WorldWideScience

Sample records for ciervo rojo cervus

  1. Ataxia enzoótica en ciervo rojo (Cervus elaphus) en Argentina Enzootic ataxia in red deer (Cervus elaphus) in Argentina

    OpenAIRE

    J P Soler; S B Cseh

    2007-01-01

    Se describe un caso de ataxia enzoótica (AE) en ciervos rojos en cautiverio ocurrido en Argentina. La AE es una patología de los ciervos que causa parálisis lenta y progresiva de las extremidades posteriores y ha sido asociada a la deficiencia de cobre. Su presentación suele ser a partir de los 9 meses de edad. El problema afectó a dos ciervas rojas con debilidad de los miembros posteriores. Se realizó necropsia a una hembra preñada. Se tomaron muestras de órganos en formol al 10%, de suero y...

  2. Ataxia enzoótica en ciervo rojo (Cervus elaphus en Argentina Enzootic ataxia in red deer (Cervus elaphus in Argentina

    Directory of Open Access Journals (Sweden)

    J P Soler

    2007-01-01

    Full Text Available Se describe un caso de ataxia enzoótica (AE en ciervos rojos en cautiverio ocurrido en Argentina. La AE es una patología de los ciervos que causa parálisis lenta y progresiva de las extremidades posteriores y ha sido asociada a la deficiencia de cobre. Su presentación suele ser a partir de los 9 meses de edad. El problema afectó a dos ciervas rojas con debilidad de los miembros posteriores. Se realizó necropsia a una hembra preñada. Se tomaron muestras de órganos en formol al 10%, de suero y sangre entera. Al feto también se le realizó necropsia y se le tomó una muestra de hígado. A partir de muestras de pasto se determinaron los niveles de Cu, Fe, Zn, Mo y SO4. En el agua se analizaron los valores de sales totales, SO4, Ca, Mg, Na y Cl. La prevalencia de esta enfermedad en el establecimiento fue del 0,14%. Los valores de Cu hepático hallados en la hembra y su feto fueron 14,6 ppm y 337 ppm MS, respectivamente. El nivel de Cu en sangre de la cierva fue de 0,5 μg/ml y el hematocrito de 46%. En mιdula espinal se encontró degeneración mielínica generalizada con pérdida de la vaina de mielina, siendo de mayor severidad en las regiones dorsales de la médula. Se observó también vacuolización de la sustancia blanca sin respuesta inflamatoria. Los niveles hepáticos de Cu en la hembra necropsiada se encontraban por debajo del valor considerado como límite, pero a pesar de esto la cupremia se hallaba dentro del rango de referencia siendo ésta una característica comúnmente observada en los casos de deficiencia de Cu. Los valores de Cu hepático fetal también estaban por debajo del rango considerado como normal. A pesar de que los parámetros medidos en pasto y agua al momento del problema estaban dentro de valores de referencia, es probable que los ciervos hayan estado expuestos previamente a bajos valores de Cu dietario durante un tiempo prolongado, lo cual pudo verse agravado por la gran demanda de Cu que ejerce el

  3. Composición y calidad de la dieta del ciervo (Cervus elaphus L. en el norte de la península ibérica

    Directory of Open Access Journals (Sweden)

    Garin, I.

    2001-06-01

    Full Text Available Plant composition and quality of the red deer (Cervus elaphus L. diet in the northern Iberian peninsula The feeding pattern of red deer varies greatly among the different European populations. The aim of our study was to elucidate the plant composition and the quality of the red deer diet in the Pyrenees (Northern Iberian peninsula. Over a one-year period, the red deer fed mainly on browse, pines being the main food. However, unlike other populations on the Iberian peninsula, consumption of herbaceous plants was higher than browse in the spring-summer period. Nevertheless, the diet of Pyrenean red deer shared some features with the Mediterranean populations such as browsing on woody legumes. Fecal nitrogen content, as an index of diet quality, showed low annual values with a marked decrease in winter. The overall feeding pattern was similar to that of other Central European populations. The large size of the surveyed population probably affected its high level of browse consumption and poor quality diet.

  4. Guía para la determinación de la edad del ciervo ibérico (Cervus elaphus hispanicus) a través de su dentición: revisión metodológica y técnicas de elección

    OpenAIRE

    Azorit Casas, Concepción E.

    2011-01-01

    La determinación de la edad de los ciervos cazados es fundamental e imprescindible para valorar tanto la calidad individual como la calidad de la población en su conjunto y pone en perspectiva cuestiones sobre gestión y manejo. La determinación de la edad es la mejor fuente de información para evaluar los resultados de la gestión desarrollada, monitorizar el cumplimiento de los objetivos marcados a medio y largo plazo, y valorar las consecuencias de prácticas de manejo anteriores. También con...

  5. Caballos y ciervos : Una aproximación a la evolución climática y económica del Paleolítico superior en el Mediterráneo peninsular

    Directory of Open Access Journals (Sweden)

    Xavier Esteve

    2005-01-01

    Full Text Available Caballos y ciervos son las principales presas de caza mayor en los yacimientos del Paleolítico superior en la cuenca mediterranea de la Península Ibérica. Sólo las cabras monteses pueden llegar a tener mayor importancia en yacimientos situados en áreas abruptas o montañosas. A pesar de los pocos requerimientos climáticos de ambas especies, podemos comprobar una clara relación entre los episodios más fríos del final del Pleistoceno y la caza del caballo y la presencia de los restos de ciervo en los yacimientos arqueológicos durante los momentos más templados. Nuestros resultados indican la existencia de una especie de frontera bioclimática Equus/Cervus que se desplazó de sur a norte en la cuenca medietrranea de la peninsula Ibérica a lo largo del Paleolítico superior.

  6. La captura del ciervo vivo en el arte prehistórico

    Directory of Open Access Journals (Sweden)

    Pilar Utrilla

    2005-01-01

    Full Text Available Se hace un recorrido por la representaciones de ciervos en el arte prehistórico que no presentan heridas sino que parecen ser objeto de una captura mediante armas arrojadizas, lazos o directamente a mano. Se insertan algunos de ellos en un ritual ceremonial que quizá tuviera relación con ritos de iniciación.

  7. Cabo Rojo National Wildlife Refuge: Comprehensive Conservation Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This Comprehensive Conservation Plan (CCP) was written to guide management on Cabo Rojo NWR for the next 15 years. This plan outlines the Refuge vision and purpose...

  8. arroz rojo (Oryza sativa L. en dos sistemas de labranza

    Directory of Open Access Journals (Sweden)

    Steven Brenes Prendas

    2006-01-01

    Full Text Available A lo largo de cuatro ciclos de cultivo de arroz anegado, entre los años 2003 y 2004, en la Hacienda El Pelón de la Bajura, Liberia, Guanacaste, Costa Rica, se determinó la distribución espacial de las poblaciones de arroz rojo en los sistemas de Siembra Directa sobre Rastrojos (SDR y en Labranza Mecanizada Convencional (LMC. Mediante levantamientos de malezas ubicados en puntos fijos a nivel de campo y con ayuda del programa Surfer, se logró construir mapas georeferenciales de dichas poblaciones. El sistema SDR logró disminuir el ritmo de crecimiento de las poblaciones, facilitando su manejo, por lo contrario el sistema LMC, favoreció: la distribución, el aumento y la densidad de las poblaciones de arroz rojo en el campo. Los mapas de georeferencia facilitarían la toma de decisiones en el manejo integrado del arroz rojo

  9. Arándano rojo I (Vaccinium macrocarpon Ait.)

    OpenAIRE

    Garrido Conejero, M. Victoria; Pérez-Urria Carril, Elena

    2014-01-01

    El arándano rojo o arándano rojo americano (Vaccinium macrocarpon Ait.) es una fruta muy consumida y apreciada que ha ganado popularidad con los años debido en parte a su contenido en compuestos beneficiosos para la salud humana. En el trabajo se consideran aspectos botánicos, composición nutricional y contenido en compuestos fitoquímicos, datos históricos y culturales e información sobre el cultivo de esta especie vegetal y sus variedades. También se considera su importancia económica y algu...

  10. A Novel Polypeptide from Cervus elaphus Linnaeus

    Institute of Scientific and Technical Information of China (English)

    LiangWENG; QiuLiZHOU; 等

    2002-01-01

    A novel polypeptide having stimulant effect on some cell proliferation was isolated from the velvet antler (Cervus elaphus Linnaeus). The velvet antler polypeptide consists of a single chain of 32 amino acid residues. Amino acid sequence of the polypeptide was identified as:VLSAADKSNVKAAWGKVGGNAPAFGAEALLRM.

  11. Hybridisation and introgression of exotic Cervus (nippon and canadensis) with red deer (Cervus elaphus) in the British Isles

    OpenAIRE

    Smith, Stephanie Lindsay

    2013-01-01

    Europe’s largest population of wild red deer (Cervus elaphus) resides in the British Isles and has been present since the end of the last ice age, c. 11,000BP. Since the mid-19th century, multiple introductions of Japanese sika (Cervus nippon) and wapiti (Cervus canadensis) have taken place across the British Isles. While wapiti introductions have generally gone extinct, sika have thrived and expanded and now often live in sympatry with red deer. Hybridisation between these spe...

  12. La ¡nasibilidad de lo real: el ciervo huidizo de la identidad The Inaccessibility of Truth: The Elusive Deer of Identity

    Directory of Open Access Journals (Sweden)

    Lola Proaño Gómez

    2008-12-01

    Full Text Available Este artículo responde a la pregunta por la posibilidad de una lectura política de los productos teatrales latinoamericanos de los últimos años, enfatizando la presencia de «lo político» en forma de rupturas lógicas y de sentido que dislocan el escenario teatral desde adentro. El grupo cubano El Ciervo Encantado, (2005-2008 busca -según el programa de mano- encontrar en Visiones de la cubanosofía, «ese ciervo escurridizo que es la identidad». La escena despliega, mediante múltiples técnicas teatrales, la incapacidad del lenguaje -lo simbólico- para captarla. La propuesta escenifica lo que se niega: la imposibilidad de aprehender la identidad exhibiendo sólo las sucesivas identificaciones que no la alcanzan. La escena señala que ellas han sido solamente un espejismo, resultado del reflejo de los discursos culturales producidos a través de la historia.This article is an answer to the question on the possibility of a political interpretation of recent Latin American dramatic products, emphasising on «political issues» through meaningful and logical ruptures that dislocate the stage from within. The Cuban theatre troupe El Ciervo Encantado (2005-2008, based on its programme, aims to find in Visiones de la cubanosofía, «the elusive deer that is identity». On stage is displayed, through various theatrical techniques, the incapacity of language -its symbolic aspect- to capture it. The proposal stages what is denied: the impossibility to apprehend identity by only presenting the successive identifications that cannot reach it. The scene states that it has only been an illusion caused by the reflection of the cultural discourses created through history.

  13. Parasitofauna del zorro rojo (Vulpes vulpes) en la Comunidad Valenciana

    OpenAIRE

    Sanchis Monsonís, Gloria

    2016-01-01

    El presente estudio sobre la parasitofauna del zorro rojo (Vulpes vulpes) se ha realizado en la Comunidad Valenciana, dentro del Programa de Vigilancia Epidemiológica sobre especies cinegéticas y salvajes. Entre mayo de 2006 y noviembre de 2013 se realizaron las necropsias de 286 zorros obtenidos de capturas autorizadas para el control de predadores, de atropellos o recogidos enfermos. Tras el análisis de las vísceras torácicas y abdominales, así como el examen de muestras de musculatura esqu...

  14. El glóbulo rojo en cifras

    Directory of Open Access Journals (Sweden)

    Mauricio Boyacá

    2004-11-01

    Full Text Available El glóbulo rojo es una célula de 5 a 7 micras de diámetro, se encarga de transportar oxígeno desde los pulmones hacia las células de los tejidos, mediante su adhesión a la hemoglobina, cuyo componente principal es el hierro, igualmente, cataliza la formacion de bicarbonato a partir del agua, y del dióxido de carbono, para que este último retorne a los pulmones disuelto en la sangre y ser eliminado, manteniendo viables las células y tejidos. Estas células sanguineas tienen un pequeño tamaño y ocupan un volumen mínimo medido en femtolitos (FI, ellas trasnportan una cantidad diminuta de hemoglobina medida en picogramos (Pg. La porducción de eritrocitos ocurre en la médula ósea de las especies superiores, en una relación aproximada de 35 milones de células por segundo. Estos viven 100 días en promedio, y mueren en un número similar. Los glóbulos rojos son depositados en el brazo, para reciclar sus componentes, ensamblados luego por la médula ósea como células nuevas. En consecuencia, un animal con un peso de 450 kilogramos, tendrá cerca de 300 billones de células circulando en el sistema vascular.

  15. El glóbulo rojo en cifras

    OpenAIRE

    Mauricio Boyacá

    2004-01-01

    El glóbulo rojo es una célula de 5 a 7 micras de diámetro, se encarga de transportar oxígeno desde los pulmones hacia las células de los tejidos, mediante su adhesión a la hemoglobina, cuyo componente principal es el hierro, igualmente, cataliza la formacion de bicarbonato a partir del agua, y del dióxido de carbono, para que este último retorne a los pulmones disuelto en la sangre y ser eliminado, manteniendo viables las células y tejidos. Estas células sanguineas tienen un pequeño tamaño y ...

  16. La composición y propiedades mecánicas de cuernas y huesos de ciervo como fuente de información para gestionar ecosistemas

    OpenAIRE

    T. Landete-Castillejos; Garcia, A.; F. Ceacero; Gallego, L.

    2013-01-01

    Este estudio hace una revisión de una línea de investigación que muestra cómo, en el ciervo, la composición mineral, propiedades mecánicas del material óseo de la cuerna, estructura e incluso histología de las cuernas están influidos por un juego de factores interrelacionados tales como la nutrición, tipo de gestión, calidad del hábitat, y densidad de población. Así, evaluar estas características se convierte en una herramienta diagnóstica que aporta información sobre las deficiencias mineral...

  17. The population size, demography and the harvest strategy for the red deer (Cervus elaphus L. in the Polish eastern Carpathians

    Directory of Open Access Journals (Sweden)

    Merta, D.

    2002-12-01

    sex-ratio était de 1:1,6, et la relation faon/femelle était de 31 faons pour 100 femelles. En appliquant un modèle de dynamique de population, nous avons calculé le taux de recrutement, lequel peut aller de 10,5% à 18,1 % du total de la population au mois de mars; il était négativement corrélé avec la densité de population de loups. La simulation sur ordinateur des différentes stratégies d'extraction a montré que le has pourcentage de vieux mâles observé dans la population actuelle était dû à la surchasse des mâles âgés de 2-5 ans. Nous pouvons recommander que la pression de chasse sur les jeunes mâles ne dépasse pas 30% du nombre total de mâles chassés.
    [es]
    Durante febrero del 2000 se estimó la densidad de población y el número de ciervos (Cervus elaphusL. en 8 distritos forestales (Baligród, Cisna, Dukla, Lutowiska, Komacza, Stuposiany, Rymanów y Wetlina por medio del índice de intercepción lineal de huellas en la nieve. Se obtuvo un total de 4081 individuos para el área de estudio (134.000 ha de bosque. La densidad media fue de 30,4 ciervos/1000 ha y su rango osciló de 10,1 ciervos/1000 ha (Distrito Forestal de Wetlina a 39,3 individuos/ 1000 ha (Distrito Forestal de Dukla. En septiembre de 2000 la observación de 952 individuos arrojó una sex-ratio de 1:1,6 (machos: hembra y un índice de 31 crías por cada 100 hembras. La tasa de reclutamiento anual se calculó mediante un modelo de dinámica poblacional, oscilando ésta entre el 10,5% y el 18,1% del tamaño poblacional en marzo y estando correlacionada negativamente con la densidad de lobos. Un programa informático de simulación de distintas estrategias de aprovechamiento cinegético mostró que el bajo porcentaje de machos viejos era debido a un exceso de caza de los venados de 2 a 5 años de edad. Por lo tanto, se recomendó que la proporción de machos jóvenes en el cupo no debería superar el 30% del total de machos cazados.

  18. Validación y uso de Espectrocopía de Infrarrojo Cercano (NIRS) para el estudio de alimentación de ciervo (Cervus elaphus hispanicus) y gamo (Dama dama) en ecosistemas mediterráneos

    OpenAIRE

    Tellado-Ruiz, María-Sierra

    2016-01-01

    [ES]En este estudio desarrollamos y validamos un método de Espectroscopía de Reflectancia en la región del infrarrojo cercano (NIRS) para determinar, de forma indirecta a partir de heces, la calidad de la dieta de dos especies de cérvidos en ambiente mediterráneo. Se estudió el contenido de fibra ácido detergente (ADF) y fibra neutro detergente (NDF), el contenido de lignina, el índice de carbono/nitrógeno (C:N), la digestibilidad enzimática (EDOM) y de la pared celular (CWD), la cantidad de ...

  19. Genetic structure of the Danish red deer (Cervus elaphus)

    DEFF Research Database (Denmark)

    NIELSEN, ELSEMARIE KRAGH; OLESEN, CARSTEN RIIS; PERTOLDI, CINO;

    2008-01-01

    The red deer (Cervus elaphus) population in Denmark became almost extinct in recent historical times due to over-hunting. The species has subsequently recovered within remote areas, but non-Danish individuals have been introduced at several localities. To assess genetic structure, past demographi...

  20. Rojo INIFAP, nueva variedad de frijol de grano rojo para el trópico de México Rojo INIFAP, a new red grain bean variety for the Tropic of Mexico

    Directory of Open Access Journals (Sweden)

    Bernardo Villar Sánchez

    2010-12-01

    Full Text Available En los Distritos de Desarrollo Rural, Centro y Altos de la Secretaría de Agricultura, Ganadería, Desarrollo Rural, Pesca y Alimentación del estado de Chiapas, existen áreas donde se siembran materiales criollos de frijol de grano rojo, los cuales se comercializan tanto en los mercados locales de las comunidades, como en la capital del estado, donde también se comercializa grano de frijol rojo proveniente de Centroamérica. Aunque estos genotipos tienen adaptación específica, son de bajo rendimiento potencial y susceptible a enfermedades. En esta entidad existe un creciente interés por parte de los agricultores por la siembra de este tipo de grano, lo cual obedece al establecimiento cada vez mayor de inmigrantes centroamericanos en el estado, que culturalmente consumen frijol de grano rojo y por lo tanto aumenta la demanda local de este tipo de frijol. Por otra parte, al incrementar la superficie de siembra y el rendimiento de frijol de grano rojo, representa una oportunidad para el estado de Chiapas de exportar este tipo de grano, considerando la demanda que hay en El Salvador, Honduras y Nicaragua, así como en los Estados Unidos de América, donde radican habitantes de estos países centroamericanos, además de promover su consumo en el país.In the Rural Development Districts (DDR, Centro y Altos of Secretaría de Agricultura, Ganadería, Desarrollo Rural, Pesca y Alimentación (SAGARPA in the State of Chiapas, there are areas where creole materials of red grain bean are sowed, which are traded in local markets where they are produced, as in those of State capital, where it is also traded red grain bean from Central America. Although these genotypes have specific adaptation, they are from low yield potential and susceptible to diseases. In this state there is a growing interest in the farmers for sowing of this type of grain, which stands for the increasing establishment of Central American immigrants in the state that culturally

  1. National Wildlife Refuge Visitor Survey 2010/2011 : Individual refuge results for Cabo Rojo National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes the National Wildlife Refuge Visitor Survey for Cabo Rojo NWR and is part of the USGS Data Series 643. The survey was conducted to better...

  2. Successful low dose insemination of flow cytometrically sorted Sika (Cervus nippon) sperm in Wapiti (Cervus elaphus).

    Science.gov (United States)

    Gao, Q H; Wei, H J; Han, C M; Du, H Z; Zhang, Z G; Zhao, W G; Zhang, Y; Li, S

    2010-03-01

    The purpose of this study was to determine a practical method in Wapiti (Cervus elaphus) of using predetermined sexed Sika (Cervus nippon) semen. Semen was collected by electro-ejaculation from one stag of proven fertility and transported to the laboratory where it was retained as unsorted (control) or was separated into X- and Y-chromosome-bearing sperm using a modified high-speed cell sorter. Wapiti hinds (n=81) were inseminated into the uterus by rectum manipulation with 1 x 10(6) (X1 and Y1 group, respectively) or 2 x 10(6) (X2 and Y2 group, respectively) of sorted frozen-thawed and 1 x 10(7) non-sorted frozen-thawed (a commercial dose control) Sika motile sperm 60-66h after removal of intra-vaginal progesterone-impregnated CIDR devices and administration of 700IU of PMSG at the time of CIDR removal. The percentage of hinds calving after insemination was similar for X1 (38.5%), X2 (41.7%), Y1 (44.4%), Y2 (38.9%) groups (P>0.05), but higher for control (75%) treatment (PSika and Wapiti-hybrid calves produced by Wapiti hinds inseminated with Y-sorted sperm were male (93.7%) and 10/10 (100%) Sika and Wapiti-hybrid calves from hinds inseminated with X-sorted sperm were female. The sex ratio of the Sika and Wapiti-hybrid calves born to hinds inseminated with sex-sorted sperm deviated significantly (PSika and Wapiti-hybrid calves were born between 237 and 250d of gestation. Male and female calves in the control group had similar birth weights and weaning weights as calves from hinds inseminated with X- or Y-sorted sperm. In conclusion it can be said that normal Sika and Wapiti-hybrid calves of predicted sex can be produced after artificial insemination of Wapiti does with low numbers of sex-sorted cryopreserved Sika sperm. PMID:19619965

  3. POSIBILIDAD DE CONTROL DEL ARROZ ROJO (Oryza sativa L.) CON LA INUNDACIÓN PROLONGADA

    OpenAIRE

    R. Polón; G. S. Díaz; R. Morejón; R. I. Castro; Noraida Pérez; A. Miranda; M. A. Ramírez

    2005-01-01

    En la Estación Experimental del Arroz "Los Palacios", desde 1998 al 2000, se desarrolló un experimento para el control del arroz rojo. Se utilizaron macetas de un área de 0.25 m2, sembrándose en éstas 20 semillas de arroz rojo a una profundidad de 3 cm. Los manejos del agua fueron desde inundación y después desagüe hasta pases de agua y después inundación. Se logró un control total y efectivo a partir de los 40 días cuando se utilizó el manejo del agua, inundación y después desagüe, respecto ...

  4. Lactation curves in captive Iberian red deer (Cervus elaphus hispanicus)

    OpenAIRE

    García Díaz, Andrés; Landete Castillejos, Tomás; Molina Casanova, Ana María; Albiñana, Bernardo; Fernández, Carlos; Garde López-Brea, José Julián; Gallego Martínez, Laureano

    1999-01-01

    This study examines milk production and the effect of milk production and sex of calf on body weights and gains of red deer calves and hinds of the Iberian subspecies (Cervus elaphus hispanicus). Milk production was assessed in 14 hinds by weighing calves before and after suckling and by adjusting these values to the Gamma function. Gamma estimates of total milk production up to d 105 were similar to the amounts computed directly from double weighing. Hinds showed two types of lactation cu...

