500μm in size; two peristomial lobes of approximately equal size, 300-400μm in length; adoral zone of membranelles containing about 1000 membranelles, lying along lobe margins and exhibiting two circles within buccal cavity;50-70 somatic kineties in mid-body; macronucleus miniliform, consisting of about 20 beads; lorica smooth, vase-shaped,(300 500)μm ×(90-130)μm in size, with 5-12 spiral ridges on neck tube; marine habitat.

  16. Checklist and distribution of ciliates from the family Euplotidae Ehrenberg, 1838 (Protista: Ciliophora: Spirotrichea) in Slovakia, Central Europe. (United States)

    Tirjaková, Eva; Botlíková, Simona; Vďačný, Peter


    A checklist of ciliates from the family Euplotidae recorded in the territory of Slovakia, Central Europe was assembled. Altogether, 11 species belonging to three genera of the family Euplotidae have been reported there: Euplotes alatus, Euplotes charon, Euplotes moebiusi, Euplotoides aediculatus, Euplotoides eurystomus, Euplotoides patella, Euplotoides woodruffi, Euplotopsis affinis, Euplotopsis finki, Euplotopsis muscicola, and Euplotopsis novemcarinata. However, records of the marine species E. alatus and E. charon are doubtful and very likely represent misidentifications of E. moebiusi. Since the euryhaline species E. woodruffi was found for the first time in Slovakia, its morphology is described. Based on the literature data and our own observations, the present checklist is also accompanied with distribution data on the 11 aforementioned species. As concerns ecology, Slovak euplotids typically occurred in freshwater bodies having higher trophic levels. Only two species, E. finki and E. muscicola, were isolated from terrestrial habitats, especially, from mosses, leaf-litter, and decaying wood mass. PMID:25781253

  17. The behaviour of both Listeria monocytogenes and rat ciliated ependymal cells is altered during their co-culture.

    Directory of Open Access Journals (Sweden)

    Mina J Fadaee-Shohada

    Full Text Available BACKGROUND: Ciliated ependymal cells line the cerebral ventricles and aqueducts separating the infected CSF from the brain parenchyma in meningitis. PRINCIPAL FINDINGS: Investigation of the interaction of Listeria monocytogenes with cultured rat brain ependymal cells showed that certain strains reduced the beat frequency of the cilia but all the strains studied significantly reduced the ciliary beat amplitude (the linear distance travelled by the tip of each cilium per beat cycle. CONCLUSION: The presence of the ependyma caused aggregation of some listeria strains and in some cases extracellular material also was seen in association with bacterial aggregates. These observations were dependent on the expression of genes required for invasion, intracellular survival and listerial cell to cell spread that are regulated by the transcriptional activator, positive regulatory factor A (PrfA.

  18. Studies on synergistic toxic effects of copper and dithiocarbamate pesticides with the ciliate protozoan Colpidium campylum (Stokes). (United States)

    Bonnemain, H; Dive, D


    The toxicity of seven dithiocarbamates and interactions occurring with copper were studied with the ciliate protozoan Colpidium campylum. No product was toxic at 0.1 mg liter-1. Thiram and mancozeb are the most toxic products (lethal at 1 mg liter-1) and ziram and propineb the least toxic. Concerning interactions with copper, no or slight interactions were observed with propineb and mancozeb, although a strong synergistic toxic effect was observed in a previous work with two structurally related products, maneb and zineb. On the contrary, the responses observed with alkyl-related dithiocarbamates (ferbam and ziram) and ethylene bis-related dithiocarbamates (nabam, thiram, and metiram) are in correlation with the results known in the literature. The synergistic toxic effect of copper and dithiocarbamates thus seems to be related mainly to the alkyl- or the ethylene bis-dithiocarbamate structure, but is not constant for molecules associated with metals (propineb, mancozeb, maneb, and zineb). PMID:2114279

  19. First Record and Redefinition of the Qingdao Population of Marine Ciliate Cardiostomatella vermiformis (Kahl, 1928) Corliss, 1960 (Protozoa, Ciliophora)

    Institute of Scientific and Technical Information of China (English)


    The living morphology and infraciliature of a marine ciliate, Cardiostomatella vermiformis isolated from a sand beach of the Jiaozhou Bay near Qingdao, China, were investigated by live observation, protargol and silver carbonate impregnation methods. Both the morphological and morphometric data largely agree with former records. Based on the data obtained, an improved diagnosis for Cardiostomatella vermiformis is supplied: Large marine Cardiostomatella with cylindrical body shape and several prolonged caudal cilia; cells in vivo about (90-500)μm × (30-120)μm; macronucleus beaded; single contractile vacuole caudally positioned; buccal apparatus conspicuously small, genus typical; three to six postoral kineties; 96-130 somatic kineties. This species is recorded for the first time in China.

  20. Insights into the phylogeny of sporadotrichid ciliates (Protozoa, Ciliophora: Hypotricha) based on genealogical analyses of multiple molecular markers (United States)

    Hu, Xiaoyan; Hu, Xiaozhong; Al-Rasheid, Khaled A. S.; Al-Farraj, Saleh A.; Song, Weibo


    The sporadotrichid ciliates are an especially diverse group. A number of investigators have studied the morphological, morphogenetic, and molecular relationships among members of this group. Despite this, a consistent classification is still lacking and several important questions about the phylogenetic relationships within this group remain unsolved. To improve our understanding of these relationships, we constructed phylogenetic trees using the nucleotide sequences of the small-subunit rRNA (SSrRNA) gene and amino acid sequences of actin I and α-tubulin. Analyses of SSrRNA gene sequences indicated that: 1) the Sporadotrichida sensu Lynn (2008) and the Oxytrichidae are polyphyletic; 2) the Uroleptus species, which are classified to urostylids, formed a sister group with the oxytrichids; 3) Halteria grandinella, which is grouped morphologically with oligotrich species, clustered within the oxytrichids. These results are congruent with previous studies based on SSrRNA gene sequences. However, the amino acid sequences of actin I and α-tubulin yielded different topologies. The main results are: 1) in all phylogenetic trees, the genus Oxytricha was paraphyletic; 2) Uroleptus was sister to a subset of Urostyla and Holosticha, albeit with low supporting values; 3) Halteria grandinella was separated distantly from the Oxytrichidae in trees inferred from actin I amino acid sequences but clustered with oligotrichids in the α-tubulin analysis. The inconsistency among the trees inferred from these different molecular markers may be caused by rapidly accumulated genetic characterizations of ciliates. Further studies with additional molecular markers and sampling of more taxa are expected to better address the relationships among sporadotrichids.

  1. The symbiotic life of Symbiodinium in the open ocean within a new species of calcifying ciliate (Tiarina sp.). (United States)

    Mordret, Solenn; Romac, Sarah; Henry, Nicolas; Colin, Sébastien; Carmichael, Margaux; Berney, Cédric; Audic, Stéphane; Richter, Daniel J; Pochon, Xavier; de Vargas, Colomban; Decelle, Johan


    Symbiotic partnerships between heterotrophic hosts and intracellular microalgae are common in tropical and subtropical oligotrophic waters of benthic and pelagic marine habitats. The iconic example is the photosynthetic dinoflagellate genus Symbiodinium that establishes mutualistic symbioses with a wide diversity of benthic hosts, sustaining highly biodiverse reef ecosystems worldwide. Paradoxically, although various species of photosynthetic dinoflagellates are prevalent eukaryotic symbionts in pelagic waters, Symbiodinium has not yet been reported in symbiosis within oceanic plankton, despite its high propensity for the symbiotic lifestyle. Here we report a new pelagic photosymbiosis between a calcifying ciliate host and the microalga Symbiodinium in surface ocean waters. Confocal and scanning electron microscopy, together with an 18S rDNA-based phylogeny, showed that the host is a new ciliate species closely related to Tiarina fusus (Colepidae). Phylogenetic analyses of the endosymbionts based on the 28S rDNA gene revealed multiple novel closely related Symbiodinium clade A genotypes. A haplotype network using the high-resolution internal transcribed spacer-2 marker showed that these genotypes form eight divergent, biogeographically structured, subclade types that do not seem to associate with any benthic hosts. Ecological analyses using the Tara Oceans metabarcoding data set (V9 region of the 18S rDNA) and contextual oceanographic parameters showed a global distribution of the symbiotic partnership in nutrient-poor surface waters. The discovery of the symbiotic life of Symbiodinium in the open ocean provides new insights into the ecology and evolution of this pivotal microalga and raises new hypotheses about coastal pelagic connectivity. PMID:26684730

  2. Laminin-332 alters connexin profile, dye coupling and intercellular Ca2+ waves in ciliated tracheal epithelial cells

    Directory of Open Access Journals (Sweden)

    Olsen Colin E


    Full Text Available Abstract Background Tracheal epithelial cells are anchored to a dynamic basement membrane that contains a variety of extracellular matrix proteins including collagens and laminins. During development, wound repair and disease of the airway epithelium, significant changes in extracellular matrix proteins may directly affect cell migration, differentiation and events mediated by intercellular communication. We hypothesized that alterations in cell matrix, specifically type I collagen and laminin α3β3γ2 (LM-332 proteins within the matrix, directly affect intercellular communication in ciliated rabbit tracheal epithelial cells (RTEC. Methods Functional coupling of RTEC was monitored by microinjection of the negatively charged fluorescent dyes, Lucifer Yellow and Alexa 350, into ciliated RTEC grown on either a LM-332/collagen or collagen matrix. Coupling of physiologically significant molecules was evaluated by the mechanism and extent of propagated intercellular Ca2+ waves. Expression of connexin (Cx mRNA and proteins were assayed by reverse transcriptase – polymerase chain reaction and immunocytochemistry, respectively. Results When compared to RTEC grown on collagen alone, RTEC grown on LM-332/collagen displayed a significant increase in dye transfer. Although mechanical stimulation of RTEC grown on either LM-332/collagen or collagen alone resulted in intercellular Ca2+ waves, the mechanism of transfer was dependent on matrix: RTEC grown on LM-332/collagen propagated Ca2+waves via extracellular purinergic signaling whereas RTEC grown on collagen used gap junctions. Comparison of RTEC grown on collagen or LM-332/collagen matrices revealed a reorganization of Cx26, Cx43 and Cx46 proteins. Conclusion Alterations in airway basement membrane proteins such as LM-332 can induce connexin reorganizations and result in altered cellular communication mechanisms that could contribute to airway tissue function.

  3. Organic UV filters inhibit multixenobiotic resistance (MXR) activity in Tetrahymena thermophila: investigations by the Rhodamine 123 accumulation assay and molecular docking. (United States)

    Gao, Li; Yuan, Tao; Cheng, Peng; Zhou, Chuanqi; Ao, Junjie; Wang, Wenhua; Zhang, Haimou


    Multixenobiotic resistance (MXR) transporters, which belong to ATP-binding cassette (ABC) family proteins, are present in living organisms as a first line of defense system against xenobiotics and environmental contaminants. The effects of six organic UV filters (4-methyl -benzylidene camphor, 4-MBC; benzophenone-3, BP-3; butyl methoxydibenzoyl-methane, BM-DBM; ethylhexyl methoxy cinnamate, EHMC; octocrylene, OC and homosalate, HMS) on multixenobiotic resistance (MXR) in Tetrahymena thermophila were investigated in this study. It was found that 4-MBC, BP-3 and BM-DBM could significantly inhibit activity of the MXR system, causing concentration dependent accumulation of rhodamine 123; while EHMC, OC and HMS had weak MXR inhibition. The IC50 (50 % inhibition concentration) values of 4-MBC, BP-3 and BM-DBM were 23.54, 40.59 and 26.37 μM, respectively, with inhibitory potentials of 23.1, 13.4 and 20.6 % relative to verapamil (VER, a model inhibitor of P-glycoprotein). Our results firstly provide the evidence for UV filters inhibition effect on MXR in aquatic organisms. In addition, it was revealed by molecular docking analysis that the selected six UV filters can occupy the same binding site on T. thermophila P-gp as VER does; and form H-bonds with residues Ser 328 and/or Asn 281. This study raises the awareness of aquatic ecological risk from the organic UV filters exposure, as they would be involved in potentiating toxic effects by chemosensitizing. PMID:27315091

  4. Ionophoric polyphenols selectively bind Cu(2+), display potent antioxidant and anti-amyloidogenic properties, and are non-toxic toward Tetrahymena thermophila. (United States)

    Martínez, Alberto; Alcendor, Ralph; Rahman, Tanzeen; Podgorny, Magdalena; Sanogo, Ismaila; McCurdy, Rebecca


    Alzheimer's disease (AD) is the most common form of dementia affecting more than 28million people in the world. Only symptomatic treatments are currently available. Anticipated tri-fold increase of AD incidence in the next 50years has established the need to explore new possible treatments. Accumulation of extracellular amyloid-β (Aβ) plaques, intracellular tangles in the brain, and formation of reactive oxygen species (ROS) are the major hallmarks of the disease. The active role of some metal ions, especially Cu(2+), in promoting both Aβ aggregation and reactive oxygen species formation has rendered ionophoric drugs as a promising treatment strategy. In this work, a series of 5 disease-modifying and multi-target ionophoric polyphenols (1-5), inspired on the structure of natural resveratrol, have been synthesized and characterized. All compounds bind Cu(2+) selectively over other biologically relevant metal ions. They form 2:1 (compound/Cu(2+)) complexes with association constants logKa 12-14 depending on the molecular design. Our results indicate that compounds 1-5 possess excellent antioxidant properties: they inhibit the Cu(2+)-catalyzed reactive oxygen species production between 47% and 100%, and they scavenge DPPH (1,1-diphenyl-2-picryl-hydrazyl) and AAPH (2,2'-azobis(2-amindino-propane)dihydrochloride) free radicals in general better than clioquinol, resveratrol and ascorbic acid. In addition, compounds 1-5 interact with Aβ peptides and inhibit both the Cu(2+)-catalyzed aggregation and the self-assembly of Aβ(1-40) up to a ∼92% extent. Interestingly, 1-5 are also able to disaggregate up to ∼91% of pre-formed Aβ(1-40) aggregates. Furthermore, cytotoxic studies show remarkably low toxicity of 1-5 toward Tetrahymena thermophila with LD50 values higher than 150μM, comparable to non-toxic natural resveratrol. PMID:27316544



    Nana, Paul; Fokam, Zephyrin; EBAGUE GUY MARTIAL NTOUNGWA; Ngassam, Pierre; Bricheux, Genevieve; Bouchard, Philippe; Ngando, Telesphore


    Studies on five new species of hysterocinetian ciliates, endocommensal within a terrestrial oligochaete from the genus Alma (Cameroon), reveal the existence of three distinct types of cytoskeletal topography within their adhesive apparatus. In the first topographical type, four superimposed antagonistic strata of skeletal fibres that correspond to the arrangement observed in the genus Ptychostomum, Stein 1860 are found. The second topographical type is characterized by the existence of an uno...

  6. Morphogenesis of respiratory syncytial virus in human primary nasal ciliated epithelial cells occurs at surface membrane microdomains that are distinct from cilia

    International Nuclear Information System (INIS)

    The distribution of cilia and the respiratory syncytial virus (RSV) nucleocapsid (N) protein, fusion (F) protein, attachment (G) protein, and M2-1 protein in human ciliated nasal epithelial cells was examined at between 1 and 5 days post-infection (dpi). All virus structural proteins were localized at cell surface projections that were distinct from cilia. The F protein was also trafficked into the cilia, and while its presence increased as the infection proceeded, the N protein was not detected in the cilia at any time of infection. The presence of the F protein in the cilia correlated with cellular changes in the cilia and reduced cilia function. At 5 dpi extensive cilia loss and further reduced cilia function was noted. These data suggested that although RSV morphogenesis occurs at non-cilia locations on ciliated nasal epithelial cells, RSV infection induces changes in the cilia body that leads to extensive cilia loss. - Highlights: • Respiratory syncytial virus (RSV) infects nasal ciliated epithelial cells. • Virus morphogenesis occurs within filamentous projections distinct from cilia. • The RSV N protein was not detected in the cilia at any time during infection. • Trafficking of the F protein into the cilia occurred early in infection. • Presence of the F protein in cilia correlated with impaired cilia function

  7. Morphogenesis of respiratory syncytial virus in human primary nasal ciliated epithelial cells occurs at surface membrane microdomains that are distinct from cilia

    Energy Technology Data Exchange (ETDEWEB)

    Jumat, Muhammad Raihan [School of Biological Sciences, Nanyang Technological University, 60 Nanyang Drive, Singapore 637551 (Singapore); Yan, Yan [Department of Otolaryngology, Yong Loo Lin School of Medicine, National University Health System, National University of Singapore, Singapore 119228 (Singapore); Ravi, Laxmi Iyer [School of Biological Sciences, Nanyang Technological University, 60 Nanyang Drive, Singapore 637551 (Singapore); Wong, Puisan [Detection and Diagnostics Laboratory, DSO National Laboratories, 27 Medical Drive, Singapore 117510 (Singapore); Huong, Tra Nguyen [School of Biological Sciences, Nanyang Technological University, 60 Nanyang Drive, Singapore 637551 (Singapore); Li, Chunwei [Department of Otolaryngology, Yong Loo Lin School of Medicine, National University Health System, National University of Singapore, Singapore 119228 (Singapore); Tan, Boon Huan [Detection and Diagnostics Laboratory, DSO National Laboratories, 27 Medical Drive, Singapore 117510 (Singapore); Wang, De Yun [Department of Otolaryngology, Yong Loo Lin School of Medicine, National University Health System, National University of Singapore, Singapore 119228 (Singapore); Sugrue, Richard J., E-mail: [School of Biological Sciences, Nanyang Technological University, 60 Nanyang Drive, Singapore 637551 (Singapore)


    The distribution of cilia and the respiratory syncytial virus (RSV) nucleocapsid (N) protein, fusion (F) protein, attachment (G) protein, and M2-1 protein in human ciliated nasal epithelial cells was examined at between 1 and 5 days post-infection (dpi). All virus structural proteins were localized at cell surface projections that were distinct from cilia. The F protein was also trafficked into the cilia, and while its presence increased as the infection proceeded, the N protein was not detected in the cilia at any time of infection. The presence of the F protein in the cilia correlated with cellular changes in the cilia and reduced cilia function. At 5 dpi extensive cilia loss and further reduced cilia function was noted. These data suggested that although RSV morphogenesis occurs at non-cilia locations on ciliated nasal epithelial cells, RSV infection induces changes in the cilia body that leads to extensive cilia loss. - Highlights: • Respiratory syncytial virus (RSV) infects nasal ciliated epithelial cells. • Virus morphogenesis occurs within filamentous projections distinct from cilia. • The RSV N protein was not detected in the cilia at any time during infection. • Trafficking of the F protein into the cilia occurred early in infection. • Presence of the F protein in cilia correlated with impaired cilia function.

  8. The use of multiple endpoints to assess cellular responses to environmental contaminants in the interstitial marine ciliate Euplotes crassus. (United States)

    Gomiero, A; Sforzini, S; Dagnino, A; Nasci, C; Viarengo, A


    This paper presents the results of investigations on the suitability of Euplotes crassus, an interstitial marine ciliate, to be used as model organism in ecotoxicology and thereafter to evaluate the toxicity of estuarine and coastal sediments upon laboratory exposure. Nowadays, anthropogenic activities have resulted in accumulation of metals and organic pollutants in the environment as well as in the food chain hence leading to serious ecological and human health problems. This may pose a risk to benthic and epibenthic organisms and it is crucial to discover toxicity tests that will identify adverse effects of sediment-associated chemicals on benthic organisms. Due to their nature as a eukaryotic cell/organism and their position in the food web, ciliated protozoa are suitable models for evaluating the effects of pollution on aquatic communities. Lethal and sublethal effects of exposure to inorganic and organic pollutants were tested on the cell mortality, replication rate, lysosomal membrane stability and endocytosis rate of E. crassus. Increasing nominal concentrations of individual and mixtures of mercury, copper, and benzo(a)pyrene were investigated in this study as they might be bioavailable in naturally occurring polluted sites. A significant decrease in the mean replication rate (ppollutants. At the same time, significant decreases of lysosomal membrane stability (ppollutants were performed showing both inorganic-organic and inorganic-inorganic additive and/or antagonist effects. Moreover, medium salinity was also varied to mimic estuarine-like environmental conditions linking biological response to ionic strengths. Under these conditions significant increases of both endocytosis rate and lysosomal membrane stability were observed and related to the increment of some Hg- and Cu-related toxic complexes. The studied biomarkers were always able to discriminate between the effects of organic and inorganic pollutants. Together with the short time and simplicity of

  9. Scanning electron microscopy and recording of the physiological activity of tracheal ciliated cells treated by fractionated irradiation

    International Nuclear Information System (INIS)

    The ciliated epithelium of the rabbit's trachea was irradiated with daily fractions of 2 Gy to an accumulated dose of 20 Gy. The beat frequency of the cilia was recorded and specimens were taken for SEM-, TEM- and LM-investigations. Examination was made 1-10 days after each fractionation schedule. An increased ciliary beat frequency was recorded at 2 Gy and 4 Gy. With increasing dose, there was an inverted relationship to the frequency. Light-microscopy showed edema and an increased amount of goblet cells in relation to the increasing dose. With SEM an increased number of ciliary blebs could be seen. These could be classified according to size and number, and showed a positive correlation to the dose. TEM-investigations showed signs of increased intracellular activity at higher doses in the form of multilobulated nuclei and an increasing number of nuclear pores. At lower doses, an increased amount of mitochondria appeared in the apical part of the cell. It is at present difficult to evaluate any correlation between the physiological activity and the morphology. More biological data are needed to explain the early irradiation effects

  10. Estimation of divergence times in litostomatean ciliates (Ciliophora: Intramacronucleata), using Bayesian relaxed clock and 18S rRNA gene. (United States)

    Vďačný, Peter


    The class Litostomatea comprises a diverse assemblage of free-living and endosymbiotic ciliates. To understand diversification dynamic of litostomateans, divergence times of their main groups were estimated with the Bayesian molecular dating, a technique allowing relaxation of molecular clock and incorporation of flexible calibration points. The class Litostomatea very likely emerged during the Cryogenian around 680 Mya. The origin of the subclass Rhynchostomatia is dated to about 415 Mya, while that of the subclass Haptoria to about 654 Mya. The order Pleurostomatida, emerging about 556 Mya, was recognized as the oldest group within the subclass Haptoria. The order Spathidiida appeared in the Paleozoic about 442 Mya. The three remaining haptorian orders evolved in the Paleozoic/Mesozoic periods: Didiniida about 419 Mya, Lacrymariida about 269 Mya, and Haptorida about 194 Mya. The subclass Trichostomatia originated from a spathidiid ancestor in the Mesozoic about 260 Mya. A further goal of this study was to investigate the impact of various settings on posterior divergence time estimates. The root placement and tree topology as well as the priors of the rate-drift model, birth-death process and nucleotide substitution rate, had no significant effect on calculation of posterior divergence time estimates. However, removal of calibration points could significantly change time estimates at some nodes. PMID:26204556

  11. Tissue mortality by Caribbean ciliate infection and white band disease in three reef-building coral species (United States)

    Bastidas, Carolina; Croquer, Aldo


    Caribbean ciliate infection (CCI) and white band disease (WBD) are diseases that affect a multitude of coral hosts and are associated with rapid rates of tissue losses, thus contributing to declining coral cover in Caribbean reefs. In this study we compared tissue mortality rates associated to CCI in three species of corals with different growth forms: Orbicella faveolata (massive-boulder), O. annularis (massive-columnar) and Acropora cervicornis (branching). We also compared mortality rates in colonies of A. cervicornis bearing WBD and CCI. The study was conducted at two locations in Los Roques Archipelago National Park between April 2012 and March 2013. In A. cervicornis, the rate of tissue loss was similar between WBD (0.8 ± 1 mm/day, mean ± SD) and CCI (0.7 ± 0.9 mm/day). However, mortality rate by CCI in A. cervicornis was faster than in the massive species O. faveolata (0.5 ± 0.6 mm/day) and O. annularis (0.3 ± 0.3 mm/day). Tissue regeneration was at least fifteen times slower than the mortality rates for both diseases regardless of coral species. This is the first study providing coral tissue mortality and regeneration rates associated to CCI in colonies with massive morphologies, and it highlights the risks of further cover losses of the three most important reef-building species in the Caribbean. PMID:27547525

  12. The water-born protein pheromones of the polar protozoan ciliate, Euplotes nobilii: Coding genes and molecular structures (United States)

    Vallesi, Adriana; Alimenti, Claudio; Di Giuseppe, Graziano; Dini, Fernando; Pedrini, Bill; Wüthrich, Kurt; Luporini, Pierangelo


    The protozoan ciliate Euplotes nobilii found in Antarctic and Arctic coastal waters relies on secretion of water-soluble cell type-specific signal proteins (pheromones) to regulate its vegetative growth and sexual mating. For three of these psychrophilic pheromones we previously determined the three-dimensional structures by nuclear magnetic resonance (NMR) spectroscopy with protein solutions purified from the natural sources, which led to evidence that their adaptation to cold is primarily achieved by increased flexibility through an extension of regions free of regular secondary structures, and by increased exposure of negative charges on the protein surface. Then we cloned the coding genes of these E. nobilii pheromones from the transcriptionally active cell somatic nucleus (macronucleus) and characterized the full-length sequences. These sequences all contain an open reading frame of 252-285 nucleotides, which is specific for a cytoplasmic pheromone precursor that requires two proteolytic cleavages to remove a signal peptide and a pro segment before release of the mature protein into the extracellular environment. The 5‧ and 3‧ non-coding regions are two- to three-fold longer than the coding region and appear to be tightly conserved, probably in relation to the inclusion of intron sequences destined to be alternatively removed to play key regulatory roles in the mechanism of the pheromone gene expression.

  13. Arrest in ciliated cell expansion on the bronchial lining of adult rats caused by chronic exposure to industrial noise

    International Nuclear Information System (INIS)

    Workers chronically exposed to high-intensity/low-frequency noise at textile plants show increased frequency of respiratory infections. This phenomenon prompted the herein investigation on the cytology of the bronchial epithelium of Wistar rats submitted to textile noise. Workplace noise from a cotton-mill room of a textile factory was recorded and reproduced in a sound-insulated animal room. The Wistar rats were submitted to a weekly schedule of noise treatment that was similar to that of the textile workers (8h/day, 5 days/week). Scanning electron microscopy (SEM) was used to compare the fine morphology of the inner surface of the bronchi in noise-exposed and control rats. SEM quantitative cytology revealed that exposure to noise for 5-7 months caused inhibition in the natural expansion of the area occupied by ciliated cells on the bronchial epithelium as adult rats grow older. This difference between noise-exposed and age-matched control rats was statistically significant (P0.05) and documents that the cytology of the rat bronchial epithelium is mildly altered by noise exposure. The decrease in the area of bronchial cilia may impair the mucociliar clearance of the respiratory airways and, thus, increase vulnerability to respiratory infection

  14. Molecular phylogeny and species delimitation within the ciliate genus Spirostomum (Ciliophora, Postciliodesmatophora, Heterotrichea), using the internal transcribed spacer region. (United States)

    Shazib, Shahed Uddin Ahmed; Vďačný, Peter; Kim, Ji Hye; Jang, Seok Won; Shin, Mann Kyoon


    Morphological and molecular delimitation of Spirostomum species is currently under debate. We addressed species boundaries within the genus Spirostomum, using the ITS1-5.8S-ITS2 region and the secondary structure of the ITS2 molecule, and 18S and 28S (D1D2) sequences additionally. The Spirostomum ITS region is among the shortest within the ciliates hitherto studied. The Spirostomum ITS2 molecule matches the "ring model", but exhibits only two helices radiating from a common loop. According to comparative analyses, they very likely correspond to helices II and III of other eukaryotes. Our phylogenetic analyses of the ITS region revealed a complex genealogical structure within the genus Spirostomum. However, boundaries among Spirostomum species could not be unambiguously determined either by phylogenetic trees, networks or sequence divergence cutoffs, because ITS2 sequences transcended species boundaries of the following morphospecies: S. ambiguum, S. minus, S. subtilis and S. teres. According to molecular diversity analysis, this is very likely caused by polymorphism in S. minus and S. teres, and by the lack of variability in S. ambiguum and S. subtilis. No compensatory base changes (CBCs) were detected in helices of the ITS2 molecule between different Spirostomum species, documenting that CBC analysis per se is not able to effectively discriminate Spirostomum species. PMID:27261253

  15. Notes on Two Marine Ciliates from the Yellow Sea, China: Placus salinus and Strombidium apolatum (Protozoa, Ciliophora)

    Institute of Scientific and Technical Information of China (English)

    XU Dapeng; SONG Weibo; HU Xiaozhong


    The living morphology and infraciliature of two rare marine ciliates, Placus salinus Dietz, 1964 and Strombidium apolatum Wilbert and Song, 2005, collected from the coastal waters near Qingdao, China, were investigated by in vivo observation and protargol impregnation technique. The improved diagnosis for Placus salinus is as follows: medium-sized marine Placus, in vivo (50 -60) μm × (30 -40)μm; cell elliptical to barrel-shaped; 28 -31 somatic kineties; single macronucleus usually ellipsoid and one micronucleus located in the indention of the macronucleus; one contractile vacuole posteriorly positioned. Strombidium apolatum is characterized by: marine strombidium (40-60) μm × (30-45) μm in vivo, cordiform in shape with somewhat pointed posterior end and conspicuous apical protrusion; extrusomes prominent, about 15μm in length and evenly arranged along the circle kinety; about 16 collar and 5-6 buccal membranelles; one elongate macronucleus and one micronucleus; circle and ventral kineties consisting of about 53 and 45 dikinetids respectively.

  16. Two New Genera of Planktonic Ciliates and Insights into the Evolution of the Family Strombidiidae (Protista, Ciliophora, Oligotrichia.

    Directory of Open Access Journals (Sweden)

    Weiwei Liu

    Full Text Available Oligotrich ciliates are common marine microplankters, but their biodiversity and evolutionary relationships have not been well-documented. Morphological descriptions and small subunit rRNA gene sequences of two new species representing two new strombidiid genera, Sinistrostrombidium cupiformum gen. nov., sp. nov. and Antestrombidium agathae gen. nov., sp. nov. are presented, and their taxonomy and molecular phylogeny are analyzed. Sinistrostrombidium gen. nov. is characterized by a sinistrally spiraled girdle kinety and a longitudinal ventral kinety. Antestrombidium gen. nov. is distinguished by tripartite somatic kineties (circular and ventral kineties plus dextrally spiraled girdle kinety. Sinistrostrombidium and Antestrombidium branched separately from one another in phylogenetic trees, clustering with different clades of strombidiids. The new genera added to the diversities of ciliary patterns and small subunit rRNA gene sequences in strombidiids leads to presentation of a new hypothesis about evolution of the 12 known strombidiid genera, based on ciliary pattern and partly supported by molecular evidence. In addition, our new morphological and molecular analyses support establishment of a new order Lynnellida ord. nov., characterized by an open adoral zone of membranelles without differentiation of anterior and ventral membranelles, for Lynnella, but we remain unable to assign the genus to a subclass with confidence.