  5. Risk assessment of Sika deer Cervus nippon in the Netherlands

    OpenAIRE

    Lammertsma, D.R.; Groot Bruinderink, G.W.T.A.; Griffioen, A.J.

    2012-01-01

    Sika Deer (Cervus nippon) is considered an invasive alien species in Europe. They were introduced in the 19th and 20th century in Europe and have established self-sustaining populations in various countries. Main concerns for Sika, without preventive measures taken and without population control, are about damage to forestry (silviculture, timber production), agriculture, Natura 2000 areas, competition with native ungulates and hybridization and introgression with native Red Deer. Risk assess...

  6. Iconografía del miedo: el cine y el "terror rojo"

    OpenAIRE

    Sánchez-Biosca, Vicente

    2012-01-01

    El presente texto se ocupa de la puesta en discurso cinematográfico del miedo en la Guerra Civil y su rápida codificación en el dominio de la propaganda y de la representación inmediatamente posterior. Nos centraremos en ese relato del «terror rojo» que constituyó un verdadero género en la literatura, el arte, las memorias, pero no menos en los dominios jurídicos y penales que tuvieron por objeto la represión e, incluso, la venganza política. El cine posee una doble particul...

  7. Estudio químico de propóleos rojos cubanos

    OpenAIRE

    Campo Fernández, Mercedes

    2008-01-01

    La ciencia ha dedicado múltiples esfuerzos para demostrar los efectos biológicos del propóleos, quedando un poco rezagados los estudios de la composición química que fundamentan su actividad biológica. Para tal problema científico este trabajo se propuso el aislamiento y caracterización espectroscópica de los componentes químicos orgánicos de propóleos rojos cubanos, para demostrar similitudes o diferencias con los propóleos ya estudiados. El estudio de caracterización estructural más exhaust...

  8. Reprodukce siky (Cervus nippon) na Plzeňsku

    OpenAIRE

    Husinec, Václav

    2013-01-01

    This thesis examines the impact of the age of female sika deer on the weight of embryos of sika deer Cervus nippon nippon in the North Pilsen Region. From 2011 to the start of 2013 hunted down female sika deer were examined to establish the presence of embryos. Embryos were subsequently taken out of the hunted deer and analysed. The location of Košetice was selected to collate the data necessary. The location and the method of collation of data has been described in one of the chapters of thi...

  9. Obtención industrial de materiales cerámicos a partir de lodos rojos del proceso Bayer

    OpenAIRE

    Aza Pendas, Salvador de; Guitián Rivera, F.; Pérez Rodríguez, G. A.

    1999-01-01

    [ES] Los Lodos Rojos son el residuo insoluble de la extracción de alúmina a partir de la bauxita por el proceso Bayer. En Galicia se producen más de 400.000 toneladas anuales de este residuo industrial, constituido fundamentalmente por una mezcla de óxidos e hidróxidos de hierro, óxidos de titanio, cuarzo, con cantidades menores de, arcillas, y otros minerales. El presente trabajo describe el proceso de aprovechamiento industrial de los Lodos Rojos, para obtener ladrillos densos para...

  10. Análisis de la competencia entre tres tipos de arroz rojo y la variedad oryzica -1

    OpenAIRE

    Montealegre S., Fabio A.; Clavijo P., Jairo

    2011-01-01

    Con el objeto de analizar la capacidad competidora de los arroces rojos Varietal Cica-6 (VC-6), Mechudo Patechulo(PM) y Pipón Desgranador (PO), se llevó a cabo una investigación de campo en la cual los arroces rojos fueron sembrados en monocultivo yen mezcla (50:50) con la variedad Orvzlca-1, Se empleó un diseño de bloquesal azar con muestreo y tres replicaciones. Las variables medidas fueron altura de planta, número de macollas y hojas por planta, área foliar, peso seco de la parte aérea y l...

  11. The Presence and Origin of Enterococcus faecalis in Cabo Rojo, Puerto Rico

    Science.gov (United States)

    Zachman, A. J.; Sturm, P.; Viqueira Ríos, R.

    2015-12-01

    Currently, a watershed management plan is being developed for Cabo Rojo region in Southwest Puerto Rico. This project fills in major gaps for water quality data on the Rio Viejo, a tributary on the Guanajibio River. The Rio Viejo flows through the town of Cabo Rojo, a town of 51,245 people. The project has identified 5 sites along the river to track bacterial loads. In the tropics, Enterococcus faecalis is an important indicator for fecal contamination in surface waters as it does not reproduce as quickly soils as E. coli. A combination of EPA 1600 and 9230B from Standard Methods for the Examination of Water and Wastewater for identification of E. faecalis were utilized. The assay is a four step procedure that identifies the four criteria of bacteria in the group D Streptococcus system. The criteria require that the bacteria are Gram-positive cocci and Esculin-positive. There also must be growth in Brain Heart Infusion Broth at 35C and 45C as well as growth in Brain Heart Infusion broth + 6.5% NaCl. Further research will be conducted at North Carolina State University to ascertain the vertebrate species that is the source of the contamination through the use of qPCR.

  12. Application of the Sea-Level Affecting Marshes Model (SLAMM 5.0) to Cabo Rojo and Laguna Cartagena National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This SeaLevel Affecting Marshes Model SLAMM report presents a model for projecting the effects of sealevel rise on coastal marshes and related habitats on Cabo Rojo...

  13. Diagnóstico del ojo rojo para el médico de atención primaria

    Directory of Open Access Journals (Sweden)

    Virgilio Galvis Ramírez

    2008-12-01

    Full Text Available El ojo rojo es uno de los motivos de consulta más comunes en atención ocular primaria, y el médico no oftalmólogo tiene la vital función de discernir cuando se trata de una patología que pueda amenazar la visión. En este artículo revisamos el enfoque diagnóstico del ojo rojo de acuerdo a nuestra experiencia profesional y empleando Medline para localizar artículos sobre el tema. Adicionalmente sugerimos un flujograma que esperamos guíe al médico de atención primaria al enfrentarse a estos casos.

  14. Effect of processing on the physicochemical, sensory, nutritional and microbiological quality of fresh-cut 'Rojo Brillante' persimmon

    OpenAIRE

    SANCHÍS SOLER, ELENA

    2016-01-01

    [EN] Persimmon (Diospyros kaki L.) 'Rojo Brillante' is an astringent variety characterised by good growing conditions, excellent colour, size, sensory characteristics and good nutritional properties. In the last decade, its production has grown substantially in Spain given the application of high levels of CO2 to remove astringency while firmness is preserved. This technology has also increased its potential as a fresh-cut commodity. However, physical damage during processing result in degrad...

  15. Babesias of red deer (Cervus elaphus in Ireland

    Directory of Open Access Journals (Sweden)

    Zintl Annetta

    2011-01-01

    Full Text Available Abstract Blood samples were obtained from 38 wild red deer (Cervus elaphus at two sites in Ireland and subjected to PCR analysis of the 18S rRNA gene followed by sequencing. Two fragments of the 18S rRNA gene were generated by two different PCR protocols and subsequent sequencing suggested that at least six of the deer were infected by a babesia that, in those loci, is indistinguishable from Babesia divergens, an important tick-borne pathogen of cattle and of zoonotic significance. Additionally, a B. odocoilei-like parasite was detected in three samples and a babesia that did not match any sequences in the GenBank database was found in five samples. Neither B. capreoli nor B. venatorum (EU1 were found. There have been several reports of B. divergens occurring in deer species, including red deer, roe deer (Capreolus capreolus and reindeer (Rangifer tarandus. However, in view of recent re-sequencing of bovine-origin samples deposited previously in GenBank, it is unlikely that any of these sequences from deer are B. divergens. The present study describes the only deer piroplasm detected so far that shows complete identity with B. divergens, in just over half of the 18S rRNA gene. The entire gene of this deer parasite should be analysed and transmission experiments undertaken before the infectivity of B. divergens for red deer can be confirmed.

  16. From surfaces to magnetic properties: special section dedicated to Juan Rojo

    Science.gov (United States)

    Mascaraque, A.; Rodríguez de la Fuente, O.; González-Barrio, Miguel A.

    2013-12-01

    Surface physics and magnetism, in particular the connection between surface defects, reduced dimensionality or size, crystal structure, electronic density of states and the mechanical and magnetic properties of solids, were always at the core of Juan Rojo's scientific interest and output. Both fields seem to meet at the nanoscale, a privileged playing field which is ideal for testing theoretical concepts, exploring new physics or probing a wealth of new, stunning and unheard-of applications. Upon reducing size or dimensionality, either in bulk systems or in thin films, surfaces and surface effects are telling. Thus, for instance, an ultra-thin coating can make nanoparticles of non-magnetic materials exhibit magnetic behaviour; or atomic steps can modify the local mechanical properties of a metallic single crystal. In this special section there are eight invited papers by disciples and close collaborators of Juan Rojo, that cover an ample spectrum of the above mentioned topics. The first paper, by Palacio et al, investigates the temperature and oxygen partial pressure conditions for FeO mono- and bi-layer growth on Ru(0001). The following paper, by Cortés-Gil et al, reports on the dramatic change in the electric resistivity of the manganite perovskite (La0.5Ca0.5)z MnO3 as a function of Ca content, an effect related to the removal of a charge-ordered state and a magnetic transition. Baeza et al study biomaterials for bone cancer treatment and skeletal reinforcing, as well as targeted magnetic nanoparticles used for intracell hyperthermia in cancer therapies. In the following paper, Marcano et al, assisted by a multi-technique approach, revisit the extraordinarily rich magnetic phase diagram of the Kondo system CeNi1- x Cux down to 100 mK temperatures. The magnetic field dependence of the martensitic transition temperature of the meta-magnetic shape memory alloy Ni50Mn34.5In15.5 in a crystalline and amorphous phase, in fields up to 13 T, is the subject of the paper

  17. La frontera a alto corrimiento al rojo historia de la formacion de las galaxias

    CERN Document Server

    Miralda-Escudé, J

    1999-01-01

    This review presents a brief discussion of the theory of Cold Dark Matter of structure formation in the universe, describing the main processes determining the power spectrum, the non-linear gravitational collapse, the formation of galaxies and the evolution of the intergalactic medium. Recent advances in the observations of high redshift galaxies, and their interpretation in the context of this theory, are then summarized. Este artí culo de revisión presenta una breve exposición de la teorí a de la Materia Invisible Frí a de la formación de estructura en el universo, describiendo los procesos más importantes que determinan el espectro de potencia, el colapso gravitatorio no lineal, la formación de galaxias y la evolución del medio intergaláctico. Resumimos también los avances recientes en las observaciones de galaxias a alto corrimiento al rojo, y la interpretación en el contexto de esa teorí a.

  18. Diagnóstico diferencial del ojo rojo Guidelines for differential diagnosis of red eye

    Directory of Open Access Journals (Sweden)

    Francisco Umaña

    1993-03-01

    Full Text Available

    En este artículo se dan pautas para el diagnóstico diferencial en casos de ojo rojo en la práctica médica no especializada; se hace énfasis en la necesidad de descartar en primer término entidades como glaucoma, queratitis, iridociclitis, escleritis, eplescleritis y cuerpo extraño antes de concluir que se trata de una conjuntivitis.

    Guidelines for the differential diagnosis of red eye In the non-specialized medical practice are given in this review. Attention Is called to the need to rule-out, In the first place, the following conditions before arriving at a diagnosis of conjunctivitis: glaucoma, keratitis, iridocyclitis, escleritis, eplescleritis and foreign body.

  19. Sarcocystosis in Cervus elaphus: Comparison of diagnostic methods

    Directory of Open Access Journals (Sweden)

    Mónica Luzón

    2015-12-01

    Full Text Available Red deer (Cervus elaphus from a National Wildlife Reserve near Toledo in central Spain were surveyed for Sarcocystis infection. A total of 61 deer were examined. Tissue compression and histology were used to examine samples from diaphragm and heart from each animal included in the study, and results from the two techniques and the two tissues were compared to determine the tissue and technique that provide the most accurate measure of prevalence and intensity. Prevalence and intensity were then compared between calves, yearlings and adults. Sarcocystis was detected in 59 (97% of the 61 deer. Comparison between tissues showed that (a prevalence based on histology was similar for heart and diaphragm, (b prevalence based on compression was significantly higher for heart than for diaphragm and (c intensity was significantly higher for heart than for diaphragm, regardless of the technique used. Comparison between techniques showed that (a both techniques rendered similar prevalences and intensities of Sarcocystis infection with heart samples and (b both techniques were not comparable with diaphragm samples (compression rendered lower prevalence but higher intensity than histology. Together these data suggest that heart is the preferable tissue for estimating prevalence and intensity, regardless of the technique used. A preliminary species identification of isolated cysts from three animals showed two morph types, corresponding to Sarcocystis cervicanis (syn. S. cf. grueneri; S. wapiti in the heart and diaphragm of three animals and S. hjorti, only in the diaphragm of two animals. Given the different location of those morph types, both heart and diaphragm should be sampled and preferably assessed using histology to most reliably detect infection. Based on histology of heart, prevalence and intensity of Sarcocystis were significantly lower in calves than in yearlings or adults.

  20. Sarcocystosis in wild red deer (Cervus elaphus) in Patagonia, Argentina.

    Science.gov (United States)

    Reissig, Elizabeth Chang; Moré, Gastón; Massone, Adriana; Uzal, Francisco A

    2016-05-01

    Sarcocystis spp. are protozoan parasites with a heteroxenous life cycle, which produce cysts in the muscle of herbivorous animals. In these animal species, sarcocystosis is frequently asymptomatic, although it may occur with high prevalence. Seven Sarcocystis spp. have been described in red deer (Cervus elephus). The aim of this study was to determine the prevalence of sarcocystosis, and to perform the morphological and molecular characterization of Sarcocystis spp. found in wild red deer of the Nahuel Huapi National Park (NHNP), Patagonia, Argentina. Full necropsies of 62 red deer killed by hunters in the NHNP and neighboring areas were performed. Samples of heart and skeletal muscle were examined histologically and selected samples were also examined by transmission electron microscopy (TEM), PCR and sequencing. Sarcocystis spp. thin walled cysts were detected in 62 % (38/62) of heart, and in 22 % (3/14) of skeletal muscle samples examined histologically. TEM revealed a smooth and thin cyst wall (≤1 μm), with scarce and separated ribbon-like protrusions. A total of three partial and one full 18S ribosomal RNA (rRNA) gene sequences were obtained, and showed the highest identity (≥99 %) with Sarcocystis taeniata, a species described in moose (Alces alces). The morphological and molecular results indicate that red deer in Argentina are frequently infected with S. taeniata, a species for which the definitive host is unknown. The present results also confirm that Sarcocystis spp. using cervids as intermediate host are not host-specific. Further studies are needed to improve the epidemiological knowledge of Sarcocystosis in red deer. PMID:26779923

  1. Sarcocystosis in Cervus elaphus: Comparison of diagnostic methods.

    Science.gov (United States)

    Luzón, Mónica; Domínguez-González, Julia; Soto-Carrión, Ana María; Alunda, José María; Fuente, Concepción de la

    2015-12-01

    Red deer (Cervus elaphus) from a National Wildlife Reserve near Toledo in central Spain were surveyed for Sarcocystis infection. A total of 61 deer were examined. Tissue compression and histology were used to examine samples from diaphragm and heart from each animal included in the study, and results from the two techniques and the two tissues were compared to determine the tissue and technique that provide the most accurate measure of prevalence and intensity. Prevalence and intensity were then compared between calves, yearlings and adults. Sarcocystis was detected in 59 (97%) of the 61 deer. Comparison between tissues showed that (a) prevalence based on histology was similar for heart and diaphragm, (b) prevalence based on compression was significantly higher for heart than for diaphragm and (c) intensity was significantly higher for heart than for diaphragm, regardless of the technique used. Comparison between techniques showed that (a) both techniques rendered similar prevalences and intensities of Sarcocystis infection with heart samples and (b) both techniques were not comparable with diaphragm samples (compression rendered lower prevalence but higher intensity than histology). Together these data suggest that heart is the preferable tissue for estimating prevalence and intensity, regardless of the technique used. A preliminary species identification of isolated cysts from three animals showed two morph types, corresponding to Sarcocystis cervicanis (syn. S. cf. grueneri; S. wapiti) in the heart and diaphragm of three animals and S. hjorti, only in the diaphragm of two animals. Given the different location of those morph types, both heart and diaphragm should be sampled and preferably assessed using histology to most reliably detect infection. Based on histology of heart, prevalence and intensity of Sarcocystis were significantly lower in calves than in yearlings or adults. PMID:26767167

  2. Effect of lunar phase on summer activity budgets of Rocky Mountain elk (Cervus elaphus nelsonii)

    Science.gov (United States)

    Rocky Mountain elk (Cervus elaphus) exist in a complex biological and social environment that is marked by necessary diurnal activities such as foraging, ruminating, and resting. It has long been understood that elk demonstrate circadian rhythms. One of the most predictable variables that could af...

  3. Effect of lunar phase on diurnal activity of Rocky Mountain Elk (Cervus Elaphus Nelsonii)

    Science.gov (United States)

    Rocky Mountain elk (Cervus elaphus nelsonii) are important components in many ecosystems across the western US and are integral with both Native American and contemporary western culture. They are prized by hunters and are the object of countless works of art. These magnificent creatures are studi...

  4. La herencia de una guerra perdida. La memoria multidireccional en Los rojos de ultramar de Jordi Soler

    Directory of Open Access Journals (Sweden)

    Elina Liikanen

    2013-12-01

    Full Text Available Los rojos de Ultramar (2004, by the Mexican author Jordi Soler, is a novel that looks into the memory of the Spanish Civil War and Franco’s dictatorship, and explores both individual and collective consequences of these events through the experience of exiles. The narrator of the novel, a fictional version of the author, is the grandson of a Spanish republican exile who decides to reconstruct his grandfather’s biography. The book shares many formal and thematic features with several recent Spanish memory novels, such as Soldados de Salamina by Javier Cercas and Mala gente que camina by Benjamin Prado, in which the historical research of a narrator-character functions as the motor of the narrative. However, Los rojos de ultramar contributes a novel point of view to the ongoing debate over the interpertation of the Spanish recent past from outside the national borders. Through the voice of the narrator, who grew up at the intersection of two cultures (the Mexican and the Catalan and two languages (Castilian and Catalan, Soler’s novel provides a transnational and multicultural perspective that bears resemblance to the model of multidirectional memory proposed by Michael Rothberg. The aim of this paper is, on the one hand, to identify the narrative features that Los rojos de ultramar shares with the memory novels by Spanish authors and, on the other hand, to discuss the particular contribution of this work that promotes cultural hybridity and uses the memory of a specific group (Spanish Republican exiles in an exemplary way in order to create solidarity between different cultural groups.

  5. Inhibición de la acumulación de rojo fenol por sulfametoxipiridazina en cortes de tejido renal

    OpenAIRE

    Sarmiento M., Jorge; Montes D., Gonzalo

    2011-01-01

    En relación con un trabajo anterior, en el cual se comprobó en el animal intacto la elevación de la concentración plasmática de penicilina cuando se había inyectado media hora antes sulfametoxipiridazina, el presente trabajo demuestra, en cortes de tejido renal adecuadamente conservados, que la capacidad de transporte del epitelio tubular renal para el rojo de fenol se inhibe en proporción a la concentración de sulfametoxipiridazina presente. Como el sistema enzimático responsable de la secre...

  6. Control biológico del piojo rojo de California, Aonidiella aurantii (Maskell) (Hemiptera: Diaspididae) y estrategias reproductivas de su principal enemigo natural Aphytis chrysomphali (Mercet) (Hymenoptera: Aphelinidae)

    OpenAIRE

    Pina Desfilis, Mª Tatiana

    2007-01-01

    RESUMEN Esta tesis describe la situación del control biológico del piojo rojo de California, Aonidiella aurantii (Maskell) (Hemiptera: Diaspididae), por parasitoides en la Comunidad Valenciana El piojo rojo de California es una de las plagas más importantes de cítricos en España. Esta plaga, a pesar de todos los tratamientos químicos que se realizan para su control, se encuentra por encima del umbral económico de daños. En este trabajo se constata, tras un muestreo realizado a lo lar...

  7. Sedici anni di censimenti del cervo sardo (Cervus elaphus corsicanus) nella riserva naturale WWF di Monte Arcosu

    OpenAIRE

    Murgia, Carlo; Murgia, Andrea; Deiana, Anna Maria

    2005-01-01

    This paper describes data collected about consistence, density and social structure of Sardinian deer (Cervus elaphus corsicanus Erxleben, 1777) subspecies of European deer (Cervus elaphus Linnaeus, 1758) from 1989 to 2004. The study area is located in the WWF Faunal Park of Monte Arcosu (south-western of Sardinia). The flora of the Reserve is typical Mediterranean vegetation. The data have been collected with two different methods, using both roaring census and direct observations. Results s...

  8. Bribri, nueva variedad de fríjol rojo pequeño para Costa Rica

    Directory of Open Access Journals (Sweden)

    Juan Carlos Hern\\u00E1ndez

    2001-01-01

    Full Text Available Entre 1996 y 1999 fue introducida y evaluada en Costa Rica la línea MD 23-24 que dio origen a la nueva variedad de frijol Bribri. La misma fue desarrollada por la Escuela Agrícola Panamericana-Zamorano y se originó de la cruza (RAB 310/XAN 155 X (DOR 391/POMPADOUR G. La variedad se caracteriza por presentar un grano pequeño de color rojo brillante, de hábito de crecimiento Tipo II-B, de porte erecto y ciclo vegetativo entre 76 y 80 días. Las dos principales zonas de vida donde se evaluó fueron la bh-T (bosque húmedo tropical y el bmh-P (bosque muy húmedo Premontano. En la mayoría de los lugares evaluados predominaron pequeñas explotaciones comerciales y suelos ultisoles de baja fertilidad. La variedad Bribri superó en rendimiento promedio, al testigo nacional en 17,2% y al testigo local en13,4%. Su producción fue superior en un 8,5% al promedio de rendimiento obtenido en todos los ensayos. La etapa de verificación y de validación se efectuó en nueve y once localidades respectivamente, con base en la tecnología empleada por los productores. Bribri superó en rendimiento a los testigos locales en el 67% de las parcelas en la fase de verificación (con un promedio de 15,5% más de kg/ha y en el 80% de las parcelas de validación (con un promedio de 7,5% mas de kg/ha. Mostró además tolerancia a la mustia hilachosa. (Thanatephorus cucumeris (A.B. Frank Donk. En el año 2000 se sembraron 100 ha de Bribri a nivel comercial en la Región Brunca

  9. Kajian kualitas daging rusa sambar (cervus unicolor) buru dan dipeliharaan secara intensif

    OpenAIRE

    Sihombing, Juli Mutiara

    2012-01-01

    JULI MUTIARA SIHOMBING: The Meat Quality Sambar Deer (Cervus unicolor) Hunting and Intensive maintained deer, guided by RISTIKA HANDARINI and HERLA RUSMARILIN. Information about sambar meat quality is still lacking, especially the comparison between Sambar deer hunting and intensively maintained. The purpose of this study to examine differences in the quality of game and deer venison reared intensively given feed with crude protein 16%. The research was conducted in deer captivity at Univ...

  10. Seasonal habitat selection of the red deer (Cervus elaphus alxaicus) in the Helan Mountains, China

    OpenAIRE

    Mingming Zhang; Zhensheng Liu; Liwei Teng

    2013-01-01

    We studied the seasonal habitat selection of the red deer, Cervus elaphus alxaicus Bobrinskii & Flerov, 1935, in the Helan Mountains, China, from December 2007 to December 2008. Habitat selection varied widely by season. Seasonal movements between high and low elevations were attributed to changes in forage availability, alpine topography, the arid climate of the Helan Mountains, and potential competition with blue sheep, Pseudois nayaur (Hodgson, 1833). The use of vegetation types varied sea...

  11. Detection of Rickettsia helvetica DNA from peripheral blood of Sika deer (Cervus nippon yesoensis) in Japan.

    Science.gov (United States)

    Inokuma, Hisashi; Seino, Nobutaka; Suzuki, Masatsugu; Kaji, Koichi; Takahashi, Hiroshi; Igota, Hiromasa; Inoue, Satoshi

    2008-01-01

    Partial nucleotide sequences of the citrate synthase and 17-kDa genes of Rickettsia helvetica were detected from peripheral blood samples of Sika deer (Cervus nippon yesoensis) in Hokkaido, Japan. Results suggest the presence of a rickettsiemia associated with R. helvetica. This is the first evidence of R. helvetica infection in Sika deer and indicates that this species may represent a potential reservoir host of R. helvetica in Japan. PMID:18263833

  12. Differential Immune Responses of Red Deer (Cervus elaphus) following Experimental Challenge with Mycobacterium avium subsp. paratuberculosis▿

    OpenAIRE

    Robinson, Mark; O'Brien, Rory; Mackintosh, Colin; Griffin, Frank

    2008-01-01

    Immune responses of red deer (Cervus elaphus) that presented with different levels of paucibacillary pathology were profiled to detail immune changes during the progression of Johne's disease. Immune responses were monitored using an immunoglobulin G1 (IgG1) antibody enzyme-linked immunosorbent assay (ELISA), a gamma interferon (IFN-γ) ELISA, and flow cytometry. Animals in the study were divided into outcome groups postmortem according to disease severity. All animals mounted IgG1 antibody an...

  13. Hybridisation between red deer (Cervus elaphus) and Japanese sika (C. nippon) on the Kintyre Peninsula, Scotland

    OpenAIRE

    Senn, Helen V.

    2009-01-01

    Hybridisation between introduced and endemic species causes conservation concerns, but also provides us with an opportunity to study the dynamics of gene flow between two species as they first meet. Japanese sika deer (Cervus nippon) were introduced to the British Isles at a number of locations at the beginning of the 20th century. In the intervening time, sika have spread and their range now extends across approximately 40% of Scotland, where they overlap with that of native red ...

  14. Určování domovského okrsku siky (Cervus nippon)

    OpenAIRE

    Janda, Jakub

    2012-01-01

    This Bachelor thesis deals with available methods of research leads to monitoring of sika deer (Cervus nippon nippon) home range, with preference for telelmetric research. The knowledges that are key for better understanding and approach to the sika deer behavior and life strategy – species that population is rising to the essential quantity. Quantity that is vital not only for management of this species but also for his influence to the forestry – harms on forest vegetation. In this th...

  15. Telemetrické sledování siky (Cervus nippon)

    OpenAIRE

    Dvořák, Stanislav

    2011-01-01

    In my thesis, I focused on the research of the spatial orientation of sika deer (Cervus nippon nippon) in Hradiste hunting using GPS devices. Research has been and still is carried on the forest Lomnica forest area. The first part is devoted to the description, morphology, biology, habitat and expansion of the sika deer, describe a device that is used to monitor and narcotization. The second part focuses on the experience I gained and assessed by telemetric monitoring and observation of this ...

  16. Haematological values of rusa deer (Cervus timorensis russa) in New Caledonia.

    Science.gov (United States)

    Audigé, L

    1992-11-01

    Blood samples were collected from 91 rusa deer (Cervus timorensis russa), immediately after being shot, to define their mean haematological values (red cell count, white cell count, differential leucocyte count, packed cell volume, haemoglobin concentration, mean cell volume, mean cell haemoglobin, and mean cell haemoglobin concentration). Male deer had a significantly higher red cell count and haemoglobin concentration, and a lower mean cell volume and mean cell haemoglobin content, than did female deer. PMID:1288471

  17. PENDUGAAN DAYA TAMPUNG RUSA LIAR (Cervus timorensis) DI PADANG RUMPUT MAR TAMAN NASIONAL WASUR MERAUKE

    OpenAIRE

    Bambang Tjahyono Hariadi; Thimotius Sraun

    2014-01-01

    The objective of this experiment was to know carrying capacity of rusa deer (Cervus timorensisi) at Mar, Wasur National Park Merauke district. The data collected were spesies of grasses, production each species and carrying capacity. The results showed species of grasses were Cynadon dactylon, Imperata cylindrica and Phragmites karka. Mar was dominated by Cynadon dactylon. The production of Cynodon dactylon was 2.183 kg/ha. The carryng capacity of rusa deer was 0.5 ha/head/year.

  18. Caracterización de un vidrio rojo medieval procedente de las vidrieras del Monasterio de las Huelgas de Burgos

    OpenAIRE

    Alonso, Mª P.; Capel, F. (F.); Valle Fuentes, F. J.; Pablos Martín, Araceli de; Ortega-Feliú, I.; Gómez-Tubío, B.; Respaldiza, M. A.

    2009-01-01

    [ES]: En el año 2007 se culminó el proceso de restauración integral de las vidrieras que cierran los ventanales de la Sala Capitular del Claustro de S. Fernando del Real Monasterio de Santa María la Real de las Huelgas de Burgos. Un vidrio rojo, de características peculiares, extraído durante el proceso de conservación-restauración de una de las vidrieras, se ha caracterizado mediante las técnicas de Microscopía óptica de luz reflejada (MOLR), Microscopía electrónica de emisión de ca...

  19. Breve historia de la traducción del «Libro rojo» de 2005 de la IUPAC

    OpenAIRE

    Miguel Ángel Ciriano; Pascual Ramón Polo

    2008-01-01

    La traducción, edición y publicación del libro «Nomenclatura de Química Inorgánica. Recomendaciones de la IUPAC 2005» («Libro rojo» de 2005) en español se realizó en tan sólo veinte meses tras la aparición de la versión original a finales de noviembre de 2005; fue la primera versión en lengua no inglesa que se publicó en el mundo. Para su traducción se utilizaron varios criterios lingüísticos —tales como respetar, hasta donde fuera posible, el DRAE, los diccionarios de la RACEFYN y el «Libro ...

  20. El amor en la literatura china : Una aproximación al Sueño en el pabellón rojo, de Cao Xueqin

    OpenAIRE

    Priego Casanova, Luis

    2012-01-01

    Análisis del tratamiento del amor en la novela Sueño en el Pabellón Rojo, de Cao Xueqin (dinastía Qing). Descripción del concepto de amor y emociones en la cultura china y su tradición literaria a través del argumento y las relaciones personales entre los personajes de la obra de Cao Xueqin.

  1. Late Quaternary distribution dynamics and phylogeography of the red deer ( Cervus elaphus) in Europe

    Science.gov (United States)

    Sommer, R. S.; Zachos, F. E.; Street, M.; Jöris, O.; Skog, A.; Benecke, N.

    2008-04-01

    Here we present spatial-temporal patterns for European late Quaternary red deer (Cervus elaphus), based on radiocarbon-supported evidence derived mainly from archaeological sites. This is followed by an overview of the recent phylogeography of this species using haplogroup studies of recent molecular data. The implications of the synthesis of palaeontological and genetic data are discussed and we propose that present day European red deer haplogroup distributions are best explained against the history of late Quaternary population contractions into and expansions from glacial refugia. Around 800 records of Cervus elaphus were assigned to the period covering the later part of the Last Glacial and the Early to Middle Holocene. Red deer becomes increasingly visible in faunal assemblages dated to late OIS-3 (<40.0 ka 14C BP). The species persisted throughout the LGM on the Iberian Peninsula, in adjacent regions of South-Western France (Gascony, Dordogne, Languedoc), on the Italian Peninsula, in the Balkans and Greece, and east of the Carpathians in Moldavia. We suggest that genetic exchange between the populations of the Balkans and the East of the Carpathians remained uninterrupted during the LGM. The expansion of red deer from its southern refugia into Central and Northern Europe begins rapidly at 12,500 14C BP. The expansion of red deer coincides with the sudden rise in temperature at the onset of Greenland Interstadial 1e and the dispersion of open birch woodland into the northern half of Europe. Radiocarbon supported records show a more or less universal distribution of Cervus elaphus across Europe following the Pleistocene/Holocene climatic change at 10.0 ka 14C BP for the first time. Molecular data and fossil record combined provide a clearer temporal and spatial pattern for the Lateglacial recolonisation process of the northern part of Europe.

  2. Parelaphostrongylus tenuis-associated meningoencephalitis in a sika deer (Cervus nippon).

    Science.gov (United States)

    Gerhold, Richard W; Keel, M Kevin; Arnold, Kim; Hotton, Doug; Beckstead, Robert B

    2010-01-01

    An adult, female, free-ranging, sika deer (Cervus nippon yakushimae) from Wicomico County, Maryland, USA, was found circling and having no fear of humans. The animal was euthanized and submitted for a postmortem exam. There were no gross lesions and the deer was negative for rabies. Microscopic examination revealed lymphoplasmacytic, neutrophilic, and eosinophilic meningoencephalitis with intralesional adult nematodes, larvae, and eggs consistent with nematodes in the family Protostrongylidae. Parelaphostrongylus tenuis was identified by polymerase chain reaction and DNA sequencing. To our knowledge, this is the first report of P. tenuis-associated encephalitis in a sika deer. PMID:20090046

  3. Surveillance of chronic wasting disease in sika deer, Cervus nippon, from Tokachi district in Hokkaido.

    Science.gov (United States)

    Kataoka, Natsumi; Nishimura, Masakazu; Horiuchi, Motohiro; Ishiguro, Naotaka

    2005-03-01

    Surveillance of chronic wasting disease (CWD) was conducted by performing Western blot analysis of tissue samples from 136 sika deer (Cervus nippon) killed by hunters in the Tokachi district of Hokkaido Island. No prion protein (PrPSc) associated with CWD was detected in any of the samples. To assess amino acid polymorphisms of the sika deer PrP gene, nucleotide sequencing of the PrP gene was performed. The only amino acid polymorphisms detected were 3 silent mutations at nucleotide positions 63, 225 and 408. These results suggest that sika deer in the Tokachi district are genetically homogeneous, and are not infected with CWD. PMID:15805745

  4. Complete mitochondrial genome sequence of northeastern sika deer (Cervus nippon hortulorum).

    Science.gov (United States)

    Shao, Yuanchen; Zha, Daiming; Xing, Xiumei; Su, Weilin; Liu, Huamiao; Zhang, Ranran

    2016-01-01

    The complete mitochondrial genome of the northeastern sika deer, Cervus nippon hortulorum, was determined by accurate polymerase chain reaction. The entire genome is 16,434 bp in length and contains 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region, all of which are arranged in a typical vertebrate manner. The overall base composition of the northeastern sika deer's mitochondrial genome is 33.3% of A, 24.5% of C, 28.7% of T and 13.5% of G. A termination associated sequence and several conserved central sequence block domains were discovered within the control region. PMID:24660928

  5. Complete mitochondrial genome sequence of tarim red deer (Cervus elaphus yarkandensis).

    Science.gov (United States)

    Shao, Yuanchen; Xing, Xiumei; Zha, Daiming; Yang, Fuhe

    2016-01-01

    The complete mitochondrial genome of the tarim red deer, Cervus elaphus yarkandensis, was determined by accurate polymerase chain reaction. The entire genome was 16,351 bp in length and contained 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region, all of which were arranged in a typical vertebrate manner. The overall base composition of the northeast sika deer's mitochondrial genome was 33.3% of A, 24.4% of C, 28.9% of T and 13.4% of G. A termination-associated sequence and several conserved central sequence block domains were discovered within the control region. PMID:24438284

  6. Isolation and characterization of Babesia pecorum sp. nov. from farmed red deer (Cervus elaphus)

    OpenAIRE

    Jouglin, Maggy; Fernández-de-Mera, Isabel G.; de la Cotte, Nathalie; Ruiz-Fons, Francisco; Gortázar, Christian; Moreau, Emmanuelle; Bastian, Suzanne; de la Fuente, José; Malandrin, Laurence

    2014-01-01

    The diversity of Babesia species infecting cervids in parts of central and southern Spain was analyzed by collecting blood from farmed red deer (Cervus elaphus). Babesia sp. was isolated in vitro from two red deer herds in Cádiz and Ciudad Real. The number of Babesia sp. carriers differed between the two herds: 36/77 in Cádiz and 1/35 in Ciudad Real. Hyalomma lusitanicum was the most prevalent tick species identified on the Cádiz farm vegetation and on sampled animals, and is therefore a cand...

  7. PENDUGAAN DAYA TAMPUNG RUSA LIAR (Cervus timorensis DI PADANG RUMPUT MAR TAMAN NASIONAL WASUR MERAUKE

    Directory of Open Access Journals (Sweden)

    Bambang Tjahyono Hariadi

    2014-06-01

    Full Text Available The objective of this experiment was to know carrying capacity of rusa deer (Cervus timorensisi at Mar, Wasur National Park Merauke district. The data collected were spesies of grasses, production each species and carrying capacity. The results showed species of grasses were Cynadon dactylon, Imperata cylindrica and Phragmites karka. Mar was dominated by Cynadon dactylon. The production of Cynodon dactylon was 2.183 kg/ha. The carryng capacity of rusa deer was 0.5 ha/head/year.

  8. Adrenal response to ACTH stimulation in Rusa deer (Cervus rusa timorensis).

    Science.gov (United States)

    van Mourik, S; Stelmasiak, T

    1984-01-01

    Resting cortisol values in immobilized mature Rusa stags (Cervus rusa timorensis) and the response to synthetic ACTH were investigated. The mean level of cortisol in mature Rusa stags was found to be 3.80 ng/ml (SD = 0.87, N = 18). Over the range 0.37-6.0 i.u. the adrenal response to ACTH challenge was linearly related to the log dose ACTH administered (r = 0.998). More than 6 i.u. of ACTH caused maximal stimulation of the adrenal gland. Rusa deer appear to be much more sensitive to ACTH administration than other species. PMID:6150796

  9. Reanimación con glóbulos rojos Rh positivo y sin prueba cruzada en emergencias médicas.

    Directory of Open Access Journals (Sweden)

    Armando Cortés

    2009-11-01

    Full Text Available INTRODUCCIÓN: Se presentan tres años de experiencia en el uso de concentrado de glóbulos rojos O Rh positivo sin cruzar para transfusión de emergencia en pacientes severamente lesionados e hipovolémicos en una clínica privada de Cali. MATERIALES Y MÉTODOS: La sangre se solicitó para pacientes con trauma, hemorragia intraoperatoria masiva inesperada, o ruptura de aneurisma. Los glóbulos rojos O Rh positivos es la primera elección para el soporte de pacientes que no pueden esperar sangre tipo específica o cruzada. La transfusión se ordenó ante signos clínicos de hemorragia clase III o clase IV en personas que no pudieron ser adecuadamente reanimadas con soluciones cristaloides. RESULTADOS: Entraron en el protocolo 119 pacientes y recibieron un total de 568 unidades de glóbulos rojos (4.77 unidades/paciente. No se presentó ningún efecto adverso. Ninguno de los pacientes presentó o desarrolló anti-D. Sólo 14 quienes eran Rh negativo, recibieron glóbulos rojos grupo O Rh positivo, siendo la mayoría de ellos hombres. No se presentó ninguna reacción hemolítica aguda o sensibilización en mujeres jóvenes; 38 (31.9% pacientes fallecieron dentro de las 24 horas del ingreso. Ninguna muerte fue atribuible a reacción transfusional o incompatibilidad sanguínea. Las complicaciones incluyen 2 (1.7% personas con disritmias, 4 (3.4% desarrollaron síndrome de dificultad respiratoria del adulto (SDRA y 7 (5.8% presentaron coagulación intravascular diseminada (CID . Ninguno de los casos de CID se relacionó con incompatibilidad transfusional. Los pacientes que sobrevivieron a las condiciones de emergencia pudieron recibir después sangre de su propio tipo sin inconvenientes. CONCLUSIONES: Los concentrados de glóbulos rojos O Rh positivos usados en la reanimación inmediata son seguros.

  10. Secondary forest succession and tree planting at the Laguna Cartagena and Cabo Rojo wildlife refuges in southwestern Puerto Rico.

    Science.gov (United States)

    Weaver, Peter L; Schwagerl, Joseph J

    2008-12-01

    Secondary forest succession and tree planting are contributing to the recovery of the Cabo Rojo refuge (Headquarters and Salinas tracts) and Laguna Cartagena refuge (Lagoon and Tinaja tracts) of the Fish and Wildlife Service in southwestern Puerto Rico. About 80 species, mainly natives, have been planted on 44 ha during the past 25 y in an effort to reduce the threat of grass fires and to restore wildlife habitat. A 2007 survey of 9-y-old tree plantings on the Lagoon tract showed satisfactory growth rates for 16 native species. Multiple stems from individual trees at ground level were common. A sampling of secondary forest on the entire 109 ha Tinaja tract disclosed 141 native tree species, or 25% of Puerto Rico's native tree flora, along with 20 exotics. Five tree species made up about 58% of the total basal area, and seven species were island endemics. Between 1998 and 2003, tree numbers and basal area, as well as tree heights and diameter at breast height values (diameter at 1.4 m above the ground), increased on the lower 30 ha of the Tinaja tract. In this area, much of it subject to fires and grazing through 1996, exotic trees made up 25% of the species. Dry forest throughout the tropics is an endangered habitat, and its recovery (i.e., in biomass, structure, and species composition) at Tinaja may exceed 500 y. Future forests, however, will likely contain some exotics. PMID:19205183

  11. Case 3018. Cervus gouazoubira Fischer, 1814 (currently Mazama gouazoubira; Mammalia, Artiodactyla): proposed conservation as the correct original spelling

    Science.gov (United States)

    Gardner, A.L.

    1999-01-01

    The purpose of this application is to conserve the spelling of the specific name of Cervus gouazoubira Fischer, 1814 for the brown brocket deer of South America (family Cervidae). This spelling, rather than the original gouazoubira, has been in virtually universal usage for almost 50 years.

  12. Seasonal habitat selection of the red deer (Cervus elaphus alxaicus in the Helan Mountains, China

    Directory of Open Access Journals (Sweden)

    Mingming Zhang

    2013-02-01

    Full Text Available We studied the seasonal habitat selection of the red deer, Cervus elaphus alxaicus Bobrinskii & Flerov, 1935, in the Helan Mountains, China, from December 2007 to December 2008. Habitat selection varied widely by season. Seasonal movements between high and low elevations were attributed to changes in forage availability, alpine topography, the arid climate of the Helan Mountains, and potential competition with blue sheep, Pseudois nayaur (Hodgson, 1833. The use of vegetation types varied seasonally according to food availability and ambient temperature. Red deer used montane coniferous forest and alpine shrub and meadow zones distributed above 2,000 m and 3,000 m in summer, alpine shrub and meadows above 3,000 m in autumn, being restricted to lower elevation habitats in spring and winter. The winter habitat of C. elaphus alxaicus was dominated by Ulmus glaucescens Franch. and Juglans regia Linnaeus, deciduous trees, and differed from the habitats selected by other subspecies of red deer. Cervus elaphus alxaicus preferred habitats with abundant vegetation coverage to open habitats in winter, but the reverse pattern was observed in summer and autumn. Red deer preferred gentle slopes (<10° but the use of slope gradient categories varied seasonally. Red deer avoidance of human disturbance in the Helan Mountains varied significantly by season. Information on red deer habitat selection can help understand the factors affecting seasonal movements and also support decision making in the management and conservation of red deer and their habitats.

  13. Prevalence and genetic diversity of Bartonella species in sika deer (Cervus nippon) in Japan.

    Science.gov (United States)

    Sato, Shingo; Kabeya, Hidenori; Yamazaki, Mari; Takeno, Shinako; Suzuki, Kazuo; Kobayashi, Shinichi; Souma, Kousaku; Masuko, Takayoshi; Chomel, Bruno B; Maruyama, Soichi

    2012-12-01

    We report the first description of Bartonella prevalence and genetic diversity in 64 Honshu sika deer (Cervus nippon centralis) and 18 Yezo sika deer (Cervus nippon yesoensis) in Japan. Overall, Bartonella bacteremia prevalence was 41.5% (34/82). The prevalence in wild deer parasitized with ticks and deer keds was 61.8% (34/55), whereas no isolates were detected in captive deer (0/27) free of ectoparasites. The isolates belonged to 11 genogroups based on a combination of the gltA and rpoB gene sequences. Phylogenetic analysis of concatenated sequences of the ftsZ, gltA, ribC, and rpoB genes of 11 representative isolates showed that Japanese sika deer harbor three Bartonella species, including B. capreoli and two novel Bartonella species. All Yezo deer's isolates were identical to B. capreoli B28980 strain isolated from an elk in the USA, based on the sequences of the ftsZ, gltA, and rpoB genes. In contrast, the isolates from Honshu deer showed a higher genetic diversity. PMID:22832020

  14. Molecular diversity of rumen bacterial communities from tannin-rich and fiber-rich forage fed domestic Sika deer (Cervus nippon) in China

    OpenAIRE

    Li, Zhi Peng; Liu, Han Lu; Li, Guang Yu; Bao, Kun; Wang, Kai Ying; Xu, Chao; Yang, Yi Feng; Yang, Fu He; Wright, André-Denis G.

    2013-01-01

    Background Sika deer (Cervus nippon) have different dietary preferences to other ruminants and are tolerant to tannin-rich plants. Because the rumen bacteria in domestic Sika deer have not been comprehensively studied, it is important to investigate its rumen bacterial population in order to understand its gut health and to improve the productivity of domestic Sika deer. Results The rumen bacterial diversity in domestic Sika deer (Cervus nippon) fed oak leaves- (OL group) and corn stalks-base...