  17. Multigene-based analyses on evolutionary phylogeny of two controversial ciliate orders: Pleuronematida and Loxocephalida (Protista, Ciliophora, Oligohymenophorea). (United States)

    Gao, Feng; Katz, Laura A; Song, Weibo


    Relationships among members of the ciliate subclass Scuticociliatia (Ciliophora, Oligohymenophorea) are largely unresolved. Phylogenetic studies of its orders Pleuronematida and Loxocephalida were initially based on small subunit ribosomal RNA gene (SSU-rDNA) analyses of a limited number of taxa. Here we characterized 37 sequences (SSU-rDNA, ITS-5.8S and LSU-rDNA) from 21 taxonomically controversial members of these orders. Phylogenetic trees constructed to assess the inter- and intra-generic relationships of pleuronematids and loxocephalids reveal the following: (1) the order Loxocephalida and its two families Loxocephalidae and Cinetochilidae are not monophyletic when more taxa are added; (2) the core pleuronematids are divided into two fully supported clades, however, the order Pleuronematida is not monophyletic because Cyclidium glaucoma is closer to Thigmotrichida; (3) the family Pleuronematidae and the genus Schizocalyptra are monophyletic, though rDNA sequences of Pleuronema species are highly variable; (4) Pseudoplatynematum and Sathrophilus are closely related to the subclass Astomatia, while Cinetochilum forms a monophyletic group with the subclass Apostomatia; and (5) Hippocomos falls in the order Pleuronematida and is closely related to Eurystomatellidae and Cyclidium plouneouri. Further, in an effort to provide a better resolution of evolutionary relationships, the secondary structures of ITS2 transcripts and the variable region 4 (V4) of the small subunit ribosomal RNA (SSU-rRNA) are predicted, revealing that ITS2 structures are conserved at the order level while V4 region structures are more variable than ITS2 structures. PMID:23541839

  18. Two New Genera of Planktonic Ciliates and Insights into the Evolution of the Family Strombidiidae (Protista, Ciliophora, Oligotrichia). (United States)

    Liu, Weiwei; Yi, Zhenzhen; Xu, Dapeng; Clamp, John C; Li, Jiqiu; Lin, Xiaofeng; Song, Weibo


    Oligotrich ciliates are common marine microplankters, but their biodiversity and evolutionary relationships have not been well-documented. Morphological descriptions and small subunit rRNA gene sequences of two new species representing two new strombidiid genera, Sinistrostrombidium cupiformum gen. nov., sp. nov. and Antestrombidium agathae gen. nov., sp. nov. are presented, and their taxonomy and molecular phylogeny are analyzed. Sinistrostrombidium gen. nov. is characterized by a sinistrally spiraled girdle kinety and a longitudinal ventral kinety. Antestrombidium gen. nov. is distinguished by tripartite somatic kineties (circular and ventral kineties plus dextrally spiraled girdle kinety). Sinistrostrombidium and Antestrombidium branched separately from one another in phylogenetic trees, clustering with different clades of strombidiids. The new genera added to the diversities of ciliary patterns and small subunit rRNA gene sequences in strombidiids leads to presentation of a new hypothesis about evolution of the 12 known strombidiid genera, based on ciliary pattern and partly supported by molecular evidence. In addition, our new morphological and molecular analyses support establishment of a new order Lynnellida ord. nov., characterized by an open adoral zone of membranelles without differentiation of anterior and ventral membranelles, for Lynnella, but we remain unable to assign the genus to a subclass with confidence. PMID:26121340

  19. Phylogenetic relationships of the ciliate class Heterotrichea (Protista, Ciliophora, Postciliodesmatophora) inferred from multiple molecular markers and multifaceted analysis strategy. (United States)

    Shazib, Shahed Uddin Ahmed; Vd'ačný, Peter; Kim, Ji Hye; Jang, Seok Won; Shin, Mann Kyoon


    The ciliate class Heterotrichea is defined by somatic dikinetids bearing postciliodesmata, by an oral apparatus consisting of a paroral membrane and an adoral zone of membranelles, as well as by features of nuclear division involving extramacronuclear microtubules. Although phylogenetic interrelationships among heterotrichs have been analyzed several times, deeper nodes of the heterotrichean tree of life remain poorly resolved. To cast more light on the evolutionary history of heterotricheans, we performed phylogenetic analyses of multiple loci (18S rRNA gene, ITS1-5.8S rRNA-ITS2 region, and 28S rRNA gene) using traditional tree-building phylogenetic methods and statistical tree topology tests as well as phylogenetic networks, split spectrum analysis and quartet likelihood mapping. This multifaceted approach has shown that (1) Peritromus is very likely an adelphotaxon of all other heterotrichs; (2) Spirostomum and Anigsteinia are sister taxa and their common monophyletic origin is strongly supported by a uniquely posteriorly-thickened paroral membrane; (3) the monotypic family Chattonidiidae should be suppressed because its type genus clusters within the family Condylostomatidae; and (4) new families are needed for Gruberia and Fabrea because their affiliation with Spirostomidae and Climacostomidae, respectively, is not supported by molecular phylogenies nor the fine structure of the paroral membrane. PMID:24859684


    Directory of Open Access Journals (Sweden)

    E. G. Cheremnykh


    Full Text Available Complement system is an important component of innate immunity, providing primary protection against pathogens invading the body. In addition, it was shown that the complement system is associated with many diseases, not only autoimmune and infectious, but also mental disorders. In this regard, it is necessary to develop affordable and fast method of measuring activity of the complement system in real-time mode. We present a new semi-automated method for assessment of serum complement activity. The assay is based on cytolytic action of complement system upon the ciliate organism Tetrahymena pyriformis. This method consists in repeated counting of live Tetrahymena motile cells by means of specially developed Biolat device, which consists of two video cameras, light sources, and movable round plate. The plate has two rows of holes. The device also includes microprocessor control unit based on AutoCiliata software, intended for control of operation module and counting the surviving cell. The calculations are based on fixation of two sequential video-frames, with subsequent software image processing. Cell death events were observed upon incubation in triethanolamine (TEA buffer containing 5% of blood serum. We have also compared complement activity in different buffers, i.e., standard medium for culturing of ciliates, Veronal-Medinalum buffer, and the TEA buffer. TEA buffer was found superior to the Veronal buffer when applied in the test system. The time of cell death in the TEA-buffered medium containing 5% serum was < 15 minutes for all the sera studied. The parameters denoting serum complement activity were as follows: a half-life time for the moving cells (TLD50, and a similar value for 100% cell inactivation (1/TLD50, functional activity of the complement system, ACS. The sensitivity of this assay was calculated from dependencies between TLD50 and ACS, and actual serum concentrations. We have suggested an opportunity for evaluation of an

  1. Pequenas Parmelia S.L. (Líquens: Ascomycotina ciliadas dos cerrados brasileiros Little ciliate Parmeliae in the brazilian cerradoes

    Directory of Open Access Journals (Sweden)

    Marcelo Pinto Marcelli


    Full Text Available Este trabalho foi baseado em coletas realizadas em todos os tipos estruturais de cerrado, incluindo formações de altitude e rochosas. São apresentadas descrições detalhadas, chave de identificação e ilustrações das espécies de Bulboíhrix (16, Relicina (2, Myelochroa (2, Parmelinella (1, Parmelinopsis (6 e Hypotrachyna (3 encontradas. B. linteolocarpa M.P. Marcelli e B. subklementii M.P. Marcelli são descritas como novas. E feita a combinação nova Parmelinella versiformis (Kremp. M.P. Marcelli. B. sensibilis (Steiner & Zahlbr. Hale é nova para o Brasil. B. meizospora (Nyl. Hale e Parmelinopsis jamesii (Hale Elix & Hale são novas para o Continente Americano. Há um grande número de primeiras citações para vários estados e várias segundas referências para o Brasil.This work deals with species of the lichen genera Bulboihrix (16, Relicina (2, Myelochroa (2, Parmelinella (1, Parmelinopsis (6 and Hypotrachyna (3 (ciliate species growing in the brazilian "cerrado" vegetation. All types of cerradoes were investigated, since almost open fields to forestal formations and including altitude rock fields, gallery forests and others placed inside cerrado areas. Altogether 30 species were found and are described in detail. B. linteolocarpa M.P. Marcelli and B. subklementii M.P. Marcelli are new species. The new combination Parmelinella versiformis (Kremp. M.P. Marcelli is done. B. sensibilis (Steiner & Zahlbr. Hale is new for Brazil. B. meizospora (Nyl. Hale and Parmelinopsis jamesii (Hale Elix & Hale are new for the American Continent.

  2. Ciliated protists from the nepheloid layer and water column of sites affected by the Deepwater Horizon oil spill in the Northeastern Gulf of Mexico (United States)

    Moss, Joseph A.; McCurry, Chelsea; Tominack, Sarah; Romero, Isabel C.; Hollander, David; Jeffrey, Wade H.; Snyder, Richard A.


    Benthic marine protists have been well documented from shallow marine benthic habitats but remain understudied in deeper habitats on continental shelves and slopes, particularly in the Northeastern Gulf of Mexico (NEGOM). This region was affected by a deep water oil well failure (BP-Deepwater Horizon, 2010). The combination of a lack of information on deep sea microbenthic communities and the potential for benthic microbial petroleum mineralization prompted this investigation. Water column and nepheloid layer samples were obtained via Niskin bottles and a multicorer respectively at stations across the NEGOM to: (1) determine whether nepheloid and water column communities are distinct and (2) assess benthic species richness relative to sediment PAH contamination. Phylum specific 18S rRNA gene amplification was used to construct clone libraries of ciliate assemblages. BLAST searches in the NCBI database indicated that a majority (~75%) of the clone sequences corresponded (94-100% similarity) with listed, yet unclassified sequences. Several putative species were common at most site locations and depths. Many known benthic ciliates, such as Uronychia transfuga, Uronychia setigera, and Spirotrachelostyla tani, were common in the nepheloid layer samples and not recovered in water column samples. Ciliated protist species richness increased with PAH levels found in surface sediments, suggesting a positive microbial response to petroleum enrichment of the benthos. The presence of previously unknown microbenthic communites in the nephaloid layer over oceanic clay-silt muds alters our view of microbial processes in the deep sea and merits investigation of the microbial processes and rates of microbial mineralization and biomass production important to global biogeochemistry.

  3. Identification of cAMP-dependent phosphorylated proteins involved in the formation of environment-resistant resting cysts by the terrestrial ciliate Colpoda cucullus

    Directory of Open Access Journals (Sweden)

    Y Sogame


    Full Text Available In the terrestrial ciliate Colpoda cucullus, an elevation of the intracellular cAMP concentration was reported to be involved in environment-resistant resting cyst formation. In the present study, cAMP-dependently phosphorylated proteins of encystment-induced C. cucullus were isolated with Phos-tag agarose phosphate-affinity beads and subsequent SDS-PAGE. In a liquid chromatography/tandem mass spectrometry analysis of these phosphoproteins, 27-, 37- and 43-kDa proteins (p27, p37 and p43 were identified as Rieske iron-sulfur protein, histone H4 (hyperacetylated form, and actin, respectively.

  4. Phylogenetic positions of two marine ciliates, Metanophrys similis and Pseudocohnilembus hargisi (Protozoa, Ciliophora, Scuticociliatia), inferred from complete small subunit rRNA gene sequences

    Institute of Scientific and Technical Information of China (English)


    The small subunit rRNA (SSrRNA) gene was sequenced for two marine scuticociliates Metanophrys similis and Pseudocohnilembus hargisi. The results show that this gene comprises 1763 and 1753 nucleotides in the two marine ciliates respectively.Metanophrys similis is phylogenetically closely related to the clade containing Mesanophrys carcini and Anophyroides haemophila, which branches basally to other species within the order Philasterida. Pseudocohnilembus hargisi groups with its congener, P. marinus, with strong bootstrap support. Paranophrys magna groups with the clade including Cohnilembus and Uronema, representing a sister clade to that containing the two Pseudocohnilembus species.

  5. Ultrastructure observation on the cells at different life history stages of Cryptocaryon irritans (Ciliophora: Prostomatea), a parasitic ciliate of marine fishes. (United States)

    Ma, Rui; Ni, Bing; Fan, Xinpeng; Warren, Alan; Yin, Fei; Gu, Fukang


    Cells of Cryptocaryon irritans at different life history stages were studied using both light and electron microscopy. The characteristics of several organelles were revealed for the first time at the ultrastructural level. It was confirmed that the cytostome of trophonts, protomonts and theronts was surrounded by cilium-palp triplets rather than ciliary triplets. The nematodesmata underlying the circumoral dikinetids were single bundles, whereas these were always paired in Prorodontids. Toxicysts were present in late-stage tomonts and theronts, but were absent in trophonts and protomonts. We posited that toxicysts might play a role in infection and invasion of host-fish tissue by theronts. The adoral brosse was unlike that of any other family of the class Prostomatea based on its location and morphology. Membranous folds were present in trophonts, protomonts and theronts. These folds were longer and more highly developed in C. irritans than in exclusively free-living prostome ciliates suggesting that they might be linked to parasitism in C. irritans. Trophonts, protomonts and theronts had multiple contractile vacuoles. The basic ultrastructure of the contractile vacuole of C. irritans was similar to that of other kinetofragminophoran ciliates. They might play different roles in different stages of the life cycle since their ultrastructure varied among trophonts, protomonts and theronts. PMID:27460894

  6. Toxicity of low concentration exposures of triclosan and triclocarban on Tetrahymena thermophila%低剂量三氯生和三氯卡班对嗜热四膜虫的毒性研究

    Institute of Scientific and Technical Information of China (English)

    白琦锋; 高礼; 袁涛


    Triclosan(TCS) and triclocarban(TCC),as two typical antibacterial agents,have been widely used in many kinds of cleaning products.Their ecotoxicity has become increasing concern,as their occurrences in environmental matrix have been frequently reported.In this paper,we studied the growth inhibition effects of environmentally relevant concentration exposure of TCS and TCC on Tetrahymena thermophila.The changes of the cell viability of Tetrahymena were further investigated.The results showed that the growth of Tetrahymena was inhibited significantly with μg·L-1 level TCS and TCC.The 24 h-EC50 of TCS and TCC was 141 μg·L-1and 728 μg·L-1,with NOEC of 2 μg·L-1 and 30 μg·L-1,LOEC of 4 μg·L-1 and 61 μg·L-1,respectively.Particularly,TCC seemly presented hormesis effect as it had growth stimulation at 1 to10 μg·L-1.In addition,when the concentrations of TCS and TCC reached 1000 μg·L-1,obvious damages of cell membrane were observed.Also,the activity of lysosomes was reduced to 88.62% and 95.75% of the control fluorescence values,respectively,when the cells were exposed to 1 μg·L-1of TCS and TCC for 2 h.This study provides important references for the ecological risk assessments of these two emerging pollutants.%研究了环境相关浓度水平(μg.L-1)的三氯生(TCS)和三氯卡班(TCC)暴露对嗜热四膜虫的生长抑制效应,并尝试探索这两种新生污染物对四膜虫细胞活性的影响.结果表明,μg.L-1水平的TCS和TCC对四膜虫的生长存在明显抑制作用,24 h-EC50分别为141μg.L-1、728μg.L-1;最低无效应浓度(NOEC)分别为2μg.L-1、30μg.L-1;最低效应浓度(LOEC)分别为4μg.L-1、61μg.L-1.其中,TCC在1—10μg.L-1水平表现出促进作用,可能是hormesis效应的体现.另外,在TCS和TCC浓度达到1000μg.L-1时均对四膜虫细胞膜产生明显损伤;TCS和TCC也影响其溶酶体活性,1μg.L-1暴露2 h时,荧光值(RFU)百分比分别降低至对照样品的88

  7. A case study for effects of operational taxonomic units from intracellular endoparasites and ciliates on the eukaryotic phylogeny: phylogenetic position of the haptophyta in analyses of multiple slowly evolving genes.

    Directory of Open Access Journals (Sweden)

    Hisayoshi Nozaki

    Full Text Available Recent multigene phylogenetic analyses have contributed much to our understanding of eukaryotic phylogeny. However, the phylogenetic positions of various lineages within the eukaryotes have remained unresolved or in conflict between different phylogenetic studies. These phylogenetic ambiguities might have resulted from mixtures or integration from various factors including limited taxon sampling, missing data in the alignment, saturations of rapidly evolving genes, mixed analyses of short- and long-branched operational taxonomic units (OTUs, intracellular endoparasite and ciliate OTUs with unusual substitution etc. In order to evaluate the effects from intracellular endoparasite and ciliate OTUs co-analyzed on the eukaryotic phylogeny and simplify the results, we here used two different sets of data matrices of multiple slowly evolving genes with small amounts of missing data and examined the phylogenetic position of the secondary photosynthetic chromalveolates Haptophyta, one of the most abundant groups of oceanic phytoplankton and significant primary producers. In both sets, a robust sister relationship between Haptophyta and SAR (stramenopiles, alveolates, rhizarians, or SA [stramenopiles and alveolates] was resolved when intracellular endoparasite/ciliate OTUs were excluded, but not in their presence. Based on comparisons of character optimizations on a fixed tree (with a clade composed of haptophytes and SAR or SA, disruption of the monophyly between haptophytes and SAR (or SA in the presence of intracellular endoparasite/ciliate OTUs can be considered to be a result of multiple evolutionary reversals of character positions that supported the synapomorphy of the haptophyte and SAR (or SA clade in the absence of intracellular endoparasite/ciliate OTUs.

  8. Potential effect of some environmental factors on the phage removal during wastewater treatment. Study in vitro

    International Nuclear Information System (INIS)

    caused by the dissolved matters. But the process was progressively more marked (24 hours later, it was 98.8% and 38% respectively for MS2 and øX-174). With solar radiations, an important inactivation of the somatic coliphage was obtained at the earlier exposition times to the sunlight. Later, the effect was amplified. øX-174 phage titer decreased almost 2 log units after exposition of 1.5 hour and more than 5 log units after 12 hours. In the case of MS2, decrease titer was less important at the first exposition times but tended to 5 log units at the last one (12 hours). The infection of the protozoan culture medium by any of the phages was followed by microscopic observations. The morphology and the mobility of the ciliate were no affected by the presence of phages. The biological cycle was also comparable to the control. The ciliate culture medium seems to have an inactivation effect mainly in the case of øX-174. Predation by Tetrahymena pyriformis cannot be considered as an important factor of phage removal from the medium

  9. Redescriptions of three trachelocercid ciliates (Protista, Ciliophora, Karyorelictea), with notes on their phylogeny based on small subunit rRNA gene sequences. (United States)

    Yan, Ying; Xu, Yuan; Yi, Zhenzhen; Warren, Alan


    Three trachelocercid ciliates, Kovalevaia sulcata (Kovaleva, 1966) Foissner, 1997, Trachelocerca sagitta (Müller, 1786) Ehrenberg, 1840 and Trachelocerca ditis (Wright, 1982) Foissner, 1996, isolated from two coastal habitats at Qingdao, China, were investigated using live observation and silver impregnation methods. Data on their infraciliature and morphology are supplied. The small subunit rRNA (SSU rRNA) genes of K. sulcata and Trachelocerca sagitta were sequenced for the first time. Phylogenetic analyses based on SSU rRNA gene sequence data indicate that both organisms, and the previously sequenced Trachelocerca ditis, are located within the trachelocercid assemblage and that K. sulcata is sister to an unidentified taxon forming a clade that is basal to the core trachelocercids. PMID:23847285

  10. Kinetic glutathione chemoassay to quantify thiol reactivity of organic electrophiles--application to alpha,beta-unsaturated ketones, acrylates, and propiolates. (United States)

    Böhme, Alexander; Thaens, Diana; Paschke, Albrecht; Schüürmann, Gerrit


    Glutathione (GSH) is a soft nucleophile and, as such, can be used to sense the reactivity of electrophilic agents toward the thiol group and other electron-rich sites of molecular structures. A new kinetic GSH chemoassay is introduced that employs a photometric method to quantify GSH loss and enables an efficient determination of second-order rate constants, k(GSH), of the reaction between electrophilic substances and GSH. Comparison with an existing 2 h static assay shows that the new kinetic variant is superior with respect to the detectable range of electrophilic reactivity and to confounding factors such as additional GSH loss due to oxidation. Analysis of the chemoassay degradation kinetics provides insight into the characteristic reaction times and the contributions of GSH-electrophile Michael addition and GSH oxidation to the overall GSH loss. For 15 alpha,beta-unsaturated ketones, nine acrylates, and two propiolates acting as Michael acceptors, the measured k(GSH) values span ca. 5 orders of magnitude. Moreover, log k(GSH) correlates with the compounds' toxicity toward the ciliates Tetrahymena pyriformis in terms of 48 h log EC(50) (50% growth inhibition) values, yielding a squared correlation coefficient (r(2)) of 0.91 and a root-mean-square error of 0.30 log units. It shows that for these and related compounds, aquatic toxicity is driven by electrophilic reactivity. The findings demonstrate that the kinetic GSH chemoassay can be used as an efficient tool to analyze, interpret, and predict correspondingly reactive toxicity in the context of qualitative and quantitative structure-activity relationship studies and as a nonanimal tool of integrated testing strategies for REACH to screen compounds for excess toxicity. PMID:19317512

  11. Use of protista and algae to study toxicity of dye compounds

    Czech Academy of Sciences Publication Activity Database

    Dias, N.; Vandrovcová, M.; Kideryová, Linda; Novotný, Čeněk; Lima, N.

    Braga, 2003, s. 71-85. [European Culture Collections Organizatin Meeting /22./. Braga (PT), 17.09.2003-19.09.2003] R&D Projects: GA ČR GA526/00/1303; GA MŠk LN00B030 Grant ostatní: GA PRAXIS(XX) XXI/BD/20328/99 Institutional research plan: CEZ:AV0Z5020903 Keywords : textile dyes * toxicity bioassays * tetrahymena pyriformis Subject RIV: EE - Microbiology, Virology

  12. Relative importance of evolutionary dynamics depends on the composition of microbial predator-prey community. (United States)

    Friman, Ville-Petri; Dupont, Alessandra; Bass, David; Murrell, David J; Bell, Thomas


    Community dynamics are often studied in subsets of pairwise interactions. Scaling pairwise interactions back to the community level is, however, problematic because one given interaction might not reflect ecological and evolutionary outcomes of other functionally similar species interactions or capture the emergent eco-evolutionary dynamics arising only in more complex communities. Here we studied this experimentally by exposing Pseudomonas fluorescens SBW25 prey bacterium to four different protist predators (Tetrahymena pyriformis, Tetrahymena vorax, Chilomonas paramecium and Acanthamoeba polyphaga) in all possible single-predator, two-predator and four-predator communities for hundreds of prey generations covering both ecological and evolutionary timescales. We found that only T. pyriformis selected for prey defence in single-predator communities. Although T. pyriformis selection was constrained in the presence of the intraguild predator, T. vorax, T. pyriformis selection led to evolution of specialised prey defence strategies in the presence of C. paramecium or A. polyphaga. At the ecological level, adapted prey populations were phenotypically more diverse, less stable and less productive compared with non-adapted prey populations. These results suggest that predator community composition affects the relative importance of ecological and evolutionary processes and can crucially determine when rapid evolution has the potential to change ecological properties of microbial communities. PMID:26684728

  13. 绿色荧光蛋白表达载体pXS75-GFP的构建及在嗜热四膜虫中的应用%Construction of Green Fluorescent Protein Expression Vector pXS75-GFP and Application in Tetrahymena thermophila

    Institute of Scientific and Technical Information of China (English)

    梁海霞; 王伟


    To construct a vector for studying the localization of protein in Tetrahymena thermophila, GFP expression vector pXS75-GFP was constructed by ligating GFP with Cd2+-inducible metallothionein (MTT1) promoter and terminator sequences. The target gene—GFP fusion gene can integrate into the MTT1 locus through homologous recombination and resistance screening. Expression of the target protein in-fusion with the C-terminal GFP tag was controllable by Cd2+. The recombinant plasmid pXS75-GFP-ATUl was constructed and biolistically transformed into Tetrahymena. The expression of a-tubulin-GFP was analyzed by Western blot. Confocal microscopy showed that a-tubulin-GFP localized at cortex in living and fixed Tetrahymena cells. The results revealed that pXS75-GFP can be used for studying the subcellular localization of proteins in Tetrahymena thermophila.%为获得能够用于构建嗜热四膜虫蛋白定位的载体,该研究将GFP基因与镉(Cd2+)诱导的四膜虫金属硫蛋白基因(MTT1)启动子序列和终止子序列融合,获得表达载体pXS75-GFP.通过同源重组和抗性筛选,pXS75-GFP载体携带的目的基因整合入四膜虫MTT1位点,在Cd2+诱导下实现GFP融合蛋白的可控表达.将α-tubulin基因ATU1克隆入pXS75-GFP中,重组质粒pXS75-GFP-ATU1通过基因枪转化入四膜虫细胞,在巴龙霉素筛选下获得稳定的α-tubulin-GFP过表达细胞株.激光共聚焦显微镜观察α-tubulin-GFP的定位,结果显示,α-tubulin-GFP融合蛋白在四膜虫细胞中表达并分布于皮层上,表明pXS75-GFP载体可用于嗜热四膜虫功能蛋白的定位分析.

  14. Comparative genomics of the pathogenic ciliate Ichthyophthirius multifiliis, its free-living relatives and a host species provide insights into adoption of a parasitic lifestyle and prospects for disease control


    Coyne, Robert S; Hannick, Linda; Shanmugam, Dhanasekaran; Jessica B Hostetler; Brami, Daniel; Joardar, Vinita S; Johnson, Justin; Radune, Diana; Singh, Irtisha; Jonathan H Badger; Kumar, Ujjwal; Saier, Milton; Wang, Yufeng; Cai, Hong; Gu, Jianying


    BACKGROUND: Ichthyophthirius multifiliis, commonly known as Ich, is a highly pathogenic ciliate responsible for 'white spot', a disease causing significant economic losses to the global aquaculture industry. Options for disease control are extremely limited, and Ich's obligate parasitic lifestyle makes experimental studies challenging. Unlike most well-studied protozoan parasites, Ich belongs to a phylum composed primarily of free-living members. Indeed, it is closely related to the model org...

  15. Comparative genomics of the pathogenic ciliate Ichthyophthirius multifiliis, its free-living relatives and a host species provide insights into adoption of a parasitic lifestyle and prospects for disease control


    Coyne, Robert S; Hannick, Linda; Shanmugam, Dhanasekaran; Jessica B Hostetler; Brami, Daniel; Joardar, Vinita S; Johnson, Justin; Radune, Diana; Singh, Irtisha; Jonathan H Badger; Kumar, Ujjwal; Saier, Milton; Wang, Yufeng; Cai, Hong; Gu, Jianying


    Background Ichthyophthirius multifiliis, commonly known as Ich, is a highly pathogenic ciliate responsible for 'white spot', a disease causing significant economic losses to the global aquaculture industry. Options for disease control are extremely limited, and Ich's obligate parasitic lifestyle makes experimental studies challenging. Unlike most well-studied protozoan parasites, Ich belongs to a phylum composed primarily of free-living members. Indeed, it is closely related to the model orga...

  16. Comparative genomics of the pathogenic ciliate Ichthyophthirius multifiliis, its free-living relatives and a host species provide insights into adoption of a parasitic lifestyle and prospects for disease control


    Coyne, Robert S; Hannick, Linda; Shanmugam, Dhanasekaran; Jessica B Hostetler; Brami, Daniel; Joardar, Vinita S; Johnson, Justin; Radune, Diana; Singh, Irtisha; Jonathan H Badger; Kumar, Ujjwal; Saier, Milton; Wang, Yufeng; Cai, Hong; Gu, Jianying


    Abstract Background Ichthyophthirius multifiliis, commonly known as Ich, is a highly pathogenic ciliate responsible for 'white spot', a disease causing significant economic losses to the global aquaculture industry. Options for disease control are extremely limited, and Ich's obligate parasitic lifestyle makes experimental studies challenging. Unlike most well-studied protozoan parasites, Ich belongs to a phylum composed primarily of free-living members. Indeed, it is closely relat...

  17. Life Cycle, Morphology, Ontogenesis, and Phylogeny of Bromeliothrix metopoides nov. gen., nov. spec., a Peculiar Ciliate (Protista, Colpodea) from Tank Bromeliads (Bromeliaceae). (United States)

    Foissner, Wilhelm


    Bromeliothrix metopoides was discovered in tank bromeliads from Central and South America. Pure cultures could be established in various media stimulating growth of its food, i.e. bacteria and heterotrophic flagellates of the genus Polytomella. The new ciliate was investigated in the light- and scanning electron microscope, with various silver impregnation techniques, and with molecular methods, using the small-subunit rDNA. The morphology and its changes during the life cycle are documented by 167 figures and a detailed morphometry. Bromeliothrix metopoides is about 27-55 × 22-36 μm in size and has a complex life cycle with Metopus-shaped, bacteriophagous theronts and trophonts (microstomes) and obovate, flagellate-feeding macrostomes having a large, triangular oral apparatus. The thin-walled resting cysts of the theronts and trophonts are uniquely ellipsoidal, while the thick-walled cyst of the macrostome morph is globular. Reproduction occurs in freely motile condition either by binary fission or polytomy, producing a unique, motile "division chain" composed of four globular offspring, of which the central ones are connected by a curious, plug-like holdfast. Division is associated with a complete reorganization of the parental oral and somatic infraciliature. Stomatogenesis is merotelokinetal as in other members of the order Colpodida. The right polykinetid is generated by the rightmost postoral kinety, while the left polykinetid is produced by the two left postoral kineties and five left side kineties. The division in freely motile condition resembles the Exocolpodidae Foissner et al., 2002, to which Bromeliothrix is tentatively assigned, differing from Exocolpoda mainly by the formation of a macrostome morph and a division chain. Bromeliothrix has a ciliary and silverline pattern typical for members of the family Colpodidae. This matches the molecular classification which, however, hardly reflects the outstanding division and life cycle, suggesting some

  18. 纤毛类原生动物中宿主-共生体系统的研究%Studies on the Host-Symbiont System in Ciliates

    Institute of Scientific and Technical Information of China (English)

    顾福康; 孙军; 何远; 田沁


    目前已经在100多种纤毛虫中观察到细菌、藻类和其他微生物等共生体。对纤毛虫中宿主-共生体系统的研究表明,双小核草履虫中卡巴粒的遗传为细胞质遗传理论提供了例证;含细菌共生体的许多厌氧纤毛虫无线粒体,共生体对宿主代谢有重要作用;尾草履虫-钝状全孢螺菌共生作用中,共生菌感染形式的39kDa、15kDa周质蛋白可分别与IF-3-1、IF-3-2两种单抗反应,其共生体早期感染过程中两种抗原的量发生显著变化,并且共生体生殖 形式选择性地合成63kDa蛋白质,该蛋白质可能是与共生作用有联系的关键分子;绿草履虫-小球藻共生系统中,共生藻中存在葡糖胺硬性壁是其与草履虫发生共生关系的基本条件,其中,共生藻参与宿主代谢,与宿主形成相互受益的专一性关系,并且藻类共生体的作用可能影响了宿主草履虫基因组有关结构,改变了其基因表达。作者推测,探索共生体对宿主基因结构及其表达产物的影响可能是对纤毛虫中共生作用研究的主要趋势,这对于深入了 解真核细胞中宿主-共生体双方的相互作用、物质交流在分子水平上的调控机理、细胞结构与功能的关系等细胞生命活动规律是有意义的。%To date, bacterial,algal and other microbial symbionts have been found in more than 100 species of ciliates. The study of the host-symbiont system in ciliates shows that: ( 1 ) The inheritance of kappa particles in the cytoplasm of Paramecium aurelia is a classic example of the cytoplasmic inheritance theory. (2) Bacterial symbionts in some anerobic ciliates that lack mitochondria play the major role in the host's metabolism. (3) In the P. Caudatum-Holospora obtusa system, 39- and 15-kDa periplasmic pro teins of the infectious H. Obtusa reacted with IF-3-1 and IF-3-2 monoclonal antibodies respectively. The amounts of both antigens were reduced during

  19. Molecular phylogeny and species separation of five morphologically similar Holosticha-complex ciliates (Protozoa, Ciliophora) using ARDRA riboprinting and multigene sequence data (United States)

    Gao, Feng; Yi, Zhenzhen; Gong, Jun; Al-Rasheid Khaled, A. S.; Song, Weibo


    To separate and redefine the ambiguous Holosticha-complex, a confusing group of hypotrichous ciliates, six strains belonging to five morphospecies of three genera, Holosticha heterofoissneri, Anteholosticha sp. pop1, Anteholosticha sp. pop2, A. manca, A. gracilis and Nothoholosticha fasciola, were analyzed using 12 restriction enzymes on the basis of amplified ribosomal DNA restriction analysis. Nine of the 12 enzymes could digest the DNA products, four ( Hinf I, Hind III, Msp I, Taq I) yielded species-specific restriction patterns, and Hind III and Taq I produced different patterns for two Anteholosticha sp. populations. Distinctly different restriction digestion haplotypes and similarity indices can be used to separate the species. The secondary structures of the five species were predicted based on the ITS2 transcripts and there were several minor differences among species, while two Anteholosticha sp. populations were identical. In addition, phylogenies based on the SSrRNA gene sequences were reconstructed using multiple algorithms, which grouped them generally into four clades, and exhibited that the genus Anteholosticha should be a convergent assemblage. The fact that Holosticha species clustered with the oligotrichs and choreotrichs, though with very low support values, indicated that the topology may be very divergent and unreliable when the number of sequence data used in the analyses is too low.

  20. Morphology and SSU rDNA sequence analysis of two hypotrichous ciliates (Protozoa, Ciliophora, Hypotrichia) including the new species Metaurostylopsis parastruederkypkeae n. sp. (United States)

    Lu, Borong; Wang, Chundi; Huang, Jie; Shi, Yuhong; Chen, Xiangrui


    The morphology and phylogeny of two hypotrichous ciliates, Metaurostylopsis parastruederkypkeae n. sp. and Neourostylopsis flavicana (Wang et al., 2011) Chen et al., 2013 were investigated based on morphology, infraciliature and the small subunit (SSU) ribosomal RNA gene (rRNA) sequence. The new species, M. parastruederkypkeae n. sp. was identified according to its characteristics: body shape ellipsoidal, size about (165-200) × (45-60) μm in vivo, cell color reddish; two types of cortical granules including wheat grain-like and yellow-greenish larger ones along the marginal cirri rows and dorsal kineties and dot-like and reddish smaller ones, grouped around marginal cirri on ventral side and arranged in short lines on dorsal side; 26-41 adoral membranelles; three frontal and one parabuccal, five to seven frontoterminal, one buccal, and three to six transverse cirri; seven to thirteen midventral pairs; five to nine unpaired ventral cirri, five to seven left and three to five right marginal rows; and three complete dorsal kineties. Phylogenetic analysis based on SSU rDNA sequences showed that both Metaurostylopsis and Neourostylopsis are monophyletic. As the internal relationship between and within both genera are not clear, further studies on the species in these two genera are necessary. The key characteristics of all known twelve Metaurostylopsis-Apourostylopsis-Neourostylopsis species complex were updated.