  15. Breve historia de la traducción del «Libro rojo» de 2005 de la IUPAC

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Ciriano

    2008-12-01

    Full Text Available La traducción, edición y publicación del libro «Nomenclatura de Química Inorgánica. Recomendaciones de la IUPAC 2005» («Libro rojo» de 2005 en español se realizó en tan sólo veinte meses tras la aparición de la versión original a finales de noviembre de 2005; fue la primera versión en lengua no inglesa que se publicó en el mundo. Para su traducción se utilizaron varios criterios lingüísticos —tales como respetar, hasta donde fuera posible, el DRAE, los diccionarios de la RACEFYN y el «Libro rojo» de 1990 de la IUPAC, traducido por Bertello y Pico Marín en 2001— y un meticuloso plan de trabajo para evitar errores y abaratar los costes de edición. Hubo que vencer dificultades hasta lograr la traducción más apropiada de términos ingleses inexistentes en español y adaptar otros para su introducción en el castellano. Una vez finalizada la obra, fue revisada por expertos químicos españoles para unificar los términos más dudosos. Se acordó que la palabra inglesa «tungsten» se traduciría únicamente por wolframio para homenajear a los verdaderos descubridores de este elemento: los hermanos Juan José y Fausto Delhuyar. ---------------------------------------------- Brief history of the IUPAC "Red Book" 2005 translation. The translation, editing and publishing of the book "Nomenclature of Inorganic Chemistry. IUPAC Recommendations 2005" ("Red Book" 2005 into Spanish was accomplished in only twenty months after the appearance of the original version in late November 2005, and it was the first non-English language version published in the world. For this purpose, several linguistic criteria were used as far as possible, such as to have a respect for the DRAE, the dictionaries of RACEFYN, and the IUPAC "Red Book" 1990, translated by Bertello and Pico Marín in 2001. In addition, a meticulous plan of work to avoid errors and lowering costs of editing was followed. Translators had to overcome some difficulties to

  16. PRÁCTICAS AGROECOLÓGICAS PARA DISMINUIR LAS AFECTACIONES DEL ARROZ ROJO. ROTACIÓN CON GIRASOL (Heliantus annus L Y LABOREO DEL SUELO

    Directory of Open Access Journals (Sweden)

    G. S. Díaz

    2006-01-01

    Full Text Available En la Estación Experimental del Arroz Los Palacios del Instituto Nacional de Ciencias Agrícolas (INCA, en el período 1999-2001, se desarrolló el presente trabajo bajo diseño experimental de Bloques al Azar con cuatro repeticiones, donde se probaron dos nuevas prácticas agroecológicas como solución alternativa al control químico del arroz rojo. La rotación anual arroz-girasol fue común a ambas prácticas; después del cultivo del girasol, el suelo se sometió a diferentes manejos para disminuir las reservas de semillas del arroz rojo presentes. En una de las variantes el laboreo se realizó en seco, se provocaron germinaciones y se eliminaron las plantas. En la otra se inundó el suelo por 30 días, se provocó la germinación y se preparó el suelo por la tecnología de fangueo continuo. Los resultados se compararon con el manejo del suelo dado en la práctica productiva, consistente en: desinfección química y preparación sin efectuar control del arroz rojo. La rotación arroz-girasol y el laboreo del suelo en seco eliminaron más del 98 % de la mezcla e incrementaron el rendimiento del arroz comercial de 1.1 a 5.1 t.ha-1. La ganancia obtenida superó los 1 200.00 pesos.ha-1.

  17. Diets of Hangul Deer Cervus elaphus hanglu (Cetartiodactyla: Cervidae in Dachigam National Park, Kashmir, India

    Directory of Open Access Journals (Sweden)

    G.M. Shah

    2009-07-01

    Full Text Available Seasonal variations in the diets of Hangul Deer Cervus elaphus hanglu in Dachigam National Park (DNP were determined by analyzing 95 freshly collected pellet samples. The pellets were collected along well defined transects during a two year study from January 2005 to December 2006. The diets showed marked seasonal variations. The spring diet was constituted by forbs (45.2%, shrubs (24%, grasses (20% and climbers (10.7%. In summer forbs accounted for 42.7% of the diet, trees 38%, grasses 14.3% and shrubs 4.8%. Except the lone representation of forb species (5.6% the autumn diet was mainly represented by shrubs (75% and trees (19.4%. The winter diet was constituted by trees (35.6%, shrubs (28.6%, forbs (21.3%, grasses (8.6% and climbers (5.8%.

  18. Nutritional evaluation of the lipid fraction of Iberian red deer (Cervus elaphus hispanicus) tenderloin.

    Science.gov (United States)

    Quaresma, M A G; Trigo-Rodrigues, I; Alves, S P; Martins, S I V; Barreto, A S; Bessa, R J B

    2012-12-01

    The meat lipid fraction of psoas major muscle from 20 adult (10 males and 10 females) feral Iberian red deer (Cervus elaphus hispanicus) was characterized by quantification of total fat, total cholesterol, vitamin E and fatty acid (FA) composition, including detailed trans octadecenoate isomers and conjugated linoleic acid (CLA) isomeric profile. The total lipid content revealed a very lean meat (0.99 g/100g of meat), with total cholesterol content averaging 55.6 mg/100g of muscle. The FA profile displayed a very high PUFA level for ruminant meat (30.2g/100g FA). The 18:2 cis-9,trans-11 content was fairly low (0.26% of total FA) compared with other ruminant meats. The comparison of stags and hinds showed more similarities than differences. Nevertheless, hinds displayed superior contents of α-tocopherol and trans MUFA and a better n-6/n-3 ratio than stags. PMID:22695295

  19. The complete mitochondrial genome of sika deer Cervus nippon (Cetartiodactyla: Cervinae) South Anhui population.

    Science.gov (United States)

    Pan, Hong-Chun; Fang, Hong-Yan; Jin, Can; Liu, Lei

    2014-04-01

    The complete mitochondrial genome of sika deer (Cervus nippon) South Anhui population is a circular molecule of 16,429 bp in length, containing 13 protein-coding genes, 2 ribosomal RNAs, 22 transfer RNAs and a control region. The A + T content of the overall base composition of H-strand is 62% (T: 28.7%; C: 24.6%; A: 33.3%; G: 13.4%). ND2, ND3 and ND5 genes begin with ATA as start codon, ND4L gene begins with GTG as start codon, while other nine protein-coding genes start with a typical ATG initiation codon. ND1, COI, COII, ATP8, ATP6, ND4L, ND5 and ND6 genes are terminated with TAA as stop codon, ND2 ends with TAG, COIII, ND3 and ND4 ends with T, Cyt b ends with AGA. PMID:23570529

  20. Complete mitochondrial genome of Cervus elaphus songaricus (Cetartiodactyla: Cervinae) and a phylogenetic analysis with related species.

    Science.gov (United States)

    Li, Yiqing; Ba, Hengxing; Yang, Fuhe

    2016-01-01

    Complete mitochondrial genome of Tianshan wapiti, Cervus elaphus songaricus, is 16,419 bp in length and contains 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region. The phylogenetic trees were reconstructed with the concatenated nucleotide sequences of the 13 protein-coding genes using maximum parsimony (MP) and Bayesian inference (BI) methods. MP and BI phylogenetic trees here showed an identical tree topology. The monopoly of red deer, wapiti and sika deer was well supported, and wapiti was found to share a closer relationship with sika deer. Tianshan wapiti shared a closer relationship with xanthopygus than yarkandensis. Rusa unicolor and Rucervus eldi were given a basal phylogenetic position. Our phylogenetic analysis provided a robust phylogenetic resolution spanning the entire evolutionary relationship of the subfamily Cervinae. PMID:24725059

  1. Two potentially zoonotic parasites infecting Philippine brown deer (Cervus mariannus desmarest, 1822 in Leyte Island

    Directory of Open Access Journals (Sweden)

    Harvie Potot Portugaliza

    2015-12-01

    Full Text Available This case report describes the necropsy findings of two potentially zoonotic parasites infecting the Philippine brown deer (Cervus mariannus in Leyte Island, Philippines. A female deer aging approximately 5-year was presented for necropsy to the Diagnostic Laboratory at the College of Veterinary Medicine, Visayas State University. Gross pathology was recorded and the selected organs having lesion were collected for histopathological studies. Results showed severe necrotizing lesions in the nasal and palatal areas, infestation of calliphorid maggots, hepatic fibrosis, cholangitis, cholecystitis, lung atelectasis and duodenitis. Heavy ruminal fluke infection was also observed. Two potentially zoonotic parasites namely Fasciola gigantica and Sarcocystis spp. were identified. The Philippine brown deer appears to have a role in transmission and amplification of zoonotic parasites, and can also be threatened by diseases caused by the parasites.

  2. Malignant catarrhal fever in farmed Rusa deer (Cervus timorensis). 2. Animal transmission and virological studies.

    Science.gov (United States)

    Westbury, H A; Denholm, L J

    1982-03-01

    A disease with clinical signs and histological lesions similar to malignant catarrhal fever in cattle was transmitted from Rusa deer (Cervus timorensis) to rabbits. This was accomplished on 3 separate occasions, and the disease was serially passaged in rabbits up to 11 times. The clinical signs in affected rabbits were pyrexia, depression, anorexia, mucopurulent conjunctivitis, nasal discharge and diarrhoea. These signs were seen in 27 of 38 inoculated rabbits with the mean incubation period being 12 days (range 8 to 20 days). Histologically, affected rabbits exhibited mononuclear perivascular cuffing and vasculitis in the brain, heart, liver and kidney. Lymph nodes and spleen showed destruction and loss of mature lymphocytes and lymphoid follicles and an increased number of large lymphoblastoid cells. These clinical signs and lesions were not detected in control rabbits. The disease was not transmitted to cattle, sheep, guinea pigs or mice, nor was an agent isolated in cattle, deer or rabbit tissue cultures, or in chicken embryos. PMID:7115234

  3. Serum biochemical values of rusa deer (Cervus timorensis russa) in New Caledonia.

    Science.gov (United States)

    Audigé, L

    1992-11-01

    Blood samples were collected from 91 rusa deer (Cervus timorensis russa), immediately after being shot. Serum mean biochemical values from shot deer are presented for blood urea nitrogen, creatinine, creatine kinase, alanine aminotransferase, aspartate aminotransferase, alkaline phosphatase, total bilirubin, total protein, albumin, calcium, and phosphorus. Mean total protein and albumin increased with age. There was an age-associated increase of gamma globulins. Mean creatine kinase activity and creatinine, albumin and phosphorus concentrations were higher in stags than in hinds. Pregnant hinds had lower mean creatine kinase activity and phosphorus and higher mean alanine aminotransferase and total protein than non-pregnant hinds. Mean calcium concentration increased when deer were agitated before bleeding. PMID:1288472

  4. An outbreak of malignant catarrhal fever in young rusa deer (Cervus timorensis).

    Science.gov (United States)

    Tomkins, N W; Jonsson, N N; Young, M P; Gordon, A N; McColl, K A

    1997-10-01

    On the basis of clinical signs and histological findings eight 9-month-old male rusa deer (Cervus timorensis) were diagnosed with sheep associated-malignant catarrhal fever. Following a variable course involving rectal temperatures around 40.5 degrees C, depression, inappetence, diarrhoea, corneal opacity and hypopyon all animals died or were euthanased over a 5-week period. Severe multifocal vasculitis, mainly periglomerular and in the arcuate vessels were consistent histological findings which in the past have been adequate to confirm clinical diagnosis of sheep associated-malignant catarrhal fever. A nested polymerase chain reaction test has been used to detect a sheep associated-malignant catarrhal fever PRC product, 238 base-pairs in size, in DNA extracted from lymphocyte preparations. The result supported the diagnosis of sheep associated-malignant catarrhal fever in these deer. PMID:9406629

  5. Evaluación de distintas estratégias de manejo químico del piojo rojo de California, Aonidiella aurantii (Maskell)

    OpenAIRE

    Tena Barreda, Alejandro; Catalán Estellés, José; Vanaclocha, Pilar; Urbaneja, Pablo; Jacas Miret, Josep Anton; Urbaneja, Alberto

    2011-01-01

    El piojo rojo de California, Aonidiella aurantii, es una plaga clave en el cultivo de los cítricos. Por lo general, esta plaga se combate realizando una aplicación fitosanitaria en primera generación y, si es necesario, otra en segunda generación alternando los insecticidas clorpirifos y piriproxifén. En este trabajo se han evaluado diversas estrategias de control basadas en la utilización de dos insecticidas, piriproxifén y spirotetramat, aplicados en dos épocas disti...

  6. Estabilidad en el almacenamiento congelado de rebanadas de lomo de atún rojo (Thunnus sp.) empacadas en atmósfera modificada con CO2

    OpenAIRE

    Myrna Luisa Medina Bracamonte; María Andreína Guerra Hidalgo; Marinela Barrero

    2014-01-01

    La disponibilidad atún rojo fresco, entero y rebanado, como todo producto pesquero fresco está restringida para los consumidores en zonas distantes a los centros de producción por su estabilidad limitada en el almacenamiento. Por ello la industria pesquera en general, en la época de mayor producción, recurre a la congelación para conservar el excedente de producción, y al empacado para protegerlo del ambiente frío y seco del congelador, evitar su deshidratación y “quemaduras por frío”. El sur...

  7. Aplicación de la cianobacteria Spirulina sp. en la remoción y recuperación del colorante rojo congo de muestras acuosas.

    OpenAIRE

    MADRIGALES UBALDO, J.R.; SÁENZ-TAVERA, I.C.; LIÑÁN MONTES, ADRIANA; SOTO REGALADO, E.; CERINO CÓRDOVA, F.; GARCÍA REYNAR, R.B.; GARZA GONZÁLEZ, MA. TERESA

    2011-01-01

    En este trabajo se utilizó la biomasa de Cianobacteria Spirulina sp. en un sistema Bach, para remover el colorante ácido Rojo Congo (RC). Se estudió el efecto de variables de operación tales como dosis de biomasa. tiempo de contacto pH inicial y temperatura. Las mejores condiciones de operación para la remoción de Re fueron: dosis de biomasa de 1 gIL, pH 2, temperatura de 25 oC y tiempo de contacto de 2 horas. Los datos experimentales del equilibrio de biosorción se ajus1aron mejor al modelo ...

  8. Sistemas agroforestales con cedro rojo, cedro nogal y primavera, una alternativa para el desarrollo de plantaciones forestales comerciales en los Tuxtlas, Veracruz, México

    OpenAIRE

    López-Sánchez, E.; M.A. Musálem

    2007-01-01

    El presente trabajo establece las bases para la instrumentación de plantaciones forestales comerciales (PFC) por medio de sistemas agroforestales (SAF) como alternativa para un sistema de producción sustentable. Propone los estándares para el diseño, establecimiento y manejo de los principales sistemas agroforestales con referencia a la región de Los Tuxtlas, Veracruz, que incluyen dentro de sus componentes arbóreos cedro rojo (Cedrela odorata L.), cedro nogal (Juglans pyriformis Lie...

  9. Microencapsulación de tomate de árbol rojo (solanum betaceum cav.), mediante spray drying para aplicación en productos lácteos

    OpenAIRE

    Revelo Vargas, Danilo Andrés

    2014-01-01

    El proceso de microencapsulación por spray drying de extractos acuosos de tomate de árbol rojo (Solanum betaceum Cav.) se evaluó utilizando como material de partida el endocarpio (SE) de la fruta y la combinación de mesocarpio y endocarpio (ME) como una alternativa de generación de productos con valor agregado a partir de esta fruta para su utilización en la industria de alimentos. La encapsulación se realizó en un spray-dryer Lab Plant a condiciones optimizadas y con variación...

  10. MINERALIZACIÓN DEL NITRÓGENO DE LA Canavalia ensiformis EN UN SUELO FERRALÍTICO ROJO DE LA HABANA

    OpenAIRE

    Gloria M. Martín; Rivera, R

    2004-01-01

    Para determinar la cantidad de nitrógeno que se libera o inmoviliza durante la descomposición de la Canavalia ensiformis, se ejecutaron dos experimentos en un suelo Ferralítico Rojo. En el primer experimento, llevado a cabo en condiciones de laboratorio, se empleó el método de incubación aeróbica (a temperatura y humedad constantes) y se evaluó la velocidad de mineralización de la Canavalia ensiformis, comparada con dos testigos: el control (suelo) y un tratamiento que recibió 75 ppm N-urea. ...

  11. ESTUDIO DE ALGUNOS GÉNEROS MICROBIANOS ASOCIADOS A DIFERENTES VARIEDADES DE TRIGO (Triticum aestivum L.) EN SUELO FERRALÍTICO ROJO

    OpenAIRE

    Annia Hernández; Plana, R.; Gloria M. Martín; J. L. Santander

    2002-01-01

    Se estudiaron los géneros bacterianos predominantes en la rizosfera de cuatro variedades de trigo (Triticum aestivum L.) crecido en un suelo Ferralítico Rojo. También se evaluó la quimioatracción de algunas rizobacterias hacia los exudados radicales de este cultivo. Se utilizó el Modelo Espermosférico para el aislamiento y los tubos colectores y la cámara de quimiotaxis modificada para la evaluación del efecto quimiotáctico de los exudados radicales. Los resultados obtenidos demostraron que e...

  12. Determinación de las características dimensionales y distribución de los cafetos variedad Caturra Rojo en condiciones de ladera

    OpenAIRE

    Benjamín Gabriel Gaskins Espinosa; Idalberto Macías Socarrás; Johann Mejías Brito

    2013-01-01

    En Cuba se trabaja desde la década de los 80 en el estudio de la cosecha selectiva de café mediante vibraciones, para la cual es necesario conocer las características dimensionales de las plantas de cafetos, por lo que el presente trabajo tiene como objetivo determinar las características dimensionales y su distribución en el área experimental de la variedad Caturra Rojo; para lo cual se determinaron las dimen- siones principales que caracterizan dicho cultivo y se hicieron análisis estadísti...

  13. Authenticity control of game meat products--a single method to detect and quantify adulteration of fallow deer (Dama dama), red deer (Cervus elaphus) and sika deer (Cervus nippon) by real-time PCR.

    Science.gov (United States)

    Druml, Barbara; Grandits, Stephanie; Mayer, Walter; Hochegger, Rupert; Cichna-Markl, Margit

    2015-03-01

    This contribution presents a single real-time PCR assay allowing the determination of the deer content (the sum of fallow deer (Dama dama), red deer (Cervus elaphus) and sika deer (Cervus nippon)) in meat products to detect food adulteration. The PCR assay does not show cross-reactivity with 20 animal species and 43 botanical species potentially contained in game meat products. The limit of quantification is 0.5% for fallow deer and red deer and 0.1% for sika deer. The deer content in meat products is determined by relating the concentration obtained with the deer PCR assay to that obtained with a reference system which amplifies mammals and poultry DNA. The analysis of binary meat mixtures with pork, a meat mixture containing equal amounts of fallow deer, red deer and sika deer in pork and a model game sausage showed that the quantification approach is very accurate (systematic error generally <25%). PMID:25306377

  14. Perturbación del drenaje venoso del territorio del tronco venoso braquiocefálico y ojo rojo en enfermo con insuficiencia renal crónica en hemodiálisis

    OpenAIRE

    Coutinho, I; Santos, C.; Penha, D; Ferreira, M; Madeira, C; Bernardo, M.

    2014-01-01

    Introducción: Pacientes en diálisis son más susceptibles a colocación de catéteres venosos centrales y en consecuencia la estenosis de vena central secundaria. Se relata un caso de un paciente en hemodiálisis con ojos rojos, que ha condicionado un diagnóstico diferencial con patologías que causan ojos rojos. Caso clínico: Hombre, 60 años, raza negra, con antecedentes de hipertensión y insuficiencia renal de etiología nefroesclerotica, en hemodiálisis desde hace 20 años. Historial de...

  15. Caracterización de la reacción citoquímica de Mycobacterium tuberculosis con rojo neutro. Correlación con el contenido de sulfolípido

    OpenAIRE

    Soto Ospina, Carlos Yesid

    2003-01-01

    CARACTERIZACIÓN DE LA REACCIÓN CITOQUÍMICA DE Mycobacterium tuberculosis CON ROJO NEUTRO. CORRELACIÓN CON EL CONTENIDO DE SULFOLÍPIDO La virulencia de M. tuberculosis se ha relacionado con diversas características fenotípicas y entre las menos exploradas se encuentran las reacciones citoquímicas con diferentes colorantes básicos. Los estudios más prometedores en este campo han sido los que describen la tinción de las cepas virulentas de M. tuberculosis con rojo neutro (RN). El principal objet...

  16. Observations on the eruption of the permanent incisor teeth of farmed Javan rusa deer (Cervus timorensis russa) in New Caledonia.

    Science.gov (United States)

    Bianchi, M; Hurlin, J C; Lebel, S; Chardonnet, P

    1997-08-01

    The eruption of the permanent incisor teeth of 14 farmed Javan rusa deer (Cervus timorensis russa) of known birth date and their live weights were observed about every 2 weeks from 12 to 30 months of age. The permanent incisor pattern was 11, 14-17 months; 12, 18-23 months; 13, 20-26 months; and 14, 22-27 months. There was no significant relationship between body weight and timing of permanent incisor eruption. PMID:16031978

  17. Spatial Ecology and Population Dynamics of Tule Elk (Cervus elaphus nannodes) at Point Reyes National Seashore, California

    OpenAIRE

    Cobb, McCrea Andrew

    2010-01-01

    The tule elk (Cervus elaphus nannodes) was reintroduced to Point Reyes National Seashore, California in 1978. After exhibiting irruptive growth for 20 years, elk abundances have fluctuated. Three subpopulations of elk currently inhabit Pt. Reyes: a fenced subpopulation at high density; a free-ranging subpopulation in designated wilderness at low density; and a free-ranging subpopulation on active ranchland at low density. Little is known about the spatial ecology and population dynamics of...

  18. Los dibujos rojos de estilos paleolítico de la Cueva de La Haza (Ramales de la Victoria, Cantabria : estudio monográfico

    Directory of Open Access Journals (Sweden)

    García Diez, Marcos

    2007-01-01

    Full Text Available La revisión del conjunto iconográfico de estilo paleolítico de la Cueva de La Haza permite ofrecer una visión diferente hasta la ahora considerada. La prospección intensiva de las paredes ha permitido localizar nuevos dibujos rojos, asi como reinterpretar formalemnte algunos de los ya conocidos. Actualmente se identifican 11 motivos zoomorfos (4 cabras, 3 caballos, 2 uros, 1 cervino y 1 indeterminado, 2 geométricos (1 rectangular y 1 triangular, 2 lineales y 13 concentraciones de color rojo. El presente estudio, realizado con carácter monográfico, analiza el conjunto temático, la ejecución técnica, los formatos anatómicos y los modos del trazado (tipo de líneas y convenciones la perspectiva, la tipometría, la implantación de los motivos en el espacio subterraneo y en el soporte, y las agrupaciones. Por último, se analiza y reflexiona sobre el proceso gráfico, la cronología, el valor de los dibujos en relación a la discusión sobre los territorios gráficos y el significado.

  19. Desarrollo del ensilado del alga Gracilaria chilensis para la alimentación del abalón rojo Haliotis rufescens

    Directory of Open Access Journals (Sweden)

    Alfonso Mardones

    2015-05-01

    Full Text Available En Chile, el principal insumo usado como alimento para abalones son las algas Gracilaria chilensis y Macrocystis pyrifera. Estas algas experimentan una notable baja de disponibilidad en otoño e invierno, lo cual trae consigo un aumento considerable de los precios, al tener que depender del abastecimiento desde áreas cada vez más alejadas de los centros de cultivo de abalones y, eventualmente, generando impactos ecológicos indirectos en sus poblaciones. El objetivo fue elaborar y evaluar un ensilado del alga G. chilensis para la alimentación de abalón rojo (Haliotis rufescens, determinando la cantidad de lixiviados generados durante el proceso, el cambio en la composición proximal del alga, la preferencia y consumo del abalón rojo de ensilado de G. chilensis. Se logró un producto ensilado de buenas características físicas, químicas y de conservación, así como una buena aceptación por parte del abalón.