  1. Morphology and phylogeny of three karyorelictean ciliates (Protista, Ciliophora), including two novel species, Trachelocerca chinensis sp. n. and Tracheloraphis dragescoi sp. n. (United States)

    Xu, Yuan; Yan, Ying; Li, Lifang; Al-Rasheid, Khaled A S; Al-Farraj, Saleh A; Song, Weibo


    This paper investigates the morphology and infraciliature of three karyorelictean ciliates, Trachelocerca chinensis sp. n., Tracheloraphis dragescoi sp. n. and a rarely known form, Geleia acuta (Dragesco, 1960) Foissner, 1998, which were isolated from the intertidal zone of sandy beaches at Zhanjiang and Qingdao, China. Trachelocerca chinensis sp. n. is distinguished from related forms by having 26-30 somatic kineties, a narrow glabrous stripe and a single nuclear group composed of approximately four to six macronuclei and two micronuclei. Tracheloraphis dragescoi sp. n. can be recognized through its 14-22 somatic kineties, wide glabrous stripe and a single nuclear group composed of about four macronuclei. Phylogenetic analyses based on small-subunit (SSU) rRNA gene sequences indicated that the genera Trachelocerca and Tracheloraphis are closely related but that neither of them appears to be a clearly monophyletic group. Nonetheless, the monophyly of Trachelocerca is not rejected by the approximately unbiased (AU) test (P = 0.143, >0.05), although that of Tracheloraphis is rejected (P = 0.011, <0.05). Geleia acuta, meanwhile, branched with Geleia fossata and falls in the Geleia clade. PMID:25238761

  2. Phylogenetic positions of four hypotrichous ciliates (Protista, Ciliophora) based on SSU rRNA gene, with notes on their morphological characters. (United States)

    Yang, Caiting; Liu, An; Xu, Yusen; Xu, Yuan; Fan, Xinpeng; Al-Farraj, Saleh A; Ni, Bing; Gu, Fukang


     The morphology and infraciliature of the four hypotrichous ciliates; Rigidohymena inquieta (Stokes, 1887) Berger, 2011, Pattersoniella vitiphila Foissner, 1987, Notohymena australis Foissner & O' Donoghue, 1990, and Cyrtohymena (Cyrtohymenides) australis (Foissner, 1995) Foissner, 2004, collected from east China, were investigated by using live observation and protargol impregnation method. An improved diagnosis for R. inquieta was supplied based on descriptions of present and previous populations. New morphology and morphogenesis information based on Chinese populations of another three hypotrichids were also supplemented. The Small-subunit rRNA (SSU rRNA) gene sequences of the four species were characterized and their phylogenetic positions were revealed by means of Bayesian inference and Maximum-likelihood analysis. The analyses shows that R. inquieta clusters with other members of the subfamily Stylonychinae, which confirms the monophyly of the subfamily and verified R. inquieta as a separated species from R. candens though it differs from others mainly by body size. C. (C.) australis occupying the basal position of the clade which contains cyrtohymenids and some other groups, declines the idea of separating Cyrtohymena into two subgenus. Notohymena australis and China population of Pattersoniella vitiphila respectively clustering with their congeners correspond well with the systematics revealed by morphological similarities. PMID:26623736

  3. The protein pheromone Er-1 of the ciliate Euplotes raikovi stimulates human T-cell activity: Involvement of interleukin-2 system

    International Nuclear Information System (INIS)

    Water-soluble protein signals (pheromones) of the ciliate Euplotes have been supposed to be functional precursors of growth factors and cytokines that regulate cell–cell interaction in multi-cellular eukaryotes. This work provides evidence that native preparations of the Euplotes raikovi pheromone Er-1 (a helical protein of 40 amino acids) specifically increases viability, DNA synthesis, proliferation, and the production of interferon-γ, tumor necrosis factor-α, interleukin (IL)-1β, IL-2, and IL-13 in human Jurkat T-cells. Also, Er-1 significantly decreases the mRNA levels of the β and γ subunits of IL-2 receptor (IL-2R), while the mRNA levels of the α subunit appeared to be not affected. Jurkat T-cell treatments with Er-1 induced the down-regulation of the IL-2Rα subunit by a reversible and time-dependent endocytosis, and increased the levels of phosphorylation of the extracellular signal-regulated kinases (ERK). The cell-type specificity of these effects was supported by the finding that Er-1, although unable to directly influence the growth of human glioma U-373 cells, induced Jurkat cells to synthesize and release factors that, in turn, inhibited the U-373 cell proliferation. Overall, these findings imply that Er-1 coupling to IL-2R and ERK immuno-enhances T-cell activity, and that this effect likely translates to an inhibition of glioma cell growth. -- Highlights: ► Euplotes pheromone Er-1 increases the growth of human Jurkat T-cells. ► Er-1 increases the T-cell production of specific cytokines. ► Er-1 activates interleukin-2 receptor and extracellular signal-regulated kinases. ► The immuno-enhancing effect of Er-1 on Jurkat cells translates to an inhibition of human glioma cell growth.

  4. La estria supranuclear de las células ciliadas en la rinitis alérgica Supranuclear stria of ciliated cells in allergic rhinitis

    Directory of Open Access Journals (Sweden)

    Ana Zerdiew


    Full Text Available Se estudiaron 80 pacientes adultos alérgicos, que cursaron con los siguientes cuadros clínicos: 16 casos de rinitis intermitente y 64 de rinitis persistente. Se realizó el recuento porcentual de la estría supranuclear de las células ciliadas, respecto de los leucocitos presentes en los extendidos obtenidos por toma endonasal. Con los datos obtenidos se clasificaron los extendidos en 4 grupos; Grupo A (N=23: predominio leucocitario eosinófilo con eosinofilia nasal >10%, Grupo B (N=15: abundantes leucocitos neutrófilos y eosinofilia nasal >10%, Grupo C (N=29: con escasos leucocitos, Grupo D (N=13: con abundantes leucocitos de predominio neutrófilo sin eosinofilia. Se observó que el incremento porcentual de estría supranuclear se correlacionó con eosinofilia nasal >10% y con las muestras que presentaron escasos leucocitos. Sin embargo se evidenció una marcada disminución del porcentaje de estría supranuclear en la leucocitosis neutrófila de etiología bacteriana.Nasal secretions were studied in 80 allergic adults patients: 16 with intermittent rhinitis and 64 with persistent rhinitis. The percentage of supranuclear stria of ciliated cells with regard to leucocytes was studied by nasal scraping. Four groups of patients were classified according to nasal leucocytic predominance: patients with eosinophilic predominance with eosinophils > 10% in Group A (N=23, patients with abundant neutrophils and eosinophils >10% in Group B (N=15, patients with scant leucocytes in Group C (N=29, patients with neutrophilic predominance without eosinophils in Group D (N=13. An increase of supranuclear stria percentage was correlated to eosinophils > 10% and also correlated to scant leucocytes. Nevertheless, a significant decrease of supranuclear stria percentage was observed in neutrophilic leukocytosis of bacterial etiology.

  5. Morphology and phylogenetic analysis of two oxytrichid soil ciliates from China, Oxytricha paragranulifera n. sp. and Oxytricha granulifera Foissner and Adam, 1983 (Protista, Ciliophora, Hypotrichia). (United States)

    Shao, Chen; Lv, Zhao; Pan, Ying; Al-Rasheid, Khaled A S; Yi, Zhenzhen


    The morphology and infraciliature of two hypotrichous ciliates, Oxytricha paragranulifera n. sp. and Oxytricha granulifera Foissner and Adam, 1983, collected respectively from the surface of a sandy soil in the Huguang mangrove forest, Zhanjiang, China, and the surface of soil in a forest beside Ziwu Road, Xian, north-west China, were examined. O. paragranulifera n. sp. is characterized by an elongate body with slightly tapered anterior end, two macronuclear nodules and two micronuclei, paroral and endoral in Stylonychia-pattern, colourless cortical granules distributed in clusters or irregular short rows, adoral zone occupying 37 % of the body length, marginal rows almost confluent posteriorly, six dorsal kineties and three caudal cirri, caudal cirri and dorsal bristles almost indistinguishable when viewed in vivo. The well-known O. granulifera Foissner and Adam, 1983 was also redescribed and can be separated from the novel species by having cortical granules arranged along dorsal kineties and marginal rows on both sides (vs grouped in clusters as well as in short irregular rows), paroral and endoral in Oxytricha-pattern (vs in Stylonychia-pattern), macronuclear nodules obviously detached (vs adjacent) and a non-saline terrestrial habitat (vs saline terrestrial). The separation of these two taxa is also firmly supported by the molecular data, which show a significant difference between the two in their SSU rRNA gene sequences (similarity 97.1 %). Phylogenetic analyses based on SSU rRNA gene sequence data suggest a close relationship within the Oxytrichidae assemblage between O. paragranulifera n. sp. and O. granulifera. PMID:24928427

  6. SSU rDNA sequence diversity and seasonally differentiated distribution of nanoplanktonic ciliates in neritic Bohai and Yellow Seas as revealed by T-RFLP.

    Directory of Open Access Journals (Sweden)

    Jun Dong

    Full Text Available Nanociliates have been frequently found to be important players in the marine microbial loop, however, little is known about their diversity and distribution in coastal ecosystems. We investigated the molecular diversity and distribution patterns of nanoplanktonic oligotrich and choreotrich (OC ciliates in surface water of three neritic basins of northern China, the South Yellow Sea (SYS, North Yellow Sea (NYS, and Bohai Sea (BS in June and November 2011. SSU rRNA gene clone libraries generated from three summertime samples (sites B38, B4 and H8 were analyzed and revealed a large novel ribotype diversity, of which many were low-abundant phylotypes belonging to the subclass Oligotrichia, but divergent from described morphospecies. Based on the data of terminal-restriction fragment length polymorphism (T-RFLP analysis of all 35 samples, we found that the T-RF richness was generally higher in the SYS than in the BS, and negatively correlated with the molar ratio of P to Si. Overall, multidimensional scaling and permutational multivariate analysis of variance of the community turnover demonstrated a distinct seasonal pattern but no basin-to-basin differentiation across all samples. Nevertheless, significant community differences among basins were recognized in the winter dataset. Mantel tests showed that the environmental factors, P:Si ratio, water temperature and concentration of dissolved oxygen (DO, determined the community across all samples. However, both biogeographic distance and environment shaped the community in winter, with DO being the most important physicochemical factor. Our results indicate that the stoichiometric ratio of P:Si is a key factor, through which the phytoplankton community may be shaped, resulting in a cascade effect on the diversity and community composition of OC nanociliates in the N-rich, Si-limited coastal surface waters, and that the Yellow Sea Warm Current drives the nanociliate community, and possibly the

  7. The protein pheromone Er-1 of the ciliate Euplotes raikovi stimulates human T-cell activity: Involvement of interleukin-2 system

    Energy Technology Data Exchange (ETDEWEB)

    Cervia, Davide, E-mail: [Department for Innovation in Biological, Agro-food and Forest systems (DIBAF), University of Tuscia, Viterbo (Italy); Department of Biomedical and Clinical Sciences, “Luigi Sacco” University Hospital, University of Milan, Milano (Italy); Catalani, Elisabetta; Belardinelli, Maria Cristina [Department for Innovation in Biological, Agro-food and Forest systems (DIBAF), University of Tuscia, Viterbo (Italy); Perrotta, Cristiana [Department of Biomedical and Clinical Sciences, “Luigi Sacco” University Hospital, University of Milan, Milano (Italy); Picchietti, Simona [Department for Innovation in Biological, Agro-food and Forest systems (DIBAF), University of Tuscia, Viterbo (Italy); Alimenti, Claudio [Department of Environmental and Natural Sciences, University of Camerino, Camerino (Italy); Casini, Giovanni; Fausto, Anna Maria [Department for Innovation in Biological, Agro-food and Forest systems (DIBAF), University of Tuscia, Viterbo (Italy); Vallesi, Adriana [Department of Environmental and Natural Sciences, University of Camerino, Camerino (Italy)


    Water-soluble protein signals (pheromones) of the ciliate Euplotes have been supposed to be functional precursors of growth factors and cytokines that regulate cell–cell interaction in multi-cellular eukaryotes. This work provides evidence that native preparations of the Euplotes raikovi pheromone Er-1 (a helical protein of 40 amino acids) specifically increases viability, DNA synthesis, proliferation, and the production of interferon-γ, tumor necrosis factor-α, interleukin (IL)-1β, IL-2, and IL-13 in human Jurkat T-cells. Also, Er-1 significantly decreases the mRNA levels of the β and γ subunits of IL-2 receptor (IL-2R), while the mRNA levels of the α subunit appeared to be not affected. Jurkat T-cell treatments with Er-1 induced the down-regulation of the IL-2Rα subunit by a reversible and time-dependent endocytosis, and increased the levels of phosphorylation of the extracellular signal-regulated kinases (ERK). The cell-type specificity of these effects was supported by the finding that Er-1, although unable to directly influence the growth of human glioma U-373 cells, induced Jurkat cells to synthesize and release factors that, in turn, inhibited the U-373 cell proliferation. Overall, these findings imply that Er-1 coupling to IL-2R and ERK immuno-enhances T-cell activity, and that this effect likely translates to an inhibition of glioma cell growth. -- Highlights: ► Euplotes pheromone Er-1 increases the growth of human Jurkat T-cells. ► Er-1 increases the T-cell production of specific cytokines. ► Er-1 activates interleukin-2 receptor and extracellular signal-regulated kinases. ► The immuno-enhancing effect of Er-1 on Jurkat cells translates to an inhibition of human glioma cell growth.

  8. Protocruzia,a highly ambiguous ciliate(Protozoa;Ciliophora):Very likely an ancestral form for Heterotrichea,Colpodea or Spirotrichea? With reevaluation of its evolutionary position based on multigene analyses

    Institute of Scientific and Technical Information of China (English)

    Thorsten; STOECK; Shin; Mann; Kyoon; Al-Rasheid; Khaled; A.; S.; Al-Khedhairy; Abdulaziz; A.


    The ciliate genus Protocruzia belongs to one of the most ambiguous taxa considering its systematic position,possibly as a member of the classes Heterotrichea,Spirotrichea or Karyorelictea,which is tentatively placed into Spirotrichea in Lynn’s 2008 system.To test these hypotheses,multigene trees(Bayesian inference,evolutionary distance,maximum parsimony,and maximum likelihood) were constructed using the small subunit rRNA(SSU rRNA) gene,internal transcribed spacer 2(ITS2) and a protein coding gene(histone H4).All analyses agree that:(1) four morphotypes of Protocruzia from different geographical origins group together and form a monophyletic clade,which cannot be assigned to any of the eleven described ciliate classes;(2) it is invariably positioned on an isolated branch separated from the class Spirotrichea suggesting that this clade should be clearly removed from Spirotrichea;(3) this leads us to hypothesize that this taxon may indeed represent a lineage on a class rank.Based on the fact that it is,both morphologically and in molecular features,closely related to the heterotrichs,Colpodea and Oligohymenophorea,Protocruziida might be an ancestral form for the subphylum Intramacronucleata in the evolutionary line from the class Heterotrichea(subphylum Postciliodesmatophora) to higher taxa.

  9. The secondary structure of large-subunit rRNA divergent domains, a marker for protist evolution

    DEFF Research Database (Denmark)

    Lenaers, G; Nielsen, Henrik; Engberg, J;


    ), Tetrahymena thermophila (ciliate), Physarum polycephalum and Dictyostelium discoideum (slime moulds), Crithidia fasciculata and Giardia lamblia (parasitic flagellates). The folding for the D3, D7a and D10 divergent domains has been refined and a consensus model for the protist 24-26S rRNA structure is...

  10. Tetrahymena Telomerase Is Active as a Monomer


    Bryan, Tracy M.; Goodrich, Karen J.; Cech, Thomas R.


    Telomerase is an enzyme that utilizes an internal RNA molecule as a template for the extension of chromosomal DNA ends. The catalytic core of telomerase consists of the RNA subunit and a protein reverse transcriptase subunit, known as telomerase reverse transcriptase (TERT). It has previously been shown that both yeast and human telomerase can form dimers or multimers in which one RNA in the complex can influence the activity of another. To test the proposal that dimerization might be essenti...

  11. An atom counting and electrophilicity based QSTR approach

    Indian Academy of Sciences (India)

    P K Chattara; D R Roy; S Giri; S Mukherjee; V Subramanian; R Parthasarathi; P Bultinck; S Van Damme


    Quantitative-structure-toxicity-relationship (QSTR) models are developed for predicting the toxicity (pIGC50) of 252 aliphatic compounds on Tetrahymena pyriformis. The single parameter models with a simple molecular descriptor, the number of atoms in the molecule, provide reasonable results. Better QSTR models with two parameters result when global electrophilicity is used as the second descriptor. In order to tackle both charge- and frontier-controlled reactions the importance of the local electro (nucleo) philicities and atomic charges is also analysed.

  12. Improvement of silver impregnation technique (Protargol) to obtain morphological features of protists ciliates, flagellates and opalinates Aperfeiçoamento da técnica de impregnação pela prata (protargol) para obtenção de caracteres morfológicos de protistas ciliados, flagelados e opalinatas


    I. D. da SILVA-NETO


    The research on ciliates, flagelates and opalinates have been widespread by the utilization of techniques employing silver impregnation (Protargol), modified by several authors. However, these are time consuming and its results are variable. The present work is a variant of the technique described by Tuffrau (1964, 1967) showing some adaptations made in our laboratory. The organisms can be preserved by different fixatives (alcoholic Bouin, Stieve's fluid, 2.5% glutaraldehyde and others) and t...

  13. Morphology and phylogenies of two hypotrichous brackish-water ciliates from China, Neourostylopsis orientalis n. sp. and Protogastrostyla sterkii (Wallengren, 1900) n. comb., with establishment of a new genus Neourostylopsis n. gen. (Protista, Ciliophora, Hypotrichia). (United States)

    Chen, Xiangrui; Shao, Chen; Liu, Xihan; Huang, Jie; Al-Rasheid, Khaled A S


    This paper investigates the morphology, infraciliature and small-subunit (SSU) rRNA gene sequences of two hypotrichous ciliates, Neourostylopsis orientalis n. sp., and Protogastrostyla sterkii (Wallengren, 1900) n. comb. (basionym Gastrostyla sterkii), collected from coastal waters in southern China. Neourostylopsis orientalis n. sp. is diagnosed mainly by the arrangement of brownish cortical granules, the numbers of adoral membranelles and frontal and transverse cirri and the characteristics of its midventral cirral pairs. The SSU rRNA gene phylogeny strongly supports the establishment of the new genus Neourostylopsis n. gen., which is characterized mainly by the following features: frontal and transverse cirri clearly differentiated, buccal cirri present, two frontoterminal cirri, midventral complex composed of midventral pairs only and not exceeding the halfway point of the cell, more than one row of marginal cirri on each side which derive from individual anlagen within each parental row, caudal cirri lacking. Thus, two new combinations are required: Neourostylopsis songi (Lei et al., 2005) n. comb., and Neourostylopsis flavicana (Wang et al., 2011) n. comb. Additionally, improved diagnoses for both Metaurostylopsis and Apourostylopsis are supplied in this study. Protogastrostyla sterkii (Wallengren, 1900) n. comb. differs from the similar congener Protogastrostyla pulchra mainly in body shape, ratio of buccal field to body length in vivo and molecular data. Based on the present studies, we conclude that the estuarine population of P. pulchra collected by J. Gong and others [Gong et al., J Eukaryot Microbiol (2007) 54, 468-478] is a population of P. sterkii. PMID:23355699

  14. CX3CR1 Is Expressed in Differentiated Human Ciliated Airway Cells and Co-Localizes with Respiratory Syncytial Virus on Cilia in a G Protein-Dependent Manner.

    Directory of Open Access Journals (Sweden)

    Kwang-Il Jeong

    Full Text Available Respiratory syncytial virus (RSV is the principal cause of bronchiolitis in infants and a significant healthcare problem. The RSV Glycoprotein (G mediates attachment of the virus to the cell membrane, which facilitates interaction of the RSV Fusion (F protein with nucleolin, thereby triggering fusion of the viral and cellular membranes. However, a host protein ligand for G has not yet been identified. Here we show that CX3CR1 is expressed in the motile cilia of differentiated human airway epithelial (HAE cells, and that CX3CR1 co-localizes with RSV particles. Upon infection, the distribution of CX3CR1 in these cells is significantly altered. Complete or partial deletion of RSV G results in viruses binding at least 72-fold less efficiently to cells, and reduces virus replication. Moreover, an antibody targeting an epitope near the G protein's CX3CR1-binding motif significantly inhibits binding of the virus to airway cells. Given previously published evidence of the interaction of G with CX3CR1 in human lymphocytes, these findings suggest a role for G in the interaction of RSV with ciliated lung cells. This interpretation is consistent with past studies showing a protective benefit in immunizing against G in animal models of RSV infection, and would support targeting the CX3CR1-G protein interaction for prophylaxis or therapy. CX3CR1 expression in lung epithelial cells may also have implications for other respiratory diseases such as asthma.

  15. Separation and electrophysiology of ciliated olfactory receptor neu-rons in Bostrychus sinensis%中华乌塘鳢纤毛嗅神经元的分离及其电生理

    Institute of Scientific and Technical Information of China (English)

    赖晓健; 洪万树; 杨薇


    The ciliated olfactory receptor neurons (cORNs) in the olfactory sac were dissociated from Bostrichthys sinensis by enzymatic and mechanical methods. The whole-cell patch-clamp technique was used to determine the resting potential, action potential and voltage-gated ion channel current. The results showed that the B. sinensis cORN was a bipolar neuron, containing cell body, axon and dendrites with olfactory knobs and cilia. The resting and action potential peaks of ciliated olfactory receptor neurons were (–57 ± 6.37) mV and (38.30 ± 0.95) mV, respec-tively. In response to depolarizing voltage steps pulse stimulation from –60 ~ +80 mV, the transient inward current was activated between –60 mV and –40 mV, and reached a peak averaging (–69.08 ± 44.15) pA at −20 to 0 mV; the outward current reached a peak averaging (267.55 ± 73.67) pA at +40 mV. The present study provides a base theory for research in the electrophysiological mechanisms of sex pheromones with their receptors and the application of sex pheromones.%  应用酶消化和机械吹打相结合的方法,快速分离出中华乌塘鳢(Bostrychys sinensis)嗅囊中纤毛嗅觉感受神经元.再应用全细胞膜片钳技术记录中华乌塘鳢纤毛嗅觉感受神经元的静息电位、动作电位及电压门控离子通道电流等电生理学特征.结果表明,中华乌塘鳢纤毛嗅觉感受神经元具有典型的双级神经元结构特征,包括细胞体,轴突,树突以及树突顶端的嗅结和纤毛.嗅觉感受神经元静息电位为(−57±6.37) mV,动作电位峰值为(38.30±0.95) mV.在−60~+80 mV 的阶梯去极化脉冲刺激中,内向电流在−60~−40 mV 激活,−20~0 mV 达到最大值,内向电流峰值为(−69.08±44.15) pA.外向电流在+40 mV 时达最大值,峰值为(267.55±73.67) pA.本研究结果为纤毛嗅觉感受神经元上性信息素受体感受性信息素的电生理机制以及性信息素的应用提供了方法和理论基础.

  16. Caryotricha minuta (Xu et al., 2008) nov. comb., a unique marine ciliate (Protista, Ciliophora, Spirotrichea), with phylogenetic analysis of the ambiguous genus Caryotricha inferred from the small-subunit rRNA gene sequence. (United States)

    Miao, Miao; Shao, Chen; Jiang, Jiamei; Li, Liqiong; Stoeck, Thorsten; Song, Weibo


    A population of Kiitricha minuta Xu et al., 2008, a small kiitrichid ciliate, was isolated from a brackish water sample in Jiaozhou Bay, Qingdao, northern China. After comparison of its morphology and infraciliature, it is believed that this morphotype should be assigned to the genus Caryotricha; hence, a new combination is suggested, Caryotricha minuta (Xu et al., 2008) nov. comb. The small-subunit (SSU) rRNA gene sequence was determined in order to elucidate the phylogenetic position of this poorly known, ambiguous genus. The organism can be clearly separated from its congener, Caryotricha convexa Kahl, 1932, by the extremely shortened ventral cirral rows in the posterior ends. Based on the data available, an improved diagnosis is given for the genus: marine Kiitrichidae with prominent buccal field; two highly developed undulating membranes; non-grouped, uniform cirral rows on both ventral and dorsal sides; enlarged transverse cirri present, which are the only differentiated cirri; marginal cirri not present; one short migratory row located posterior to buccal field; structure of dorsal kineties generally in Kiitricha pattern. The sequence of the SSU rRNA gene of C. minuta differs by 13 % from that of Kiitricha marina. Molecular phylogenetic analyses (Bayesian inference, least squares, neighbour joining, maximum parsimony) indicate that Caryotricha, together with Kiitricha, diverges at a deep level from all other spirotrichs. Its branching position is between Phacodiniidia and Licnophoridia. The results strongly support the distinct separation of the Kiitricha-Caryotricha clade, which always branches basal to the Stichotrichia-Hypotrichia-Oligotrichia-Choreotrichia assemblage. These results also confirm the previous hypothesis that the Kiitricha-Caryotricha group, long assumed to be a close relation to the euplotids, represents a taxon at subclass level within the spirotrichs. PMID:19196791

  17. Using the Ciliate Protozoan Vorticella in Teaching. (United States)

    Jones, Alick R.


    Describes methods for collection, culture, observation, and making permanent stained preparations of the protozoan vorticella. Suggestions are made for experiments to investigate growth, reproduction, settlement, ecology, feeding, and osmoregulation. (CS)

  18. Sex determination: ciliates' self-censorship. (United States)

    Bloomfield, Gareth


    Differentiation involves the expression of certain latent cellular characteristics and the repression of others. A new study has revealed how Paramecium uses short RNAs to delete information from the somatic genome of one of its two sexes. PMID:25004369

  19. The mitochondrion-like organelle of Trimastix pyriformis contains the complete glycine cleavage system

    Czech Academy of Sciences Publication Activity Database

    Zubáčová, Z.; Novák, L.; Bublíková, J.; Vacek, V.; Fousek, Jan; Rídl, Jakub; Tachezy, J.; Doležal, P.; Vlček, Čestmír; Hampl, V.


    Roč. 8, č. 3 (2013), e55417. E-ISSN 1932-6203 R&D Projects: GA ČR GAP506/12/1010 Institutional support: RVO:68378050 Keywords : transcriptome sequencing * Trimastix * mitochondrion-like organelle * glycine cleavage complex Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.534, year: 2013

  20. Head roll stabilisation in the nocturnal bull ant Myrmecia pyriformis: implications for visual navigation. (United States)

    Raderschall, Chloé A; Narendra, Ajay; Zeil, Jochen


    Ant foragers are known to memorise visual scenes that allow them to repeatedly travel along idiosyncratic routes and to return to specific places. Guidance is provided by a comparison between visual memories and current views, which critically depends on how well the attitude of the visual system is controlled. Here we show that nocturnal bull ants stabilise their head to varying degrees against locomotion-induced body roll movements, and this ability decreases as light levels fall. There are always un-compensated head roll oscillations that match the frequency of the stride cycle. Head roll stabilisation involves both visual and non-visual cues as ants compensate for body roll in complete darkness and also respond with head roll movements when confronted with visual pattern oscillations. We show that imperfect head roll control degrades navigation-relevant visual information and discuss ways in which navigating ants may deal with this problem. PMID:26994172

  1. Fontes de lipídeos e monensina na alimentação de novilhos Nelore e sua relação com a população de protozoários ciliados do rúmen Effects of feeding monensin and different sources of fat on the ruminal population of ciliate protozoa in Nellore steers

    Directory of Open Access Journals (Sweden)

    Amaury Camilo Valinote


    Full Text Available Quatro novilhos Nelore, fistulados e canulados no rúmen, foram distribuídos em um delineamento quadrado latino 4 x 4, para avaliar o caroço de algodão e o sal de cálcio de ácidos graxos como fontes de gordura assim como o efeito da monensina em dietas com caroço de algodão, sobre a população de protozoários ciliados e o pH do rúmen. Os tratamentos experimentais foram: dieta controle (CTRL, dieta com sal de cálcio de ácidos graxos (SC, dieta com caroço de algodão (CA e dieta com caroço de algodão sem monensina (CASM. Amostras do conteúdo ruminal foram colhidas às 0, 2, 4, 6 e 8 horas após a alimentação. Foi utilizada câmara de contagem de Sedgwick-Rafter com capacidade de 1mL e microscópio ótico comum provido de retículo com área de 0,4362 mm², para identificação dos gêneros de ciliados. Não houve diferença entre os tratamentos para o pH do rúmen. Os tratamentos com caroço de algodão reduziram todos os gêneros de protozoários ciliados, em especial de Entodinium, provavelmente pela gordura liberada. Os protozoários dos gêneros Diplodinium, Epidinium e Eudiplodinum e o número total de protozoários foram os únicos que sofreram influência do tempo de alimentação. Sais de cálcio de ácidos graxos foram suficientemente inertes no ambiente ruminal, não afetando o número de protozoários ciliados no rúmen de bovinos Nelore. A utilização de monensina em dietas contendo caroço de algodão e alto concentrado não influenciou o número de protozoários ciliados no rúmen de bovinos Nelore.Four ruminally and duodenally cannulated Nellore steers were assigned to a 4 x 4 latin square to study the effects of feeding monensin (M and different sources of fat on the ruminal population of ciliate protozoa and ruminal pH. The experimental diets contained (DM basis 19% of sugar cane and were supplemented with M [control (CTRL], M plus calcium salts of fatty acids (CSFA, M plus whole cottonseed (MWCS, or only WCS

  2. Telomerase Holoenzyme Proteins and Processivity Subunit in Tetrahymena thermophila


    Min, Bosun


    Telomeres are specialized protein-DNA structures that protect the ends of linear chromosomes, and they are maintained by the telomerase ribonucleoprotein (RNP) enzyme complex. Recombinant telomerase RNP with catalytic activity contains, at a minimum, the catalytic reverse transcriptase subunit (TERT) and the telomerase RNA (TER). However, endogenous telomerase is a much larger holoenzyme complex, with telomerase-associated subunits that contribute to RNP assembly and regulation. Telomerase-as...

  3. Protozoários ciliados do rúmen de bovinos e bubalinos alimentados com dietas suplementadas com monensina ou própolis Ruminal ciliate protozoa of cattle and buffalo fed on diet supplemented with monensin or extracts from propolis

    Directory of Open Access Journals (Sweden)

    Thaís Barros Ríspoli


    Full Text Available O objetivo deste trabalho foi avaliar o efeito de dietas suplementadas com monensina ou produtos à base de própolis, nas populações de protozoários ciliados no rúmen de bovinos (Bos taurus e bubalinos (Bubalus bubalis. Quatro bovinos da raça Holandesa e quatro búfalos da raça Murrah adultos, fistulados no rúmen, foram distribuídos em delineamento quadrado latino (4x4. A dieta constituiu-se de 50% de silagem de milho e 50% de concentrado à base de milho em grãos e farelo de soja, com adição de monensina sódica ou aditivo à base de própolis LLOSA2 ou LLOSC1. As amostras do conteúdo ruminal foram coletadas duas horas após a alimentação. O gênero Entodinium foi o mais representativo em todos os tratamentos, para ambas as raças de ruminantes. Em búfalos, foi observado o efeito redutor do tratamento LLOSC1 nas populações do gênero Entodinium, além do efeito redutor dos tratamentos monensina e LLOSA2 sobre os gêneros da subfamília Diplodiniinae. A média de ciliados foi maior em bubalinos (56x10(4 mL-1 do que em bovinos (26x10(4 mL-1. Houve aumento do pH ruminal dos bovinos no tratamento com monensina. O extrato de própolis LLOSC1 reduziu os ciliados do rúmen em bubalinos.The aim of this work was to evaluate the effect of diets supplemented with monensin or with extracts of propolis, on the population of ciliate protozoa in the rumen of cattle (Bos taurus and water buffalo (Bubalus bubalis. Four Holstein cattle and four Murrah buffalo, fistulated in the rumen, were distributed in 4x4 Latin square design. The diet was constituted by 50% corn silage and 50% concentrate based on corn grain and soybean meal, and the supplementation of monensin sodium or propolis extracts LLOSA2 or LLOSC1. Samples of ruminal contents were collected two hours after feeding. The genus Entodinium was the most common in all treatments for both cattle and buffalo. The LLOSC1 treatment reduced the populations of the genus Entodinium in buffalo

  4. Níveis de proteína degradável para novilhas em crescimento sobre a concentração de protozoários ciliados e outros parâmetros ruminais Levels of degradable protein given to heifers for the ciliate protozoa concentration and other ruminal parameters

    Directory of Open Access Journals (Sweden)

    Joaquim Balcells


    Full Text Available Em um ensaio de controle de parâmetros ruminais (pH, ritmo de trânsito (%h, volume ruminal (l, e concentração de protozoários ciliados, foram utilizadas quatro novilhas Holstein, canuladas no rúmen e duodeno, recebendo dietas com 4 níveis de proteína degradável, sem suplementar ou suplementadas com 25, 50 e 75 gramos de proteína degradável por quilo de concentrado em forma de uréia e caseína (98,2 e 93,2% de matéria orgânica e proteína bruta, respectivamente. As rações experimentais foram compostas por 25% de palha de cevada sem tratar e 75% de concentrado formulado em base a diferentes proporções (25/75 e 75/25 de milho/cevada, com 5% de resíduo de trigo e 5% de suplemento vitamínico mineral. Uma contínua infusão de marcador de fluxo de fase líquida (Cr-EDTA foi executada. Os oito tratamentos experimentais (2 dietas x 4 níveis de infusão foram administrados em 8 períodos de balanço em um delineamento cross-over, em esquema fatorial. O nível de infusão de N degradável afetou de forma significativa os valores médios ponderados de pH, que decresceram ao aumentar a suplementação (p 3/mL que de cevada (59,5 x 103/mL; p Entodinium alcançou 87,8% da população total. O gênero Epidinium apresentou menores valores com a dieta de cevada (3,73 vs. 1,89x103/mL, p 3/mL, p 5/mL, p In this experiment four Holstein heifers fitted with rumen and duodenum canulae were utilized to evaluate the rumen parameters as pH, passage rate (%/h, volume (L and ciliated protozoa concentration, when fed diets with four levels of rumen degradable protein. This was achieved supplementing 0, 25, 50 or 75 grams of degradable protein per kg of concentrate as a urea and casein (98.2% OM and 93.2% CP. The diets had 25% of barley straw without treatment and 75% concentrate formulated to contain different proportions (25/75 and 75/25 of corn and barley and also 5% of wheat residue and 5% of mineral and vitamin supplement. A continuous infusion of

  5. Storage Stability and Improvement of Intermediate Moisture Foods (United States)

    Labuza, T. P.