  20. ABONOS VERDES E INOCULACIÓN MICORRÍZICA DE POSTURAS DE CAFETO SOBRE SUELOS FERRALÍTICOS ROJOS LIXIVIADOS

    Directory of Open Access Journals (Sweden)

    Ciro Sánchez Esmoris

    2011-01-01

    Full Text Available Con el objetivo de evaluar el manejo de los abonosverdes en la producción de posturas micorrizadas de cafetosobre suelos Ferralíticos Rojos Lixiviados se sembraron ycaracterizaron Sorgum vulgare, Crotalaria juncea y Canavaliaensiformis, incorporándose a los 70 días en el suelo yobteniéndose diferentes sustratos (SAV, sobre los cuales seestudió la respuesta de las posturas a la inoculación de unacepa eficiente de HMA (G. intraradices, en un diseño completamente aleatorizado con arreglo factorial (5x2 eincluyendo los tratamientos de suelo y suelo/humus de lombriz(3/1. Con posterioridad se estudió la efectividad de la inoculacióncon G. intraradices sobre otros sustratos conformados poradiciones de humus de lombriz al suelo con sorgo incorporado(SAV, en relaciones 9/1, 7/1 y 5/1 SAV/humus de lombriz,incluyendo además los tratamientos SAV, suelo/humus de lombriz(3/1 y suelo, mediante un arreglo factorial (6 x 2. Se encontraronlas mayores producciones de masa seca y extracciones de N, Py K con el sorgo, seguida por la crotalaria. Si bien los abonosverdes incrementaron ligeramente la micorrización nativa delas posturas, siempre se encontró una significativa respuestadel cafeto a la inoculación micorrízica en presencia de cualesquierade los sustratos con abonos verdes incorporados (SAV; noobstante en este tipo de suelo la utilización conjunta de losabonos verdes y la inoculación micorrízica del cafeto no lograronde por si garantizar un óptimo crecimiento de las posturas,siendo necesaria la adición de cantidades complementarias dehumus de lombriz en relación 7/1 sobre el sorgo incorporado,así como la inoculación de las posturas para obtener unamicorrización efectiva y posturas vigorosas de cafeto.

  1. Mejoramiento genético del frijol rojo y negro mesoamericano para Centroamérica y El Caribe

    Directory of Open Access Journals (Sweden)

    Juan C. Rosas

    2000-01-01

    Full Text Available La producción de frijol en Centroamérica es llevada a cabo mayormente en laderas de suelos marginales, limitada por diversos factores bióticos y abióticos. Más de 350,000 t de este grano se producen en cerca de 0,5 millones de hectáreas, con rendimientos promedios de 678 kg/ha. La mayoría de los productores de frijol utilizan bajos insumos y muy pocas fincas están mecanizadas. El autoconsumo es alto; sin embargo, una alta proporción de este grano es comprado por intermediarios. En Honduras, el frijol es el sétimo cultivo en valor económico y es el de mayor rentabilidad entre el maíz, arroz y sorgo. Las dos clases comerciales más importantes en Centroamérica son el frijol rojo y negro pequeños (raza Mesoamérica. El mejoramiento de estos tipos de frijol se ha enfocado en el desarrollo de resistencia a enfermedades (mosaico común, mosaico dorado, antracnosis, mancha angular, roya, mustia hilachosa y bacteriosis común e insectos (principalmente picudo de la vaina; y tolerancia a baja fertilidad, sequía y calor. Programas adecuados de hibridación, evaluación y selección son usados para el desarrollo de cultivares con resistencia múltiple, alto rendimiento, buena adaptación y aceptación comercial. La ampliación de la base genética se obtiene usando fuentes de germoplasma Andino y Mesoamericano en la etapa de hibridación. La selección simultánea por varios caracteres y pruebas multilocalidades son utilizadas. Los viveros y ensayos de adaptación y rendimiento de líneas avanzadas son distribuídos a países de Centroamérica, México, y El Caribe. Las pruebas y validaciones en fincas y la liberación de variedades, son efectuadas por los programas nacionales de frijol de los países miembros de PROFRIJOL, en colaboración con el Zamorano, CIAT y el Bean/Cowpea CRSP

  2. Haematological and serum biochemical reference values in free-ranging red deer (Cervus elaphus atlanticus

    Directory of Open Access Journals (Sweden)

    Olav Rosef

    2004-04-01

    Full Text Available Analyses of haematological and biochemical constituents were carried out on the Norwegian subspecies of free-ranging red deer (Cervus elaphus atlanticus. All animals were captured from January to March by using a mixture of xylazine and tiletamin-zolazepam. Immobilisation was performed with plastic projectile syringes fired from a dart gun. Fourteen haematological parameters were analysed. There were no differences in the values between hinds and stags and between adults and calves (P > 0.01. Of the 22 biochemical compounds investigated there was a significant difference (P < 0.01 between calves and adults for lactate dehydrogenase (LD, globulin, beta globulin, gamma globulin, and the minerals Na, K, Mg, Zn, Ca, and P. Differences (P < 0.01 between hinds and stags were found in cholesterol, gamma glutamyl transferase (GGT, alpha-1 globulin, alpha-2 globulin and Cu. The blood values determined in this study can be used as reference values for this red deer subspecies immobilised with a mixture of xylazine-tiletamin-zolazepam for health control and diagnosis of diseases.Abstract in Norwegian /Sammendrag:Hematologiske og biokjemiske parametere er analysert på norsk frittlevende hjort (Cervus elaphus atlanticus. Hjorten ble immobilisert i tidsrommet januar til mars ved hjelp av et spesialgevær ladet med plast kanyler som inneholdt en blanding av xylazin og tiletamin-zolazepam. Det var ingen forskjeller i de14 undersøkte hematologiske verdiene mellom hinder, kalver og bukker (P>0,01. Av de 22 biokjemiske parametrene som ble undersøkt var det en signifikant forskjell mellom kalver og voksne (P<0,01 når det gjelder laktat dehydrogenase, globulin, beta globulin, gamma globulin og mineralene Na, K, Mg, Zn, Ca og P. Det var en signifikant forskjell mellom hinder og bukker (P<0.01 på parametrene kolesterol, gamma glutamyl transferase, alfa-1 globulin, alfa-2 globulin og Cu. Blodverdiene som ble målt i dette studiet kan bli brukt som referanseverdier

  3. Estabilidad en el almacenamiento congelado de rebanadas de lomo de atún rojo (Thunnus sp. empacadas en atmósfera modificada con CO2

    Directory of Open Access Journals (Sweden)

    Myrna Luisa Medina Bracamonte

    2014-12-01

    Full Text Available La disponibilidad atún rojo fresco, entero y rebanado, como todo producto pesquero fresco está restringida para los consumidores en zonas distantes a los centros de producción por su estabilidad limitada en el almacenamiento. Por ello la industria pesquera en general, en la época de mayor producción, recurre a la congelación para conservar el excedente de producción, y al empacado para protegerlo del ambiente frío y seco del congelador, evitar su deshidratación y “quemaduras por frío”. El surgimiento del Empacado en Atmósfera Modificada como alternativa para incrementar la vida útil de productos alimenticios despertó la inquietud de evaluar la estabilidad de rebanadas de lomo de atún rojo (Thunnus sp. fresco, congeladas y empacadas con 100 % de CO2 durante su almacenamiento a las temperaturas convencionales para su distribución y venta, -10 y -18 ºC, evaluando la estabilidad química, física, microbiológica y sensorial de las rebanadas de lomo de atún rojo durante ≈ 4 meses de almacenamiento congelado. El 50 % de las rebanadas se congeló a -10 ºC (Tratamiento 1 y el 50 % restante a -18 ºC (Tratamiento 2. Las rebanadas congeladas se empacaron individualmente, el 50 % en atmósfera de 100 % de CO2 conservando la proporción 1:2 (rebanada:gas y el 50 % restante en atmósfera de aire. Se almacenaron a la temperatura correspondiente: Tratamiento 1 a -10 ºC y Tratamiento 2 a -18 ºC durante 111 días. Al final del almacenamiento el tratamiento P2 (100 % CO2 ofreció mejor barrera a la pérdida de humedad, favoreció la estabilidad de la fracción de proteínas solubles en solución salina. Las muestras P2 tuvieron mayor aceptación sensorial, fueron las más oscuras y rojas, con menor recuento microbiológico, coincidiendo con el menor contenido en bases volátiles totales. A -10 ºC la atmósfera de 100 % de CO2 no evitó la “quemadura por frío” y los panelistas percibieron el “olor a pescado”.

  4. Mineralogical, IR-spectral and geochemical monitoring of hydrothermal alteration in a deformed and metamorphosed Jurassic VMS deposit at Arroyo Rojo, Tierra del Fuego, Argentina

    Science.gov (United States)

    Biel, C.; Subías, I.; Acevedo, R. D.; Yusta, I.; Velasco, F.

    2012-04-01

    The Arroyo Rojo Zn-Pb-Cu volcanogenic massive sulfide deposit is the main deposit of the Fin del Mundo District in the Fuegian Andes, Argentina. This deposit is hosted by a Middle Jurassic volcanic and volcanoclastic sequence forming the Lemaire Formation. The latter consists, from the base up, of the following: rhyolitic and dacitic porphyritic rocks, ignimbrite, tuff, and flow. It is underlain by a pre-Jurassic basement and overlain by the hyaloclastic andesites of the Yahgán Formation. The Arroyo Rojo consists of stacked lenticular lenses that are associated with disseminated mineralization in both the footwall and the hanging wall. The internal structure of the ore lenses is marked by the occurrence of massive, semi-massive and banded facies, along with stringer and brecciated zones and minor ore disseminations. The mineral assemblage comprises mainly pyrite and sphalerite, with minor amounts of galena and chalcopyrite and rare pyrrhotite, arsenopyrite, tetrahedrite and bournonite. The ores and the volcanic host rocks have metamorphosed to greenschist facies and were overprinted by a penetrative tectonic foliation, which led to the development of mylonitic, and cataclastic textures, recrystallization and remobilization. Primary depositional characteristics and regional and hydrothermal alteration patterns were preserved despite deformation and metamorphism. Therefore, primary banding was preserved between facies boundaries. In addition, some remnants of magmatic origin are recognizable in preserved phenocrysts and volcaniclastic phenoclasts. Most of the volcanic and volcaniclastic rocks of the host sequence show a rhyolitic to rhyo-dacitic composition. Regional seafloor alteration, characterized by the presence of clinozoisite, Fe-chlorite and titanite, along with quartz and albite, is partially obliterated by hydrothermal alteration. The hydrothermal alteration is stratabound with the following assemblages, which developed from the base to top: (1) Quartz

  5. Prevalence of Dermatophytes in Red Deer (Cervus elaphus in The Stelvio National Park, Italy

    Directory of Open Access Journals (Sweden)

    Roberta Perego

    2015-10-01

    Full Text Available Dermatophytosis has been described in wildlife, but the literature reporting dermatophyte prevalence in deer is incomplete. To determine the prevalence of dermatophytes and to evaluate the hypothetical role of asymptomatic carriers hair samples were collected from 30 legally hunted wild red deer (Cervus elaphus in the Stelvio National Park, Italy. All deer were visually examined for dermatologic lesions and the coat was brushed using a modified Mackenzie collection method. A small sample of hair was used for direct microscopical examination and subsequently fungal culture was performed on the hair samples. Macroscopic and microscopic examinations were used to identify dermatophytes, saprophytic fungi and yeasts. None of the deer had visible cutaneous lesions. No dermatophyte spores or hyphae were found on direct microscopical examination and, when hair samples were cultured, dermatophytes were not demonstrated in any sample. Only saprophytic fungi were grown, predominantly Alternaria spp., Mucor spp., Cladosporium spp. These results did not reveal the presence of asymptomatic carriers of dermatophytes in the deer sample population of Stelvio National Park and suggest that it is unlikely that, at least in the investigated geographical area, the red deer act a reservoir for transmission of dermatophytes to other wild animals, livestock or people living locally

  6. Do red deer stags (Cervus elaphus use roar fundamental frequency (F0 to assess rivals?

    Directory of Open Access Journals (Sweden)

    Maxime Garcia

    Full Text Available It is well established that in humans, male voices are disproportionately lower pitched than female voices, and recent studies suggest that this dimorphism in fundamental frequency (F0 results from both intrasexual (male competition and intersexual (female mate choice selection for lower pitched voices in men. However, comparative investigations indicate that sexual dimorphism in F0 is not universal in terrestrial mammals. In the highly polygynous and sexually dimorphic Scottish red deer Cervus elaphus scoticus, more successful males give sexually-selected calls (roars with higher minimum F0s, suggesting that high, rather than low F0s advertise quality in this subspecies. While playback experiments demonstrated that oestrous females prefer higher pitched roars, the potential role of roar F0 in male competition remains untested. Here we examined the response of rutting red deer stags to playbacks of re-synthesized male roars with different median F0s. Our results show that stags' responses (latencies and durations of attention, vocal and approach responses were not affected by the F0 of the roar. This suggests that intrasexual selection is unlikely to strongly influence the evolution of roar F0 in Scottish red deer stags, and illustrates how the F0 of terrestrial mammal vocal sexual signals may be subject to different selection pressures across species. Further investigations on species characterized by different F0 profiles are needed to provide a comparative background for evolutionary interpretations of sex differences in mammalian vocalizations.

  7. First description of Onchocerca jakutensis (Nematoda: Filarioidea) in red deer (Cervus elaphus) in Switzerland.

    Science.gov (United States)

    Bosch, Felix; Manzanell, Ralph; Mathis, Alexander

    2016-08-01

    Twenty-seven species of the genus Onchocerca (Nematoda; Filarioidea) can cause a vector-borne parasitic disease called onchocercosis. Most Onchocerca species infect wild and domestic ungulates or the dog, and one species causes river blindness in humans mainly in tropical Africa. The European red deer (Cervus e. elaphus) is host to four species, which are transmitted by blackflies (simuliids) or biting midges (ceratopogonids). Two species, Onchocerca flexuosa and Onchocerca jakutensis, produce subcutaneous nodules, whereas Onchocerca skrjabini and Onchocerca garmsi live free in the hypodermal serous membranes. During the hunting season, September 2013, red deer (n = 25), roe deer (Capreolus c. capreolus, n = 6) and chamois (Rupicapra r. rupicapra, n = 7), all shot in the Grisons Region (Switzerland) were investigated for the presence of subcutaneous nodules which were enzymatically digested, and the contained Onchocerca worms were identified to species by light and scanning electron microscopy as well as by PCR/sequencing. In addition, microfilariae from skin samples were collected and genetically characterized. Neither nodules nor microfilariae were discovered in the roe deer and chamois. Adult worms were found in 24% of red deer, and all of them were identified as O. jakutensis. Two morphologically different microfilariae were obtained from five red deer, and genetic analysis of a skin sample of one red deer indicated the presence of another Onchocerca species. This is the first report of O. jakutensis in Switzerland with a prevalence in red deer similar to that in neighbouring Germany. PMID:27617204

  8. Response of red deer stags ( Cervus elaphus) to playback of harsh versus common roars

    Science.gov (United States)

    Garcia, Maxime; Wyman, Megan T.; Charlton, Benjamin D.; Tecumseh Fitch, W.; Reby, David

    2014-10-01

    Red deer stags ( Cervus elaphus) give two distinct types of roars during the breeding season, the "common roar" and the "harsh roar." Harsh roars are more frequent during contexts of intense competition, and characterized by a set of features that increase their perceptual salience, suggesting that they signal heightened arousal. While common roars have been shown to encode size information and mediate both male competition and female choice, to our knowledge, the specific function of harsh roars during male competition has not yet been studied. Here, we investigate the hypothesis that the specific structure of male harsh roars signals high arousal to competitors. We contrast the behavioral responses of free ranging, harem-holding stags to the playback of harsh roars from an unfamiliar competitor with their response to the playback of common roars from the same animal. We show that males react less strongly to sequences of harsh roars than to sequences of common roars, possibly because they are reluctant to escalate conflicts with highly motivated and threatening unfamiliar males in the absence of visual information. While future work should investigate the response of stags to harsh roars from familiar opponents, our observations remain consistent with the hypothesis that harsh roars may signal motivation during male competition, and illustrate how intrasexual selection can contribute to the diversification of male vocal signals.

  9. Detachment of hard ticks (Acari: Ixodidae) from hunted sika deer (Cervus nippon).

    Science.gov (United States)

    Tsunoda, Takashi

    2014-08-01

    Ixodid ticks were collected from 13 sika deer, Cervus n.nippon, shot in the Boso Peninsula in central Japan from late February to early March 1999. Haemaphysalis megaspinosa was the most abundant species of the adults collected, although Haemaphysalis longicornis, H. flava, H. kitaokai, H. cornigera, Ixodes ovatus, and Amblyomma testudinarium were also collected. Males were more abundant than females for H. longicornis, H. megaspinosa, H. flava, and H. kitaokai. Ticks that had inserted their hypostome into its host skin (designated attached) were distinguished from those that were detached and on the host's surface. A greater fraction of males than females of all four species were detached. Females were classified in three feeding stages (engorged, partially engorged, and unfed). More H. longicornis and H. megaspinosa unfed female ticks than engorged and partially-engorged female ticks were collected detached. Our results indicated that H. megaspinosa, H. longicornis, H. flava, and H. kitaokai male ticks detached sooner than female ticks after their host died. PMID:24659518

  10. Sperm membrane proteome in wild Japanese macaque (Macaca fuscata) and Sika deer (Cervus nippon).

    Science.gov (United States)

    Kawase, Osamu; Cao, Shinuo; Xuan, Xuenan

    2015-01-01

    Whereas recent advances in proteome-related techniques have accumulated a lot of information about sperm proteins in model animals, the information in non-model wildlife species is absolutely deficient, although this knowledge would be valuable to regulate wildlife overabundance. To characterize the repertoires of sperm membrane proteins in Japanese overpopulated wildlife, our study focuses on the following two species: Macaca fuscata and Cervus nippon. We enriched sperm membrane proteins by the phase partitioning with Triton X-114, and then separated them by two-dimensional electrophoresis, and, finally, they were comprehensively identified by peptide mass fingerprinting. Sperm membrane proteins were successfully enriched. They included some proteins with unknown function and fertility-related proteins that work in sperm development, motility, capacitation, transport, protection, acrosome reaction, and fertilization. Additionally, beta-defensin 126 and epithelial chloride channel were strongly detected in M. fuscata but not in C. nippon, whereas lactadherin and NADH-cytochrome b5 reductase 1 were strongly detected in C. nippon alone. This study is an initiative case showing that the sperm of wildlife conserve major fertility-related proteins, but express some proteins in a species-specific manner. In the development of a practical method for fertility control, this aspect may be taken into consideration. PMID:25277530

  11. The complete mitochondrial genome of Sika deer Cervus nippon hortulorum (Artiodactyla: Cervidae) and phylogenetic studies.

    Science.gov (United States)

    Liu, Yan-Hua; Liu, Xin-Xin; Zhang, Ming-Hai

    2016-07-01

    Sika deer (Cervus nippon Temminck 1836) are classified in the order Artiodactyla, family Cervidae, subfamily Cervinae. At present, the phylogenetic studies of C. nippon are problematic. In this study, we first determined and described the complete mitochondrial sequence of the wild C. nippon hortulorum. The complete mitogenome sequence is 16 566 bp in length, including 13 protein-coding genes, two rRNA genes, 22 tRNA genes, a putative control region (CR) and a light-strand replication origin (OL). The overall base composition was 33.4% A, 28.6% T, 24.5% C, 13.5% G, with a 62.0% AT bias. The 13 protein-coding genes encode 3782 amino acids in total. To further validate the new determined sequences and phylogeny of Sika deer, phylogenetic trees involving 15 most closely related species available in GenBank database were constructed. These results are expected to provide useful molecular data for deer species identification and further phylogenetic studies of Artiodactyla. PMID:26258510

  12. Isolation and characterization of peptidoglycan recognition protein 1 from antler base of sika deer (Cervus nippon).

    Science.gov (United States)

    Jiang, Wei; Yin, Yongguang; Zhou, Yajun; He, Guidan; Qi, Yue

    2014-03-01

    Peptidoglycan recognition proteins (PGRPs) are secreted innate immunity pattern recognition molecules. In this study, a new peptidoglycan recognition protein 1 named cnPGRP1 was isolated from an antler base of sika deer Cervus nippon. The antler base antimicrobial proteins (AAP) were subjected to consecutive chromatographic methods connected to Sephadex G-25 gel filtration column (CM) anion-exchange column, and RP-HPLC. The molecular weight of cnPGRP1 was 17.2 kDa under SDS-PAGE, and peptide mass fingerprint analysis by MALDI-TOF-MS as peptidoglycan recognition protein 1 matched to Dasypus novemcinctus. The matched amino acids sequences were RLYEIIQKWPHYRA. Both Gram-positive and Gram-negative bacteria can be killed by cnPGRP1 in the 50-250 μg/mL range through in vitro. Furthermore, cnPGRP1 has been found to bind Gram-positive bacteria, Gram-negative bacteria, and even fungus. PMID:24360898

  13. Effects of supplemental feeding on gastrointestinal parasite infection in Rocky Mountain Elk (Cervus elaphus)

    Science.gov (United States)

    Hines, Alicia M.; Ezenwa, Vanessa O.; Cross, Paul C.; Rogerson, Jared D.

    2007-01-01

    The effects of management practices on the spread and impact of parasites and infectious diseases in wildlife and domestic animals are of increasing concern worldwide, particularly in cases where management of wild species can influence disease spill-over into domestic animals. In the Greater Yellowstone Ecosystem, USA, winter supplemental feeding of Rocky Mountain elk (Cervus elaphus) may enhance parasite and disease transmission by aggregating elk on feedgrounds. In this study, we tested the effect of supplemental feeding on gastrointestinal parasite infection in elk by comparing fecal egg/oocyst counts of fed and unfed elk. We collected fecal samples from fed and unfed elk at feedground and control sites from January to April 2006, and screened all samples for parasites. Six different parasite types were identified, and 48.7% of samples were infected with at least one parasite. Gastrointenstinal (GI) nematodes (Nematoda: Strongylida), Trichuris spp., and coccidia were the most common parasites observed. For all three of these parasites, fecal egg/oocyst counts increased from January to April. Supplementally fed elk had significantly higher GI nematode egg counts than unfed elk in January and February, but significantly lower counts in April. These patterns suggest that supplemental feeding may both increase exposure and decrease susceptibility of elk to GI nematodes, resulting in differences in temporal patterns of egg shedding between fed and unfed elk.

  14. Chemical capture of free-ranging red deer (Cervus elaphus with medetomidine-ketamine

    Directory of Open Access Journals (Sweden)

    J.M. Arnemo

    1994-12-01

    Full Text Available Seventeen free-ranging red deer (Cervus elaphus (12 calves and 5 yearling hinds were immobilized with a combination of medetomidine hydrochloride (MED and ketamine hydrochloride (KET in winter (January-March. Immobilizations were performed with plastic projectile syringes fired from a dart gun. Mean (SD doses of 0.147 (0.024 mg MED/kg and 2.5 (0.4 mg KET/kg induced recumbency in 5.0 (2.0 minutes in the calves and all of them were completely immobilized. The initial doses in the yearling hinds were 0.099 (0.016 mg MED/kg and 1.9 (0.2 mg KET/kg but three of them required addirional dosing for induction of reliable restraint. The distance covered by the animals between darting and recumbency ranged from 40-250 m for calves and 100-300 m for yearling hinds. The animals were translocated to deer farms for breeding purposes and were given 12.5-25.0 mg of atipamezole hydrochloride before transportation. All animals recovered completely. Haematological and serum biochemical comparisons between free-ranging calves immobilized with medetomidine-ketamine (n=3 and captive unmedicated calves (n=4 showed that chemical capture induce very little stress in red deer.