    Shelf life tests are used to estimate the rate of nonenzymatic browning; however, controlling the reducing sugar levels below 23:1 molar ratio to amines, slows the rate. In addition, liquid glycols surpress browning. The protozoan Tetrahymena pyriformis W can be used to estimate nutrition losses during browning. At high temperatures (80 to 120 C) used in processing intermediate moisture foods (IMF), vitamin C destruction shifts to a zero order mechanism. BHA and BHT are the most effective antioxidants against rancidity. In shelf life testing however, 45 C should be the maximum temperature used. Water binding agents are studied. The five isotherms of thirteen humectants were determined. The results show that neither the method of addition nor sequence of addition affects the a sub u lowering ability of these humectants. Results were used to formulate shelf stable IMF processed cheese foods with at least four months shelf life.

  6. Aplicações de técnicas de análise de imagem em microbiologia ambiental


    A.L. Amaral; M. Mota; Ferreira, E. C.


    São evidenciadas algumas aplicações da análise de imagem em microbiologia ambiental, nomeadamente: o reconhecimento e identificação automática de algumas espécies de protozoários presentes em estações de tratamento de águas residuais; o estudo da influência de três tóxicos na mobilidade do protozoário ciliado Tetrahymena pyriformis em meio líquido; a correlação entre actividade metanogénica, velocidade de sedimentação e parâmetros morfológicos de agregados microbianos em dig...

  7. Dicty_cDB: VFC553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce. 42 2e-05 3 AF136446 |AF136446.1 Tetrahymena pyriformis chaperonin-containing-TCP1 theta subunit (CCTtheta) gene, com.... 222 8e-57 BC050492_1( BC050492 |pid:none) Danio rerio chaperonin containing ... 214 2e-54 (Q6EE31) RecName: Full=T-complex protein... 3' end partial sequence, similar to ddbj:Z37164 M.musculus Cctq mRNA encoding cytosolic chaperone containing TCP-1, theta subuni...AFASKLFAIK LATNTANTVLRVDQIIMSKPAGVQNHQKWVQ Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bi... cytosolic chaperone containing TCP-1, theta subunit (CCTtheta). 52 0.009 1 AV364477 |AV364477.1 Mus muscul

  8. Dicty_cDB: Contig-U16062-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 999431_1( EF999431 |pid:none) Leishmania donovani adenylate nucl... 93 3e-17 AF085429_1( AF085429 |pid:none) Candida parapsilos...ome 3, clone:... 44 0.47 4 ( DQ366035 ) Clostridium perfringens strain CW92 plasmid p...nium helveticum strain UTEX 441 chloropl... 34 0.79 11 ( BA000016 ) Clos...2 8.1 3 ( AF160864 ) Tetrahymena pyriformis mitochondrial DNA, complet... 32 8.4 8 ( AM180355 ) Clostridium difficil...AL627444 ) Mouse DNA sequence from clone RP23-307A1 on chrom... 40 9.2 6 ( CP000962 ) Clostridium botulinum A3 str. Loch Ma

  9. Dicty_cDB: Contig-U02912-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 15(T4... 35 4.7 AY765220_1( AY765220 |pid:none) Tetrahymena pyriformis GL metallot... 35 4.7 AJ536344_1( AJ536344 |pid:none) Archi...11( AM746676 |pid:none) Sorangium cellulosum 'So ce 56'... 35 8.1 EU273942_1( EU273942 |pid:none) Amphimedon queenslandica notch...3_1( AF106933 |pid:none) Drosophila melanogaster plexin B (... 35 6.2 AF355595_1( AF355595 |pid:none) Aedes ...790,757,118 total letters Searching..................................................done Score E Sequences ...; 1,051,180,864 total letters Searching..................................................done Score E Sequences

  10. Efeito da monensina e do óleo de soja sobre os protozoários ciliados do rúmen e correlação dos protozoários com parâmetros da fermentação ruminal e digestivos Effect of monensin and soybean oil on rumen ciliate protozoa and correlation between protozoa with ruminal fermentation and digestive parameters

    Directory of Open Access Journals (Sweden)

    Isabel Martinele


    lactating cows on the counting of ciliate protozoa beyond establishing correlations between number of protozoa with some parameters of digestion and ruminal fermentation. The treatments consisted of the inclusion of 33 ppm of sodium monensin or soybean oil at 4% DM, as following: control diet, without oil or monensin - CT; diet with monensin - MN; diet with soybean oil - OL; diet with the combination of 33 ppm of monensin and 4% of soybean oil - OM. Occurrence of 11 ciliate genera was observed, being Entodinium the predominant in all treatments. No significant soybean oil × monensin interaction was observed on protozoa number and genera. The genera Entodinium, Dasytricha, Eremoplastron and Isotricha reduced in the diets with oil, while monensin reduced the counting of Dasytricha, Eremoplastron and Epidinium. The total number of ciliate protozoa and cellulolytics protozoa was reduced by soybean oil and monensin effects, showing a defaunatory additive effect when combined the oil and the monensin. The ciliate cellulolytics was reduced by linoleic acid intake and was related positively with NDF ruminal digestibility and ruminal ammonia. The total number of protozoa was correlated with the molar proportion of propionate in the ruminal liquid, suggesting that monensin and soybean oil, due their defaunatory effect, can reduce the loss of methane in the rumen.

  11. Microbial Diffraction Gratings as Optical Detectors for Heavy Metal Pollutants (United States)

    Noever, David; Matsos, Helen; Brittain, Andrew; Obenhuber, Don; Cronise, Raymond; Armstrong, Shannon


    As a significant industrial pollutant, cadmium is implicated as the cause of itai-itai disease. For biological detection of cadmium toxicity, an assay device has been developed using the motile response of the protozoa species, Tetrahymena pyriformis. This mobile protozoa measures 50 microns in diameter, swims at 10 body lengths per second, and aggregates into macroscopically visible patterns at high organism concentrations. The assay demonstrates a Cd(+2) sensitivity better than 1 micro-M and a toxicity threshold to 5 micro-M, thus encouraging the study of these microbial cultures as viable pollution detectors. Using two-dimensional diffraction patterns within a Tetrahymena culture, the scattered light intensity varies with different organism densities (population counts). The resulting density profile correlates strongly with the toxic effects at very low dosages for cadmium (less than 5 ppm) and then for poison protection directly (with nickel and copper antagonists competing with cadmium absorption). In particular, copper dosages as low as 0.1-0.5 mM Cu have shown protective antagonism against cadmium, have enhanced density variability for cultures containing 1 mM Cd(+2) and therefore have demonstrated the sensitivity of the optical detection system. In this way, such microbial diffraction patterns give a responsive optical measure of biological culture changes and toxicity determination in aqueous samples of heavy metals and industrial pollutants.

  12. Automated image analysis reveals the dynamic 3-dimensional organization of multi-ciliary arrays

    Directory of Open Access Journals (Sweden)

    Domenico F. Galati


    Full Text Available Multi-ciliated cells (MCCs use polarized fields of undulating cilia (ciliary array to produce fluid flow that is essential for many biological processes. Cilia are positioned by microtubule scaffolds called basal bodies (BBs that are arranged within a spatially complex 3-dimensional geometry (3D. Here, we develop a robust and automated computational image analysis routine to quantify 3D BB organization in the ciliate, Tetrahymena thermophila. Using this routine, we generate the first morphologically constrained 3D reconstructions of Tetrahymena cells and elucidate rules that govern the kinetics of MCC organization. We demonstrate the interplay between BB duplication and cell size expansion through the cell cycle. In mutant cells, we identify a potential BB surveillance mechanism that balances large gaps in BB spacing by increasing the frequency of closely spaced BBs in other regions of the cell. Finally, by taking advantage of a mutant predisposed to BB disorganization, we locate the spatial domains that are most prone to disorganization by environmental stimuli. Collectively, our analyses reveal the importance of quantitative image analysis to understand the principles that guide the 3D organization of MCCs.

  13. Chitinolytic activity of the rumen ciliates Diploplastron affine

    Czech Academy of Sciences Publication Activity Database

    Belzecki, G.; Miltko, R.; Michalowski, T.; Šimůnek, Jiří; Kopečný, Jan


    Roč. 53, č. 3 (2008), s. 201-203. ISSN 0015-5632 R&D Projects: GA ČR GA525/05/2584 Grant ostatní: Ministry of Scientific Research and Information Technology Poland(PL) 2 P06Z 052 30 Institutional research plan: CEZ:AV0Z50450515 Keywords : Diploplastron affine Subject RIV: EE - Microbiology, Virology Impact factor: 1.172, year: 2008

  14. Ecotoxicity assessment using ciliate cells in millifluidic droplets. (United States)

    Illing, Rico; Burkart, Corinna; Pfitzner, Daniel; Jungmann, Dirk; Baraban, Larysa; Cuniberti, Gianaurelio


    Precise analysis of the aquatic cells and their responses to the toxic chemicals, i.e., water disinfective agents, is of crucial importance due to their role in the ecosystem. We demonstrate the application of the droplets based millifluidic tool for isolating and longtime monitoring of single Paramecium tetraurelia cells using a large number of water-in-oil emulsion droplets. Due to the automated monitoring of the fluorescence signal, the droplets containing cells are distinguished from the empty reservoirs. A viability indicator is used to follow the metabolic dynamic of the cells in every single droplet. Finally, we perform ecotoxicity tests in droplets, exposing the encapsulated paramecia cells to silver nitrate for determination of EC50 levels, and compare the output with the conventional microtiter plate assay. PMID:27051472

  15. A survey of entodiniomorphid ciliates in chimpanzees and bonobos

    Czech Academy of Sciences Publication Activity Database

    Pomajbíková, K.; Petrželková, Klára Judita; Profousová, Ilona; Petrášová, Jana; Kišidayová, S.; Váradyová, Z.; Modrý, David


    Roč. 142, č. 1 (2010), s. 42-48. ISSN 0002-9483 R&D Projects: GA ČR GA524/06/0264; GA AV ČR KJB600930615; GA MŠk MEB080890 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Troglodytella abrassarti * entodiniomorphids * Pan troglodytes * Pan paniscus * captivity Subject RIV: EG - Zoology Impact factor: 2.693, year: 2010

  16. Unsteady feeding and optimal strokes of model ciliates

    CERN Document Server

    Michelin, Sebastien


    The flow field created by swimming microorganisms not only enables their locomotion but also leads to advective transport of nutrients. In this paper we address analytically and computationally the link between unsteady feeding and unsteady swimming on a model microorganism, the spherical squirmer, actuating the fluid in a time-periodic manner. We start by performing asymptotic calculations at low P\\'eclet number (Pe) on the advection-diffusion problem for the nutrients. We show that the mean rate of feeding as well as its fluctuations in time depend only on the swimming modes of the squirmer up to order Pe^(3/2), even when no swimming occurs on average, while the influence of non-swimming modes comes in only at order Pe^2. We also show that generically we expect a phase delay between feeding and swimming of 1/8th of a period. Numerical computations for illustrative strokes at finite Pe confirm quantitatively our analytical results linking swimming and feeding. We finally derive, and use, an adjoint-based opt...

  17. Preparation Of Ciliated Protozoa For Scanning Electron Microscopy




    Author: Microscopy Laboratory General notes: The same procedures are used to fix and stain cells for SEM and for TEM. Cells can be fixed using conventional [glutaraldehyde-osmium fixation]( described for transmission electron microscopy. To preserve ciliary orientation, use the "instant fixation" protocol described here. With this method, the cortex and ciliary beat form is well preserved but the cytoplasm is poorly preser...

  18. Imine-Functionalized Triazatriangulenium Platforms: Towards an Artificial Ciliated Epithelium. (United States)

    Hammerich, Melanie; Rusch, Talina; Krekiehn, Nicolai R; Bloedorn, Andreas; Magnussen, Olaf M; Herges, Rainer


    Triazatriangulenium (TATA) platforms have been used to prepare highly ordered, self-assembled monolayers of free- and vertically standing imines on Au(111) surfaces. Upon irradiation, the imines undergo trans-cis isomerization and a fast thermal reaction (t1/2 =0.58 s at 20 °C) back to the more stable trans form. It is known that the photochemical reaction proceeds through rotation of the C=N bond and the thermochemical reaction through inversion at the N atom. The imine motors, therefore, should be able to induce a net displacement of particles above the surface similar to cilia epithelia in nature. PMID:27016909

  19. Effect of an energy-deficient diet on populations of ciliate protozoans in bovine rumen Efeito da deficiência de energia na dieta sobre a população de protozoários ciliados do rúmen de bovinos

    Directory of Open Access Journals (Sweden)

    P.C. Soares


    Full Text Available Ten young rumen-cannulated crossbred steers were randomly divided into two groups: a control group (C; n=4, which was fed a balanced diet for daily weight gain of 900g; and a pronounced energy-deprived group (PED; n=6, receiving 30% less of the required energy for maintenance. After 140 days of these alimentary regimes, rumen fluid and urine samples were collected for biochemical and functional tests, before feeding and at 1, 3, 6, and 9 hours after feeding. The energy-deprivation diet caused a significant reduction in the number of Entodinium, Eodinium, Isotricha, Dasytricha, Eremoplastron, Eudiplodinium, Metadinium, Charonina, Ostracodinium, and Epidinium protozoa. There was no effect of the time of sampling in both groups on the total number of ciliates in rumen fluid. A higher number of protozoan forms in binary division were recorded in the control group, at the 6th and 9th hours after feeding (PForam utilizados 10 novilhos mestiços com cânula ruminal, distribuídos em dois grupos: no grupo controle (C; n=4 receberam dieta balanceada para ganho diário de 900g; no grupo tratado com carência pronunciada de energia (CP; n=6, receberam dieta com 30% a menos do nível de mantença em energia. Após 140 dias sob esses regimes de alimentação, foram coletadas amostras do fluido ruminal e urina, para realização de provas bioquímicas e funcionais, antes e às 1, 3, 6 e 9 horas após o fornecimento do alimento. A carência energética resultou em diminuição significativa na quantidade dos protozoários Entodinium, Eodinium, Isotricha, Dasytricha, Eremoplastron, Eudiplodinium, Metadinium, Charonina, Ostracodinium e Epidinium. Não houve efeito da hora de coleta sobre o total de ciliados nos grupos C e CP. Maior número de formas em divisão binária foi registrado no grupo C, na sexta e nona horas pós-alimentação (P<0,019. Observaram-se altas correlações positivas entre a contagem total de protozoários e a fermentação de glicose, am

  20. Protozoan colonization on artificial substrates in relation to water quality in a tropical Indian harbour

    Institute of Scientific and Technical Information of China (English)


    A field study was conducted to evaluate the protozoancolonization patterns on artificial substrates in relation to organic pollution within a tropical harbour. The composition of protozoans and their succession rates on artificial substrates(polyurethane foam units) were compared between two field stations(A and B), and their presence were considered with regards to the prevailing water quality conditions at the study sites. Altogether 44 genera of flagellates and ciliates were documented. The common genera of flagellates and ciliates were documented. The common genera of flagellates encountered included Monas, Polytoma,and Chromalina. Among the ciliates, the predominant genera were Tetrahymena, Vorticella, Lagynophyra, and Heloiphyra. These groups exhibited characteristic successional patterns in relation to ambient water quality. At Station A, located close to the sewage outfall, the water quality parameters included poor Secchi-disc transparency(0.48m), dissolved oxygen of 1.93 mg/ml, salinity of 18 psu, and temperature 31.3 鳦. Here, thenanoflagellates(spumella)colonized first, followed by microcilliate(Tetrahymena) and sessile form(Vorticella). Station B, located on the seaward side, was characterized by relatively less-stressed environmental conditions with transparency 1.85m and dissolved oxygen value of 6.04 mg/ml. Salinity of 27.27 psu, and mean temperature of 30鳦 were recordedat "B". At this station, the nanoflagellate Polytoma was first documented to colonize on the substrate, followed by microcilliate(Lagynophra) and suctorid(Heliophyra). These findings support the use of protozoans as indicator species for evaluating the hazards posed by organic pollution to natural estuarine communities.

  1. Inheritance of the group I rDNA intron in Tetrahymena pigmentosa

    DEFF Research Database (Denmark)

    Nielsen, Henrik; Simon, E M; Engberg, J


    - strains looking for a strong polarity in the inheritance of the intron (intron homing). Based on the genetic analysis we find that the intron in T. pigmentosa is inherited as a neutral character and that intron+ and intron- alleles segregate in a Mendelian fashion with no sign of intron homing. In an...

  2. The Two SAS-6 Homologs in Tetrahymena thermophila Have Distinct Functions in Basal Body Assembly


    Culver, Brady P.; Meehl, Janet B.; Giddings, Thomas H.; Winey, Mark


    Cilia and flagella are structurally and functionally conserved organelles present in basal as well as higher eukaryotes. The assembly of cilia requires a microtubule based scaffold called a basal body. The ninefold symmetry characteristic of basal bodies and the structurally similar centriole is organized around a hub and spoke structure termed the cartwheel. To date, SAS-6 is one of the two clearly conserved components of the cartwheel. In some organisms, overexpression of SAS-6 causes the f...

  3. DYF-1 Is Required for Assembly of the Axoneme in Tetrahymena thermophila▿ †


    Dave, Drashti; Wloga, Dorota; Sharma, Neeraj; Gaertig, Jacek


    In most cilia, the axoneme can be subdivided into three segments: proximal (the transition zone), middle (with outer doublet microtubules), and distal (with singlet extensions of outer doublet microtubules). How the functionally distinct segments of the axoneme are assembled and maintained is not well understood. DYF-1 is a highly conserved ciliary protein containing tetratricopeptide repeats. In Caenorhabditis elegans, DYF-1 is specifically needed for assembly of the distal segment (G. Ou, O...

  4. Study of cilia assembly in Tetrahymena and the role of cytosolic chaperonin CCT


    Seixas, Ana Cecília Fernandes, 1974-


    Os cílios são organelos conservados evolutivamente que são requeridos num vasto número de processos celulares tais como locomoção, quimiotaxia, movimento de fluídos e transdução de sinais. Nos últimos anos, um grande número de publicações tem demonstrado o impacto que pequenas alterações no correcto funcionamento dos cílios tem no Homem. Várias doenças humanas que se caracterizam por quadros clínicos complexos, como o síndrome de Bardet-Biedl (BBS) e o síndrome de Meckel-Gruber (MKS) foram re...

  5. Enzymatic assay for calmodulins based on plant NAD kinase activity

    Energy Technology Data Exchange (ETDEWEB)

    Harmon, A.C.; Jarrett, H.W.; Cormier, M.J.


    NAD kinase with increased sensitivity to calmodulin was purified from pea seedlings (Pisum sativum L., Willet Wonder). Assays for calmodulin based on the activities of NAD kinase, bovine brain cyclic nucleotide phosphodiesterase, and human erythrocyte Ca/sup 2 -/-ATPase were compared for their sensitivities to calmodulin and for their abilities to discriminate between calmodulins from different sources. The activities of the three enzymes were determined in the presence of various concentrations of calmodulins from human erythrocyte, bovine brain, sea pansy (Renilla reniformis), mung bean seed (Vigna radiata L. Wilczek), mushroom (Agaricus bisporus), and Tetrahymena pyriformis. The concentrations of calmodulin required for 50% activation of the NAD kinase (K/sub 0.5/) ranged from 0.520 ng/ml for Tetrahymena to 2.20 ng/ml for bovine brain. The A/sub 0.5/ s ranged from 19.6 ng/ml for bovine brain calmodulin to 73.5 ng/ml for mushroom calmodulin for phosphodiesterase activation. The K/sub 0.5/'s for the activation of Ca/sup 2 +/-ATPase ranged from 36.3 ng/mol for erythrocyte calmodulin to 61.7 ng/ml for mushroom calmodulin. NAD kinase was not stimulated by phosphatidylcholine, phosphatidylserine, cardiolipin, or palmitoleic acid in the absence or presence of Ca/sup 2 +/. Palmitic acid had a slightly stimulatory effect in the presence of Ca/sup 2 +/ (10% of maximum), but no effect in the absence of Ca/sup 2 +/. Palmitoleic acid inhibited the calmodulin-stimulated activity by 50%. Both the NAD kinase assay and radioimmunoassay were able to detect calmodulin in extracts containing low concentrations of calmodulin. Estimates of calmodulin contents of crude homogenates determined by the NAD kinase assay were consistent with amounts obtained by various purification procedures. 30 references, 1 figure, 4 tables.

  6. Stress and Protists: No life without stress. (United States)

    Slaveykova, Vera; Sonntag, Bettina; Gutiérrez, Juan Carlos


    We report a summary of the symposium "Stress and Protists: No life without stress", which was held in September 2015 on the VII European Congress of Protistology in partnership with the International Society of Protistologists (Seville, Spain). We present an overview on general comments and concepts on cellular stress which can be also applied to any protist. Generally, various environmental stressors may induce similar cell responses in very different protists. Two main topics are reported in this manuscript: (i) metallic nanoparticles as environmental pollutants and stressors for aquatic protists, and (ii) ultraviolet radiation - induced stress and photoprotective strategies in ciliates. Model protists such as Chlamydomonas reinhardtii and Tetrahymena thermophila were used to assess stress caused by nanoparticles while stress caused by ultraviolet radiation was tested with free living planktonic ciliates as well as with the symbiont-bearing model ciliate Paramecium bursaria. For future studies, we suggest more intensive analyses on protist stress responses to specific environmental abiotic and/or biotic stressors at molecular and genetic levels up to ecological consequences and food web dynamics. PMID:27365178

  7. Transposon Invasion of the Paramecium Germline Genome Countered by a Domesticated PiggyBac Transposase and the NHEJ Pathway

    Directory of Open Access Journals (Sweden)

    Emeline Dubois


    Full Text Available Sequences related to transposons constitute a large fraction of extant genomes, but insertions within coding sequences have generally not been tolerated during evolution. Thanks to their unique nuclear dimorphism and to their original mechanism of programmed DNA elimination from their somatic nucleus (macronucleus, ciliates are emerging model organisms for the study of the impact of transposable elements on genomes. The germline genome of the ciliate Paramecium, located in its micronucleus, contains thousands of short intervening sequences, the IESs, which interrupt 47% of genes. Recent data provided support to the hypothesis that an evolutionary link exists between Paramecium IESs and Tc1/mariner transposons. During development of the macronucleus, IESs are excised precisely thanks to the coordinated action of PiggyMac, a domesticated piggyBac transposase, and of the NHEJ double-strand break repair pathway. A PiggyMac homolog is also required for developmentally programmed DNA elimination in another ciliate, Tetrahymena. Here, we present an overview of the life cycle of these unicellular eukaryotes and of the developmentally programmed genome rearrangements that take place at each sexual cycle. We discuss how ancient domestication of a piggyBac transposase might have allowed Tc1/mariner elements to spread throughout the germline genome of Paramecium, without strong counterselection against insertion within genes.

  8. Preliminary report on the development of some indices of relative nutritive value (RNV) of cereal and legume samples, applicable in the early generations of selection

    International Nuclear Information System (INIS)

    Rapid screening methods for biuret nitrogen determination and fluorometric lysine estimation are described. While the biuret method has been found to be suitable for early generation screening for peptide nitrogen determination, fluorescence estimation of dansylated grain meal could be taken as a good index of available lysine in cereal and legume samples. The necessity of rapid and inexpensive tests for the determination of Relative Nutritive Value (RNV) in the advance generations of screening, is discussed. Preliminary data available on two such tests, utilizing protozoan Tetrahymena pyriformis W. and flour beetle Tribolium confusum Duval, indicated promise. Both techniques were tried on different cereal and legume samples. The relative lethality of beetle larvae and their nitrogen retention were taken as indices of RNV in legumes. Larval Nitrogen Retention Index (LNRI) of cereal samples was found to be dependent both on nitrogen content and on protein quality. It was concluded that both these organisms need to be further investigated for their potential as test animals for RNV determination in the advance segregating populations. (author)

  9. Acute toxicity of metals and reference toxicants to a freshwater ostracod, Cypris subglobosa Sowerby, 1840 and correlation to EC{sub 50} values of other test models

    Energy Technology Data Exchange (ETDEWEB)

    Khangarot, B.S., E-mail: [Ecotoxicology Division, Indian Institute of Toxicology Research (Formerly: Industrial Toxicology Research Centre), Post Box No. 80, Mahatma Gandhi Marg, Lucknow 226001 (India); Das, Sangita [Ecotoxicology Division, Indian Institute of Toxicology Research (Formerly: Industrial Toxicology Research Centre), Post Box No. 80, Mahatma Gandhi Marg, Lucknow 226001 (India)


    The ostracod Cypris subglobosa Sowerby, 1840 static bioassay test on the basis of a 48 h of 50% of immobilization (EC{sub 50}) has been used to measure the toxicity of 36 metals and metalloids and 12 reference toxicants. Among the 36 metals and metalloids, osmium (Os) was found to be the most toxic in the test while boron (B), the least toxic. The EC{sub 50} values of this study revealed positive linear relationship with the established test models of cladoceran (Daphnia magna), sludge worm (Tubifex tubifex), chironomid larvae (Chironomus tentans), protozoan (Tetrahymena pyriformis), fathead minnow (Pimephales promelas), bluegill sunfish (Lepomis macrochirus), and aquatic macrophyte duckweed (Lemna minor). Correlation coefficients (r{sup 2}) for 17 physicochemical properties of metals or metal ions and EC{sub 50}s (as pM) were examined by linear regression analysis. The electronegativity, ionization potential, melting point, solubility product of metal sulfides (pK{sub sp}), softness parameter and some other physicochemical characteristics were significantly correlated with EC{sub 50}s of metals to C. subglobosa. The reproducibility of toxicity test was determined using 12 reference toxicants. The coefficient of variability of the EC{sub 50}s ranged from 6.95% to 55.37% and variability was comparable to that noticed for D. magna and other aquatic test models. The study demonstrated the need to include crustacean ostracods in a battery of biotests to detect the presence of hazardous chemicals in soils, sewage sludges, sediments and aquatic systems.

  10. Imparting magnetic dipole heterogeneity to internalized iron oxide nanoparticles for microorganism swarm control

    International Nuclear Information System (INIS)

    Tetrahymena pyriformis is a single cell eukaryote that can be modified to respond to magnetic fields, a response called magnetotaxis. Naturally, this microorganism cannot respond to magnetic fields, but after modification using iron oxide nanoparticles, cells are magnetized and exhibit a constant magnetic dipole strength. In experiments, a rotating field is applied to cells using a two-dimensional approximate Helmholtz coil system. Using rotating magnetic fields, we characterize discrete cells’ swarm swimming which is affected by several factors. The behavior of the cells under these fields is explained in detail. After the field is removed, relatively straight swimming is observed. We also generate increased heterogeneity within a population of cells to improve controllability of a swarm, which is explored in a cell model. By exploiting this straight swimming behavior, we propose a method to control discrete cells utilizing a single global magnetic input. Successful implementation of this swarm control method would enable teams of microrobots to perform a variety of in vitro microscale tasks impossible for single microrobots, such as pushing objects or simultaneous micromanipulation of discrete entities

  11. Nutritional aspects of irradiated shrimp

    International Nuclear Information System (INIS)

    Data available in the literature on the nutritional aspects of irradiated shrimp are reviewed and the indication is that irradiation of shrimp at doses up to about 3.2 kGy does not significantly affect the levels of its protein, fat, carbohydrate and ash. There are no reports on the effect of irradiation of shrimp above 3.2 kGy on these components. Limited information available indicates that there are some minor changes in the fatty acid composition of shrimp as a result of irradiation. Irradiation also causes some changes in the amino acid composition of shrimp; similar changes occur due to canning and hot-air drying. Some of the vitamins in shrimp, such as thiamine, are lost as a result of irradiation but the loss is less extensive than in thermally processed shrimp. Protein quality of shrimp, based on the growth of rats as well as that of Tetrahymena pyriformis, is not affected by irradiation. No adverse effects attributed to irradiation were found either in short-term or long-term animal feeding tests

  12. A coralline algal-associated bacterium, pseudoalteromonas strain J010, yields five new korormicins and a bromopyrrole. (United States)

    Tebben, Jan; Motti, Cherie; Tapiolas, Dianne; Thomas-Hall, Peter; Harder, Tilmann


    The ethanol extract of Pseudoalteromonas strain J010, isolated from the surface of the crustose coralline alga Neogoniolithon fosliei, yielded thirteen natural products. These included a new bromopyrrole, 4'-((3,4,5-tribromo-1H-pyrrol-2-yl) methyl)phenol (1) and five new korormicins G-K (2-6). Also isolated was the known inducer of coral larval metamorphosis, tetrabromopyrrole (TBP), five known korormicins (A-E, previously named 1, 1a-c and 3) and bromoalterochromide A (BAC-A). Structures of the new compounds were elucidated through interpretation of spectra obtained after extensive NMR and MS investigations and comparison with literature values. The antibacterial, antifungal and antiprotozoal potential of 1-6, TBP and BAC-A was assessed. Compounds 1-6 showed antibacterial activity while BAC-A exhibited antiprotozoal properties against Tetrahymena pyriformis. TBP was found to have broad-spectrum activity against all bacteria, the protozoan and the fungus Candida albicans. PMID:24828288

  13. A Coralline Algal-Associated Bacterium, Pseudoalteromonas Strain J010, Yields Five New Korormicins and a Bromopyrrole

    Directory of Open Access Journals (Sweden)

    Jan Tebben


    Full Text Available The ethanol extract of Pseudoalteromonas strain J010, isolated from the surface of the crustose coralline alga Neogoniolithon fosliei, yielded thirteen natural products. These included a new bromopyrrole, 4′-((3,4,5-tribromo-1H-pyrrol-2-yl methylphenol (1 and five new korormicins G–K (2–6. Also isolated was the known inducer of coral larval metamorphosis, tetrabromopyrrole (TBP, five known korormicins (A–E, previously named 1, 1a–c and 3 and bromoalterochromide A (BAC-A. Structures of the new compounds were elucidated through interpretation of spectra obtained after extensive NMR and MS investigations and comparison with literature values. The antibacterial, antifungal and antiprotozoal potential of 1–6, TBP and BAC-A was assessed. Compounds 1–6 showed antibacterial activity while BAC-A exhibited antiprotozoal properties against Tetrahymena pyriformis. TBP was found to have broad-spectrum activity against all bacteria, the protozoan and the fungus Candida albicans.

  14. Acute toxicity of metals and reference toxicants to a freshwater ostracod, Cypris subglobosa Sowerby, 1840 and correlation to EC(50) values of other test models. (United States)

    Khangarot, B S; Das, Sangita


    The ostracod Cypris subglobosa Sowerby, 1840 static bioassay test on the basis of a 48h of 50% of immobilization (EC(50)) has been used to measure the toxicity of 36 metals and metalloids and 12 reference toxicants. Among the 36 metals and metalloids, osmium (Os) was found to be the most toxic in the test while boron (B), the least toxic. The EC(50) values of this study revealed positive linear relationship with the established test models of cladoceran (Daphnia magna), sludge worm (Tubifex tubifex), chironomid larvae (Chironomus tentans), protozoan (Tetrahymena pyriformis), fathead minnow (Pimephales promelas), bluegill sunfish (Lepomis macrochirus), and aquatic macrophyte duckweed (Lemna minor). Correlation coefficients (r(2)) for 17 physicochemical properties of metals or metal ions and EC(50)s (as pM) were examined by linear regression analysis. The electronegativity, ionization potential, melting point, solubility product of metal sulfides (pK(sp)), softness parameter and some other physicochemical characteristics were significantly correlated with EC(50)s of metals to C. subglobosa. The reproducibility of toxicity test was determined using 12 reference toxicants. The coefficient of variability of the EC(50)s ranged from 6.95% to 55.37% and variability was comparable to that noticed for D. magna and other aquatic test models. The study demonstrated the need to include crustacean ostracods in a battery of biotests to detect the presence of hazardous chemicals in soils, sewage sludges, sediments and aquatic systems. PMID:19683870

  15. Acute toxicity of metals and reference toxicants to a freshwater ostracod, Cypris subglobosa Sowerby, 1840 and correlation to EC50 values of other test models

    International Nuclear Information System (INIS)

    The ostracod Cypris subglobosa Sowerby, 1840 static bioassay test on the basis of a 48 h of 50% of immobilization (EC50) has been used to measure the toxicity of 36 metals and metalloids and 12 reference toxicants. Among the 36 metals and metalloids, osmium (Os) was found to be the most toxic in the test while boron (B), the least toxic. The EC50 values of this study revealed positive linear relationship with the established test models of cladoceran (Daphnia magna), sludge worm (Tubifex tubifex), chironomid larvae (Chironomus tentans), protozoan (Tetrahymena pyriformis), fathead minnow (Pimephales promelas), bluegill sunfish (Lepomis macrochirus), and aquatic macrophyte duckweed (Lemna minor). Correlation coefficients (r2) for 17 physicochemical properties of metals or metal ions and EC50s (as pM) were examined by linear regression analysis. The electronegativity, ionization potential, melting point, solubility product of metal sulfides (pKsp), softness parameter and some other physicochemical characteristics were significantly correlated with EC50s of metals to C. subglobosa. The reproducibility of toxicity test was determined using 12 reference toxicants. The coefficient of variability of the EC50s ranged from 6.95% to 55.37% and variability was comparable to that noticed for D. magna and other aquatic test models. The study demonstrated the need to include crustacean ostracods in a battery of biotests to detect the presence of hazardous chemicals in soils, sewage sludges, sediments and aquatic systems.