  15. Malignant catarrhal fever in farmed Rusa deer (Cervus timorensis). 1. Clinico-pathological observations.

    Science.gov (United States)

    Denholm, L J; Westbury, H A

    1982-03-01

    A sporadic fatal disease is described in 7 Rusa deer (Cervus timorensis) from 5 deer farms in Victoria. Bilateral ophthalmia and wasting were the most significant signs in a clinical course varying from 4 to 34 days. Bilateral hypopyon, peripheral corneal opacities and interstitial mononuclear cell infiltration of the renal cortex with pronounced mural thickening and dilatation of vessels at the cortico-medullary junction were the only consistent lesions. Haemorrhagic ileitis, colitis and typhlitis were the major lesions in two deer that died 4 and 6 days after onset of clinical disease. Ecchymotic haemorrhages and sub-serosal haematomas on the intestines and mesentery were the main finding in cases with a longer clinical course. Other gross lesions varied between cases. The most significant histological lesion was fibrinoid necrotising vasculitis with adventitial lymphoid cell infiltration characteristic of bovine malignant catarrhal fever. Mucosal erosions seen in protracted cases of this disease were associated with lymphoid cell infiltration into foci of degenerating epithelial cells. In many lymph nodes there was severe follicular necroses. In chronic cases extensive proliferation of lymphoblastoid cells was seen in the parafollicular cortex and medullary sinuses of nodes which also showed discrete follicular necrosis. PMID:6981408

  16. La 'diplomacia atómica' en la Guerra Fría y Estados Unidos: ¿Teléfono Rojo? Volamos hacia Moscú

    OpenAIRE

    Rubio Pobes, Coro

    2010-01-01

    [ES]En el marco de un volumen sobre Historia y cine dedicado a Estados Unidos, este capítulo analiza, desde una perspectiva historiográfica, el film de Stanley Kubrick ¿Teléfono rojo? Volamos hacia Moscú (Dr. Strangelove, 1963/64). Expone las claves para entender esta ácida denuncia sobre la amenaza nuclear de la Guerra Fría y el desmedido poder del estamento militar en el Estados Unidos en los años de frenética carrera armamentística con la Unión Soviética, y a la vez explica el marco histór...

  17. Introgression through rare hybridization: A genetic study of a hybrid zone between red and sika deer (genus Cervus) in Argyll, Scotland.

    OpenAIRE

    Goodman, S. J.; Barton, N. H.; Swanson, G.; Abernethy, K; Pemberton, J M

    1999-01-01

    In this article we describe the structure of a hybrid zone in Argyll, Scotland, between native red deer (Cervus elaphus) and introduced Japanese sika deer (Cervus nippon), on the basis of a genetic analysis using 11 microsatellite markers and mitochondrial DNA. In contrast to the findings of a previous study of the same population, we conclude that the deer fall into two distinct genetic classes, corresponding to either a sika-like or red-like phenotype. Introgression is rare at any one locus...

  18. Identification of single-nucleotide polymorphisms of the prion protein gene in sika deer (Cervus nippon laiouanus)

    OpenAIRE

    Jeong, Hyun-Jeong; Lee, Joong-Bok; Park, Seung-Yong; Song, Chang-Seon; Kim, Bo-Sook; Rho, Jung-Rae; Yoo, Mi-Hyun; Jeong, Byung-Hoon; Kim, Yong-Sun; Choi, In-Soo

    2007-01-01

    Polymorphisms of the prion protein gene (PRNP) have been detected in several cervid species. In order to confirm the genetic variations, this study examined the DNA sequences of the PRNP obtained from 33 captive sika deer (Cervus nippon laiouanus) in Korea. A total of three single-nucleotide polymorphisms (SNPs) at codons 100, 136 and 226 in the PRNP of the sika deer were identified. The polymorphic site located at codon 100 has not been reported. The SNPs detected at codons 100 and 226 induc...

  19. Effects of ovarian storage condition on in vitro maturation of Hokkaido sika deer (Cervus nippon yesoensis) oocytes.

    Science.gov (United States)

    Tulake, Kuerban; Yanagawa, Yojiro; Takahashi, Yoshiyuki; Katagiri, Seiji; Higaki, Shogo; Koyama, Keisuke; Wang, Xuguang; Li, Heping

    2014-11-01

    The effects of different preservation conditions (temperature 20-25 or 10-15 degrees C; duration 12 or 24 h) for ovaries of Cervus nippon yesoensis on in vitro maturation of oocytes were examined. When ovaries were kept for 12 h at 20-25 degrees C, maturation rate of oocytes was highest (71%); however, it declined when the preservation time was extended to 24 h (31%). When the preservation temperature decreased to 10-15 degrees C, the maturation rate after 12 h preservation decreased (51%) but it remained in same level even though preservation time is prolonged to 24 h (55%). PMID:25597189

  20. Comportamiento productivo y reproductivo del ganado holstein rojo, holstein negro y pardo suizo en Palmira, Valle del Cauca

    Directory of Open Access Journals (Sweden)

    Zapata Oscar

    1989-06-01

    Full Text Available Three breeds of dairy cattle (26 Red Holstein RH, 97 Black Holstein BH and 29 Brown Swiss BS, were evaluated for reproductive eficiency, and milk production for the years 1979 - 1987 a t the Instituto Colombiano Agropecuario, Palmira. Days of milking, milk and fat production were for BH (324.0days, 2545.9 kg, 91.1 kg for the RH (300.0 days, 2243.7 kg, 81.0 kg for the BS (298.2 days, 1886.6 kg, 66.9 kg. % fat average were 3.6% in RH, 3.7 % in BH and BS. The lactation curves for the three breeds were best ajusted with the model: Y=A+B(lnt + C(lnt2. Larger persistaency was observed on BS followed by RH. The BS presented better reproductive efficiency than RH and BH with a mean of 169.0,177.4 and 195.6 days, calving data-conception and 2.0, 22 and 22 for number of services per conception. The HR breed had a calving age of 3.4 years and 470.5 kg of calving weight larger than 3.5 years and 440.0 kg for the BH and 3.8 years and 458.1 kg for the BS. Average weight at birth for males and females together BS showed grater weights (37.02 kq, BH and RH showed similar results (36.0 and 362 kg. The incidence of problem at birth was higher for RH (10.90/0 and puerperium problems in BS(21.60,b. Not significal effect of calving weight and rainfall on milk yield and calving date-conception. In most cases there was no correlation between milk yield and calving date-conception. There was a very narow relation between calving date- conception and number of services per conception.En el Instituto Colombiano Agropecuario-Palmira, se evaluó el comportamiento productivo y reproductivo de 152 vacas; 26 Holstein Rojo (HR, 97 Holstein Negro (HN y 29 vacas Pardo Suizo (PS, durante el período 1979-1987. La mayor duración de la lactancia, producción de leche y grasa (kg la presentó la raza HN (324 días, 2545.9 ka, 91.1 kg, seguido de la HR (300 días, 2243.7,81.0 kg y de la PS (298.2 días, 1886.6 kg, 66.9 kg. los porcentajes de grasa fueron 3.6 (HR y 3.7010 (HN y PSI

  1. Artificial insemination, hybridization and pregnancy detection in sika deer (Cervus nippon ).

    Science.gov (United States)

    Willard, S T; Hughes, D M; Bringans, M; Sasser, R G; White, D R; Jaques, J T; Godfrey, R W; Welsh, T H; Randel, R D

    1996-10-01

    Artificial insemination (AI) was performed on sika hinds (Cervus nippon ) receiving various dosages of pregnant mare serum gonadotropin (PMSG; Year 1: 0, 50 and 100 IU; Year 2: 100 and 150 IU) and using semen collected from elk and 1 2 elk x 1 2 sika stags. The time from synchronization device removal (CIDR vs norgestomet) to estrus was determined through observations of mounting activity. Methods for pregnancy detection, serum progesterone (P4), estrone sulfate (E1S), pregnancy-specific protein B (PSPB) and ultrasonography, following AI (Year 1: AI, Days 28 and 48 after AI; Year 2: AI, Days 42, 53 and 100 after AI) and a 90-d natural breeding season were investigated. From available production data, body weights were compared among sika and 1 4 elk x 3 4 sika hybrids relative to age. Pregnancy rates tended (P treatment and sire; administration of 0 IU PMSG resulted in fewer hinds becoming pregnant to AI than 50 or 100 IU of PMSG. Hinds receiving 100 IU of PMSG had higher (P 0.10) between the CIDR and norgestomet groups. Pregnancy rates 50 d after a 90-d breeding season were similar (P > 0.10) between ultrasound (70.9%) and PSPB (61.6%). Serum P4 after 90 d in breeding groups and 50 d after stag removal were higher (P 0.10) between ultrasound (49.0%) and PSPB (37.3%). Serum P4 28 and 48 d after AI were higher (P 0.10) between ultrasound and PSPB (66.7%). Serum P4 was higher (P sika males tended (P sika males, while 1 4 elk x 3 4 sika females were heavier (P sika females at all ages. In summary, this study documents the use of AI and methods for pregnancy detection in sika hinds as well as preliminary information regarding the production of elk-x-sika hybrids. PMID:16727942

  2. Susceptibility of European red deer (Cervus elaphus elaphus to alimentary challenge with bovine spongiform encephalopathy.

    Directory of Open Access Journals (Sweden)

    Mark P Dagleish

    Full Text Available European red deer (Cervus elaphus elaphus are susceptible to the agent of bovine spongiform encephalopathy, one of the transmissible spongiform encephalopathies, when challenged intracerebrally but their susceptibility to alimentary challenge, the presumed natural route of transmission, is unknown. To determine this, eighteen deer were challenged via stomach tube with a large dose of the bovine spongiform encephalopathy agent and clinical signs, gross and histological lesions, presence and distribution of abnormal prion protein and the attack rate recorded. Only a single animal developed clinical disease, and this was acute with both neurological and respiratory signs, at 1726 days post challenge although there was significant (27.6% weight loss in the preceding 141 days. The clinically affected animal had histological lesions of vacuolation in the neuronal perikaryon and neuropil, typical of transmissible spongiform encephalopathies. Abnormal prion protein, the diagnostic marker of transmissible encephalopathies, was primarily restricted to the central and peripheral nervous systems although a very small amount was present in tingible body macrophages in the lymphoid patches of the caecum and colon. Serial protein misfolding cyclical amplification, an in vitro ultra-sensitive diagnostic technique, was positive for neurological tissue from the single clinically diseased deer. All other alimentary challenged deer failed to develop clinical disease and were negative for all other investigations. These findings show that transmission of bovine spongiform encephalopathy to European red deer via the alimentary route is possible but the transmission rate is low. Additionally, when deer carcases are subjected to the same regulations that ruminants in Europe with respect to the removal of specified offal from the human food chain, the zoonotic risk of bovine spongiform encephalopathy, the cause of variant Creutzfeldt-Jakob disease, from consumption of

  3. Antlers of Cervus elaphus as biomonitors of {sup 90}Sr in the environment

    Energy Technology Data Exchange (ETDEWEB)

    Baeza, A.; Vallejo, I. [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain); Guillen, J., E-mail: fguillen@unex.e [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain); Salas, A.; Corbacho, J.A. [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain)

    2011-03-15

    Adequate radioprotection of the environment requires the identification of biomonitors sensitive to the variation of its radionuclide content. Due to the chemical similarities between calcium and strontium, calcified tissues of mammals are considered to be good {sup 90}Sr biomonitors. This work considered Cervus elaphus antlers which, being shed annually, can give information about the importance of radiostrontium contamination in an ecosystem in the time period required for the growth of the antler. The samples were collected at various points of W and SW Spain. The mean value of their {sup 90}Sr content was (70 {+-} 43 (S.D.)) Bq/kg d.w., range (16-218) Bq/kg d.w., and the radionuclide was evenly distributed in the different parts of the antler. There was a good correlation between the antlers' {sup 90}Sr content and the {sup 90}Sr deposited in the soil. The antlers' content of {sup 226}Ra (from the natural uranium series) and the contents of some stable elements (Ca, Mg, Sr, and K) were also determined. The values for these stable elements were practically constant in the analyzed samples, and the concentrations measured decreased in the following order: Ca > Mg > K > Sr > {sup 90}Sr > {sup 226}Ra - Research highlights: {yields} There was a good correlation between the antlers' {sup 90}Sr content and the {sup 90}Sr deposited in the soil. {yields} The content of stable elements (Ca, Mg, Sr, K) in the analyzed antlers were practically constant. {yields} The concentrations measured decreased in the following order: Ca > Mg > K > Sr >{sup 90}Sr >{sup 226}Ra.

  4. Colonization of the Scottish islands via long-distance Neolithic transport of red deer (Cervus elaphus).

    Science.gov (United States)

    Stanton, David W G; Mulville, Jacqueline A; Bruford, Michael W

    2016-04-13

    Red deer (Cervus elaphus) have played a key role in human societies throughout history, with important cultural significance and as a source of food and materials. This relationship can be traced back to the earliest human cultures and continues to the present day. Humans are thought to be responsible for the movement of a considerable number of deer throughout history, although the majority of these movements are poorly described or understood. Studying such translocations allows us to better understand ancient human-wildlife interactions, and in the case of island colonizations, informs us about ancient human maritime practices. This study uses DNA sequences to characterise red deer genetic diversity across the Scottish islands (Inner and Outer Hebrides and Orkney) and mainland using ancient deer samples, and attempts to infer historical colonization events. We show that deer from the Outer Hebrides and Orkney are unlikely to have originated from mainland Scotland, implying that humans introduced red deer from a greater distance. Our results are also inconsistent with an origin from Ireland or Norway, suggesting long-distance maritime travel by Neolithic people to the outer Scottish Isles from an unknown source. Common haplotypes and low genetic differentiation between the Outer Hebrides and Orkney imply common ancestry and/or gene flow across these islands. Close genetic proximity between the Inner Hebrides and Ireland, however, corroborates previous studies identifying mainland Britain as a source for red deer introductions into Ireland. This study provides important information on the processes that led to the current distribution of the largest surviving indigenous land mammal in the British Isles. PMID:27053752

  5. An assessment of zoonotic and production limiting pathogens in rusa deer (Cervus timorensis rusa) from Mauritius.

    Science.gov (United States)

    Jori, F; Godfroid, J; Michel, A L; Potts, A D; Jaumally, M R; Sauzier, J; Roger, M

    2014-08-01

    A population of approximately 70,000 rusa deer (Cervus timorensis russa) represents the most important mammal species reared for food on the island of Mauritius, being the main source of red meat for the local population. However, very limited information is available on the circulation of pathogens affecting the productivity and health of this species. To produce baseline data on the circulation of infectious pathogens in rusa deer under production, a serological survey and/or direct pathogen detection for six selected infectious diseases was undertaken in 2007 in a sample of 53% of the herds reared in semi-free-ranging conditions in hunting estates. Seropositive results were recorded for Johne's disease with an indirect ELISA test (1.7%, n = 351), heartwater with an immunofluorescence antibody test (IFAT) (95.5%, n = 178) and leptospirosis with a Microscopic Agglutination Test (MAT) (25.9%, n = 363). Significant associations were found between seroprevalence to some of the leptospiral serogroups detected (Tarassovi, Pomona, Sejroe and Mini) and age of the animals, animal density or location of the estates (being more prevalent in hotter and more humid areas). In addition, Mycobacterium bovis and M. avium subspecies paratuberculosis were confirmed in two deer carcasses by culture and PCR, respectively. No antibodies against Brucella spp. nor Rift Valley Fever virus were detected with the use of respective indirect ELISA's. The results obtained suggest that the population of rusa deer from Mauritius is exposed to a wide range of pathogens which may affect their productivity. In addition, the results highlight the potential public health risks incurred by deer industry workers and consumers. This survey fills an important gap in knowledge regarding the health of tropical deer meat in Mauritius and justifies the need to implement more regular surveys of selected pathogens in the deer population. PMID:24382104

  6. Natural diet and food habitat use of the Tarim red deer, Cervus elaphus yarkandensis

    Institute of Scientific and Technical Information of China (English)

    QIAO Jianfang; YANG Weikang; GAO Xingyi

    2006-01-01

    In order to determine the natural diet and food habitat use of Tarim red deer (Cervus elaphus yarkandensis), a study was carried out in Qiemo, Xinjiang, China from October 2000 to June 2001. Direct observation combined with faecal analysis method was used to determine the natural diet of red deer. 15 different species of plant were identified as food items. Among them, 13 species of plants were identified in winter diet and 9 species in summer. Red deer consumed a wider range of species in winter because of their nutrient requirement as well as the shortage of food and the scarcity of high-quality forage in the study area. Phragmites communis, Glycyrrhiza inflata and populus diversifolia were frequently present in the deer's diet whenever in winter and summer. Among them, Phragmites communis was the most abundant plant in the area and was included in the deer's diet. Observation on food selection frequency of captive Tarim red deer showed that Populus diversifolia was the first preferred species. However, this food was limited in the study area. Five food habitat types were found in the study area according to plant association: (1)Phragmites communis-Tamarix ramosissima association, (2) Tamarix ramosissima-Halostachys caspica association, (3) Tamarix ramosissima-Phragmites communis association, (4) Populus diversifoliaPhragmites communis association, (5) Burned area.Among them, Phragmites communis-Tamarix ramosissima association (reed meadow and reed marsh)was preferred to other types within the study area whenever in summer and winter. Dense reed cover could reduce the chance of detection from predator and obstruct attack from predator. Furthermore, under the cover of the reed, Tarim red deer was protected from direct solar radiation during the hours of www. scichina.com www.springerlink.com hot day in summer. The reed meadow and marsh was preferred, presumably because the red deer could minimize their movements while searching for food, water and cover.

  7. Variación espacio-temporal de la densidad poblacional de erizo rojo Strongylocentrotus franciscanus (Echinodermata: Echinoidea: Strongylocentrotidae) en Baja California Spatial and temporal variation of the population density of the red sea urchin Stronngylocenntrotus franciscanus (Echinodermata: Echinoidea: Strongylocentrotidae) in Baja California

    OpenAIRE

    Julio S. Palleiro-Nayar; Gabriela Montaño-Moctezuma; Óscar Sosa-Nishizaki

    2012-01-01

    Se estimó la densidad poblacional de erizo rojo, Strongylocentrotus franciscanus, en 10 localidades de la costa occidental de Baja California, México, donde se realiza la extracción comercial de este recurso pesquero. Se compararon las estimaciones realizadas en cuatro años muestreados: 2003, 2005, 2006 y 2008. Las variaciones observadas en las localidades analizadas indicaron diferencias espacio-temporales para la densidad de erizo rojo y diferencias en la estructura de tallas, las cuales es...

  8. Vaccination of elk (Cervus canadensis) with Brucella abortus strain RB51 overexpressing superoxide dismutase and glycosyltransferase genes does not induce adequate protection against experimental brucella abortus challenge

    Science.gov (United States)

    In recent years, elk (Cervus canadensis) have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area (GYA). In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the d...

  9. Gastrointestinal tract development in red deer (Cervus elaphus) calves from 1 to 12 months of age.

    Science.gov (United States)

    Hammond, K J; Hoskin, S O; Jopson, N B; Mackintosh, C G; Hofstra, G; Thompson, B R; Stevens, D R

    2013-11-01

    This study provides a detailed description of the development of the gastrointestinal tract (GIT) of farmed red deer (Cervus elaphus) calves over the first 12 months of age. GIT development was measured using a combination of computerised tomography (CT) scanning and traditional slaughter plus dissection techniques. Red deer calves of a known birth date were randomly assigned to two treatment groups. A group of five animals were repeatedly CT scanned at 31, 63, 92, 135, 207, 275 and 351 days of age to identify GIT organs and determine their volume. From a group of 20 animals, subsets of four individuals were also scanned at corresponding ages (except 135 days of age). They were immediately euthanised and dissected after CT scanning to compare CT-scanned results with actual anatomical measurements. Individual organ weights were compared with their respective organ volumes determined by CT scanning and were found to have a strong, positive relationship. The combined rumen and reticulum (RR) CT-scanned volume was compared with its volume determined by the water-displacement technique and this also showed good correlation between the two techniques (R = 0.92). The allometric growth rates of organs, relative to animal live weight gains, in descending order, were the rumen, omasum, reticulum, abomasum, caecum blind sac, kidneys, spleen and liver. The red deer GIT was continuing to grow and develop when the last measurement was taken at 351 days of age. The greatest growth of the RR, when expressed in terms of empty weight, was between 31 and 92 days of age. Compared with sheep and cattle, it appears that the red deer have a similar or greater rate of RR development up until approximately 60 to 90 days of age; however, the final increments of GIT maturity in deer may take longer to complete, with the empty weight of the RR gaining 7.5 g/day between 275 and 351 days of age. CT scanning was validated in this study as a viable technique to follow GIT development in the same

  10. Experimental transmission of bovine spongiform encephalopathy to European red deer (Cervus elaphus elaphus

    Directory of Open Access Journals (Sweden)

    Reid Hugh W

    2008-05-01

    Full Text Available Abstract Background Bovine spongiform encephalopathy (BSE, a member of the transmissible spongiform encephalopathies (TSE, primarily affects cattle. Transmission is via concentrate feed rations contaminated with infected meat and bone meal (MBM. In addition to cattle, other food animal species are susceptible to BSE and also pose a potential threat to human health as consumption of infected meat products is the cause of variant Creutzfeldt-Jakob disease in humans, which is invariably fatal. In the UK, farmed and free ranging deer were almost certainly exposed to BSE infected MBM in proprietary feeds prior to legislation banning its inclusion. Therefore, although BSE has never been diagnosed in any deer species, a possible risk to human health remains via ingestion of cervine products. Chronic wasting disease (CWD, also a TSE, naturally infects several cervid species in North America and is spreading rapidly in both captive and free-ranging populations. Results Here we show that European red deer (Cervus elaphus elaphus are susceptible to intra-cerebral (i/c challenge with BSE positive cattle brain pool material resulting in clinical neurological disease and weight loss by 794–1290 days and the clinical signs are indistinguishable to those reported in deer with CWD. Spongiform changes typical of TSE infections were present in brain and accumulation of the disease-associated abnormal prion protein (PrPd was present in the central and peripheral nervous systems, but not in lymphoid or other tissues. Western immunoblot analysis of brain material showed a similar glycosylation pattern to that of BSE derived from infected cattle and experimentally infected sheep with respect to protease-resistant PrP isoforms. However, the di-, mono- and unglycosylated bands migrated significantly (p Conclusion This study shows that deer are susceptible to BSE by intra-cerebral inoculation and display clinical signs and vacuolar pathology that are similar to those

  11. Relations between nutritional condition and survival of North American elk Cervus elaphus

    Science.gov (United States)

    Bender, L.C.; Cook, J.G.; Cook, R.C.; Hall, P.B.