  16. Enzymology of the P-C bond. A study of the biosynthesis and biodegradation of 2-aminoethylphosphonate

    International Nuclear Information System (INIS)

    The mechanisms by which phosphorus-carbon bonds are made and are broken in biological systems are not well understood. In their laboratory they have examined the biosynthesis and biodegradation of the most predominate phosphonate in nature, 2-aminoethylphosphonate (AEP). In Bacillus cereus AEP is first converted to phosphonoacetaldehyde (PA) before hydrolysis of the P-C linkage takes place. They have examined the catalytic mechanism of the enzyme which catalyzes this hydrolysis, phosphonoacetaldehyde hydrolase (phosphonatase). Treatment of the enzyme with [3H]-PA and NaBH4 resulted in ethylation of an active site lysine and loss of catalytic activity. Thus, hydrolysis appears to occur via a covalent imine intermediate. Their studies of AEP biosynthesis in Tetrahymena pyriformis have focused on testing the precursor roles of PEP, phosphonopyruvate and PA. Resuspended microsomes were found to catalyze in the presence of pyridoxal phosphate and alanine, the conversion of these three precursors to AEP. The P-C bond appears to be formed by rearrangement of PEP

  17. Imparting magnetic dipole heterogeneity to internalized iron oxide nanoparticles for microorganism swarm control

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Paul Seung Soo, E-mail: [Drexel University, Department of Mechanical Engineering and Mechanics (United States); Becker, Aaron, E-mail: [Harvard University, Department of Cardiovascular Surgery (United States); Ou, Yan, E-mail:; Julius, Anak Agung, E-mail: [Rensselaer Polytechnic Institute, Department of Electrical, Computer, and Systems Engineering (United States); Kim, Min Jun, E-mail: [Drexel University, Department of Mechanical Engineering and Mechanics (United States)


    Tetrahymena pyriformis is a single cell eukaryote that can be modified to respond to magnetic fields, a response called magnetotaxis. Naturally, this microorganism cannot respond to magnetic fields, but after modification using iron oxide nanoparticles, cells are magnetized and exhibit a constant magnetic dipole strength. In experiments, a rotating field is applied to cells using a two-dimensional approximate Helmholtz coil system. Using rotating magnetic fields, we characterize discrete cells’ swarm swimming which is affected by several factors. The behavior of the cells under these fields is explained in detail. After the field is removed, relatively straight swimming is observed. We also generate increased heterogeneity within a population of cells to improve controllability of a swarm, which is explored in a cell model. By exploiting this straight swimming behavior, we propose a method to control discrete cells utilizing a single global magnetic input. Successful implementation of this swarm control method would enable teams of microrobots to perform a variety of in vitro microscale tasks impossible for single microrobots, such as pushing objects or simultaneous micromanipulation of discrete entities.

  18. Fortification with iron chelate and substitution of sucrose by sucralose in light uvaia sherbet (Eugenia pyriformis Cambess): physical, chemical and sensory characteristics. (United States)

    Giarola, Tales Márcio de Oliveira; Pereira, Cristina Guimarães; de Resende, Jaime Vilela


    In this work, iron fortified light uvaia sherbet, with low sucrose content, was developed and its physical, chemical and sensory characteristics were evaluated. The central composite rotational design (CCRD), applicable to the response surface methodology, was used to analyze the formulations. In the formulations, in addition of iron fortification (9 to 15 mg/100 g), the sucrose was substituted by micronized sucralose in a proportion of 66-94 %. The responses were analyzed with respect to changes in pH, total solids, ash, carbohydrates, proteins, calories, overrun, nucleation and thawing temperatures, rheological parameters and sensory attributes. Protein contents and acidity were similar in all formulations. There was a reduction of over 25 % in the caloric value. The rheological results showed pseudoplastic behavior and significant viscosity differences among the tested sherbets. In the overrun and thawing behavior results the sucrose concentration had a significant influence as the formulations with substitution by 28 g of sucralose/kg of sucrose showed greater air incorporation. In the flavor attribute there was not significance in relation to the iron fortification. Sherbets prepared with substitution of sucrose by sucralose and fortified with iron showed good acceptability, more stability and more resistant to thawing. PMID:26344966

  19. The nuclear pore complex acts as a master switch for nuclear and cell differentiation. (United States)

    Iwamoto, Masaaki; Hiraoka, Yasushi; Haraguchi, Tokuko


    Cell differentiation is associated with the functional differentiation of the nucleus, in which alteration of the expression profiles of transcription factors occurs to destine cell fate. Nuclear transport machineries, such as importin-α, have also been reported as critical factors that induce cell differentiation. Using various fluorescence live cell imaging methods, including time-lapse imaging, FRAP analysis and live-cell imaging associated correlative light and electron microscopy (Live CLEM) of Tetrahymena, a unicellular ciliated protozoan, we have recently discovered that type switching of the NPC is the earliest detectable event of nuclear differentiation. Our studies suggest that this type switching of the NPC directs the fate of the nucleus to differentiate into either a macronucleus or a micronucleus. Our findings in this organism may provide new insights into the role of the NPC in controlling nuclear functions in general in eukaryotes, including controlling cell fate leading to cell differentiation in multicellular metazoa. PMID:26479399

  20. Taxonomy, distribution and prevalence of parasites of tigerfish, Hydrocynus vittatus (Castelnau, 1861) in the Sanyati basin, Lake Kariba, Zimbabwe. (United States)

    Mabika, Nyasha; Barson, Maxwell; Van Dyk, Cobus; Avenant-Oldewage, Annemariè


    Parasites of the tigerfish (Hydrocynus vittatus) were investigated in the period October 2014 to July 2015 in the Sanyati Basin, Lake Kariba. The fish were collected using seine netting and also during the annual Kariba International Tiger Fishing Tournament. A total of 80 fish specimens (24 males and 56 females) were collected and were infected with the following seven parasite taxa: Monogenea (Annulotrema sp.1 from the gills and Annulotrema sp.2 from the skin), Nematoda (Contracaecum larvae), Cestoda (bothriocephalid, larval cyclophyllid), Copepoda (Lamproglena hemprichii), pentastomid, Myxosporea (Myxobolus sp.,) and unicellular ciliate parasites (Trichodina sp., Tetrahymena sp., and unidentified). Annulotrema sp. 1 was observed in all fish and had the highest prevalence, mean intensity and abundance. The fish organs infected were gills, skin, fin, body cavity, stomach, intestines, mesentery, liver, kidney, brain cavity and swim bladder. No parasites were observed in the muscle, eyes and blood. The distribution of the parasites was highest in the gills and lowest in the brain cavity and swimbladder. Bothriocephalids, pentastomes and Trichodina sp. were not observed in male fish. Sex was not related to the intensity of parasites. The results of the study showed that H. vittatus has a richer parasite community than other previous investigated alestids. Pentastomes, Myxobolus sp., Trichodina sp., Tetrahymena sp. and bothriocephalid cestodes are new records for H. vittatus in Zimbabwe. PMID:27447228

  1. Ingredients for protist coexistence: competition, endosymbiosis and a pinch of biochemical interactions. (United States)

    Müller, Johann P; Hauzy, Céline; Hulot, Florence D


    1. The interaction between mutualism, facilitation or interference and exploitation competition is of major interest as it may govern species coexistence. However, the interplay of these mechanisms has received little attention. This issue dates back to Gause, who experimentally explored competition using protists as a model [Gause, G.F. (1935) Vérifications expérimentales de la théorie mathématique de la lutte pour la vie. Actualités Scientifiques et Industrielles, 277]. He showed the coexistence of Paramecium caudatum with a potentially allelopathic species, Paramecium bursaria. 2. Paramecium bursaria hosts the green algae Chlorella vulgaris. Therefore, P. bursaria may benefit from carbohydrates synthesised by the algae. Studying endosymbiosis with P. bursaria is possible as it can be freed of its endosymbiont. In addition, C. vulgaris is known to produce allelochemicals, and P. bursaria may benefit also from allelopathic compounds. 3. We designed an experiment to separate the effects of resource exploitation, endosymbiosis and allelopathy and to assess their relative importance for the coexistence of P. bursaria with a competitor that exploits the same resource, bacteria. The experiment was repeated with two competitors, Colpidium striatum or Tetrahymena pyriformis. 4. Results show that the presence of the endosymbiont enables the coexistence of competitors, while its loss leads to competitive exclusion. These results are in agreement with predictions based on resource equilibrium density of monocultures (R*) supporting the idea that P. bursaria's endosymbiont is a resource provider for its host. When P. bursaria and T. pyriformis coexist, the density of the latter shows large variation that match the effects of culture medium of P. bursaria. Our experiment suggests these effects are because of biochemicals produced in P. bursaria culture. 5. Our results expose the hidden diversity of mechanisms that underlie competitive interactions. They thus support

  2. Absence of Positive Selection on Centromeric Histones in Tetrahymena Suggests Unsuppressed Centromere-Drive in Lineages Lacking Male Meiosis


    Elde, Nels C.; Kevin C Roach; Yao, Meng-Chao; Harmit S Malik


    Centromere-drive is a process where centromeres compete for transmission through asymmetric "female" meiosis for inclusion into the oocyte. In symmetric "male" meiosis, all meiotic products form viable germ cells. Therefore, the primary incentive for centromere-drive, a potential transmission bias, is believed to be missing from male meiosis. In this article, we consider whether male meiosis also bears the primary cost of centromere-drive. Because different taxa carry out different combinatio...

  3. Staurosporine-induced cell death in Tetrahymena thermophila has mixed characteristics of both apoptotic and autophagic degeneration

    DEFF Research Database (Denmark)

    Christensen, S T; Chemnitz, J; Straarup, E M; Kristiansen, Karsten; Wheatley, D N; Rasmussen, L

    phosphorylation of the PKC-specific substrate, myelin basic protein fragment 4-14. Our results show that cell death in the presence of staurosporine is associated with morphological and ultrastructural changes similar to both apoptosis and autophagic degeneration, but these in turn can be postponed or prevented...

  4. Direct Single-Stranded DNA Binding by Teb1 Mediates the Recruitment of Tetrahymena thermophila Telomerase to Telomeres


    Upton, Heather E.; Hong, Kyungah; Collins, Kathleen


    The eukaryotic reverse transcriptase telomerase copies its internal RNA template to synthesize telomeric DNA repeats at chromosome ends in balance with sequence loss during cell proliferation. Previous work has established several factors involved in telomerase recruitment to telomeres in yeast and mammalian cells; however, it remains unclear what determines the association of telomerase with telomeres in other organisms. Here we investigate the cell cycle dependence of telomere binding by ea...

  5. An overview of Suctorian ciliates (Ciliophora, Suctorea) as epibionts of halacarid mites (Acari, Halacaridae)

    Digital Repository Service at National Institute of Oceanography (India)

    Dovgal, I.; Chatterjee, T.; Ingole, B.S.

    of Learning, I.S.M. Annexe, P.O. – I.S.M., Dhanbad-826004, Jharkhand, India. E-mail: 3 Biological Oceanography Division, National Institute of Oceanography, Dona Paula, Goa-403004, India. E-mail: Abstract Scant... lived predominantly on halacarid adults and deutonymphs, and rarely on protonymphs and larvae because of short life span in protonymph and larva stages. Analysis of the literature and our own data have shown that only four suctorian species observed...

  6. Insights on short–term blooms of planktonic ciliates, provided by an easily recognised genus: Cyrtostrombidium

    Czech Academy of Sciences Publication Activity Database

    Bulit, C.; Macek, Miroslav; Montagnes, D. J. S.


    Roč. 52, č. 1 (2013), s. 1-12. ISSN 0065-1583 Institutional support: RVO:60077344 Keywords : bloom * conjugation * parasitism * patch * population dynamics * lagoon Subject RIV: EE - Microbiology, Virology Impact factor: 1.179, year: 2013

  7. The ciliate, Troglodytella abrassarti, contributes to polysaccharide hydrolytic activities in the chimpanzee colon

    Czech Academy of Sciences Publication Activity Database

    Profousová, Ilona; Mihaliková, K.; Laho, T.; Váradyová, Z.; Petrželková, Klára Judita; Modrý, David; Kišidayová, S.


    Roč. 56, č. 4 (2011), s. 339-343. ISSN 0015-5632 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Grant ostatní: VFU(CZ) 245/2009/FVL Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : different protozoal populations * low-fiber diets * Eudiplodinium maggii * fibrolytic activity * degrading enzymes Subject RIV: EG - Zoology Impact factor: 0.677, year: 2011

  8. Preliminary Insights into the Impact of Dietary Starch on the Ciliate, Neobalantidium coli, in Captive Chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Schovancová, K.; Pomajbíková, Kateřina; Procházka, Petr; Modrý, David; Bolechová, P.; Petrželková, Klára Judita


    Roč. 8, č. 11 (2013), e81374. E-ISSN 1932-6203 R&D Projects: GA ČR GA206/09/0927; GA MŠk(CZ) ED1.1.00/02.0068 Grant ostatní: GA MŠk(CZ) EE2.3.20.0300 Institutional support: RVO:60077344 ; RVO:68081766 Keywords : Balantidium coli * nonstrach polysaccharides * lowland gorillas * resistant strach * evolution * infection * parasites * humans Subject RIV: EE - Microbiology, Virology; EG - Zoology (UBO-W) Impact factor: 3.534, year: 2013

  9. Novel insights into the genetic diversity of Balantidium and Balantidium-like cyst-forming Ciliates

    Czech Academy of Sciences Publication Activity Database

    Pomajbíková, K.; Oborník, Miroslav; Horák, Aleš; Petrželková, Klára Judita; Grim, J. N.; Levecke, B.; Todd, A.; Mulama, M.; Kiyang, J.; Modrý, David


    Roč. 7, č. 3 (2013), e2140. ISSN 1935-2735 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 ; RVO:60077344 Keywords : Troglodytella abrassarti * Intestinal parasites * Coli infection Subject RIV: EG - Zoology Impact factor: 4.489, year: 2013

  10. Effects of a ciliate protozoa predator on microbial communities in pitcher plant (Sarracenia purpurea leaves.

    Directory of Open Access Journals (Sweden)

    Taylor K Paisie

    Full Text Available The aquatic communities found within the water filled leaves of the pitcher plant, Sarracenia purpurea, have a simple trophic structure providing an ideal system to study microscale interactions between protozoan predators and their bacterial prey. In this study, replicate communities were maintained with and without the presence of the bactivorous protozoan, Colpoda steinii, to determine the effects of grazing on microbial communities. Changes in microbial (Archaea and Bacteria community structure were assessed using iTag sequencing of 16S rRNA genes. The microbial communities were similar with and without the protozoan predator, with>1000 species. Of these species, Archaea were negligible, with Bacteria comprising 99.99% of the microbial community. The Proteobacteria and Bacteroidetes were the most dominant phyla. The addition of a protozoan predator did not have a significant effect on microbial evenness nor richness. However, the presence of the protozoan did cause a significant shift in the relative abundances of a number of bacterial species. This suggested that bactivorous protozoan may target specific bacterial species and/or that certain bacterial species have innate mechanisms by which they evade predators. These findings help to elucidate the effect that trophic structure perturbations have on predator prey interactions in microbial systems.

  11. Dealing with the presence of the ciliate Euplotes sp. in cultures of the copepod Acartia tonsa

    DEFF Research Database (Denmark)

    Drillet, Guillaume; Dutz, Jörg


    Acartia tonsa fed with Rhodomonas salina. We found that at a concentration of 2 cells ml-1, Euplotes sp. had no effect on the production and hatching success of eggs but increased/decreased the mortality/quality of non-subitaneous eggs. Euplotes sp. had a good fatty acid profile containing high proportion...

  12. Primary structure of the mating pheromone Er-1 of the ciliate Euplotes raikovi. (United States)

    Raffioni, S; Luporini, P; Chait, B T; Disper, S S; Bradshaw, R A


    The complete amino acid sequence of the mating pheromone Er-1 purified from Euplotes raikovi homozygous for mat-1 was determined by automated Edman degradation of the whole protein and peptides generated by cyanogen bromide, trypsin, Staphylococcus aureus V8 protease, and chymotrypsin. The proposed sequence is: Asp-Ala-Cys-Glu-Gln-Ala-Ala-Ile-Gln-Cys-Val-Glu-Ser-Ala-Cys-Glu-Ser-Leu- Cys-Thr-Glu-Gly-Glu-Asp-Arg-Thr-Gly-Cys-Tyr-Met-Tyr-Ile-Tyr-Ser-Asn-Cys- Pro-Pro-Tyr-Val The calculated molecular weight is 4411.0, which is in agreement with the averaged mass of 4410.2 obtained by fission fragment ionization mass spectrometry. Previously reported values of the native molecular weight, determined by gel filtration, have ranged from 9,000 to 12,000. Thus, the native structure is likely a dimer (or larger aggregate) of identical subunits with the three disulfide bonds present occurring as intrachain links. Secondary structure predictions suggest a helical structure at the amino terminus. A comparison of the Er-1 amino acid sequence with known protein sequences did not reveal any significant similarities. PMID:3142868

  13. Identification and functional characterization of an uncharacterized antimicrobial peptide from a ciliate Paramecium caudatum. (United States)

    Cui, Pengfei; Dong, Yuan; Li, Zhijian; Zhang, Yubo; Zhang, Shicui


    The global ever-growing concerns about multi-drug resistant (MDR) microbes leads to urgent demands for exploration of new antibiotics including antimicrobial peptides (AMPs). Here we demonstrated that a cDNA from Ciliata Paramecium caudatum, designated Pcamp1, coded for a protein with features characteristic of AMPs, which is not homologous to any AMPs currently known. Both the C-terminal 91 amino acid residues of PcAMP1, cPcAMP1, expressed in Escherichia coli and the C-terminal 26 amino acid residues (predicted mature AMP), cPcAMP1/26, synthesized, underwent a coil-to-helix transition in the presence of TFE, SDS or DPC. Functional assays revealed that cPcAMP1 and cPcAMP1/26 were both able to kill Aeromonas hydrophila and Staphylococcus aureus. ELISA showed that cPcAMP1 and cPcAMP1/26 were able to bind to microbe-associated molecular pattern molecules LPS and LTA, which was further corroborated by the observations that cPcAMP1 could deposit onto the bacterial membranes. Importantly, both cPcAMP1 and cPcAMP1/26 were able to induce bacterial membrane permeabilization and depolarization, and to increase intracellular ROS levels. Additionally, cPcAMP1 and cPcAMP1/26 were not cytotoxic to mammalian cells. Taken together, our results show that PcAMP1 is a potential AMP with a membrane selectivity towards bacterial cells, which renders it a promising template for the design of novel peptide antibiotics against MDR microbes. It also shows that use of signal conserved sequence of AMPs can be an effective tool to identify potential AMPs across different animal classes. PMID:26883426

  14. New records of epibiont Ciliates (Ciliophora) from Indian coast with descriptions of six new species

    Digital Repository Service at National Institute of Oceanography (India)

    Chatterjee, T.; Fernandez-Leborans, G.; Ramteke, D.; Ingole, B.S.

    data about the macronucleus. C. nodosa has the lorica with one or more annular ridges, without data about macronucleus, external stalk slender, two zooids per lorica. C. triangula has an external stalk curved, and all the stalk was striated...

  15. Molecular diversity of entodiniomorphid ciliate Troglodytella abrassarti and its coevolution with chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Vallo, Peter; Petrželková, Klára Judita; Profousová, Ilona; Petrášová, J.; Pomajbíková, K.; Leendertz, F.; Hashimoto, C.; Simmons, N.; Babweteera, F.; Machanda, Z.; Piel, A.; Robbins, M. M.; Boesch, Ch.; Sanz, C.; Morgan, D.; Sommer, V.; Furuichi, T.; Fujita, S.; Matsuzawa, T.; Kaur, T.; Huffman, M. A.; Modrý, David


    Roč. 148, č. 4 (2012), s. 525-533. ISSN 0002-9483 Institutional support: RVO:68081766 ; RVO:60077344 Keywords : SSU rDNA * ITS * entodiniomorphida * Troglodytellidae * Pan troglodytes Subject RIV: EG - Zoology Impact factor: 2.481, year: 2012

  16. Immunostaining Phospho-epitopes in Ciliated Organs of Whole Mount Zebrafish Embryos. (United States)

    Rothschild, Sarah C; Francescatto, Ludmila; Tombes, Robert M


    The rapid proliferation of cells, the tissue-specific expression of genes and the emergence of signaling networks characterize early embryonic development of all vertebrates. The kinetics and location of signals - even within single cells - in the developing embryo complements the identification of important developmental genes. Immunostaining techniques are described that have been shown to define the kinetics of intracellular and whole animal signals in structures as small as primary cilia. The techniques for fixing, imaging and processing images using a laser-scanning confocal compound microscope can be completed in as few as 36 hr. Zebrafish (Danio rerio) is a desirable organism for investigators who seek to conduct studies in a vertebrate species that is affordable and relevant to human disease. Genetic knockouts or knockdowns must be confirmed by the loss of the actual protein product. Such confirmation of protein loss can be achieved using the techniques described here. Clues into signaling pathways can also be deciphered by using antibodies that are reactive with proteins that have been post-translationally modified by phosphorylation. Preserving and optimizing the phosphorylated state of an epitope is therefore critical to this determination and is accomplished by this protocol. This study describes techniques to fix embryos during the first 72 hr of development and co-localize a variety of relevant epitopes with cilia in the Kupffer's Vesicle (KV), the kidney and the inner ear. These techniques are straightforward, do not require dissection and can be completed in a relatively short period of time. Projecting confocal image stacks into a single image is a useful means of presenting these data. PMID:26967668

  17. Tunable functionality and toxicity studies of titanium dioxide nanotube layers

    Energy Technology Data Exchange (ETDEWEB)

    Feschet-Chassot, E.; Raspal, V.; Sibaud, Y. [Clermont Universite, Universite d' Auvergne, C-BIOSENSS, BP 10448, F-63000 Clermont Ferrand (France); Awitor, O.K., E-mail: koawitor@iut.u-clermont1.f [Clermont Universite, Universite d' Auvergne, C-BIOSENSS, BP 10448, F-63000 Clermont Ferrand (France); Bonnemoy, F. [Clermont Universite, Universite Blaise Pascal, UMR CNRS 6023, LMGE, BP 10448, F-63000 Clermont Ferrand (France); Bonnet, J.L.; Bohatier, J. [Clermont Universite, Universite Blaise Pascal, UMR CNRS 6023, LMGE, BP 10448, F-63000 Clermont Ferrand (France); Clermont Universite, Universite d' Auvergne, Laboratoire de Biologie cellulaire, BP 10448, F-63000 Clermont Ferrand (France)


    In this study, we have developed a simple process to fabricate scalable titanium dioxide nanotube layers which show a tunable functionality. The titanium dioxide nanotube layers were prepared by electrochemical anodization of Ti foil in 0.4 wt.% hydrofluoric acid solution. The nanotube layers structure and morphology were characterized using X-ray diffraction and scanning electron microscopy. The surface topography and wettability were studied according to the anodization time. The sample synthesized displayed a higher contact angle while the current density reached a local minimum. Beyond this point, the contact angles decreased with anodization time. Photo-degradation of acid orange 7 in aqueous solution was used as a probe to assess the photocatalytic activity of titanium dioxide nanotube layers under UV irradiation. We obtained better photocatalytic activity for the sample fabricated at higher current density. Finally we used the Ciliated Protozoan T. pyriformis, an alternative cell model used for in vitro toxicity studies, to predict the toxicity of titanium dioxide nanotube layers in a biological system. We did not observe any characteristic effect in the presence of the titanium dioxide nanotube layers on two physiological parameters related to this organism, non-specific esterases activity and population growth rate.

  18. Ciprofloxacin residue and antibiotic-resistant biofilm bacteria in hospital effluent. (United States)

    Ory, Jérôme; Bricheux, Geneviève; Togola, Anne; Bonnet, Jean Louis; Donnadieu-Bernard, Florence; Nakusi, Laurence; Forestier, Christiane; Traore, Ousmane


    Discharge of antimicrobial residues and resistant bacteria in hospital effluents is supposed to have strong impacts on the spread of antibiotic resistant bacteria in the environment. This study aimed to characterize the effluents of the Gabriel Montpied teaching hospital, Clermont-Ferrand, France, by simultaneously measuring the concentration of ciprofloxacin and of biological indicators resistant to this molecule in biofilms formed in the hospital effluent and by comparing these data to ciprofloxacin consumption and resistant bacterial isolates of the hospital. Determination of the measured environmental concentration of ciprofloxacin by spot sampling and polar organic chemical integrative (POCIS) sampling over 2 weeks, and comparison with predicted environmental concentrations produced a hazard quotient >1, indicating a potential ecotoxicological risk. A negative impact was also observed with whole hospital effluent samples using the Tetrahymena pyriformis biological model. During the same period, biofilms were formed within the hospital effluent, and analysis of ciprofloxacin-resistant isolates indicated that Gamma-Proteobacteria were numerous, predominantly Aeromonadaceae (69.56%) and Enterobacteriaceae (22.61%). Among the 115 isolates collected, plasmid-mediated fluoroquinolone-resistant genes were detected, with mostly aac(6')-lb-cr and qnrS. In addition, 60% of the isolates were resistant to up to six antibiotics, including molecules mostly used in the hospital (aminosides and third-generation cephalosporins). In parallel, 1247 bacteria isolated from hospitalized patients and resistant to at least one of the fluoroquinolones were collected. Only 5 of the 14 species identified in the effluent biofilm were also found in the clinical isolates, but PFGE typing of the Gram-negative isolates found in both compartments showed there was no clonality among the strains. Altogether, these data confirm the role of hospital loads as sources of pollution for wastewater

  19. NCBI nr-aa BLAST: CBRC-TTRU-01-0631 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0631 ref|XP_001031599.1| PAS ... domain S-box family protein [Tetrahymena thermophila] ... gb|EAR83936.1| PAS ... domain S-box family protein [Tetrahymena thermophi ...

  20. Free-living protozoa in the gastrointestinal tract and feces of pigs: Exploration of an unknown world and towards a protocol for the recovery of free-living protozoa. (United States)

    Chavatte, N; Lambrecht, E; Van Damme, I; Sabbe, K; Houf, K


    Associations with free-living protozoa (FLP) have been implicated in the persistence of foodborne pathogenic bacteria in food-related environments. To date however no information is available on the presence of FLP in the gastrointestinal tract (GIT) of pigs, which represents an important reservoir for zoonotic foodborne bacteria and hence a potential location for associations with FLP. This is at least partly due to the lack of adequate protocols to recover FLP from intestinal content and feces. In the present study different protocols to recover FLP from the porcine GIT and feces were tested. The most effective protocols were then applied to explore the presence of live FLP in the pig GIT and feces. A filtration based protocol was identified as the most suitable method to recover viable FLP from the porcine GIT and feces. Cultivable FLP were recovered from different parts of the GIT, suggesting at least a transient presence of FLP in this habitat. Free-living amoebae species (Acanthamoeba spp., Hyperamoeba sp., Vannella sp., Vermamoeba vermiformis, hartmannellids and vahlkampfiids) but also ciliates (Colpoda sp. and Tetrahymena/Glaucoma lookalike) and flagellates (cercomonads, bodonids and glissomonads) were recovered and cultured from pig intestinal content. Acanthamoeba hatchetti and Filamoeba sinensis were isolated for the first time from pig intestinal content. Despite high gastric acidity, non-cyst forming amoeba species were also detected which suggests survival of their trophozoites in the animal GIT. PMID:27369581

  1. Abundance, diversity and community composition of free-living protozoa on vegetable sprouts. (United States)

    Chavatte, N; Lambrecht, E; Van Damme, I; Sabbe, K; Houf, K


    Interactions with free-living protozoa (FLP) have been implicated in the persistence of pathogenic bacteria on food products. In order to assess the potential involvement of FLP in this contamination, detailed knowledge on their occurrence, abundance and diversity on food products is required. In the present study, enrichment and cultivation methods were used to inventory and quantify FLP on eight types of commercial vegetable sprouts (alfalfa, beetroot, cress, green pea, leek, mung bean, red cabbage and rosabi). In parallel, total aerobic bacteria and Escherichia coli counts were performed. The vegetable sprouts harbored diverse communities of FLP, with Tetrahymena (ciliate), Bodo saltans and cercomonads (flagellates), and Acanthamoeba and Vannella (amoebae) as the dominant taxa. Protozoan community composition and abundance significantly differed between the sprout types. Beetroot harbored the most abundant and diverse FLP communities, with many unique species such as Korotnevella sp., Vannella sp., Chilodonella sp., Podophrya sp. and Sphaerophrya sp. In contrast, mung bean sprouts were species-poor and had low FLP numbers. Sampling month and company had no significant influence, suggesting that seasonal and local factors are of minor importance. Likewise, no significant relationship between protozoan community composition and bacterial load was observed. PMID:26742616

  2. Ecological effects of ionizing radiation on population and ecosystem: a computational model ecosystem study

    International Nuclear Information System (INIS)

    Ecosystem is a self-sustaining system of complexity, and their responses to the impacts are synergistic and subjected to the demographic stochasticity of the species, environmental stochasticity and randomness. Environmental fate and effects of radiation has ranged from observable DNA damage of the cell to the fare on tissues, individual, population, community and ecosystems. The quantitative, systematic individual-based model, SIM-COSM was developed to simulate impacts of radiation exposure and other toxicants on an aquatic microbial ecosystem (microcosm). The microcosm consists of heterotroph ciliate protozoa (Tetrahymena thermophila B) as a consumer, autotroph flagellate algae (Euglena gracilis Z) as a producer and saprotroph bacteria (Escherichia coli DH5) as a decomposer. The symbiosis among microbes is self-organized by realizing material cycle and sustained for more than 2 years after inoculation. The system can not afford to lose any one of the microbes to maintain its sustainability. Experimental ecotoxicological tests for (a) gamma radiation, (b) Manganese ions and (c) Gadolinium are summarized. Population dynamics of microbes in Microcosm and its computer simulations by SIM-COSM are shown together in a figure. Population dynamics in Microcosm and SIM-COSM exposed to 500 Gy of gamma-radiation at 50 days after inoculation are shown also in a figure. To take the effects on the interactions between species and environment into account, one option is to put the ecotoxicity tests as experimental micro ecosystem study and theoretical model ecosystem analysis. (M. Suetake)

  3. Toxicity of five anilines to crustaceans, protozoa and bacteria

    Directory of Open Access Journals (Sweden)



    Full Text Available Aromatic amines (anilines and related derivates are an important class of environmental pollutants that can be released to the aquatic environment as industrial effluents or as breakdown products of pesticides and dyes. The toxicity of aniline, 2-chloroaniline, 3-chloroaniline, 4-chloroaniline and 3,5-dichloroaniline towards a multitrophic test battery comprised of bacteria Aliivibrio fischeri (formerly Vibrio fischeri, a ciliated protozoan Tetrahymena thermophila and two crustaceans (Daphnia magna and Thamnocephalus platyurus were investigated. Under the applied test conditions, the toxicity of the anilines notably varied among the test species. The bacteria and protozoa were much less sensitive towards the anilines than the crustaceans: EC50 values 13–403 mg L-1 versus 0.13–15.2 mg L-1. No general tendency between toxicity and the chemical structure of the anilines (the degree of chloro-substitution and the position of the chloro-substituents was found in the case of all the tested aquatic species. The replacement of the artificial test medium (ATM by the river water remarkably decreased the toxicity of anilines to crustaceans but not to protozoa. This research is part of the EU 6th Framework Integrated Project OSIRIS, in which ecotoxicogenomic studies of anilines (e.g., for Daphnia magna will also be performed that may help to clarify the mechanisms of toxicity of different anilines.

  4. Re-evaluation of the phylogenetic position of the genus Dexiotrichides (Protozoa, Ciliophora, Scuticociliatida) inferred from stomatogenetic and molecular information for Dexiotrichides pangi

    Institute of Scientific and Technical Information of China (English)

    SONG Weibo; Alan WARREN; David ROBERTS; SHANG Huimin; MA Hongwei; Norbert WILBERT; MIAO Miao; YI Zhenzhen


    The divisional process and systematic position of the marine scuticociliate Dexiotrichides pangi are studied. Based on both stomatogenetic data and 18S rDNA gene sequences, the phylogeny and morphogenetic characteristics of this taxon, and of other related genera, are analyzed and discussed. Both the divisionary events and the molecular biological data indicate that this species/genus, together with certain other genera in the Dexiotricha-complex, occupies an intermediate position between the tetrahymenids and the "typical" scuticociliate, which suggests that the Dexiotricha-like taxa should be excluded from the "true" scuticociliates. As a further contribution, the process of stomatogenesis in D. pangican be summarized as follows: (1) The oral primordia in the opisthe are formed only by the proliferation of basal bodies in the scutica field, which subsequently develop intothree membranelles, while the new paroral membrane seems to be generated by the sub-anterior portion of somatic kinety 1 (the 1st postoral intercalary kinety). The latter character exhibits a mode similar to Tetrahymena. (2) In the proter the parental membranelles are retained and remain unchanged throughout the entire division process; only the old paroral membrane is disassembled and differentiated into the anlage, which then gives rise to the new paroral membrane and the scutica of the proter. The 18S rRNA gene sequence reported here isthe first one for a ciliate in the Dexiotricha-complex.

  5. Gene : CBRC-PABE-22-0000 [SEVENS

    Lifescience Database Archive (English)


  6. Protozoan Tetrahymena: the great contributions to the fundamental research%原生动物四膜虫"小材"有"大用"

    Institute of Scientific and Technical Information of China (English)




  7. Tetrahymena gene encodes a protein that is homologous with the liver-specific F-antigen and associated with membranes of the Golgi apparatus and transport vesicles

    DEFF Research Database (Denmark)

    Hummel, R; Nørgaard, P; Andreasen, P H;


    associated with membranes of the Golgi apparatus and transport vesicles pointing to a role of TF-ag in membrane trafficking. Transcription of the TF-ag gene, as determined by run-on analyses, was only detectable in growing cells, and following transfer to starvation condition pre-existing TF-ag mRNA was...

  8. Effects of Pluronic F-68 on Tetrahymena cells: protection against chemical and physical stress and prolongation of survival under toxic conditions

    DEFF Research Database (Denmark)

    Hellung-Larsen, P; Assaad, F; Pankratova, Stanislava; Saietz, B L; Skovgaard, L T

    concentrations of Ca2+ (70 microM); (c) prolongs the survival of cells exposed to higher ion concentrations (10 mM Ca2+, or Na+ or K+); (d) postpones the death caused by trace metal ions like Zn2+, Fe3+ and, Cu2+; (e) protects cells from the death caused by shearing forces; and (f) prolongs the survival of cells...

  9. Laparoscopic excision of a ciliated hepatic foregut cyst in a child: A case report and review of the literature

    Directory of Open Access Journals (Sweden)

    Nicholas E. Bruns


    Conclusion: This case report suggests that laparoscopy may be safe and effective for resection of CHFCs with favorable anatomy such as peripheral location and noninvolvement of key vascular and biliary structures.

  10. The Extracellular Matrix Protein Artichoke Is Required for Integrity of Ciliated Mechanosensory and Chemosensory Organs in Drosophila Embryos


    Andrés, Marta; Turiégano, Enrique; Göpfert, Martin C.; Canal, Inmaculada; Torroja, Laura


    Sensory cilia are often encapsulated by an extracellular matrix (ECM). In Caenorhabditis elegans, Drosophila melanogaster, and vertebrates, this ECM is thought to be directly involved in ciliary mechanosensing by coupling external forces to the ciliary membrane. Drosophila mechano- and chemosensory cilia are both associated with an ECM, indicating that the ECM may have additional roles that go beyond mechanosensory cilium function. Here, we identify Artichoke (ATK), an evolutionarily conse...

  11. Pelagic ciliate assemblage of high-altitude lake Atexcac (Puebla, México): Comparison with similar lakes in other regions

    Czech Academy of Sciences Publication Activity Database

    Macek, Miroslav; Lugo, V. A.; Vilaclara, F. G.

    Leiden 093 Backhuys Publishers, 2000 - (Munawar, M.; Lawrence, S.; Munawar, I.; Malley, D.), s. 45-59 Grant ostatní: CONACyT(MX) P220 CCOR880369; EU(XE) MOLAR ENV4-CT95-0007 Keywords : hydrology Subject RIV: EE - Microbiology, Virology

  12. TPP1 is a homologue of ciliate TEBP-β and interacts with POT1 to recruit telomerase (United States)

    Xin, Huawei; Liu, Dan; Wan, Ma; Safari, Amin; Kim, Hyeung; Sun, Wen; O'Connor, Matthew S.; Songyang, Zhou


    Telomere dysfunction may result in chromosomal abnormalities, DNA damage responses, and even cancer. Early studies in lower organisms have helped to establish the crucial role of telomerase and telomeric proteins in maintaining telomere length and protecting telomere ends. In Oxytricha nova, telomere G-overhangs are protected by the TEBP-α/β heterodimer. Human telomeres contain duplex telomeric repeats with 3' single-stranded G-overhangs, and may fold into a t-loop structure that helps to shield them from being recognized as DNA breaks. Additionally, the TEBP-α homologue, POT1, which binds telomeric single-stranded DNA (ssDNA), associates with multiple telomeric proteins (for example, TPP1, TIN2, TRF1, TRF2 and RAP1) to form the six-protein telosome/shelterin and other subcomplexes. These telomeric protein complexes in turn interact with diverse pathways to form the telomere interactome for telomere maintenance. However, the mechanisms by which the POT1-containing telosome communicates with telomerase to regulate telomeres remain to be elucidated. Here we demonstrate that TPP1 is a putative mammalian homologue of TEBP-β and contains a predicted amino-terminal oligonucleotide/oligosaccharide binding (OB) fold. TPP1-POT1 association enhanced POT1 affinity for telomeric ssDNA. In addition, the TPP1 OB fold, as well as POT1-TPP1 binding, seemed critical for POT1-mediated telomere-length control and telomere-end protection in human cells. Disruption of POT1-TPP1 interaction by dominant negative TPP1 expression or RNA interference (RNAi) resulted in telomere-length alteration and DNA damage responses. Furthermore, we offer evidence that TPP1 associates with the telomerase in a TPP1-OB-fold-dependent manner, providing a physical link between telomerase and the telosome/shelterin complex. Our findings highlight the critical role of TPP1 in telomere maintenance, and support a yin-yang model in which TPP1 and POT1 function as a unit to protect human telomeres, by both positively and negatively regulating telomerase access to telomere DNA.

  13. Ciliate food vacuole content and bacterial community composition in the warm-monomictic crater Lake Alchichica, Mexico

    Czech Academy of Sciences Publication Activity Database

    Bautista-Reyes, F.; Macek, Miroslav


    Roč. 79, č. 1 (2012), s. 85-97. ISSN 0168-6496 Institutional research plan: CEZ:AV0Z60170517 Keywords : CARD-FISH * selective predation * oxygen gradient Subject RIV: EE - Microbiology, Virology Impact factor: 3.563, year: 2012



    Matsuoka, Tatsuomi; Kondoh, Asuka; Sabashi, Kunihisa; Nagano, Nobuaki; Akematsu, Takahiko; Kida, Akemi; Iino, Ryota


    Resting cyst formation (encystment) of Colpoda cucullus is caused by an increase in an external Ca2+ concentration or overpopulation of Colpoda vegetative cells. The Ca2+-mediated or overpopulation-mediated encystment was suppressed by Ca2+ channel blockers (Cd2+, La3+, Ni2+), Ca2+-chelating reagents (EGTA, BAPTA), calmodulin antagonists (W-7, trifluoperazine), Rp-cAMPS (an cAMP analog antagonist) and 2-deoxyadenosine (a P-site inhibitor of adenylate cyclase). On the other hand, by the additi...

  15. Role of essential lipids in copepod nutrition: no evidence for trophic upgrading of food quality by a marine ciliate

    DEFF Research Database (Denmark)

    Klein Breteler, W.; Koski, Marja; Rampen, S.


    -quality Rhodomonas sp. diet. The specific mass of fatty acids in S. sulcatum was much lower than in the Dunaliella sp. diet, However, the fatty acid composition of the protozoan more or less resembled that of the food, lacking long-chain highly unsaturated fatty acids (HUFAs). Sterols only occurred in Dunaliella sp...

  16. CEP164-null cells generated by genome editing show a ciliation defect with intact DNA repair capacity. (United States)

    Daly, Owen M; Gaboriau, David; Karakaya, Kadin; King, Sinéad; Dantas, Tiago J; Lalor, Pierce; Dockery, Peter; Krämer, Alwin; Morrison, Ciaran G


    Primary cilia are microtubule structures that extend from the distal end of the mature, mother centriole. CEP164 is a component of the distal appendages carried by the mother centriole that is required for primary cilium formation. Recent data have implicated CEP164 as a ciliopathy gene and suggest that CEP164 plays some roles in the DNA damage response (DDR). We used reverse genetics to test the role of CEP164 in the DDR. We found that conditional depletion of CEP164 in chicken DT40 cells using an auxin-inducible degron led to no increase in sensitivity to DNA damage induced by ionising or ultraviolet irradiation. Disruption of CEP164 in human retinal pigmented epithelial cells blocked primary cilium formation but did not affect cellular proliferation or cellular responses to ionising or ultraviolet irradiation. Furthermore, we observed no localisation of CEP164 to the nucleus using immunofluorescence microscopy and analysis of multiple tagged forms of CEP164. Our data suggest that CEP164 is not required in the DDR. PMID:26966185

  17. Seasonal dynamics, composition and feeding patterns of ciliate assemblages in oligotrophic lakes covering a wide pH range

    Czech Academy of Sciences Publication Activity Database

    Macek, Miroslav; Callieri, C.; Šimek, Karel; Vázquez, A.L.


    Roč. 166, č. 2 (2006), s. 261-287. ISSN 0003-9136 R&D Projects: GA ČR(CZ) GA206/97/0072; GA MŠk(CZ) ME 296; GA MŠk(CZ) OK 118 Grant ostatní: UNAM DGAPA/PAPIIT(MX) IN208502; EC(XE) ENV4-CT95-0007; EC(XE) EVK1-CT-1999-00032; FES UNAM(MX) PAPCA Institutional research plan: CEZ:AV0Z6017912 Keywords : mountain lakes * timberline * acidified lakes * tropical high altitude lake * mixotrophy * oligotrichs * prostomes * gymnosotmes * peritrichs * scuticociliates Subject RIV: EH - Ecology, Behaviour Impact factor: 1.362, year: 2006

  18. Acute effects of heavy metals on the expression of glutathione-related antioxidant genes in the marine ciliate Euplotes crassus

    International Nuclear Information System (INIS)

    Highlights: • Significant higher increases in the relative ROS and total GSH levels were observed after exposure to heavy metals. • Real-time PCR data showed expression levels of GPx and GR mRNA were sensitively modulated within 8 h of exposure to heavy metals. • E. crassus GPx and GR genes may be involved in cellular defense mechanisms against heavy metal-induced oxidative stress. • E. crassus GPx and GR genes will be useful as potential molecular markers for monitoring heavy metal contamination. - Abstract: Euplotes crassus, a single-celled eukaryote, is directly affected by environmental contaminants. Here, exponentially cultured E. crassus were exposed to cadmium, copper, lead, and zinc and then the reactive oxygen species (ROS) and total glutathione (GSH) levels were measured. Subsequently, the transcriptional modulation of glutathione peroxidase (GPx) and glutathione reductase (GR) were estimated by quantitative RT-PCR. After an 8-h exposure, significantly higher increases in the relative ROS and total GSH levels were observed in exposed group, compared to the controls. Real-time PCR data revealed that the expression levels of GPx and GR mRNA were sensitively modulated within 8 h of exposure to all heavy metals. These findings suggest that these genes may be involved in cellular defense mechanisms by modulating their gene expression against heavy metal-induced oxidative stress. Thus, they may be useful as potential molecular biomarkers to assess sediment environments for contaminants

  19. Morphology and systematics of two freshwater urostylid ciliates, with description of a new species (Protista, Ciliophora, Hypotrichia). (United States)

    Pan, Xuming; Fan, Yangbo; Gao, Feng; Qiu, Zijian; Al-Farraj, Saleh A; Warren, Alan; Shao, Chen


    The morphology of two freshwater urostylid species, Neourostylopsis flava spec. nov. and Pseudourostyla subtropicaChen et al., 2014, isolated from freshwater ponds in northern and southern China, respectively, was investigated following examination of specimens in vivo and following protargol staining. Neourostylopsis flava spec. nov. is distinguished from its congeners by the following characteristics: body size 150-220 × 50-75 μm in vivo; yellow in colour; bright yellow to yellow-brownish spherical cortical granules densely arranged along marginal cirral rows and in irregular short rows on dorsal side; adoral zone with 40-55 membranelles; six to eight frontal, three or four buccal, two pretransverse ventral and seven to nine transverse cirri; 27-40 midventral pairs extending to about anterior 55% of cell; four or five left and four right marginal rows; freshwater habitat. A redescription of a freshwater population of P. subtropica is also provided. Phylogenetic analyses based on small subunit ribosomal DNA sequences shows that P. subtropica and N. flava spec. nov. group with their congeners and both Neourostylopsis and Pseudourostyla are monophyletic. PMID:26752607

  20. A new entodiniomorphid ciliate, Troglocorys cava n. g., n. sp., from the wild eastern chimpanzee (Pan troglodytes schweinfurthii) from Uganda

    Czech Academy of Sciences Publication Activity Database

    Tokiwa, T.; Modrý, David; Ito, A.; Pomajbíková, K.; Petrželková, Klára Judita; Imai, S.


    Roč. 57, č. 2 (2010), s. 115-120. ISSN 1066-5234 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Infraciliature * Kalinzu Forest * protozoa * scanning electron microscopy Subject RIV: EG - Zoology Impact factor: 2.397, year: 2010

  1. Cold-shock based method to induce the discharge of extrusomes in ciliated protists and its efficiency. (United States)

    Buonanno, Federico; Ortenzi, Claudio


    Extrusomes are ejectable organelles in protists, which are able to discharge their contents to the outside of the cell in response to external stimuli. It is known that a large number of extrusomes functions as organelles for offense or defense in predator-prey interactions among protists and/or microinvertebrates. To date, the main approach to study these interactions was to compare artificially-induced extrusome-deficient cells with normal cells as prey for predators. Commonly applied methods to obtain extrusome-deficient cells use external chemicals, which could alter the viability of cells and/or interfere with the subsequent analysis of the substances (secondary metabolites) contained in the extrusomes. The cold-shock based method here presented has proven to be effective to remove different kinds of extrusomes from several protist species without harming the treated cells and without adding external reagents. This method could be also useful to simplify the related analysis of the chemical nature of the secreted secondary metabolites. PMID:26375274

  2. [Transgenic bioinsecticides inimical to parasites, but imical to environment]. (United States)

    Kucińska, Jolanta; Lonc, Elzbieta; Rydzanicz, Katarzyna


    Identification of Bacillus thuringiensis (Bt) parasporal crystalline inclusions composed of Cry proteins (=delta-endotoxins) resulted in introduction of microbial pesticides for biological control of some parasites. Delta-endotoxins are encoded by cry genes and are active against pest and nuisance insects (mostly mosquitoes and black flies--vectors of still important infectious diseases). The recent significant progress in DNA recombination technique may overcome limitations (a short residual persistence and a narrow spectrum of activity) associated with application of Bt conventional products. An introduction of cry genes from mosquitocidal subspecies B. th. israelensis (Bti) to the aquatic microorganisms inhabiting the same water bodies as mosquito and fly larvae (Diptera), has considerably improved the toxin delivery system to target insects. However, in the first experiments, in which Bti genes were cloned in cyanobacteria (Agmenellum quadruplicatum, Synechocystis PCC6803), a low gene expression was observed. Thus, it was necessary to integrate cry genes with strong promoters or to increase the number of vector-introduced copies. To overcome the obstacles of low gene expression and regulatory restriction for recombinant organisms, Bti spore/crystal formulations were encapsulated in the aquatic protozoan, Tetrahymena pyriformis. Large numbers of crystals (180 to 240/cell) were accumulated in its food vacuoles. This system resulted also in an increase in toxin persistence from 24 to 71 h. Cloning Bti genes in B. sphaericus (which also produces mosquitocidal proteins) was another way of an increasing Bt crystal residual activity. In this case, the crystals were additionally protected by B. sphaericus exosporium. These transgenic bacteria produced large amounts of delta-endotoxins that remained under water surface longer than the wild B. sphaericus strains. Moreover, they had a broader spectrum of insecticidal activity, because B. sphaericus is toxic mostly to

  3. Effects of chronic γ-irradiation on the aquatic microbial microcosm: equi-dosimetric comparison with effects of heavy metals

    International Nuclear Information System (INIS)

    Effects of chronic γ-irradiation were investigated in the aquatic microcosm consisting of flagellate algae Euglena gracilis as producers, ciliate protozoa Tetrahymena thermophila as consumers and bacteria Escherichia coli as decomposers. At 1.1 Gy day−1, no effects were observed. At 5.1 Gy day−1, cell densities of E. coli showed a tendency to be lower than those of controls. At 9.7 and 24.7 Gy day−1, population decrease was observed in E. coli. E. gracilis and T. thermophila died out after temporal population decrease and subsequent population increase in T. thermophila. It is likely that this temporal population increase was an indirect effect due to interspecies interactions. Effect dose rates of γ-rays were compared with effect concentrations of some metals using the radiochemoecological conceptual model and the effect index for microcosm. Comparison of these community-level effects data with environmental exposure data suggests that ionising radiation, gadolinium and dysprosium have low risks to affect aquatic microbial communities while manganese, nickel and copper have considerable risks. Effects of chronic irradiation were smaller than those of acute irradiation, and an acute to chronic ratio was calculated to be 28 by dividing an acute dose by chronic daily dose rate at which the effect index was 10%. This ratio would be useful for community-level extrapolation from acute to chronic radiation effects. - Highlights: ► Effects of chronic γ-irradiation were investigated in the microbial microcosm. ► A possible indirect effect due to interspecies interactions was detected. ► Effect dose rates of γ-rays were compared with effect concentrations of some metals. ► It is likely that radiation have low risks to affect aquatic microbial communities. ► Effects of chronic γ-irradiation were smaller than those of acute one.

  4. A highly conserved Poc1 protein characterized in embryos of the hydrozoan Clytia hemisphaerica: localization and functional studies.

    Directory of Open Access Journals (Sweden)

    Cécile Fourrage

    Full Text Available Poc1 (Protein of Centriole 1 proteins are highly conserved WD40 domain-containing centriole components, well characterized in the alga Chlamydomonas, the ciliated protazoan Tetrahymena, the insect Drosophila and in vertebrate cells including Xenopus and zebrafish embryos. Functions and localizations related to the centriole and ciliary axoneme have been demonstrated for Poc1 in a range of species. The vertebrate Poc1 protein has also been reported to show an additional association with mitochondria, including enrichment in the specialized "germ plasm" region of Xenopus oocytes. We have identified and characterized a highly conserved Poc1 protein in the cnidarian Clytia hemisphaerica. Clytia Poc1 mRNA was found to be strongly expressed in eggs and early embryos, showing a punctate perinuclear localization in young oocytes. Fluorescence-tagged Poc1 proteins expressed in developing embryos showed strong localization to centrioles, including basal bodies. Anti-human Poc1 antibodies decorated mitochondria in Clytia, as reported in human cells, but failed to recognise endogenous or fluorescent-tagged Clytia Poc1. Injection of specific morpholino oligonucleotides into Clytia eggs prior to fertilization to repress Poc1 mRNA translation interfered with cell division from the blastula stage, likely corresponding to when neosynthesis normally takes over from maternally supplied protein. Cell cycle lengthening and arrest were observed, phenotypes consistent with an impaired centriolar biogenesis or function. The specificity of the defects could be demonstrated by injection of synthetic Poc1 mRNA, which restored normal development. We conclude that in Clytia embryos, Poc1 has an essentially centriolar localization and function.

  5. Five new species of the genus Dendronephthya Kukenthal, 1905, (Octocorallia: Nephtheidae) from the Indian Ocean

    NARCIS (Netherlands)

    Verseveldt, J.; Ofwegen, van L.P.


    Five new species of Dendronephthya from the Indian Ocean are described and figured: Dendronephthya (Morchellana) bruuni, D. (M.) hystricosa, D. (M.) pyriformis, D. (M.?) staphyloidea and D. (Roxasia) vervoorti.

  6. Increased fucosyl glycoconjugate by Mycoplasma hyopneumoniae enhances adherences of Pasteurella multocida type A in the ciliated epithelial cells of the respiratory tract


    Park, Changhoon; Jeong, Jiwoon; KANG, Ikjae; Choi, Kyuhyung; Park, Su-Jin; Chae, Chanhee


    Background The objective of this study was to elucidate the pathogenic mechanisms of how Mycoplasma hyopneumoniae enhances secondary Pasteurella multocida type A infection which leads to porcine enzootic pneumonia in infected pigs. Sixteen pigs were experimentally infected with M. hyopneumoniae and then euthanized at 7, 14, 21 and 28 days post inoculation. In situ hybridization for M. hyopneumoniae DNA and Ulex europaeus agglutinin-I (UEA-I) lectin histochemistry for fucosyl glycoconjugate, w...

  7. Investigations of the effects of UV and X-ray radiation and the repair of radiation damage in the ciliate Stylonychia mytilus

    International Nuclear Information System (INIS)

    Using the example of Stylomychia mytilus, the effects of UV-radiation and ionizing X-ray radiation are compared. The effects on cell division and on the repair of radiation damage in DNA are compared. Sensitivity to UV radiation differs between the stages of the cell cycle while the effects of X-ray radiation are independent of phase. There is no difference in repair processes. (AJ) 891 AJ/AJ 892 MKO

  8. 纤毛虫与养殖刺参的"腐皮综合症"%Ciliates and “cankered cutis disease” of Apostichopus japonicus

    Institute of Scientific and Technical Information of China (English)

    刘晓云; 范瑞青; 谭金山; 高澜


    @@ 近年伴随刺参(Apostichopus japonicus)养殖业的快速发展,病害问题日趋突出.2004年山东沿海多处养殖海参发病,有些地方海参的死亡率高达50%以上.许多专家对刺参的病因和病原进行了研究,将发生于2004年春季的养殖刺参爆发性疾病称之为"腐皮综合症"或"化皮病",并定性其为细菌性疾病.

  9. Digestion, ruminal fermentation, ciliate protozoal populations, and milk production from dairy cows fed cinnamaldehyde, quebracho condensed tannin, or Yucca schidigera saponin extracts. (United States)

    Benchaar, C; McAllister, T A; Chouinard, P Y


    Four ruminally cannulated lactating cows were used in a 4 x 4 Latin square design (28-d periods) to determine the effects of cinnamaldehyde (CIN; 1 g/cow per day), condensed tannins from quebracho trees (QCT, containing 70% tannins, 150 g/cow per day), and saponins from Yucca schidigera extract (YSE, containing 10% saponins; 60 g/cow per day) on digestion, ruminal fermentation characteristics, protozoal populations, and milk production. Intake of dry matter was not affected by the addition of CIN or QCT, but cows fed YSE had lesser intake than cows fed the control diet (21.8 vs. 23.2 kg/d). Apparent total-tract digestibilities of dry matter, organic matter, crude protein, neutral detergent fiber, and acid detergent fiber were unaffected by dietary treatments. Supplementation with CIN, QTE, or YSE did not affect in situ ruminal degradation of soybean meal, grass silage, or corn grain. Ruminal pH (6.67), total volatile fatty acid concentration (135 mM), and molar proportions (mol/100 mol of total volatile fatty acid) of acetate (65.0), propionate (19.6), and butyrate (11.2) were similar among treatments. Ruminal NH(3)-N concentration was not changed by the addition of CIN and YSE, but tended to decrease in cows fed QCT compared with cows fed the control diet (132 vs. 160 mg/L). Total numbers of ruminal protozoa were not changed by adding CIN, QCT, or YSE in the diet (5.85 log(10)/mL). However, the number of Isotricha was greater in ruminal fluid of cows fed CIN than in ruminal fluid of cows fed the control diet (4.46 vs. 4.23 log(10)/mL). Milk production (33.1 kg/d), milk fat (4.3%), and milk protein (3.5%) remained unchanged between dietary treatments. Results of this study show that under our experimental conditions, supplementing dairy cow diets with CIN, QCT, or YSE had limited effects on digestion, ruminal fermentation characteristics, and protozoal populations. The lack of effects observed in this study suggests that these antimicrobials require administration at greater doses to favorably alter rumen microbial fermentation. PMID:19038952

  10. 肺炎患者痰中检出纤毛虫1例%Ciliated protozoan in sputum of a pneumonia patient

    Institute of Scientific and Technical Information of China (English)




  11. Morphology, ontogenetic features and SSU rRNA gene-based phylogeny of a soil ciliate, Bistichella cystiformans spec. nov. (Protista, Ciliophora, Stichotrichia). (United States)

    Fan, Yangbo; Hu, Xiaozhong; Gao, Feng; Al-Farraj, Saleh A; Al-Rasheid, Khaled A S


    The morphology, ontogeny and SSU rRNA gene-based phylogeny of Bistichella cystiformans spec. nov., isolated from the slightly saline soil of a mangrove wetland in Zhanjiang, southern China, were investigated. The novel species was characterized by having five to eight buccal cirri arranged in a row, three to five transverse cirri, four macronuclear nodules aligned, and 17-32 and 20-34 cirri in frontoventral rows V and VI, respectively, both extending to the transverse cirri. The main ontogenetic features of the novel species were as follows: (1) the parental adoral zone of the membranelles is completely inherited by the proter; (2) the frontoventral and transverse cirri are formed in a six-anlagen mode; (3) basically, the frontal-ventral-transverse cirral anlagen II-V generate one transverse cirrus each at their posterior ends, while anlage VI provides no transverse cirrus; (4) both marginal rows and dorsal kineties develop intrakinetally, no dorsal kinety fragment is formed; and (5) the macronuclear nodules fuse into a single mass at the middle stage. Phylogenetic analyses based on the SSU rRNA gene showed that the novel species groups with the clade containing Bistichella variabilis, Parabistichella variabilis, Uroleptoides magnigranulosus and two species of the genus Orthoamphisiella. Given present knowledge, it was considered to be still too early to come to a final conclusion regarding the familial classification of the genus Bistichella; further investigations of key taxa with additional molecular markers are required. PMID:25242538

  12. Biodiversity and molecular phylogeny of Australian Clevelandella species (Class Armophorea, Order Clevelandellida, Family Clevelandellidae), intestinal endosymbiotic ciliates in the wood-feeding roach Panesthia cribrata Saussure, 1864. (United States)

    Lynn, Denis H; Wright, André-Denis G


    There are over 100 species in the Order Clevelandellida distributed in many hosts. The majority is assigned to one of the five families, the Nyctotheridae. Our knowledge of clevelandellid genetic diversity is limited to species of Nyctotherus and Nyctotheroides. To increase our understanding of clevelandellid genetic diversity, species were isolated from intestines of the Australian wood-feeding roach Panesthia cribrata Saussure, 1864 from August to October, 2008. Four morphospecies, similar to those reported in Java and Japan by Kidder [Parasitologica, 29:163-205], were identified: Clevelandella constricta, Clevelandella nipponensis, Clevelandella parapanesthiae, and Clevelandella panesthiae. Small subunit rRNA gene sequences assigned all species to a "family" clade that was sister to the clade of species assigned to the Family Nyctotheridae in the Order Clevelandellida. Genetics and morphology were consistent for the first three Clevelandella species, but isolates assigned to C. panesthiae were assignable to three different genotypes, suggesting that this may be a cryptic species complex. PMID:23590673

  13. La familia de las metalotioneínas en "Tetrahymena" y su aplicación en el desarrollo de biosensores celulares para la detección de metales pesados


    Amaro Torres , Francisco


    La evaluación de la contaminación por metales pesados se debe realizar en base a parámetros como la biodisponibilidad de metales, su toxicidad y genotoxicidad. Para ello se utilizan los llamado biosensores celulares, y los ciliados, como microorganismos eucariotas móviles y sin pared celular, constituyen una excelente herramienta para ello. Aunque T. thermophila presenta un gen codificante (TtPCS) para una proteína homóloga a fitoquelatín sintasas, la ausencia de fitoquelatinas en este ciliad...

  14. NCBI nr-aa BLAST: CBRC-DDIS-05-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-05-0004 ref|XP_001009011.1| Somatostatin/Cortistatin family protein [Tetr...ahymena thermophila SB210] gb|EAR88766.1| Somatostatin/Cortistatin family protein [Tetrahymena thermophila SB210] XP_001009011.1 3e-07 22% ...

  15. Dicty_cDB: VHE717 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d21, 5' end. 70 3e-13 3 EV830481 |EV830481.1 TTSB084TH Tetrahymena thermophila SB210 cDNA library (Heavy metals...trahymena thermophila SB210 cDNA library (Heavy metals) Tetrahymena thermophila c

  16. Gene : CBRC-PABE-17-0002 [SEVENS

    Lifescience Database Archive (English)


  17. NCBI nr-aa BLAST: CBRC-OLAT-26-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0001 ref|YP_740847.1| NADH dehydrogenase subunit 4 [Tetrahymena pigmentos...a] gb|ABI51756.1| NADH dehydrogenase subunit 4 [Tetrahymena pigmentosa] YP_740847.1 0.011 37% ...

  18. NCBI nr-aa BLAST: CBRC-BTAU-01-2897 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2897 ref|YP_740836.1| NADH dehydrogenase subunit 5 [Tetrahymena pigmentos...a] gb|ABI51745.1| NADH dehydrogenase subunit 5 [Tetrahymena pigmentosa] YP_740836.1 0.019 21% ...

  19. Combined effects of γ-rays and acidification on an experimental model ecosystem

    International Nuclear Information System (INIS)

    It is necessary to evaluate combined effects of ionizing radiation and other toxic agents on ecosystems, because ecosystems are exposed to these various factors. The authors studied combined effects of γ-rays and acidification on an experimental model ecosystem (microcosm) mimicking aquatic microbial communities. Microcosms, consisted of flagellate algae Euglena gracilis Z as a producer, ciliate protozoa Tetrahymena thermophila B as a consumer and bacteria Escherichia coli DH5α as a decomposer, were loaded by the following treatments: Irradiation with 100 Gy 60Co γ-rays; Acidification of culture medium to pH4.0 with the mixture of 0.1 N HNO3 and 0.1 N H2SO4 (1:1, v/v), which mimicked acid rain; and Irradiation with 100 Gy γ-rays followed by the acidification of the culture medium (pH 4.0). The γ-irradiation induced a temporary decrease in cell densities of E. coli, but did not affect cell densities of the other species. The concentrations of chlorophyll a and ATP in the microcosm were not affected by the γ-irradiation, and chlorophyll a concentrations in a Eu. gracilis cell were not affected, either. The acidification significantly decreased cell densities of T. thermophila, slightly decreased cell densities of E. coli, and slightly increased cell densities of Eu. gracilis. The concentrations of chlorophyll a and ATP in the microcosm were increased by the acidification, although chlorophyll a concentrations in a Eu. gracilis cell were decreased. The combined exposure to γ-rays and acids temporarily decreased cell densities of E. coli, significantly decreased cell densities of T. thermophila, and slightly increased cell densities of Eu. gracilis. The concentrations of chlorophyll a and ATP in the microcosm were increased by the combined exposure, although chlorophyll a concentrations in a Eu. gracilis cell were decreased. The authors therefore conclude that combined exposure to γ-rays and acids had additive effects on cell densities, chlorophyll a and ATP

  20. Identification of hopanoid, sterol, and tetrahymanol production in the aerobic methanotroph Methylomicrobium alcaliphilum 20Z (United States)

    Welander, P. V.; Summons, R. E.


    observed in freshwater and marine ciliates (such as Tetrahymena thermophila) and two bacteria unrelated to aerobic methanotrophs, Rhodopseudomonas and Bradyrhizobium. Utilizing comparative genomics we identified the oxidosqualene cyclase gene required for sterol biosynthesis as well as two copies of the squalene hopene cyclase gene necessary for hopanoid biosynthesis in the M. alcaliphilum genome. To determine if one or both copies of the squalene hopene cyclase gene were necessary for aminohopanoid or tetrahymanol production, shc gene deletions were constructed and the subsequent mutants were analyzed for impaired hopanoid production. The occurrence of sterols, hopanoids and gammacerane lipids in one bacterium not only provides a unique system in which to study the biosynthesis and function of each lipid class but also to investigate any potential functional and evolutionary relationship these three lipid classes may share. In turn, these studies provide information necessary to properly interpret the occurrence of these molecules in the rock record.

  1. A mechanism of transmission and factors affecting coral susceptibility to Halofolliculina sp. infection (United States)

    Rodríguez, S.; Cróquer, A.; Guzmán, H. M.; Bastidas, C.


    Anecdotal evidence collected since 2004 suggests that infections caused by ciliates in the genus Halofolliculina may be related to coral mortality in more than 25 scleractinian species in the Caribbean. However, the relationship between the presence of ciliates and coral mortality has not yet been firmly established. Field and laboratory manipulations were used to test if ciliate infections harm corals, if ciliates are able to infect healthy colonies, and if coral susceptibility to ciliate infection depends on temperature, depth, distance to an infected colony, and the presence of injuries. Ciliate infections were always characterized by a visually detectable front of ciliates located on recently exposed coral skeletons. These infections altered the normal structure of the colony by causing tissue mortality (0.8 ± 0.95 cm month-1, mean ± SD) and by delaying or preventing recovery from injuries. Under laboratory conditions, ciliates transmitted directly and horizontally from infected to healthy hosts, and coral susceptibility to ciliate infections increased with the presence of injuries. After invasion, the ciliate population grew, rapidly and after 8 d, produced tissue mortality on 32% of newly infected hosts. Thus, our results support the existence of a new Caribbean coral syndrome that is associated with tissue mortality, is infectious, and transmits directly and horizontally. Even though the role of ciliates in the development of lesions on coral tissues remains unclear, their presence is by far the most conspicuous sign of this syndrome; thus, we propose to name this condition Caribbean ciliate infection (CCI).