    2008-01-01

    We related annual and seasonal survival of four populations of elk Cervus elaphus in the Pacific Northwest, USA, to measures and indices of individual nutritional condition. Among populations, for all mortality (human and non-human causes) sources inclusive, annual survival of adult females was correlated with a rump body condition score (rs = 0.627, P = 0.071), and survival over spring-summer-autumn (SSA) was correlated with mean ingesta-free body fat (IFBF; rs = 0.567, P = 0.088) and rump body condition score (rBCS; rs = 0.615, P = 0.050). For non-human mortality sources only, survival through SSA was correlated with IFBF (rs = 0.567, P = 0.088) and rBCS (rs = 0.615, P = 0.050), and survival over winter was correlated with withers body condition score (rs = 0.677, P = 0.045). For human-caused mortality sources only, survival over SSA was correlated with rBCS (rs = 0.696, P = 0.036) and IFBF (rs = 0.696, P = 0.036). For individuals, logistic analysis found that individual likelihood of dying from all mortality sources inclusive was best predicted (??2 = 8.3, P = 0.004, ?? = -1.24) by longissimus dorsi (loin) muscle thickness, a measure of protein catabolism. For only non-human mortality sources, a model (??2 = 16.1, P = 0.0003) containing both loin muscle thickness (??2 = 5.7, P = 0.017, ??= -1.02) and percent ingesta-free body fat (??2 = 4.9, P = 0.027, ?? = -0.35) best predicted individual susceptibility to mortality. Odds ratios indicated that odds of dying increased approximately 3X for each centimeter of loin muscle catabolized and 1.4X for each percent less body fat. No condition indices at the individual level were related to survival from human-caused mortality sources. Our study populations were characterized by low-marginal condition (i.e. mean ingesta-free body fat levels of 5.9-12.3% for lactating cows in late autumn); this likely increased the prominence of measures of muscle catabolism relative to fat accretion in influencing individual elk survival

  12. Determinación de las características dimensionales y distribución de los cafetos variedad Caturra Rojo en condiciones de ladera

    Directory of Open Access Journals (Sweden)

    Benjamín Gabriel Gaskins Espinosa

    2013-01-01

    Full Text Available En Cuba se trabaja desde la década de los 80 en el estudio de la cosecha selectiva de café mediante vibraciones, para la cual es necesario conocer las características dimensionales de las plantas de cafetos, por lo que el presente trabajo tiene como objetivo determinar las características dimensionales y su distribución en el área experimental de la variedad Caturra Rojo; para lo cual se determinaron las dimen- siones principales que caracterizan dicho cultivo y se hicieron análisis estadísticos de correlación y regresión para conocer la relación entre las características dimensionales, dispersión y distribución espacial; los resultados obtenidos permitirán caracterizar desde el punto de vista dimensional esta variedad de cafeto en condiciones de ladera, aspecto novedoso para este tipo de estudio.

  13. ESTUDIO DE ALGUNOS GÉNEROS MICROBIANOS ASOCIADOS A DIFERENTES VARIEDADES DE TRIGO (Triticum aestivum L. EN SUELO FERRALÍTICO ROJO

    Directory of Open Access Journals (Sweden)

    Annia Hernández

    2002-01-01

    Full Text Available Se estudiaron los géneros bacterianos predominantes en la rizosfera de cuatro variedades de trigo (Triticum aestivum L. crecido en un suelo Ferralítico Rojo. También se evaluó la quimioatracción de algunas rizobacterias hacia los exudados radicales de este cultivo. Se utilizó el Modelo Espermosférico para el aislamiento y los tubos colectores y la cámara de quimiotaxis modificada para la evaluación del efecto quimiotáctico de los exudados radicales. Los resultados obtenidos demostraron que en las variedades Gang y Caeté, Pseudomonas es la población dominante, siendo Pseudomonas (Burkholderia cepacia la especie más fuertemente atraída por los exudados radicales a los 14 días y 40 minutos de exposición. En las variedades Culiacam y Antisama, es el género Azospirillum el predominante en la rizosfera, siendo esta especie la más fuertemente atraída por los exudados radicales a los 14 días y 60 minutos de exposición. Esta investigación permite la aplicación de biofertilizantes a base de los géneros microbianos predominantes en la rizosfera del trigo, potenciando su actividad sin alterar la biología del suelo.

  14. Observations on rutting behaviour of Hangul Deer Cervus elaphus hanglu (Cetartiodactyla: Cervidae in Dachigam National Park, Kashmir, India

    Directory of Open Access Journals (Sweden)

    B.A. Bhat

    2009-06-01

    Full Text Available Observations on seasonal rutting behaviour of Hangul Deer Cervus elaphus hanglu were recorded in Dachigam National Park (DNP during the years 2005 to 2007. A total of 24 breeding herds were seen. The size of the herd varied from 2-5, and usually comprised of one large stag and one or more hinds. The rutting season commenced in the main valley of lower Dachigam by late September and extended up to the first week of November. The peak was from October 9 to 20. The stags in rut became intolerant of each other and separated. The most conspicuous feature of the rut was the reverberating resonant roars by stags. The courtship behaviour was observed on six occasions and only mature stags (8-tined and above were involved in courtship. Various anthropogenic activities in the habitat were found to impair the rutting behaviour of deer.

  15. Serological survey for Lyme disease in sika deer (Cervus nippon yesoensis) by enzyme-linked immunosorbent assay (ELISA).

    Science.gov (United States)

    Isogai, E; Isogai, H; Masuzawa, T; Yanagihara, Y; Sato, N; Hayashi, S; Maki, T; Mori, M

    1991-01-01

    Seventy-six wild sika deer (Cervus nippon yesoensis) from areas endemic for Borrelia burgdorferi during 1988 to 1989 had the IgG antibody to the bacteria in enzyme-linked immunosorbent assay. The percentage of seropositive deer was 25.0% to strain HO14 and 22.4% to strain HP3, respectively. Specific IgG antibody titers were high in summer but low in winter. In summer, seropositive deer were 75.0%. Similar results were obtained in serum specimens obtained monthly from 4 farmed deer. It was suggested that the sika deer could be one of the wild reservoirs for B. burgdorferi in Hokkaido, Japan. The transmission risk of B. burgdorferi is considered to be greatest during late spring to early summer. PMID:1808467

  16. Changes in plasma levels of cortisol and corticosterone after acute ACTH stimulation in rusa deer (Cervus rusa timorensis).

    Science.gov (United States)

    van Mourik, S; Stelmasiak, T; Outch, K H

    1985-01-01

    Resting cortisol and corticosterone levels in immobilized mature rusa stags (Cervus rusa timorensis) and the influence of synthetic ACTH on the cortisol/corticosterone ratio (F/B ratio) were investigated. The basal concentration of cortisol was found to be 14.07 nmol/l (SD = 9.3, N = 15) and corticosterone was 3.79 nmol/l (SD = 2.3, N = 15). The cortisol/corticosterone ratio for the basal level was 5.31 (SD = 3.9, N = 15). After ACTH administration the cortisol/corticosterone ratio increased to 11.41 (SD = 5.4, N = 147) regardless of doses of ACTH administered to individual stags. The adrenal response to ACTH administration has a potential application for selection of deer most suitable for deer farming. PMID:2863041

  17. Rusa deer (Cervus timorensis) as a host for the cattle tick (Boophilus microplus) in Papua New Guinea.

    Science.gov (United States)

    Owen, I L

    1977-04-01

    The rusa deer (Cervus timorensis) is more resistant to the cattle tick (Boophlilus microplus) than are Britsh breed cattle in Papua New Guinea. The average yield of replete female ticks from deer was 1.6% (0.3-3.2%) as compared to 11.2% (3.4-23.1%) from calves. Ticks from deer were more slender, lighter in weight and produced fewer eggs (mean 1,800) than did ticks from calves (mean 2,200) but the deer was shown to be an effective host. A cervid population can maintain a tick population in the absence of bovine hosts thus presenting an important factor in eradication programs. Nutritional stress appears to result in a higher seasonal prevalence of infestation amongst males and non-pregnant females. PMID:864854

  18. Vaccination of Elk (Cervus canadensis) with Brucella abortus Strain RB51 Overexpressing Superoxide Dismutase and Glycosyltransferase Genes Does Not Induce Adequate Protection against Experimental Brucella abortus Challenge

    OpenAIRE

    Nol, Pauline; Olsen, Steven C.; Rhyan, Jack C.; Sriranganathan, Nammalwar; McCollum, Matthew P.; Hennager, Steven G.; Pavuk, Alana A.; Sprino, Phillip J.; Boyle, Stephen M.; Berrier, Randall J.; Salman, Mo D.

    2016-01-01

    In recent years, elk (Cervus canadensis) have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area. In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the development of effective disease management strategies for wild elk herds is of utmost importance, not only for the prevention of reintroduction of brucellosis to cattle, but also for the overall health o...

  19. Vegetation Recovery in Response to the Exclusion of Grazing by Sika Deer (Cervus nippon) in Seminatural Grassland on Mt. Kushigata, Japan

    OpenAIRE

    Nagaike, Takuo; Ohkubo, Eiji; Hirose, Kazuhiro

    2014-01-01

    We examined the recovery of vegetation in seminatural grassland in central Japan after eliminating grazing by sika deer (Cervus nippon) by fencing. By 2012, after 5 years of fencing for exclusion of sika deer, the species composition of quadrats within the enclosure reverted to the original species composition in 1981, not browsed by sika deer. Conversely, outside the fence was different from the baseline quadrats in 1981. Iris sanguinea, a prominent flower in the area, recovered within the e...

  20. The Association of BDNF Gene Variants with Behaviour Traits in Sika Deer (Cervus nippon)

    OpenAIRE

    Wei Wan-Hong; Guo Jun; Yang Yan; Lv Shen-Jin

    2011-01-01

    It is widely accepted that Brain Derived Neurotrophic Factor (BDNF) is involved in modulating behaviour performance induced by environmental conditions. The aim of this study was to study polymorphisms of the BDNF gene and their relationship with animal behaviour in sika deer (Cervus nippon). About 48 sika deer reared under Ping-Shan-Tang Farm (25 deers) and Zhu-Yu-Wan Park (23 deers), Yangzhou City, Jiangsu province, China were observed and blood samples taken to identify BDNF genotypes. Dat...

  1. Seed contents of sika deer (Cervus nippon) dung and the fate of seeds in a temperate short grassland in an urban park in Japan

    OpenAIRE

    Haruna Ishikawa

    2011-01-01

    Many studies have suggested the positive effects of grazing by large herbivorous mammals on seed dispersal, but little isknown about how herbivores could affect the fate of ingested seeds. This study examined the effects of seed ingestion bysika deer (Cervus nippon) on seed fate in a temperate grassland established in an urban park long resided by high densitiesof sika deer. I compared species composition and seasonal traits of seed abundance and maturity in the grasslandcommunity with those ...

  2. CONTROLLING ANTLER GROWTH IN A CASTRATED INDOCHINESE SIKA DEER CERVUS NIPPON PSEUDAXIS USING A COMMERCIALLY AVAILABLE TRENBOLONE ACETATE AND ESTRADIOL IMPLANT.

    Science.gov (United States)

    Raines, Janis A; Storms, Timothy

    2015-12-01

    A captive Indochinese sika deer (Cervus nippon pseudaxis) was castrated at the age of 5 yr. The resultant abnormal antler growth over the next few years became difficult to manage from both the veterinary and husbandry standpoints. Using a commercially available trenbolone acetate and estradiol implant marketed for domestic cattle heifers, normal mineralization of the abnormal antlers was achieved along with the expected normal casting. The deer was then maintained for 6 yr using an annual implant regimen. PMID:26667563

  3. Predisposition assessment of mountainous forests to bark peeling by red deer (Cervus elaphus L.) as a strategy in preventive forest habitat management

    OpenAIRE

    Friedrich Reimoser; Ursula Nopp-Mayr; Friedrich Voelk

    2011-01-01

    This paper presents a method to assess the predisposition of mountainous forests to bark peeling by red deer (Cervus elaphus), which illustrates options in preventive forest habitat management. We developed an expert system, based on expert interviews and literature analyses. We selected the most important site- and stand-related predisposing factors for bark peeling of red deer, considering the relation of food dependent and food independent settling stimuli. Within the mechanistic expert sy...

  4. 梅花鹿耶尔森氏菌感染的诊断和治疗%THE DIAGNOSIS AND TREATMENT OF CERVUS NIPPON INFECTED WITH YERSINIA

    Institute of Scientific and Technical Information of China (English)

    雷蕾; 张再蓉; 王成东; 余星明; 赵波

    2001-01-01

    Four sika deers (Cervus nippon) (3 males, and 1 female) with depression, loss of appetite, high body temperature and hematochezia were dead in June, 1999 and Yersinia was cultured from their pathological materials. In addition, the susceptibility of Yersinia to antibiotics and the toxicity to mice were detected. All the other sika deers contacted with the died animals were treated with amikacin sulfate and protected from the disease.

  5. Population genetic structure of wild and farmed rusa deer (Cervus timorensis russa) in New-Caledonia inferred from polymorphic microsatellite loci

    OpenAIRE

    Garine-Wichatitsky de, M.; De Meeûs, Thierry; Chevillon, Christine; BERTHIER, D.; Barre, N.; Thevenon, S.; Maillard, J.C.

    2009-01-01

    Historical records indicate that 12 rusa deer (Cervus timorensis russa) were introduced in New-Caledonia during the 1870s. We used eight polymorphic microsatellite DNA loci to assess the genetic differentiation and diversity of farmed and wild deer populations. Past genetic bottlenecks were detected in both sub-populations, although higher genetic diversity was maintained in farmed populations, probably due to the regular introduction of reproducers from wild populations and from other farms....

  6. A Possible Role for Rusa Deer (Cervus timorensis russa) and Wild Pigs in Spread of Trypanosoma evansi from Indonesia to Papua New Guinea

    OpenAIRE

    1999-01-01

    Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa) and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were m...

  7. MINERALIZACIÓN DEL NITRÓGENO DE LA Canavalia ensiformis EN UN SUELO FERRALÍTICO ROJO DE LA HABANA

    Directory of Open Access Journals (Sweden)

    Gloria M. Martín

    2004-01-01

    Full Text Available Para determinar la cantidad de nitrógeno que se libera o inmoviliza durante la descomposición de la Canavalia ensiformis, se ejecutaron dos experimentos en un suelo Ferralítico Rojo. En el primer experimento, llevado a cabo en condiciones de laboratorio, se empleó el método de incubación aeróbica (a temperatura y humedad constantes y se evaluó la velocidad de mineralización de la Canavalia ensiformis, comparada con dos testigos: el control (suelo y un tratamiento que recibió 75 ppm N-urea. En el segundo experimento, conducido en condiciones de macetas (5 kg, con plantas de maíz, se estudió comparativamente la mineralización de la Canavalia ensiformis sola o en presencia de fertilizante mineral (sulfato de amonio, comparado también contra un testigo control (suelo y el fertilizante mineral. Los resultados indican que en condiciones de incubación aeróbica, el período de inmovilización del N del suelo se extiende durante 75 días, con posterioridad a esa fecha comienza a detectarse nitrógeno mineral neto. En condiciones de macetas, bajo fluctuaciones diarias de temperatura y humedad, se verifica la mineralización del N de la canavalia a los 15 días después de la germinación del maíz, 26 días después de la incorporación del abono verde, lo cual sugiere que las oscilaciones diarias de temperatura y humedad y la presencia de las plantas de maíz pueden acelerar la descomposición de los abonos verdes.

  8. Caracterización cromatográfica y espectroscópica de un pigmento rojo obtenido a partir de Bothryodiplodia theobromae

    Directory of Open Access Journals (Sweden)

    Grolamys Castillo

    2010-01-01

    Full Text Available Durante la producción microbiológica de los jasmonatos a partir del hongo Bothryodiplodia theobromae se obtiene una gran variedad de metabolitos, muchos de los cuales no han sido caracterizados y pueden presentar interesantes propiedades bioactivas que conduzcan a su posible aplicación. Lograr la identificación, caracterización y cuantificación de estos metabolitos constituye un problema analítico novedoso y complejo que es necesario abordar y que puede resolverse empleando diferentes métodos cromatográficos y espectroscópicos. En el presente trabajo se lleva a cabo el estudio de caracterización cromatográfica y espectroscópica de la fracción acuosa que resulta del procedimiento de separación por extracción líquido-líquido con solventes de diferente polaridad del caldo de fermentación, donde queda el pigmento rojo. La fracción acuosa resultó ser la más purificada y se caracterizó espectroscópicamente por UV e IR y cromatográficamente por TLC y HPLC. Se establecieron las condiciones cromatográficas por HPLC utilizando una columna RP-18 para definir el perfil cromatográfico de la fracción, se purificó la misma por columna de Sephadex LH-20 y se obtuvo un compuesto que sugiere una estructura similar a un flavonoide del tipo antocianina.

  9. Tratamiento del Colorante Azo Rojo Directo 23 mediante Reactores Discontinuos Secuenciados Anaerobios/Aerobios Treatment of Direct Red 23 Azo Dye by Anaerobic/Aerobic Sequencing Batch Reactors

    Directory of Open Access Journals (Sweden)

    Fernanda Morales-Guzmán

    2009-01-01

    Full Text Available Se evaluó el tratamiento del colorante azo Rojo Directo 23 mediante un proceso anaerobio/aerobio integrado en un sólo reactor. Se utilizaron dos reactores: uno de lecho expandido con carbón activado granular como mediador redox y otro conteniendo la biomasa suspendida, ambos operados en discontinuo. Se evaluó la eficiencia del proceso mediante la reducción y transformación del colorante a aminas aromáticas totales en la fase anaerobia y la degradación de éstas en la fase aerobia. La eliminación del colorante fue por microorganismos y no por adsorción en el carbón activado granular. Las concentraciones de colorante utilizadas fueron de 25 a 100 mg L-1. En el reactor de lecho expandido la eficiencia de degradación global del colorante fue del 90 % y la eliminación de las aminas formadas fue del 100 %.The treatment of the azo dye Direct Red 23 was evaluated by an anaerobic/aerobic process done in a single reactor. Two reactors were used: one was an expanded-bed with granular activated carbon as redox mediator and the other containing the suspended biomass, both operated in batch mode. The efficiency of the process was evaluated by the reduction and transformation of the azo dye to total aromatic amines in the anaerobic phase and the degradation of these in the aerobic phase. The elimination of azo dye direct red was by microorganisms and not by adsorption in the granular activated carbon. The concentration of azo dye used was of 25 to 100 mg L-¹. In the expanded-bed reactor the removal efficiency of the dye was 90 % and the elimination of the amines formed was of 100 %.

  10. Análisis simultáneo de la remoción de azul brillante y rojo 40 mediante espectrofotometría de derivadas

    Directory of Open Access Journals (Sweden)

    Yurany Villada

    2015-01-01

    Full Text Available Los efluentes de industrias como la alimentaria y textil contienen induda - blemente una mezcla de colorantes. No obstante, la evaluación de estos sistemas multicomponentes ha sido poco explorada debido a la comple - jidad para su cuantificación. Como una aproximación más cercana a la contaminación de estos vertimientos, se evaluó la adsorción de la mezcla de colorantes rojo 40 ( R40 y azul brillante ( AB sobre corteza de coco bajo sistema discontinuo, considerando las variables p H , concentración inicial de los colorantes, dosificación de adsorbente y temperatura. Para su cuan - tificación se utilizó el modelo de las primeras derivadas, haciendo uso de un espectrofotómetro UV-V is Lambda 35. Bajo las mejores condiciones, se alcanzó una remoción máxima del 76,5% para la mezcla de R40 y AB a p H ácido (p H = 2.0, dosificación de 20 g/ L , concentraciones iniciales de 10 mg/L y temperatura de 55 °C. El porcentaje de error promedio total encontrado para el modelo de cuantificación fue de 1,35% para R40 y 1,10% para AB , lo que señala la validez del método. Además, en la mezcla binaria, el AB experimentó un menor efecto antagonista por la presencia del R40 , con un porcentaje de adsorción 3,7 veces mayor que el obtenido para el R40 .

  11. Genetic diversity and population structure of a Sichuan sika deer (Cervus sichuanicus) population in Tiebu Nature Reserve based on microsatellite variation.

    Science.gov (United States)

    He, Ya; Wang, Zheng-Huan; Wang, Xiao-Ming

    2014-11-18

    Cervus sichuanicus is a species of sika deer (Cervus nippon Group). To date, research has mainly focused on quantity surveying and behavior studies, with genetic information on this species currently deficient. To provide scientific evidence to assist in the protection of this species, we collected Sichuan sika deer fecal samples from the Sichuan Tiebu Nature Reserve (TNR) and extracted DNA from those samples. Microsatellite loci of bovine were used for PCR amplification. After GeneScan, the genotype data were used to analyze the genetic diversity and population structure of the Sichuan sika deer in TNR. Results showed that the average expected heterozygosity of the Sichuan sika deer population in TNR was 0.562, equivalent to the average expected heterozygosity of endangered animals, such as Procapra przewalskii. Furthermore, 8 of 9 microsatellite loci significantly deviated from the Hardy-Weinberg equilibrium and two groups existed within the Sichuan sika deer TNR population. This genetic structure may be caused by a group of Manchurian sika deer (Cervus hortulorum) released in TNR. PMID:25465089

  12. Don Juan Víctor Abargues de Sostén y la presencia española en el Mar Rojo y Abisinia a finales del siglo XIX

    OpenAIRE

    Mañé Rodríguez, Montserrat

    2005-01-01

    Durante el siglo XIX, África fue la gran meta de las expediciones europeas, cuyo afán colonialista ganaba a los intereses filantrópicos de épocas pasadas: la curiosidad intelectual dejaba paso a los intereses políticos y económicos, España no fue ajena a este movimiento, si bien los problemas internos y la falta de recursos hicieron que sus exploraciones tuvieran escasos resultados, Abargues de Sostén, gran impulsor teórico de la presencia española en el mar Rojo, fue enviado a Abisi...

  13. Modelación del efecto de la variabilidad de las precipitaciones en los términos del balance hídrico de un suelo Ferralítico Rojo

    OpenAIRE

    Hanoi Medina González; Jorge García Coronado; María E. Ruiz Pérez

    2012-01-01

    Se ilustra una metodología para evaluar el efecto de posibles cambios del régimen de precipitaciones en el balance hídrico de un suelo Ferralítico Rojo sembrado con papa bajo riego en la provincia Mayabeque. Para ello se crean escenarios de variabilidad en la frecuencia e intensidad de las precipitaciones y se evalúa el efecto de éstos en la respuesta de un modelo de simulación en términos del número de riegos para mantener el suelo por encima de un nivel umbral de humedad y el agua percolada...