  2. Ecological impacts of umbrella effects of radiation on the individual members

    International Nuclear Information System (INIS)

    In order to study the interactions in a model aquatic microcosm, an individual-based computer simulation model was developed. The microcosm consists of Euglena gracilis as an autotroph algae, Tetrahymena thermophila as a heterotroph protozoa and Escherichia coli as a saprotroph bacteria. There exists a strong interaction between Tetrahymena and E. coli as the first is the predator of the second. Ecological toxicity tests were conducted to test the population level impacts of the biological effects of radiation and toxicants on the lethality and mobility factors that influence directly or indirectly growth and reproduction. Radiological effects on lethality of E. coli individuals were translated to the reduction of the equilibrium population of Tetrahymena. A synergistic effect at the community level was also observed by the simulation of a combined exposure of radiation and a toxicant which reduced the feeding efficiency of Tetrahymena

  3. Description of two marine amphisiellid ciliates, Amphisiella milnei (Kahl, 1932) Horváth, 1950 and A. sinica sp. nov. (Ciliophora: Hypotrichia), with notes on their ontogenesis and SSU rDNA-based phylogeny. (United States)

    Li, Liqiong; Zhao, Xiaolu; Ji, Daode; Hu, Xiaozhong; Al-Rasheid, Khaled A S; Al-Farraj, Saleh A; Song, Weibo


    The morphology and taxonomy of two marine Amphisiella species, isolated from mariculture waters in northern China, were investigated using standard techniques. One species corresponds well with the original description of the poorly known Amphisiella milnei (Kahl, 1932) Horváth, 1950 by remarkable characteristics, inter alia, (i) the additional cirri between the left frontal cirrus and the buccal cirrus, and (ii) ring-shaped structure in the anterior and posterior body portion (posterior one sometimes lacking). The detailed description of the cirral pattern and an informative ontogenetic stage first reveal that the additional cirri, which are uniformly absent in all congeners, originate from the frontal-ventral transverse cirral anlage I. The other species represents a new species of Amphisiella, A. sinica sp. nov. It is distinguished from its most closely related congener A. annulata (Kahl, 1928) Borror, 1972 by having numerous ring-shaped structures with a shallow brim more or less densely centralised at both ends of the body. Brief notes on the cell division and phylogenetic analyses based on small subunit (SSU) rRNA gene sequence for both organisms are also supplied in order to get further understanding of their systematic positions. The molecular information indicates that both organisms belong to two separate clades and confirms that the genus Amphisiella might be polyphyletic. PMID:27156119

  4. Morphology and small-subunit rRNA gene sequences of two novel marine ciliates, Metanophrys orientalis spec. nov. and Uronemella sinensis spec. nov. (Protista, Ciliophora, Scuticociliatia), with an improved diagnosis of the genus Uronemella. (United States)

    Pan, Xuming; Zhu, Mingzhuang; Ma, Honggang; Al-Rasheid, Khaled A S; Hu, Xiaozhong


    The morphology and infraciliature of two novel marine scuticociliates, Metanophrys orientalis spec. nov. and Uronemella sinensis spec. nov., collected from sandy beaches at Qingdao, China, were investigated using live observation and protargol-staining methods. Metanophrys orientalis spec. nov. is distinguished by the following characteristics: marine habitat and a slender to elongate oval body with pointed anterior end and rounded caudal end, in vivo about 25-50 µm long; buccal field about a quarter to a third of body length; nine or ten somatic kineties with dikinetids approximately in anterior half of body, monokinetids in posterior half; membranelles 1 and 2 almost equal in length and composed of two and three longitudinal rows of kinetids respectively; paroral membrane with zigzag structure extending anteriorly to middle portion of membranelle 2; contractile vacuole pore located at posterior end of somatic kinety 1. The genus Uronemella is redefined as follows: marine form with an elongate-elliptical or inverted pear-shaped body; apical plate conspicuous; buccal field about two-thirds of body length, cytostome subequatorially located; oral apparatus Uronema-like; somatic kineties comprising a mixture of dikinetids and monokinetids. Uronemella sinensis spec. nov. is recognized by having an elongate-elliptical body with truncated apical frontal plate, size in vivo about 25-35 × 15-20 µm, nine or ten somatic kineties, membranelle 1 consisting of two or three basal bodies, contractile vacuole pore at posterior end of somatic kinety 1. This study also compared the small-subunit rRNA gene sequences of these two species with other closely related species to show the sequence divergence, which ranged from 3.53 to 9.60%. Phylogenetic analyses support the contention that the genus Uronemella is monophyletic, while Metanophrys is non-monophyletic. PMID:23859947

  5. 环境相关浓度三氯生和三氯卡班暴露对嗜热四膜虫体内抗氧化酶活力的影响%Effects of triclosan and triclocarban at environmental relevant concentration on antioxidative enzyme activities in Tetrahymena thermophila

    Institute of Scientific and Technical Information of China (English)

    高礼; 程鹏; 白琦锋; 张海谋; 袁涛


    目的 研究两种抗菌剂三氯生(triclosan,TCS)和三氯卡班(triclocarban,TCC)在环境相关浓度水平对嗜热四膜虫体内抗氧化酶活力的影响.方法 将处于对数生长期的嗜热四膜虫分别暴露于0(对照)、0.1、100μg/L的TCS和TCC培养24 h,测定嗜热四膜虫体内超氧化物歧化酶(SOD)、过氧化氢酶(CAT)、谷胱甘肽-S转移酶(GST)和乳酸脱氢酶(LDH)的活力.结果 与对照组比较,各浓度TCS和TCC暴露均可诱导嗜热四膜虫体内SOD活力明显升高(P<0.05或P<0.01),LDH活力明显下降(P<0.01);各浓度TCS暴露均可诱导嗜热四膜虫体内CAT和GST活力均明显升高(P<0.05或P<0.01),但各浓度TCC暴露对这两种酶的影响均不显著.结论 TCS和TCC在环境相关浓度水平下能够诱导嗜热四膜虫产生抗氧化应激.

  6. Exploiting Oxytricha trifallax nanochromosomes to screen for non-coding RNA genes


    Jung, Seolkyoung; Swart, Estienne C.; Minx, Patrick J.; Magrini, Vincent; Mardis, Elaine R.; Landweber, Laura F.; Eddy, Sean R.


    We took advantage of the unusual genomic organization of the ciliate Oxytricha trifallax to screen for eukaryotic non-coding RNA (ncRNA) genes. Ciliates have two types of nuclei: a germ line micronucleus that is usually transcriptionally inactive, and a somatic macronucleus that contains a reduced, fragmented and rearranged genome that expresses all genes required for growth and asexual reproduction. In some ciliates including Oxytricha, the macronuclear genome is particularly extreme, consis...

  7. The influence of zooplankton enrichment on the microbial loop in a shallow, eutrophic lake. (United States)

    Zingel, Priit; Agasild, Helen; Karus, Katrit; Kangro, Kersti; Tammert, Helen; Tõnno, Ilmar; Feldmann, Tõnu; Nõges, Tiina


    With increasing primary productivity, ciliates may become the most important members of the microbial loop and form a central linkage in the transformation of microbial production to upper trophic levels. How metazooplankters, especially copepods, regulate ciliate community structure in shallow eutrophic waters is not completely clear. We carried out mesocosm experiments with different cyclopoid copepod enrichments in a shallow eutrophic lake to examine the responses of ciliate community structure and abundance to changes in cyclopoid copepod biomass and to detect any cascading effects on bacterioplankton and edible phytoplankton. Our results indicate that an increase in copepod zooplankton biomass favours the development of small-sized bacterivorous ciliates. This effect is unleashed by the decline of predaceous ciliate abundance, which would otherwise graze effectively on the small-sized ciliates. The inverse relationship between crustacean zooplankton and large predaceous ciliates is an important feature adjusting not only the structure of the ciliate community but also the energy transfer between meta- and protozooplankton. Still we could not detect any cascading effects on bacterio- or phytoplankton that would be caused by the structural changes in the ciliate community. PMID:26555735

  8. Biological and chemical data determined in mesocosm experiments by Dauphin Island Sea Lab in June and August of 2011 (NODC Accession 0118680) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Abundances of viruses, prokaryotes, diatoms, dinoflagellates, ciliates and heterotrophic nanoflagellates were determined over time in mesocosm experiments measuring...

  9. In silico prediction of toxicity of non-congeneric industrial chemicals using ensemble learning based modeling approaches

    International Nuclear Information System (INIS)

    Ensemble learning approach based decision treeboost (DTB) and decision tree forest (DTF) models are introduced in order to establish quantitative structure–toxicity relationship (QSTR) for the prediction of toxicity of 1450 diverse chemicals. Eight non-quantum mechanical molecular descriptors were derived. Structural diversity of the chemicals was evaluated using Tanimoto similarity index. Stochastic gradient boosting and bagging algorithms supplemented DTB and DTF models were constructed for classification and function optimization problems using the toxicity end-point in T. pyriformis. Special attention was drawn to prediction ability and robustness of the models, investigated both in external and 10-fold cross validation processes. In complete data, optimal DTB and DTF models rendered accuracies of 98.90%, 98.83% in two-category and 98.14%, 98.14% in four-category toxicity classifications. Both the models further yielded classification accuracies of 100% in external toxicity data of T. pyriformis. The constructed regression models (DTB and DTF) using five descriptors yielded correlation coefficients (R2) of 0.945, 0.944 between the measured and predicted toxicities with mean squared errors (MSEs) of 0.059, and 0.064 in complete T. pyriformis data. The T. pyriformis regression models (DTB and DTF) applied to the external toxicity data sets yielded R2 and MSE values of 0.637, 0.655; 0.534, 0.507 (marine bacteria) and 0.741, 0.691; 0.155, 0.173 (algae). The results suggest for wide applicability of the inter-species models in predicting toxicity of new chemicals for regulatory purposes. These approaches provide useful strategy and robust tools in the screening of ecotoxicological risk or environmental hazard potential of chemicals. - Graphical abstract: Importance of input variables in DTB and DTF classification models for (a) two-category, and (b) four-category toxicity intervals in T. pyriformis data. Generalization and predictive abilities of the constructed

  10. In silico prediction of toxicity of non-congeneric industrial chemicals using ensemble learning based modeling approaches

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Kunwar P., E-mail:; Gupta, Shikha


    Ensemble learning approach based decision treeboost (DTB) and decision tree forest (DTF) models are introduced in order to establish quantitative structure–toxicity relationship (QSTR) for the prediction of toxicity of 1450 diverse chemicals. Eight non-quantum mechanical molecular descriptors were derived. Structural diversity of the chemicals was evaluated using Tanimoto similarity index. Stochastic gradient boosting and bagging algorithms supplemented DTB and DTF models were constructed for classification and function optimization problems using the toxicity end-point in T. pyriformis. Special attention was drawn to prediction ability and robustness of the models, investigated both in external and 10-fold cross validation processes. In complete data, optimal DTB and DTF models rendered accuracies of 98.90%, 98.83% in two-category and 98.14%, 98.14% in four-category toxicity classifications. Both the models further yielded classification accuracies of 100% in external toxicity data of T. pyriformis. The constructed regression models (DTB and DTF) using five descriptors yielded correlation coefficients (R{sup 2}) of 0.945, 0.944 between the measured and predicted toxicities with mean squared errors (MSEs) of 0.059, and 0.064 in complete T. pyriformis data. The T. pyriformis regression models (DTB and DTF) applied to the external toxicity data sets yielded R{sup 2} and MSE values of 0.637, 0.655; 0.534, 0.507 (marine bacteria) and 0.741, 0.691; 0.155, 0.173 (algae). The results suggest for wide applicability of the inter-species models in predicting toxicity of new chemicals for regulatory purposes. These approaches provide useful strategy and robust tools in the screening of ecotoxicological risk or environmental hazard potential of chemicals. - Graphical abstract: Importance of input variables in DTB and DTF classification models for (a) two-category, and (b) four-category toxicity intervals in T. pyriformis data. Generalization and predictive abilities of the

  11. Dicty_cDB: Contig-U05260-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 69950 |pid:none) Tetrahymena thermophila putative i... 37 0.18 AK296062_1( AK296062 |pid:none) Homo sapiens ...omyces thermotolerans str... 32 5.8 DQ214475_1( DQ214475 |pid:none) Taeniopygia guttata ...AA-aaa56b10.g1 R.similis_EST_RSAA Radopholus si... 44 5.0 1 ( EV839645 ) TT1EP77TV Tetrahymena thermophila S... TT1EP77TH Tetrahymena thermophila SB210 cDNA libr... 38 7.2 2 ( AC234872 ) Hydractinia symbiolongicarpus cl...omyces thermotolerans str... 40 0.021 ( P32252 ) RecName: Full=Ras-like protein rasB; Flags

  12. Taxonomy and nomenclature of some mainland SE-Asian Coeliccia species (Odonata, Platycnemididae) using micro-CT analysis. (United States)

    Steinhoff, Philip O M; Uhl, Gabriele


    The taxonomic status of some mainland Southeast Asian Coeliccia species is evaluated. The following synonymies are presented: C. acco is a junior synonym of C. pyriformis; C. tomokunii that of C. scutellum; C.onoi that of C. cyanomelas. C. scutellum hainanense is promoted to species level, C. hainanense. Redescriptions of the holotype of C. pyriformis and of the lectotypes of C. scutellum and C. hainanense are presented with illustrations. The male genital ligulae were examined by means of non-destructive X-ray micro-computed tomography (micro-CT) and subsequent 3D-reconstruction. The advantage of virtual types generated by micro-CT analysis, particularly for the examination of internal structures, is discussed. PMID:26701563

  13. Chemotaxonomical study of vegetables X. The carotenoids of some vegetables from Cucurbita genus

    Directory of Open Access Journals (Sweden)

    Gavrila NEAMTU


    Full Text Available Im Rahmen unserer chemotaxonomischen Untersuchungen uber die Carotinoide hoherer Pflanzen (1, 2, 3, 4, 5 befassen wir uns in vorliegender Arbeit mit den Carotinoiden einiger Pflanzen der Gattung Cucurbita. Wir berichten von C. maxima Duch. var. bananina Greb., C. maxima Duch. var. maxima cv. Marica, C. pepo var. oblonga Greb. und C. pepo var. pyriformis Alef., unter Hinweis auf carotenotaxonomisch interessante Befunde.

  14. Evaluation of phytochemical constituents and antioxidant activity of selected actinorhizal fruits growing in the forests of Northeast India

    Indian Academy of Sciences (India)

    Arvind K Goyal; Tanmayee Mishra; Malay Bhattacharya; Pallab Kar; Arnab Sen


    Hippophae salicifolia, Elaeagnus pyriformis, Myrica esculenta and M. nagi are actinorhizal plants growing in the sacred forests of Northeast India with multipurpose uses. The present investigation was undertaken to determine the phenol, flavonoid and flavonol contents of the fresh fruit juice of these plant species including the antioxidant potential by means of DPPH, H2O2 and NO scavenging activity and FRP. The total phenolic, flavonoid and flavonol contents of fruit juice ranged from 321.68±0.06 to 76.67±0.01 mg/g GAE, 272.92±0.07 to 20.12±0.02 mg/g QE and 258.92±0.08 to 18.72±0.02 mg/g QE, respectively. At 2.0 mg/mL concentration, DPPH scavenging activity was found to be the highest in M. esculenta (89.62%) and the lowest in E. pyriformis (17.58%). The reducing power activity was found significantly higher in H. salicifolia juice, which increased with increase in concentration. The H2O2 scavenging activity of H. salicifolia juice was found to be as high as 98.78%, while Elaeagnus juice was found to be less effective with just 48.90%. Juice of H. salicifolia showed the greatest NO scavenging effect of 75.24% as compared to juice of E. pyriformis, where only 37.54% scavenging was observed at the same concentration. Taking into account all the experimental data, it can be said that the fruits of H. salicifolia and both M. nagi and M. esculenta have good antioxidant activity compared to fruits of E. pyriformis.

  15. Co-Transport of Polycyclic Aromatic Hydrocarbons by Motile Microorganisms Leads to Enhanced Mass Transfer under Diffusive Conditions

    DEFF Research Database (Denmark)

    Gilbert, Dorthea; Jakobsen, Hans H.; Winding, Anne; Mayer, Philipp


    with hydrophobicity indicated PAH co-transport with the motile organisms. Fluorescence microscopy confirmed such transport. The effective diffusivity of T. pyriformis, determined by video imaging microscopy, was found to exceed molecular diffusivities of the PAHs up to four-fold. Cell-bound PAH...... fractions were determined to range from 28% (naphthalene) to 92% (pyrene). Motile microorganisms can therefore function as effective carriers for HOCs under diffusive conditions and might significantly enhance mobility and availability of HOCs....



    Juliana Moscardini Chavasco; Barbara Helena Muniz Prado E Feliphe; Claudio Daniel Cerdeira; Fabricio Damasceno Leandro; Luiz Felipe Leomil Coelho; Jeferson Junior da Silva; Jorge Kleber Chavasco; Amanda Latercia Tranches Dias


    The antimicrobial activity of plant hidroethanolic extracts on bacteria Gram positive, Gram negative, yeasts, Mycobacterium tuberculosis H37 and Mycobacterium bovis was evaluated by using the technique of Agar diffusion and microdilution in broth. Among the extracts evaluated by Agar diffusion, the extract of Bidens pilosa leaf presented the most expressive average of haloes of growth inhibition to the microorganisms, followed by the extract of B. pilosa flower, of Eugenia pyriformis' leaf an...



    Eduardo Suguino; Adriana Novais Martins; Marcos José Perdoná; Nobuyoshi Narita; Keigo Ninami


    Although they are natives of São Paulo state, these fruits are discarded and cut down in their natural habitat, even in the legal reserve, which is causing their disappearance. Aiming to evaluate the pine bark substrate porosity in the development of Surinam cherry (Eugenia uniflora L.) and uvaia plant (Eugenia pyriformis Cambess), two experiments were conducted in greenhouses. The treatments were: 100% ground pine bark without separation of particles; 100% pine bark of ≤ 0,1mm; 75% pine bark...

  18. Acquired phototrophy in Mesodinium and Dinophysis – A review of cellular organization, prey selectivity, nutrient uptake and bioenergetics

    DEFF Research Database (Denmark)

    Hansen, Per Juel; Nielsen, Lasse Tor; Johnson, Matthew; Berge, Terje; Flynn, Kevin J.


    chloroplasts may be retained, and the host ciliate has considerable control over the acquired chloroplasts; Mesodinium rubrum is capable of dividing its acquired chloroplasts and can also photoacclimate. In Dinophysis spp., the contents of ciliate prey are sucked out, but only the chloroplasts are retained...

  19. Escape response of planktonic protists to fluid mechanical signals

    DEFF Research Database (Denmark)

    Jakobsen, Hans Henrik


    The escape response to fluid mechanical signals was examined in 6 protists, 4 ciliates and 2 dinoflagellates. When exposed to a siphon flow. 3 species of ciliates, Balanion comatum, Strobilidium sp., and Mesodinium pulex, responded with escape jumps. The threshold deformation rates required to...

  20. AcEST: DK960877 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ia with plantlets Developmental stage gametophytes with sporophytes...57 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_J14. 5' end sequence. Accession DK960877 Tissue type prothall...Q228Z0|Q228Z0_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210 Align length 40 Score (bit) 38.1 E-val...AAAYFTDQVDSA 365 >sp|A6RG85|NM111_AJECN Pro-apoptotic serine protease NMA111 OS=Ajellomyces capsulata (strai...228Z0_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210 GN=TTHERM_01466260 PE=4 SV=1 Length

  1. Dicty_cDB: Contig-U13658-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BH146662 ) ENTPN88TF Entamoeba histolytica Sheared DNA Entam... 38 0.058 3 ( CP001078 ) Clostridium botulinum E3 str. Ala...ffective length of database: 5,564,391 effective search space: 3032593095 effective search space used: 30325...g-U13658-1Q.Seq.d (561 letters) Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters Searchin... Form T... 36 0.66 2 ( CN593818 ) TTE00012664 Normalized large Tetrahymena thermoph... 36 0.66 2 ( CN593882 ...) TTE00010796 Normalized large Tetrahymena thermoph... 36 0.66 2 ( CN593982 ) TTE00013067 Normalized large T

  2. Shedding light on microbial dark matter: a TM6 bacterium as natural endosymbiont of a free-living amoeba. (United States)

    Delafont, Vincent; Samba-Louaka, Ascel; Bouchon, Didier; Moulin, Laurent; Héchard, Yann


    The TM6 phylum belongs to the so-called microbial dark matter that gathers uncultivated bacteria detected only via DNA sequencing. Recently, the genome sequence of a TM6 bacterium (TM6SC1) has led to suggest that this bacterium would adopt an endosymbiotic life. In the present paper, free-living amoebae bearing a TM6 strain were isolated from a water network. The amoebae were identified as Vermamoeba vermiformis and the presence of a TM6 strain was detected by polymerase chain reaction and microscopy. The partial sequence of its 16S rRNA gene showed this strain to be closely related to the sequenced TM6SC1 strain. These bacteria displayed a pyriform shape and were found within V. vermiformis. Therefore, these bacteria were named Vermiphilus pyriformis. Interactions studies showed that V. pyriformis was highly infectious and that its relation with V. vermiformis was specific and highly stable. Finally, it was found that V. pyriformis inhibited the encystment of V. vermiformis. Overall, this study describes for the first time an endosymbiotic relationship between a TM6 bacterium and a free-living amoeba in the environment. It suggests that other bacteria of the TM6 phylum might also be endosymbiotic bacteria and may be found in other free-living amoebae or other organisms. PMID:26471960

  3. Mass entrapment and lysis of Mesodinium rubrum cells in mucus threads observed in cultures with Dinophysis

    DEFF Research Database (Denmark)

    Ojamäe, Karin; Hansen, Per Juel; Lips, Inga


    The entrapment and death of the ciliate Mesodinium rubrum in the mucus threads in cultures with Dinophysis is described and quantified. Feeding experiments with different concentrations and predator–prey ratios of Dinophysis acuta, Dinophysis acuminata and M. rubrum to study the motility loss and...... aggregate formation of the ciliates and the feeding behaviour of Dinophysis were carried out. In cultures of either Dinophysis species, the ciliates became entrapped in the mucus, which led to the formation of immobile aggregates of M. rubrum and subsequent cell lysis. The proportion of entrapped ciliates...... was influenced by the concentration of Dinophysis and the ratio of predator and prey in the cultures. At high cell concentrations of prey (136 cells mL−1) and predator (100 cells mL−1), a maximum of 17% of M. rubrum cells became immobile and went through cell lysis. Ciliates were observed trapped in...

  4. Semi-automated recognition of protozoa by image analysis


    A.L. Amaral; Baptiste, C; Pons, M. N.; Nicolau, Ana; Lima, Nelson; Ferreira, E. C.; Mota, M.; H. Vivier


    A programme was created to semi-automatically analyse protozoal digitised images. Principal Component Analysis technique was used for species identification. After data collection and mathematical treatment, a threedimensional representation was generated and several protozoa (Opercularia, Colpidium, Tetrahymena, Prorodon, Glaucoma and Trachelophyllum) species could be positively identified.

  5. Dicty_cDB: Contig-U15232-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 66615 ) TTBA328TG Tetrahymena thermophila CU428 log phase... 70 1e-37 5 ( DL168374 ) Methods for Identifying...-Sampling_GS-30-02-01-1... 113 3e-37 5 ( DL171366 ) Methods for Identifying the T

  6. Dicty_cDB: Contig-U05385-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ooled Normal... 44 8.9 1 ( EY443462 ) CBAY6349.rev CBAY Tubifex tubifex Embryos and juv... 44 8.9 1 ( EY4396...62 ) CBAY3503.rev CBAY Tubifex tubifex Embryos and juv... 44 8.9 1 ( EV838263 ) TT1E508TV Tetrahymena thermo

  7. Protozoários ciliados do rúmen de bovinos e bubalinos alimentados com dietas suplementadas com monensina ou própolis Ruminal ciliate protozoa of cattle and buffalo fed on diet supplemented with monensin or extracts from propolis


    Thaís Barros Ríspoli; Isabella Lopes Rodrigues; Rafael Gioia Martins Neto; Ricardo Kazama; Odimari Pricila Pires Prado; Lúcia Maria Zeoula; Pedro Braga Arcuri


    O objetivo deste trabalho foi avaliar o efeito de dietas suplementadas com monensina ou produtos à base de própolis, nas populações de protozoários ciliados no rúmen de bovinos (Bos taurus) e bubalinos (Bubalus bubalis). Quatro bovinos da raça Holandesa e quatro búfalos da raça Murrah adultos, fistulados no rúmen, foram distribuídos em delineamento quadrado latino (4x4). A dieta constituiu-se de 50% de silagem de milho e 50% de concentrado à base de milho em grãos e farelo de soja, com adição...

  8. Fontes de lipídeos e monensina na alimentação de novilhos Nelore e sua relação com a população de protozoários ciliados do rúmen Effects of feeding monensin and different sources of fat on the ruminal population of ciliate protozoa in Nellore steers


    Amaury Camilo Valinote; José Carlos Machado Nogueira Filho; Paulo Roberto Leme; Saulo da Luz e Silva; José Aparecido Cunha


    Quatro novilhos Nelore, fistulados e canulados no rúmen, foram distribuídos em um delineamento quadrado latino 4 x 4, para avaliar o caroço de algodão e o sal de cálcio de ácidos graxos como fontes de gordura assim como o efeito da monensina em dietas com caroço de algodão, sobre a população de protozoários ciliados e o pH do rúmen. Os tratamentos experimentais foram: dieta controle (CTRL), dieta com sal de cálcio de ácidos graxos (SC), dieta com caroço de algodão (CA) e dieta com caroço de a...

  9. Intersite epibiosis characterization on dominant mangrove crustacean species from Malaysia

    NARCIS (Netherlands)

    Fernandez-Leborans, G.; Hanamura, Y.; Siow, R.; Chee, P.-E.


    Epibiosis was studied in dominant mangrove crustacean species in several areas in Malaysia. The observed basibionts were the crustaceans Mesopodopsis orientalis, Acetes japonicus, Acetes sibogae, Acetes indicus and Fenneropenaeus merguiensis and the epibionts found were the protozoan ciliates Acinet

  10. Effect of heterotrophic versus autotrophic food on feeding and reproduction of the calanoid copepod Acartia tonsa : relationship with prey fatty acid composition

    DEFF Research Database (Denmark)

    Broglio, E.; Jonasdottir, Sigrun; Calbet, A.; Jakobsen, Hans Henrik; Saiz, E.


    ) and ingestion rates, or as the quotient: EPR/ingestion rate. The diets, offered in monoculture, were the heterotrophic ciliates Strombidium sulcatum or Mesodinium pulex, the heterotrophic dinoflagellate Gymnodinium dominans, the autotrophic cryptophyte Rhodomonas salina and the autotrophic...

  11. Non-invasive sources of cells with primary cilia from pediatric and adult patients

    NARCIS (Netherlands)

    Ajzenberg, H.; Slaats, G.G.; Stokman, M.F.; Arts, H.H.; Logister, I.; Kroes, H.Y.; Renkema, K.Y.; Haelst, M.M. van; Terhal, P.A.; Rooij, I.A.L.M. van; Keijzer-Veen, M.G.; Knoers, N.V.; Lilien, M.R.; Jewett, M.A.; Giles, R.H.


    BACKGROUND: Ciliopathies give rise to a multitude of organ-specific pathologies; obtaining relevant primary patient material is useful for both diagnostics and research. However, acquisition of primary ciliated cells from patients, particularly pediatric patients, presents multiple difficulties. Bio

  12. Role of food uptake for photosynthesis, growth and survival of the mixotrophic dinoflagellate Dinophysis acuminata

    DEFF Research Database (Denmark)

    Riisgaard, Karen; Hansen, Per Juel


    Dinophysis acuminata is a mixotrophic dinoflagellate frequently causing diarrhetic shellfish poisoning. D. acuminata was isolated from Danish coastal waters and cultivated using the mixotrophic ciliate Mesodinium rubrum as prey. The roles of food uptake and photosynthesis for the growth and...

  13. Studies on the associates and parasites of zooplankton from southwest and southeast coasts of India

    Digital Repository Service at National Institute of Oceanography (India)

    Santhakumari, V.

    Associates and parasites of zooplankton from southwest and southeast coasts of India were studied. Among the epizoic forms two species of ciliates infesting copepods were new records from Indian waters. Eight species of suctorians were found epizoic...

  14. Estudios histológico e histoquímico del sistema digestivo de la almeja catarina Argopecten ventricosus (Sowerby, 1842)


    Cáceres, C.; Alarcón, F.J.


    Histological and histochemical studies on the digestive system of Argopecten ventricosus (Sowerby, 1842) was carried out. Lips show a ciliated columnar epithelium with glycoproteins and acid and alkaline phosphatases, and α-D glucosidase activity. Esophagus and lips epitheliums are similar. Acid and alkaline phosphatases, α-D glucosidase and leucil aminopeptidase activities were detected. The epithelium of the stomach is ciliated and contains glands which secrete glycoproteins. Acid and alkal...

  15. Serous adenocarcinoma of the sigmoid mesentery arising in cystic endosalpingiosis


    McCoubrey, A.; Houghton, O; McCallion, K; McCluggage, W G


    This case report describes a Mullerian serous adenocarcinoma arising within a multoloculated cyst lined by ciliated serous-type epithelium located in the sigmoid mesentery. Twenty years previously the patient underwent a hysterectomy, bilateral salpingo-oophorectomy, and omentectomy. The ovaries contained bilateral serous cystadenofibromas, and multiple cysts lined by ciliated serous-type epithelium were present in the omentum. The resection specimen 20 years later contained a 14 cm multilocu...

  16. Utilisation des protozoaires ciliés (Paramecium africanum, Colpidium uncinatum, Neobursaridium gigas) pour l'épuration bactériologique des eaux polluées en microcosme


    Nguedji, JBT.; Zébazé, SH.; Kemka, N.; Foto, SM.; Njiné, T.; Nola, M.; Bouetou, TB.


    An Microcosm Use of Ciliate Protozoa (Paramecium africanum, Colpidium uncinatum, Neobursaridium gigas) for Bacterial Purification of Polluted Water. Tests on the grazing of ciliated protozoa Paramecium africanum, Colpidium uncinatum and Neobursaridium gigas on the bacteria Escherichia coli and Staphylococcus sp. were carried out in an microcosm aquatic environment. These tests aimed at assessment of the role of these predators protozoa in the bacterial purification of polluted water. The evol...

  17. Tolerance of sewage treatment plant microorganisms to mosquitocides. (United States)

    Tietze, N S; Olson, M A; Hester, P G; Moore, J J


    Beneficial protozoa and rotifers collected from a wastewater treatment plant in Panama City, FL, were tested for tolerance to 11 commonly used mosquito larvicides and adulticides in the laboratory. The acute effects were assessed using selected concentrations of the adulticides fenthion, malathion, naled, permethrin, and resmethrin; and the larvicides Bacillus thuringiensis israelensis, Bacillus sphaericus, diflubenzuron, larviciding oil, methoprene, and temephos for the following microorganism taxa: ameoboids, flagellates, free-swimming ciliates, stalked ciliates, and rotifers. PMID:8126488

  18. RNA-directed epigenetic regulations of DNA rearrangements


    Mochizuki, Kazufumi


    Ciliated protozoa undergo extensive DNA rearrangements, including DNA elimination, chromosome breakage and DNA descrambling, when the germline micronucleus produces the new macronucleus during sexual reproduction. It has long been known that many of these events are epigenetically controlled by DNA sequences of the parental macronuclear genome. Recent studies in some model ciliates have revealed that these epigenetic regulations are mediated by non-coding RNAs. DNA elimination in Paramecium a...

  19. Avian Influenza Virus Glycoproteins Restrict Virus Replication and Spread through Human Airway Epithelium at Temperatures of the Proximal Airways


    Scull, Margaret A.; Gillim-Ross, Laura; Santos, Celia; Roberts, Kim L.; Bordonali, Elena; Subbarao, Kanta; Barclay, Wendy S.; Pickles, Raymond J.


    Transmission of avian influenza viruses from bird to human is a rare event even though avian influenza viruses infect the ciliated epithelium of human airways in vitro and ex vivo. Using an in vitro model of human ciliated airway epithelium (HAE), we demonstrate that while human and avian influenza viruses efficiently infect at temperatures of the human distal airways (37°C), avian, but not human, influenza viruses are restricted for infection at the cooler temperatures of the human proximal ...

  20. Influence of palm fatty acid distillate on rumen degradability and protozoa population in buffaloes

    Directory of Open Access Journals (Sweden)

    Weber Vilas Boas Soares


    Full Text Available Oil and fat as energy sources at low cost are relevant in ruminant nutrition. The aim of this study was to evaluate the effects of palm fatty acid distillate (PFAD on the degradability and ciliate protozoa population in buffalo. Four rumen fistulated buffaloes were fed a basal diet in a Latin square (4x4 design trial. Treatments were designed with four of different levels of PFAD added directly into the rumen: 0; 200; 420 and 500 g/animal/d. High levels of PFAD (420 and 500 g/d promoted higher degradation of the soluble fraction and lower in potentially degradable fraction of dry matter (DM and neutral detergent fibre (NDF with lower values of potential and effective degradability in two evaluated grasses, bermudagrass and brachiariagrass. Significant decreases in the total number of protozoa/mL of rumen content, Entodinium and ciliates belonging to subfamily Diplodiniinae were observed at higher level of PFDA addition in the rumen. Also, Epidinium and Holotrich ciliates disappeared from the rumen. Significant correlations were observed of the ciliate concentration and composition as a function of dietary lipids content. Entodinium composition increased from 68.0% to 99.6% and Diplodiniinae reduced from 30.4% to 0.4% with increasing PFAD level indicating higher fat toxicity effect on the Diplodiniinae ciliates than Entodinium species and direct action of the larger ciliates on the fibre degradation.

  1. Influence of palm fatty acid distillate on rumen degradability and protozoa population in buffaloes

    Directory of Open Access Journals (Sweden)

    Raul Franzolin

    Full Text Available Oil and fat as energy sources at low cost are relevant in ruminant nutrition. The aim of this study was to evaluate the effects of palm fatty acid distillate (PFAD on the degradability and ciliate protozoa population in buffalo. Four rumen fistulated buffaloes were fed a basal diet in a Latin square (4x4 design trial. Treatments were designed with four of different levels of PFAD added directly into the rumen: 0; 200; 420 and 500 g/animal/d. High levels of PFAD (420 and 500 g/d promoted higher degradation of the soluble fraction and lower in potentially degradable fraction of dry matter (DM and neutral detergent fibre (NDF with lower values of potential and effective degradability in two evaluated grasses, bermudagrass and brachiariagrass. Significant decreases in the total number of protozoa/mL of rumen content, Entodinium and ciliates belonging to subfamily Diplodiniinae were observed at higher level of PFDA addition in the rumen. Also, Epidinium and Holotrich ciliates disappeared from the rumen. Significant correlations were observed of the ciliate concentration and composition as a function of dietary lipids content. Entodinium composition increased from 68.0% to 99.6% and Diplodiniinae reduced from 30.4% to 0.4% with increasing PFAD level indicating higher fat toxicity effect on the Diplodiniinae ciliates than Entodinium species and direct action of the larger ciliates on the fibre degradation.

  2. Dermatan sulfate in tunicate phylogeny: Order-specific sulfation pattern and the effect of [→4IdoA(2-Sulfate)β-1→3GalNAc(4-Sulfate)β-1→] motifs in dermatan sulfate on heparin cofactor II activity


    Sugahara Kazuyuki; Bao Xingfeng; Vicente Cristina P; Lotufo Tito; Lima Paula C; Kozlowski Eliene O; Pavão Mauro SG


    Abstract Background Previously, we have reported the presence of highly sulfated dermatans in solitary ascidians from the orders Phlebobranchia (Phallusia nigra) and Stolidobranchia (Halocynthia pyriformis and Styela plicata). Despite the identical disaccharide backbone, consisting of [→4IdoA(2S)β-1→3GalNAcβ-1→], those polymers differ in the position of sulfation on the N-Acetyl galactosamine, which can occur at carbon 4 or 6. We have shown that position rather than degree of sulfation is imp...

  3. Dicty_cDB: FC-BN10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qaqvqiyhy*ng*rnthsq*rvnsri*ylrrmfmvkl*tvcyvmvplpvvimqpfiwr qvnywqrlyqnvvnvhslgkfvwivihqiiyvgdyrn...cer Institute Human BAC Library) complete sequence. 38 0.26 2 AC063935 |AC063935.12 Homo sapiens c...: (bits) Value AY924419_1( AY924419 |pid:none) Trimastix pyriformis ATCC50562 gua... 156 1e-36 AF144745_1( A...ens mRNA for KIAA1258 pro... 153 1e-35 (Q9Y2T3) RecName: Full=Guanine deaminase; Short=Guana...e) Rattus norvegicus guanine deaminas... 152 3e-35 (Q5RAV9) RecName: Full=Guanine deaminase; Short=Guana

  4. Sistemas agroforestales con cedro rojo, cedro nogal y primavera, una alternativa para el desarrollo de plantaciones forestales comerciales en los Tuxtlas, Veracruz, México


    López-Sánchez, E.; M.A. Musálem


    El presente trabajo establece las bases para la instrumentación de plantaciones forestales comerciales (PFC) por medio de sistemas agroforestales (SAF) como alternativa para un sistema de producción sustentable. Propone los estándares para el diseño, establecimiento y manejo de los principales sistemas agroforestales con referencia a la región de Los Tuxtlas, Veracruz, que incluyen dentro de sus componentes arbóreos cedro rojo (Cedrela odorata L.), cedro nogal (Juglans pyriformis Lie...

  5. Análisis comparativo de caracteres diagnósticos para la identificación de tres especies argentinas de Myrtaceae empleadas en la medicina popular


    Lorca, Graciela L.; Amat, Anibal Gumersindo; González, Claudio F.


    Se estudia la morfología y anatomía comparadas de Eugenia unflora L. (n. v."pitanga", "ñangapirí"), Eugenia pyriformis Camb. (n.v."ibajay mi") y Hexach-Iamys edulis (Berg) Kausel et Legrand (n.v. "ibajay") utilizadas en la medicina popular de la Provincia de Misiones (Argentina) en la hipertensión arterial y la diabetes. Se determinan los parámetros diagnósticos para la identificación de estas especies tanto en estado íntegro como fragmentario.

  6. Limites térmicos para a germinação em função da origem de sementes de espécies de Eugenia (Myrtaceae) nativas do Brasil Thermal requirements for the seeds of Brazilian species of Eugenia (Myrtaceae) according to their origin


    Edmir Vicente Lamarca; Cristiana Vendrame e Silva; Claudio José Barbedo


    A germinação das sementes é dependente de numerosos fatores abióticos, dentre os quais a temperatura figura entre os principais. No presente estudo analisou-se o comportamento germinativo de sementes de E. brasiliensis, E. involucrata, E. pyriformis e E. uniflora em resposta a diferentes condições de luz e temperatura, incluindo-se o cálculo da soma térmica durante o desenvolvimento e maturação das sementes. Os resultados demonstraram que a germinação de sementes e o desenvolvimento de plântu...

  7. Dicty_cDB: Contig-U11938-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y: 1998 length of database: 5,674,871 effective HSP length: 16 effective length of query: 1982 effe... 2e-48 CU928170_238( CU928170 |pid:none) Kluyveromyces thermotolerans str... 193 2e-47 AM494957_379( AM494957 |pid:none) Leishman...ctive length of database: 5,564,391 effective search space: 11028622962 effective search ...0 2e-28 AF153269_1( AF153269 |pid:none) Tetrahymena thermophila dynein hea... 130 2e-28 AC009463_15( AC009463 |pid:none) Trypanosoma... 84 1e-16 3 ( AF025312 ) Tetrahymena thermophila cytoplasmic dynein heavy ... 50 5e-16 5 ( AC014970 ) Drosophila melanogaster

  8. Two distinct gene subfamilies within the family of cysteine protease genes.


    Karrer, K M; Peiffer, S L; DiTomas, M E


    A cDNA clone for a physiologically regulated Tetrahymena cysteine protease gene was sequenced. The nucleotide sequence predicts that the clone encodes a 336-amino acid protein composed of a 19-residue N-terminal signal sequence followed by a 107-residue propeptide and a 210-residue mature protein. Comparison of the deduced amino acid sequence of the protein with those of other cysteine proteases revealed a highly conserved interspersed amino acid motif in the propeptide region of the protein,...

  9. RNA Binding Domain of Telomerase Reverse Transcriptase


    Lai, Cary K.; Mitchell, James R.; Collins, Kathleen


    Telomerase is a ribonucleoprotein reverse transcriptase that extends the ends of chromosomes. The two telomerase subunits essential for catalysis in vitro are the telomerase reverse transcriptase (TERT) and the telomerase RNA. Using truncations and site-specific mutations, we identified sequence elements of TERT and telomerase RNA required for catalytic activity and protein-RNA interaction for Tetrahymena thermophila telomerase. We found that the TERT amino and carboxyl termini, although evol...

  10. Progress in structural studies of telomerase


    Miracco, Edward J.; Jiang, Jiansen; Cash, Darian; Feigon, Juli


    Telomerase is the ribonucleoprotein (RNP) reverse transcriptase responsible for synthesizing the 3′ ends of linear chromosomes. It plays critical roles in tumorigenesis, cellular aging, and stem cell renewal. The past two years have seen exciting progress in determining telomerase holoenzyme architecture and the structural basis of telomerase activity. Notably, the first electron microscopy structures of telomerase were reported, of the Tetrahymena thermophila telomerase holoenzyme and a huma...

  11. Repair processes in diverse systems: overview

    International Nuclear Information System (INIS)

    Studies on DNA repair in several bacterial systems as well as in eukaryotes are reviewed. Some topics discussed are: excision repair of uv damage in Mycoplasma; repair replication in uv-irradiated Tetrahymena; repair of double-strand breaks in DNA of Micrococcus radiodurans; DNA repair in Neurospora; lack of dimer excision in x-irradiated Vicia faba; and DNA repair in Nicotiana, Haplopappus, and Chlamydomonas

  12. Chlamydomonas IFT70/CrDYF-1 Is a Core Component of IFT Particle Complex B and Is Required for Flagellar Assembly


    Fan, Zhen-Chuan; Behal, Robert H.; Geimer, Stefan; Wang, Zhaohui; Williamson, Shana M.; Zhang, Haili; Cole, Douglas G.; Qin, Hongmin


    DYF-1 is a highly conserved protein essential for ciliogenesis in several model organisms. In Caenorhabditis elegans, DYF-1 serves as an essential activator for an anterograde motor OSM-3 of intraflagellar transport (IFT), the ciliogenesis-required motility that mediates the transport of flagellar precursors and removal of turnover products. In zebrafish and Tetrahymena DYF-1 influences the cilia tubulin posttranslational modification and may have more ubiquitous function in ciliogenesis than...

  13. Efeito da monensina e do óleo de soja sobre os protozoários ciliados do rúmen e correlação dos protozoários com parâmetros da fermentação ruminal e digestivos Effect of monensin and soybean oil on rumen ciliate protozoa and correlation between protozoa with ruminal fermentation and digestive parameters


    Isabel Martinele; Eduardo da Costa Eifert; Rogério de Paula Lana; Pedro Braga Arcuri; Marta D'Agosto


    Quatro vacas lactantes canuladas no rúmen, com 155 dias em lactação, foram dispostas em um quadrado latino 4 × 4 e alimentadas, duas vezes ao dia, com silagem de milho e concentrado (relação 55:45, base matéria seca), para se avaliarem os efeitos da monensina e do óleo de soja na dieta de vacas lactantes sobre a contagem de protozoários ciliados, além de estabelecer correlações entre os protozoários com alguns parâmetros da digestão e da fermentação ruminal. Os tratamentos consistiram da incl...

  14. Estudo dos protozoários ciliados em bovinos consumindo dietas com diferentes níveis de proteína não degradável no rúmen 1 - DOI: 10.4025/actascianimsci.v25i1.2146 Ciliated protozoa in the rumen of cattle under different levels of undegradable protein diets - DOI: 10.4025/actascianimsci.v25i1.2146


    José Aparecido Cunha; José Carlos Machado Nogueira Filho; Maria Regina Coalho; César Gonçalves de Lima


    O experimento foi realizado no Departamento de Zootecnia da Faculdade de Zootecnia e Engenharia de Alimentos da Universidade de São Paulo, no Campus da USP, em Pirassununga, Estado de São Paulo, e teve por objetivos estudar a variação de pH e identificar e quantificar os protozoários ciliados do rúmen de bovinos submetidos a dietas com diferentes níveis de proteína não degradável no rúmen (PNDR), denominados tratamentos A-24%, B-30%, C-36% e D-42%. Todas as rações foram formuladas para serem ...

  15. The second species of Gromia (Protista) from the deep sea: its natural history and association with the Pakistan margin oxygen minimum zone. (United States)

    Gooday, Andrew J; Bowser, Samuel S


    We describe a gromiid protist Gromia pyriformis sp. nov., from bathyal depths on the Pakistan margin (NE Arabian Sea), an area characterised by a well-developed Oxygen Minimum Zone (OMZ). The new species is smaller (length usually <1 mm) than the only other described deep-sea gromiid species (Gromia sphaerica) or the well-known coastal species Gromia oviformis. Its identification as a gromiid is based on the test-wall ultrastructure. This includes (i) an outer wall (165-300 nm thick) limited by an electron-opaque layer and perforated by pore structures which typically extend through its entire thickness, and (ii) inner "honeycomb membrane" structures which form a discontinuous sheet (18-20 nm thick) lying parallel to the outer wall. An outermost glycocalyx (approximately 75 nm thick), not observed in other gromiid species, is also present and imparts a finely granular appearance to the outer test surface, as seen by Scanning Electron Microscopy (SEM). Numerous rod-shaped prokaryotes are attached to the exterior of the glycocalyx. Gromia pyriformis sp. nov. typically occurs above the sediment-water interface, attached to the large arborescent foraminiferan Pelosina sp. It is confined to a very narrow bathymetric zone (approximately 1000 m water depth) in the lower portion of the OMZ, where bottom-water oxygen concentrations are approximately 0.2 ml l(-1). PMID:16050043

  16. Navigational efficiency of nocturnal Myrmecia ants suffers at low light levels.

    Directory of Open Access Journals (Sweden)

    Ajay Narendra

    Full Text Available Insects face the challenge of navigating to specific goals in both bright sun-lit and dim-lit environments. Both diurnal and nocturnal insects use quite similar navigation strategies. This is despite the signal-to-noise ratio of the navigational cues being poor at low light conditions. To better understand the evolution of nocturnal life, we investigated the navigational efficiency of a nocturnal ant, Myrmecia pyriformis, at different light levels. Workers of M. pyriformis leave the nest individually in a narrow light-window in the evening twilight to forage on nest-specific Eucalyptus trees. The majority of foragers return to the nest in the morning twilight, while few attempt to return to the nest throughout the night. We found that as light levels dropped, ants paused for longer, walked more slowly, the success in finding the nest reduced and their paths became less straight. We found that in both bright and dark conditions ants relied predominantly on visual landmark information for navigation and that landmark guidance became less reliable at low light conditions. It is perhaps due to the poor navigational efficiency at low light levels that the majority of foragers restrict navigational tasks to the twilight periods, where sufficient navigational information is still available.

  17. Non-typeable Haemophilus influenzae decreases cilia beating via protein kinase C epsilon

    Directory of Open Access Journals (Sweden)

    Bailey Kristina L


    Full Text Available Abstract Background Haemophilus influenzae infection of the nasal epithelium has long been associated with observations of decreased nasal ciliary beat frequency (CBF and injury to the ciliated epithelium. Previously, we have reported that several agents that slow CBF also have the effect of activating protein kinase C epsilon (PKCϵ activity in bronchial epithelial cells. The subsequent auto-downregulation of PKCϵ or the direct inhibition of PKCϵ leads to the specific detachment of the ciliated cells. METHODS: Primary cultures of ciliated bovine bronchial epithelial cells were exposed to filtered conditioned media supernatants from non-typeable H. influenzae (NTHi cultures. CBF and motile points were measured and PKCϵ activity assayed. Results NTHi supernatant exposure significantly and rapidly decreased CBF in a dose-dependent manner within 10 minutes of exposure. After 3 hours of exposure, the number of motile ciliated cells significantly decreased. Direct measurement of PKCϵ activity revealed a dose-dependent activation of PKCϵ in response to NTHi supernatant exposure. Both CBF and PKCϵ activity changes were only observed in fresh NTHi culture supernatant and not observed in exposures to heat-inactivated or frozen supernatants. Conclusions Our results suggest that CBF slowing observed in response to NTHi is consistent with the stimulated activation of PKCϵ. Ciliated cell detachment is associated with PKCϵ autodownregulation.

  18. Microfaunal indicators, Ciliophora phylogeny and protozoan population shifts in an intermittently aerated and fed bioreactor

    Energy Technology Data Exchange (ETDEWEB)

    Ntougias, Spyridon, E-mail: [Democritus University of Thrace, Department of Environmental Engineering, Laboratory of Wastewater Management and Treatment Technologies, Vas. Sofias 12, 67100 Xanthi (Greece); Tanasidis, Spartakos; Melidis, Paraschos [Democritus University of Thrace, Department of Environmental Engineering, Laboratory of Wastewater Management and Treatment Technologies, Vas. Sofias 12, 67100 Xanthi (Greece)


    Microfauna community structure was examined in the mixed liquor of a bench-scale bioreactor equipped with an intermittent aeration and feeding system. The reactor was operated under an intermittent aeration of 25 min in every 1 h and varying feeding conditions (0.264, 0.403 and 0.773 kg BOD{sub 5}/m{sup 3} d). A total of 14 protozoan and metazoan taxa were identified by microscopic examination. Sessile ciliates, followed by crawling ciliates, were the major protozoan groups under 0.403 kg BOD{sub 5}/m{sup 3} d organic loading conditions, while sessile ciliate population was remarkably increased under an organic loading of 0.773 kg BOD{sub 5}/m{sup 3} d. Principal Component Analysis and Pearson correlation coefficient tests were performed in order to reveal relationships between microfauna community and operational parameters. Ciliophora specific-18S rRNA gene clone library was constructed to identify ciliate diversity under 0.773 kg BOD{sub 5}/m{sup 3} d organic loading conditions. Ciliophora diversity consisted of members of Aspidiscidae, Epistylidae, Opisthonectidae and Vorticellidae, with the majority of the clones being associated with the species Vorticella fusca. At least one novel phylogenetic linkage among Ciliophora was identified. Comparisons made after molecular characterization and microscopic examination of Ciliophora community showed that the estimation of broad ciliate groups is useful for ecological considerations and evaluation of the operational conditions in wastewater treatment plants.

  19. Characteristics of microfauna and their relationships with the performance of an activated sludge plant in China

    Institute of Scientific and Technical Information of China (English)

    ZHOU Kexin; XU Muqi; LIU Biao; CAO Hong


    The occurrence and abundance of the microfauna groups were compared with the physico-chemical and operational parameters of the Baoding Lugang Sewage Treatment Plant in China. Attached and crawling ciliates were the dominant groups of ciliates. Crawling ciliates and testate amoebae showed a strong association with effluent BOD5 (biochemical oxygen demand). Therefore, these two groups are likely to be useful bioindicators since their number decreased as the process produced poor quality effluent. Testate amoebae also had significant negative correlations with effluent TN (total nitrogen), NH4+-N, SS (suspended solids) and SVI (sludge volumetric index), which means that this group of ciliates may be indicators of good performance of the activated sludge system. Carnivorous ciliates and flagellates had significant positive correlations with SVI, suggesting that these two groups may be indicators of bad settlement conditions of sludge. As identification of the microfauna species is difficult and time-consuming, we recommend using microfauna functional groups to evaluate the performance of the activated sludge system.

  20. Effects of Predation by Protists on Prokaryotic Community Function, Structure, and Diversity in Anaerobic Granular Sludge (United States)

    Hirakata, Yuga; Oshiki, Mamoru; Kuroda, Kyohei; Hatamoto, Masashi; Kubota, Kengo; Yamaguchi, Takashi; Harada, Hideki; Araki, Nobuo


    Predation by protists is top-down pressure that regulates prokaryotic abundance, community function, structure, and diversity in natural and artificial ecosystems. Although the effects of predation by protists have been studied in aerobic ecosystems, they are poorly understood in anoxic environments. We herein studied the influence of predation by Metopus and Caenomorpha ciliates—ciliates frequently found in anoxic ecosystems—on prokaryotic community function, structure, and diversity. Metopus and Caenomorpha ciliates were cocultivated with prokaryotic assemblages (i.e., anaerobic granular sludge) in an up-flow anaerobic sludge blanket (UASB) reactor for 171 d. Predation by these ciliates increased the methanogenic activities of granular sludge, which constituted 155% of those found in a UASB reactor without the ciliates (i.e., control reactor). Sequencing of 16S rRNA gene amplicons using Illumina MiSeq revealed that the prokaryotic community in the UASB reactor with the ciliates was more diverse than that in the control reactor; 2,885–3,190 and 2,387–2,426 operational taxonomic units (>97% sequence similarities), respectively. The effects of predation by protists in anaerobic engineered systems have mostly been overlooked, and our results show that the influence of predation by protists needs to be examined and considered in the future for a better understanding of prokaryotic community structure and function. PMID:27431197

  1. Microfaunal indicators, Ciliophora phylogeny and protozoan population shifts in an intermittently aerated and fed bioreactor

    International Nuclear Information System (INIS)

    Microfauna community structure was examined in the mixed liquor of a bench-scale bioreactor equipped with an intermittent aeration and feeding system. The reactor was operated under an intermittent aeration of 25 min in every 1 h and varying feeding conditions (0.264, 0.403 and 0.773 kg BOD5/m3 d). A total of 14 protozoan and metazoan taxa were identified by microscopic examination. Sessile ciliates, followed by crawling ciliates, were the major protozoan groups under 0.403 kg BOD5/m3 d organic loading conditions, while sessile ciliate population was remarkably increased under an organic loading of 0.773 kg BOD5/m3 d. Principal Component Analysis and Pearson correlation coefficient tests were performed in order to reveal relationships between microfauna community and operational parameters. Ciliophora specific-18S rRNA gene clone library was constructed to identify ciliate diversity under 0.773 kg BOD5/m3 d organic loading conditions. Ciliophora diversity consisted of members of Aspidiscidae, Epistylidae, Opisthonectidae and Vorticellidae, with the majority of the clones being associated with the species Vorticella fusca. At least one novel phylogenetic linkage among Ciliophora was identified. Comparisons made after molecular characterization and microscopic examination of Ciliophora community showed that the estimation of broad ciliate groups is useful for ecological considerations and evaluation of the operational conditions in wastewater treatment plants.

  2. Abundance and species composition of planktonic Ciliophora from the wastewater discharge zone in the Bahía Blanca Estuary, Argentina

    Directory of Open Access Journals (Sweden)

    María Sonia Barría de Cao


    Full Text Available The specific composition and abundance variation of the ciliate community from a wastewater discharge zone in the Bahía Blanca estuary, Argentina, were studied all throughout a year, from June 1995 to May 1996. The polluted area exhibited high values of particulate organic matter and nutrients, particularly phosphates. Aloricate ciliates were represented by 15 species belonging to the genera Strombidium Claparède & Lachmann, 1859; Strombidinopsis Kent, 1881; Cyrtostrombidium Lynn & Gilron, 1993; Strobilidium Schewiakoff, 1983; Lohmmanniella Leegaard, 1915 and Tontonia Fauré-Fremiet, 1914. Tintinnids were represented by nine species belonging to the genera Tintinnidium Kent, 1881, Tintinnopsis Stein, 1867 and Codonellopsis Jörgensen, 1924. The total abundance of aloricate ciliates reached a peak of 1,800 ind. 1-1 and the total abundance of tintinnids reached a peak of 9,400 ind. 1-1. Tintinnidium balechi Barría de Cao, 1981 was the most abundant ciliate in the community. Considerations on the presence and abundance of ciliates are made in relation to physicochemical and biochemical parameters.

  3. Linking foraging strategies of marine calanoid copepods to patterns of nitrogen stable isotope signatures in a mesocosm study

    DEFF Research Database (Denmark)

    Sommer, Frank; Saage, A.; Santer, B.;


    The foraging modes of calanoid copepods differ in that stationary suspension-feeding is more easily detected by prey with strong escape responses (ciliates) than is 'cruising' or 'ambushing' feeding. Thus, the ability of a copepod to include heterotrophic prey in its diet may be associated with its...... copepod delta(15)N to generally increase with decreasing copepod density because of increased food availability, and predicted stronger increases for cruising than for stationary suspension-fee ding species. As an assemblage, copepods had a pronounced impact on the food web: diatoms and ciliates decreased...... longicornis, a stationary suspension-feeder, showed a uniform isotopic increase in all mesocosms, which we believe resulted from nutritional stress arising from poor feeding on both ciliates (too fast for ingestion by T. longicornis) and nanoflagellates (too small). However, Pseudocalanus elongatus, a species...

  4. Molecular genetic investigations on Balantidium ctenopharyngodoni Chen, 1955, a parasite of the grass carp (Ctenopharyngodon idella). (United States)

    Marton, Szilvia; Bányai, Krisztián; Forró, Barbara; Lengyel, György; Székely, Csaba; Varga, Ádám; Molnár, Kálmán


    Balantidium ctenopharyngodoni is a common ciliate in Hungary, infecting the hindgut of grass carp (Ctenopharyngodon idella), a cyprinid fish of Chinese origin. Although data have already been presented on its occasional pathogenic effect on the endothelium of the host, generally it is a harmless inhabitant of the gut. Phylogenetic analysis of the 18S rDNA and ITS fragments of this protozoan proved that it is in the closest phylogenetic relationship with endocommensalist and symbiont ciliates of mammals feeding on large volumes of green forage, in a similar way as Balantidium spp. known from algae-eating marine fishes. PMID:27342092

  5. Larval nervous systems

    DEFF Research Database (Denmark)

    Nielsen, Claus


    The apical organ of ciliated larvae of cnidarians and bilaterians is a true larval organ that disappears before or at metamorphosis. It appears to be sensory, probably involved in metamorphosis, but knowledge is scant. The ciliated protostome larvae show ganglia/nerve cords that are retained as the...... ‘deuterostomian’ blastopore fates both in an annelid and in a mollusk, which are both placed in families with the ‘normal’ spiralian gastrulation type, and in the chaetognaths demonstrates that the chordate type of gastrulation could easily have evolved from the spiralian type. This indicates that the latest...

  6. The role of Scgb1a1+ Clara cells in the long-term maintenance and repair of lung airway, but not alveolar, epithelium


    Rawlins, Emma L.; Okubo, Tadashi; Xue, Yan; Brass, David M; Auten, Richard L.; Hasegawa, Hiroshi; Wang, Fan; Hogan, Brigid L.M.


    To directly test the contribution of Scgb1a1+ Clara cells to postnatal growth, homeostasis and repair of lung epithelium, we generated a Scgb1a1-CreERTM “knock-in” mouse line for lineage tracing these cells. Under all conditions tested the majority of Clara cells in the bronchioles both self-renew and generate ciliated cells. In the trachea, Clara cells give rise to ciliated cells but do not self-renew extensively. Nevertheless, they can contribute to tracheal repair. In the postnatal mouse l...

  7. A multi-Species Microalgae Bloom in Bahia de La Paz, Gulf of California, México (June 2008)


    Gárate Lizárraga, Ismael; Band Schmidt, Christine Johanna; AGUIRRE BAHENA, FERNANDO; GRAYEB DEL ALAMO, TANOS


    Red tides Patches were observed in Bahía de La Paz in June 17 and 18 of 2008. According to temperature and wind data this bloom occurred under upwelling-like conditions. Examination of the red tide samples showed that the ciliate Myrionecta rubra and two naked dinoflagellates Gyrodinium instriatum and Katodinium glaucum as the main species responsible for this bloom Total density (microalgae and ciliate) at the sampling stations was similar on both days, varying from 4607 × 103 to cells L-1 t...

  8. On combinatorial properties of elementary intramolecular operations

    Directory of Open Access Journals (Sweden)

    Vladimir Rogojin


    Full Text Available Here we tackle a problem from biology in terms of discrete mathematics. We are interested in a complex DNA manipulation process happening in eukaryotic organisms of a subclass of ciliate species called {\\it Stichotrichia} during so-called gene assembly. This process is in particular interesting since one can interpret gene assembly in ciliates as sorting of permutations. We survey here results related to studies on sorting permutations with some specific rewriting rules that formalize elementary intramolecular gene assembly operations. The research question is ``what permutation may be sorted with our operations?"

  9. Effect of coconut oil and defaunation treatment on methanogenesis in sheep


    Machmüller, Andrea; Soliva, Carla; Kreuzer, Michael


    The present study was conducted to evaluate in vivo the role of rumen ciliate protozoa with respect to the methane-suppressing effect of coconut oil. Three sheep were subjected to a 2 $\\times$ 2 factorial design comprising two types of dietary lipids (50 g$\\cdot$kg$^{-1}$ coconut oil vs. 50 g$\\cdot$kg$^{-1}$ rumen-protected fat) and defaunation treatment (with vs. without). Due to the defaunation treatment, which reduced the rumen ciliate protozoa population by 94% on average, total tract fib...

  10. Dicty_cDB: CFD785 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 19_1( AY924419 |pid:none) Trimastix pyriformis ATCC50562 gua... 159 7e-38 AF369885_1( AF369885 |pid:none) Mus spretus 151 1e-35 AY926576_1( AY926576 |pid:none) Malawimonas californiana guanine d... 149 4e-35*fqvllihmlmhhniimqaqvqiyhy*ng*r nthsq*rvnsri*ylrrmfmvkl*tvcyvmvplpvvimqpfiwrqvnywqrlyqnvvnvh slvkfvwivi... Homo sapiens 3 BAC RP11-336E3 (Roswell Park Cancer Institute Human BAC Library) complete sequence. 38 0.16 155 1e-36 (Q9Y2T3) RecName: Full=Guanine deaminase; Short=Guanase... 155 1e-36 AK157014_1( AK157014 |

  11. Dicty_cDB: Contig-U10396-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es in database: 6905 Lambda K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penal...ciparum chromosome 13. 38 0.003 14 ( CP000263 ) Buchnera aphidicola str. Cc (Cina...r54e04.p1k. 48 0.041 2 ( AC189492 ) Brassica rapa subsp. pekinensis clone KBrB084M08,... 34 ... pyriformis mitochondrial DNA, complet... 36 0.27 6 ( AC006283 ) Arabidopsis thaliana c...lus GSS, BAC clone CH241-95F20, T7 end... 48 0.35 1 ( BM415521 ) OP20597 Mixed Stage EST's from Globodera pal

  12. Tolerância à dessecação de sementes de espécies de Eugenia Desiccation tolerance of seeds of species of Eugenia


    Liliana Ferreira Delgado; Claudio José Barbedo


    O objetivo deste trabalho foi avaliar a tolerância à dessecação de sementes de seis espécies frutíferas nativas de Eugenia (E. brasiliensis Lam., E. cerasiflora Miq., E. involucrata DC., E. pyriformis Camb., E. umbelliflora Berg. e E. uniflora L.) e fornecer subsídios para a conservação do poder germinativo dessas sementes durante o armazenamento. As sementes foram submetidas a secagens progressivas, em estufa (40ºC) e em câmaras com sílica-gel (25ºC), até 10% de água. Após cada secagem, as s...

  13. Large organic-walled Protista ( Gromia) in the Arabian Sea: Density, diversity, distribution and ecology (United States)

    Aranda da Silva, A.; Gooday, A. J.


    The genus Gromia includes large marine protists ('gromiids') with filose pseudopodia and sack-like organic tests. The first deep-water species were discovered in the 1990s on the Oman Margin of the Arabian Sea and subsequently found on the Pakistan Margin. We present a survey of gromiids in samples collected off Oman in 2002 and off Pakistan in 2003. In addition to the two species ( Gromia sphaerica and Gromia pyriformis) already described from this area, at least eight undescribed gromiid species were present. Sausage shaped, grape shaped and spherical morphotypes were represented among this material. On the Oman Margin, gromiids occurred in densities up to several thousand individuals m -2 at 1400 and 1700 m but were much less common at 1100 and 2000 m. Apart from G. pyriformis, which was fairly common (several hundred individuals m -2) at 1000 m, gromiids were uncommon in core samples taken off Pakistan, with 11 indiv. m -2 at 1200 m and 19 indiv. m -2 at 1850 m. On both margins, these protists occurred at depths >1000 m where bottom-water oxygen concentrations exceeded ˜0.2 ml l -1 (=8.92 μM l -1) land sediments were fully bioturbated and oxidised. However, they were not observed at similar oxygen levels above the OMZ. Most gromiids lived on the sediment surface with their apertures facing down and their pseudopodia presumably deployed into the sediment to feed on surficial material and associated bacteria. We conclude that these large protists may play an important ecological role in the bathyal Arabian Sea, particularly in carbon cycling but also in structuring the surficial sediments. In addition, their tests, particularly those of G. sphaerica, provide substrates for attached Foraminifera.

  14. Ornitholimnology: Effects of grazing by the Andean flamingo (Phoenicoparrus andinus). (United States)

    Hurlbert, S H; Chang, C C


    Experimental exclusion of the Andean flamingo (Phoenicoparrus andinus) from shallow water areas of a salt lake in the Bolivian Andes caused large increases in the biomass of microorganisms inhabiting the surface sediments, especially a large diatom (Surirella wetzeli), amebas, ciliates, and nematodes. This is a conservative demonstration of the influences that water birds in general exert on the structure of aquatic ecosystems. PMID:16593350

  15. Ornitholimnology: Effects of grazing by the Andean flamingo (Phoenicoparrus andinus)


    Hurlbert, Stuart H.; Chang, Cecily C. Y.


    Experimental exclusion of the Andean flamingo (Phoenicoparrus andinus) from shallow water areas of a salt lake in the Bolivian Andes caused large increases in the biomass of microorganisms inhabiting the surface sediments, especially a large diatom (Surirella wetzeli), amebas, ciliates, and nematodes. This is a conservative demonstration of the influences that water birds in general exert on the structure of aquatic ecosystems.

  16. Normobaric Hypoxia Induces Mild Damage to Epithelium of Terminal Bronchioles in Rabbits (Ultrastructural Study)

    Czech Academy of Sciences Publication Activity Database

    Uhlík, J.; Konrádová, V.; Vajner, L.; Adášková, Jana


    Roč. 50, č. 10 (2005), s. 432-438. ISSN 0375-8427 Source of funding: V - iné verejné zdroje Keywords : airways * Clara cells * ciliated cells * electron microscopy Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.621, year: 2005

  17. Comparison of Effect of Hypoxia on Epithelium of Trachea and Terminal Bronchioles

    Czech Academy of Sciences Publication Activity Database

    Uhlík, J.; Konrádová, V.; Vajner, L.; Adášková, Jana; Herget, J.


    Roč. 9, Suppl. 3 (2003), s. 478-479. ISSN 1431-9276. [Microscopy Conference /31./. Dresden, 07.09.2003-12.09.2003] Source of funding: V - iné verejné zdroje Keywords : airway epithelium * Clara cells * ciliated cells * hypoxia * electron microscopy Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.648, year: 2003

  18. Vertical distribution, grazing and egg production of calanoid copepods during winter-spring in Gullmarsfjorden

    DEFF Research Database (Denmark)

    Titelman, J.; Tiselius, P.


    were superfluous throughout the water column. Copepods and ciliates were never correlated. Ingestion as determined from gut fluorescence and egg production analyses suggested a higher degree of herbivory during the spring bloom than before and after. There was potential for copepod predation control of...

  19. Do protozoa control the elimination of Vibrio cholerae in brackish water?

    Czech Academy of Sciences Publication Activity Database

    Martínez-P., M. E.; Macek, Miroslav; Castro-G., M. T.


    Roč. 89, č. 2 (2004), s. 215-227. ISSN 1434-2944 R&D Projects: GA MŠk(CZ) ME 296 Grant ostatní: UNAM/DGAPA/PAPIT(MX) IN216796 Keywords : ciliate feeding * selectivity * toxin producing bacteria Subject RIV: EE - Microbiology, Virology Impact factor: 0.742, year: 2004

  20. External morphology of the cycliophoran dwarf male: a comparative study of Symbion pandora and S. americanus

    DEFF Research Database (Denmark)

    Neves, Ricardo C.; Cunha, Marina R.; Funch, Peter;


    microscopy. In both species, anterior and ventral ciliated fields, as well as paired lateral sensorial organs, were identified, thus confirming previous observations. However, new details are described herein such as the penial pouch that encloses the penis. We compare our findings on both Symbion species...