  14. Relaciones nitrógeno-potasio en fertirriego para el cultivo protegido del tomate en suelo Ferralítico Rojo Nitrogen-potassium ratios in fertirrigation for protected cultivation of tomato in Red Ferralitic soil

    OpenAIRE

    María Isabel Hernández Díaz; Marisa Chailloux Laffita; Víctor Moreno Placeres; Anselma Ojeda Veloz; Julia Mirta Salgado Pulido; Odalis Bruzón Guerrero

    2009-01-01

    El objetivo del presente trabajo fue evaluar el efecto de soluciones nutritivas en el fertirriego, con diferentes relaciones entre el nitrógeno y el potasio, en la productividad y calidad de los frutos del tomate (híbrido Hazera 3019), en suelo Ferralítico Rojo. La experiencia se desarrolló en el Instituto de Investigaciones Hortícolas Liliana Dimitrova (La Habana, Cuba). Se estudiaron cuatro soluciones nutritivas, que se diferenciaron en su relación NO3-+NH4+/K+ en términos de meq L-1 (N/K),...

  15. El depósito de sulfuros masivos polimetálicos de Arroyo Rojo, Tierra del Fuego (Argentina): Mineralogía, geoquímica y metalogenia

    OpenAIRE

    Biel Soria, Cecilia; Subías Pérez, Ignacio Ernesto; Acevedo, Rogelio Daniel

    2011-01-01

    El objetivo de esta tesis es avanzar en el conocimiento de la geología y modelos de alteración hidrotermal de los yacimientos de sulfuros masivos de los Andes Fueguinos. Para ello se ha seleccionado el depósito de Arroyo Rojo, el más representativo del cinturón Río Encajado-Río Hambre (Tierra del Fuego, Argentina). Este depósito encaja en la parte volcánica y volcanoclástica de la Formación Lemaire, de edad jurásica media, compuesta de base a techo por: riolitas, dacitas, ignimbritas, tobas y...

  16. Evaluación del potencial de los biosólidos procedentes del tratamiento de aguas residuales para uso agrícola y su efecto sobre el cultivo de rabano rojo (raphanus sativus l.).

    OpenAIRE

    Ramírez Pisco, Ramiro; Pérez Arenas, Martha Inés

    2011-01-01

    El trabajo se adelantó en predios de la planta de tratamiento de aguas residuales “El Salitre”, en la ciudad de Bogotá, con el propósito de evaluar el potencial del subproducto del tratamiento de aguas residuales “biosólido”, para su aplicación en la agricultura por medio de la valoración del crecimiento, desarrollo y producción del cultivo de rábano rojo, y establecer una posible alternativa al problema de disposición final de 3900 toneladas de este material generado mensualmente en las plan...

  17. PARTICIPACIÓN DEL NITRÓGENO DE LOS ABONOS VERDES EN LA NUTRICIÓN NITROGENADA DEL MAÍZ (Zea mays L.) CULTIVADO SOBRE SUELO FERRALÍTICO ROJO

    OpenAIRE

    Gloria M. Martín; Rivera, R

    2002-01-01

    El presente trabajo se realizó con el objetivo de estudiar la eficiencia del nitrógeno incorporado con los abonos verdes, utilizados como precedente en el cultivo del maíz en un suelo Ferralítico Rojo de La Habana. Para ello, se estudió el grado de participación de diferentes fuentes de nitrógeno (abonos verdes y fertilizante mineral) en la nutrición nitrogenada del maíz, mediante los métodos isotópico y de las diferencias. El experimento se condujo en condiciones de macetas (5 kg) y se estud...

  18. EVALUACIÓN ECONÓMICA DE DIFERENTES FORMULACIONES QUÍMICAS EN EL CULTIVO DE LA PAPA (Solanum tuberosum L.) EN UN SUELO FERRALÍTICO ROJO DE LA PROVINCIA LA HABANA

    OpenAIRE

    Josefa Ruiz; Margarita García; Hernández, A,

    2003-01-01

    Durante el período 1999-2001, se llevaron a cabo dos experimentos de campo y una extensión agrícola, con el objetivo de evaluar el efecto de diferentes formulaciones de fertilizantes químicos sobre el cultivo de la papa en las condiciones de suelos Ferralíticos Rojos de La Habana. Los resultados mostraron una alta respuesta de la papa a las formulaciones aplicadas, dada por el efecto de estas sobre el crecimiento, el rendimiento y sus componentes. Los más altos rendimientos del cultivo se obt...

  19. Mejoramiento de riego por surcos, continuo e intermitente, en suelo ferralítico rojo lixiviado en el sistema productivo Banao

    Directory of Open Access Journals (Sweden)

    Manuel Rodríguez González

    2014-01-01

    Full Text Available Este trabajo tiene como objetivo mejorar la efectividad del regadío e incrementar su productividad agrícola, tal fue el propósito de esta investigación. Se realizaron siete evaluaciones de campo, con riego intermitente a tiempos constantes con tres ciclos de riego de 2 min, automatizado con la válvula hidráulica FULCON DN150 y con flujo continuo, asociado al cultivo de cebolla, en suelo Ferralítico rojo lixiviado (Nitisol ródico-éutrico. Se evaluó el calcetín antierosivo como accesorio de la tubería con salidas múltiples para riego intermitente, con un diseño experimental en franja, con tres tratamientos de 15 surcos cada tratamiento y la presencia de un testigo. Para determinar los parámetros de diseño y evaluación se tuvo en cuenta el Qmáx, tiempo de avance, tiempo de aplicación, tiempo de oportunidad, área regada en función del tiempo, los indicadores de rendimiento del cultivo y el análisis económicos del cultivo. El aforo del agua promedio del riego en el surco fue de 0,416 L·s -1 que representó solo el 52,6% del Qmáx. Con el calcetín se reduce 1,7 veces el tiempo avance, 1,33 veces el tiempo de aplicación y regar 153,2 m 2 ·h -1 más área respecto al testigo, en este propio tratamiento el tiempo de oportunidad del primer tercio solo supera al último tercio 2,3 veces mientras que el testigo 6,43 veces. Se demostró que con esta modalidad se puede regar más área en la misma unidad de tiempo que el riego de flujo continuo. Los mayores rendimientos se obtuvieron con el uso del calcetín que representó el 41,7% del total obtenido en la unidad experimental. Se demuestran la ventaja económica que representa la utilización práctica de esta tecnología, que alcanza un beneficio neto del 45% superior al método tradicional.

  20. Estudio comparativo del comportamiento electroquímico del hierro en medio alcalino en presencia de lodos rojos y lodos grises. Efecto del Al3+

    Directory of Open Access Journals (Sweden)

    Abreu, C. M.

    2009-02-01

    Full Text Available Red mud (RM is the main by-product of the Bayer process for alumina extraction from bauxite, and grey slurries (GS are generated during the granite rocks transformation processes. The huge volume of those wastes generated every year suppose a serious environmental problem. Recent works by our group demonstrate the efficiency of both types of muds as corrosion inhibitors for iron and steel in alkaline media containing chlorides. The elemental analysis of these slurries shows that Al3+ is the main common element. Therefore, the aim of this paper is to study the effect of the soluble Al3+ in the electrochemical behaviour of iron in alkaline media, in presence and absence of chlorides. The electrochemical study using Cyclic Voltammetry (CV and Electrochemical Impedance Spectroscopy (EIS together with surface analysis techniques allowed to conclude that Al3+ blocks the surface of steel in alkaline media chloride increasing the steel resistance to chloride attack.

    Los elevados volúmenes de residuos generados por los lodos rojos (LR, procedentes del proceso de obtención de la alúmina a partir de la bauxita y los lodos grises (LG, originados durante el proceso de la transformación del granito, suponen un grave problema medioambiental. Trabajos recientes de este grupo demuestran la eficacia de ambos tipos de lodos como inhibidores de la corrosión del hierro y acero en medio alcalino clorurado. Esta característica ha llevado al estudio individualizado de sus componentes mayoritarios y, dentro de éstos, el Al3+, elemento común presente en mayor proporción. El estudio mediante técnicas electroquímicas como la Voltametría Cíclica (VC y la Espectroscopía de Impedancia Electroquímica (EIE, apoyadas en técnicas de análisis químico y superficial, ha permitido visualizar cómo el Al3+ es capaz de bloquear la superficie del acero en medio alcalino aumentando su resistencia al ataque

  1. ESTADO DE LA POBLACIÓN DE MONOS AULLADORES ROJOS EN EL CAÑÓN DEL BARBAS, FRAGMENTO MONTANO, CORDILLERA CENTRAL, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Gomez-Posada Carolina

    2010-04-01

    Full Text Available

    Los bosques de montaña en Colombia han sufrido fuerte degradación por causas antrópicas; en la actualidad la mayoría son remanentes aislados e inmersos en hábitats antropogénicos. Los aulladores rojos han persistido en estas condiciones pero poco se conoce sobre su biología y respuesta a la alteración de su ambiente. Evaluamos la densidad poblacional y estatus de esta especie en la cuenca del río Barbas (Quindío y Risaralda, fragmento de bosque montano bajo (790 ha. Estimamos la densidad empleando censos por transectos lineales repetidos. Adicionalmente seguimos tropas de aulladores y evaluamos variables de vegetación teniendo en cuenta los requerimientos de la especie. Estimamos una densidad de 11.7±6 grupos y 132.1±68 individuos por km2, para un tamaño poblacional de 1044 aulladores. El tamaño promedio por tropa fue 11, con elevado número de individuos en capacidad de reproducirse y pocos individuos inmaduros (lo cual indica posibles alteraciones sociales. En general el bosque ofrece buena disponibilidad de recursos estructurales y alimenticios para los aulladores. Esta población no se encuentra amenazada en la actualidad por actividades antrópicas, el bosque se encuentra en buen estado con pequeñas zonas en recuperación, la frontera agrícola se encuentra estable y no hubo evidencias de cacería. El fragmento ha sido recientemente protegido bajo la figura de Parque Regional Natural y se adelantan corredores de conexión con otros remanentes. Sin embargo, esta población de aulladores se encuentra aislada de otras poblaciones y por tanto es urgente desarrollar medidas de manejo del paisaje para atenuar los efectos del aislamiento.

  2. Cervus elaphus Foraging Impacts on Plants and Soils at an Ungrazed Desert Grass/Shrubland in Northwestern New Mexico, USA

    Directory of Open Access Journals (Sweden)

    Louis C. Bender

    2015-01-01

    Full Text Available We evaluated Cervus elaphus herbivory and trampling impacts on plants and soils on Chaco Culture National Historical Park (Chaco, a desert grass/shrubland in northwestern New Mexico, USA, most (63% of which has been protected from grazing by domestic livestock since 1948. We conducted grazing, browse, and water infiltration surveys in areas which received different amounts of C. elaphus use (use and control, 2004–2007. Browse utilization was <32% on monitored species and Odocoileus hemionus use accounted for the majority of browsing. Live plant cover was greater on areas receiving more C. elaphus use, and no grass species were used above recommended levels. Stubble heights of Bouteloua spp. were positively related to relative C. elaphus use on some areas, suggesting possible stimulation of grassland productivity by C. elaphus grazing. Water infiltration rates either did not differ among use or control sites or were faster in use sites, indicating no impacts of C. elaphus use on soil compaction. At current C. elaphus densities (0.2–0.4/km2, negative impacts to plants and soils were not seen on Chaco, and some evidence suggests that light grazing is optimizing desert grasslands of Chaco.

  3. Molecular survey on the presence of zoonotic arthropod-borne pathogens in wild red deer (Cervus elaphus).

    Science.gov (United States)

    Ebani, Valentina Virginia; Rocchigiani, Guido; Bertelloni, Fabrizio; Nardoni, Simona; Leoni, Alessandro; Nicoloso, Sandro; Mancianti, Francesca

    2016-08-01

    To estimate the prevalence of some zoonotic tick-borne pathogens in red deer (Cervus elaphus) living in Italian areas with high risk of arthropod exposure, blood samples from 60 red deer were tested by PCR for A. phagocytophilum, Borrelia burgdorferi s.l., Coxiella burnetii, Francisella tularensis, and piroplasms. Thirty-four (56.67%) animals resulted positive for one or more pathogens. In particular, 24 (40%) red deer were positive for A. phagocytophilum, 16 (26.67%) for Babesia divergens, 6 (10%) for C. burnetii, 2 (3.33%) for B. burgdorferi s.l. No positive reaction was observed for F. tularensis. Thirteen (21.67%) animals resulted co-infected by two or three pathogens. Red deer is confirmed as competent reservoir of A. phagocytophilum and B. divergens, but not of B. burgdorferi. This is the first report of C. burnetii-positive red deer in central Italy. Hunters may be at risk of infection both through infected ticks and during the infected cervids carcasses dressing. PMID:27477510

  4. Genetic diversity among Chinese sika deer (Cervus nippon) populations and relationships between Chinese and Japanese sika deer

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Sika deer (Cervus nippon) is a cervid endemic to mainland and insular Asia and endangered. We analyzed variation in the mitochondrial DNA (mtDNA) control region for four subspecies to understand the genetic diversity, population structure and evolutionary history in China. 335 bp were sequenced and eight haplotypes were identified based on 25 variable sites among the populations. Sika deer in China showed lower genetic diversity, suggesting a small effective population size due to habitat fragmentation, a low number of founder individuals, or the narrow breeding program. AMOVA analysis indicated that there was significant genetic subdivision among the four populations, but no correlation between the genetic and geographic distance. Phylogenetic analyses also revealed that Chinese sika deer may be divided into three genetic clades, but the genetic structure among Chinese populations was inconsistent with subspecies designations and present geographic distribution. Including the sequence data of Japanese sika deer, the results indicated that Chinese populations were more closely related to Southern Japanese populations than to the Northern Japanese one, and the Taiwan population was closer to populations of Northeastern China and Sichuan than to those of Southern China.

  5. Molecular identification of the Cryptosporidium deer genotype in the Hokkaido sika deer (Cervus nippon yesoensis) in Hokkaido, Japan.

    Science.gov (United States)

    Kato, Satomi; Yanagawa, Yojiro; Matsuyama, Ryota; Suzuki, Masatsugu; Sugimoto, Chihiro

    2016-04-01

    The protozoan Cryptosporidium occurs in a wide range of animal species including many Cervidae species. Fecal samples collected from the Hokkaido sika deer (Cervus nippon yesoensis), a native deer of Hokkaido, in the central, western, and eastern areas of Hokkaido were examined by polymerase chain reaction (PCR) to detect infections with Cryptosporidium and for sequence analyses to reveal the molecular characteristics of the amplified DNA. DNA was extracted from 319 fecal samples and examined with PCR using primers for small-subunit ribosomal RNA (SSU-rRNA), actin, and 70-kDa heat shock protein (HSP70) gene loci. PCR-amplified fragments were sequenced and phylogenetic trees were created. In 319 fecal samples, 25 samples (7.8 %) were positive with SSU-rRNA PCR that were identified as the Cryptosporidium deer genotype. Among Cryptosporidium-positive samples, fawns showed higher prevalence (16.1 %) than yearlings (6.4 %) and adults (4.7 %). The result of Fisher's exact test showed a statistical significance in the prevalence of the Cryptosporidium deer genotype between fawn and other age groups. Sequence analyses with actin and HSP70 gene fragments confirmed the SSU-rRNA result, and there were no sequence diversities observed. The Cryptosporidium deer genotype appears to be the prevalent Cryptosporidium species in the wild sika deer in Hokkaido, Japan. PMID:26687968

  6. Bacterial community composition and fermentation patterns in the rumen of sika deer (Cervus nippon) fed three different diets.

    Science.gov (United States)

    Li, Zhipeng; Wright, André-Denis G; Liu, Hanlu; Bao, Kun; Zhang, Tietao; Wang, Kaiying; Cui, Xuezhe; Yang, Fuhe; Zhang, Zhigang; Li, Guangyu

    2015-02-01

    Sika deer (Cervus nippon) rely on microorganisms living in the rumen to convert plant materials into chemical compounds, such as volatile fatty acids (VFAs), but how the rumen bacterial community is affected by different forages and adapt to altered diets remains poorly understood. The present study used 454-pyrosequencing of bacterial 16S ribosomal RNA (rRNA) genes to examine the relationship between rumen bacterial diversity and metabolic phenotypes using three sika deer in a 3 × 3 latin square design. Three sika deer were fed oak leaves (OL), corn stover (CS), or corn silage (CI), respectively. After a 7-day feeding period, when compared to the CS and CI groups, the OL group had a lower proportion of Prevotella spp. and a higher proportion of unclassified bacteria belonging to the families Succinivibrionaceae and Paraprevotellaceae (Psika deer. However, the differences in interplay patterns between rumen bacterial community composition and metabolic phenotypes were altered in the native and domesticated diets indicating the changed fermentation patterns in the rumen of sika deer. PMID:25252928

  7. Movement and Activity Patterns of Translocated Elk (Cervus elaphus Nelsoni on an Active Coal Mine in Kentucky

    Directory of Open Access Journals (Sweden)

    Widén, P.

    2007-06-01

    Full Text Available Monitoring activity and movements of newly translocated wildlife is necessary for identifying factors that may hinder population establishment. We documented movements and activity of 6 radio-collared Rocky Mountain elk (Cervus elaphus nelsoni translocated to Kentucky from the 4th of March 1999 until the 17th of July 1999. Seventy three percent of daily activity occurred during crepuscular hours, a period that accounted for only 33% of the day. Elk tended to be more active at dawn (39% than dusk (32%. Elk spent most of their time feeding (49.4% and resting-ruminating (44.6%, with little time spent walking or standing (6.0%. Elk were disturbed 9 times by humans and once by dogs during 702 hours of monitoring. Eight of these disturbance events occurred in reclaimed grassland. During each disturbance, elk moved farther (892 m than during the same hours when undisturbed (282 m. Disturbances altered elk movement and activity patterns, and fragmented social groups. Wildlife managers should identify sources of disturbance at release sites and implement plans that minimize their impacts on reintroduced animals.

  8. Genetic Structure and Effective Population Sizes in European Red Deer (Cervus elaphus) at a Continental Scale: Insights from Microsatellite DNA.

    Science.gov (United States)

    Zachos, Frank E; Frantz, Alain C; Kuehn, Ralph; Bertouille, Sabine; Colyn, Marc; Niedziałkowska, Magdalena; Pérez-González, Javier; Skog, Anna; Sprĕm, Nikica; Flamand, Marie-Christine

    2016-07-01

    We analyzed more than 600 red deer (Cervus elaphus) from large parts of its European distribution range at 13 microsatellite loci, presenting the first continent-wide study of this species using nuclear markers. Populations were clearly differentiated (overall F ST = 0.166, Jost's D est = 0.385), and the BAPS clustering algorithm yielded mainly geographically limited and adjacent genetic units. When forced into only 3 genetic clusters our data set produced a very similar geographic pattern as previously found in mtDNA phylogeographic studies: a western group from Iberia to central and parts of Eastern Europe, an eastern group from the Balkans to Eastern Europe, and a third group including the threatened relict populations from Sardinia and Mesola in Italy. This result was also confirmed by a multivariate approach to analyzing our data set, a discriminant analysis of principal components. Calculations of genetic diversity and effective population sizes (linkage disequilibrium approach) yielded the lowest results for Italian (Sardinia, Mesola; N e between 2 and 8) and Scandinavian red deer, in line with known bottlenecks in these populations. Our study is the first to present comparative nuclear genetic data in red deer across Europe and may serve as a baseline for future analyses of genetic diversity and structuring in this widespread ungulate. PMID:26912909

  9. 半圈养条件下白唇鹿行为时间分配及活动规律的研究%Time Budget and Behaviour Pattern of Cervus Albirostris in Captivity

    Institute of Scientific and Technical Information of China (English)

    何利军; 丁由中; 王小明; 夏述忠

    2001-01-01

    From March to April,1998,the authors studied the time budget andbehaviour patterns of Cervus albirostris in Shanghai Wild Animal Park.We analyzed the results from 23 days′observation for different sex and weather were analyzed.Cervus albirostris spent about 50% daytime in resting,and 40% daytime in feeding.Resting behaviour was presented from 8∶00 to 17∶00.The female spent more resting time than the male(p<0.05)in fine days.The female spent less standing time than the male in rainy days(p<0.01).Cervus albirostris spent more standing time in fine days than in rainy days(p<0.05 for the male,p<0.01 for the female).

  10. Seasonal variation in plasma testosterone, luteinizing hormone concentrations and LH-RH responsiveness in mature, male rusa deer (Cervus rusa timorensis).

    Science.gov (United States)

    van Mourik, S; Stelmasiak, T; Outch, K H

    1986-01-01

    Plasma testosterone and luteinizing hormone (LH) concentrations in immobilized or yarded rusa stags (Cervus rusa timorensis) were investigated over a two-year period. Testosterone concentrations showed a minor elevation in autumn (May) and reached maximal levels in late winter-early spring (August) coinciding with the rut. Luteinizing hormone in plasma was only detectable from January to May. Maximal responsiveness of the pituitary-gonadal axis to LH-RH stimulation was recorded in August. The combination of Fentaz (fentanylcitrate and azaperone) and Rompun (xylazine hydrochloride) for immobilizing deer influences hypothalamic function. PMID:2869876

  11. Characteristics of Antioxidant Systems of Yellow Fraction of Red Deer's (Cervus elaphus L.) Semen During the Rutting Period.

    Science.gov (United States)

    Koziorowska-Gilun, M; Szurnicka, M; Dziekonska, A; Kordan, W; Giżejewski, Z; Filipowicz, K

    2016-04-01

    The objective of this study was to make the preliminary characterization of the antioxidant defence systems of the yellow fraction (YF) of red deer's (Cervus elaphus L.) semen during the rutting period. The semen was collected using artificial vagina (AV). The studies included spectrophotometric determination of antioxidant enzymes activities such as superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPx). We also analysed the contents of low-molecular antioxidants such as L-glutathione (GSH + GSSG), L-ascorbate (ASC) and total antioxidant status (TAS). Additionally, the samples were subjected to PAGE and stained for SOD and GPx activities. It was demonstrated that the yellow fraction exhibited activities of SOD and GPx, with the highest activities in September and October. CAT activity was not detected. Staining for the SOD and GPx activities confirmed three protein bands with SOD activity and one protein band with GPx activity. The content of GSH + GSSG was similar in trials dating from October to December contrary to the content of ASC which was high in samples from September and October. The stable rate of TAS was observed during the whole rutting period. The results of this study showed that the YF of red deer semen is equipped with basic battery of antioxidant enzymes comprising SOD and GPx, with the supporting role of GSH + GSSG and ASC. Moreover, the samples obtained at the peak of the rutting period occurring from September to October had the highest enzymatic activity in comparison with remaining months of the rutting period, which contributed to the high quality of the semen by preventing it from the formation of oxidative stress during the short period of intense sexual activity of male red deer. The better understanding of the mechanisms of antioxidant defence systems in the YF of deer's semen may contribute to the potential use of this fraction in technology of wild ruminant semen preservation. PMID:26854018

  12. Immunohistochemical and biochemical characteristics of BSE and CWD in experimentally infected European red deer (Cervus elaphus elaphus

    Directory of Open Access Journals (Sweden)

    Dagleish Mark P

    2009-07-01

    Full Text Available Abstract Background The cause of the bovine spongiform encephalopathy (BSE epidemic in the United Kingdom (UK was the inclusion of contaminated meat and bone meal in the protein rations fed to cattle. Those rations were not restricted to cattle but were also fed to other livestock including farmed and free living deer. Although there are no reported cases to date of natural BSE in European deer, BSE has been shown to be naturally or experimentally transmissible to a wide range of different ungulate species. Moreover, several species of North America's cervids are highly susceptible to chronic wasting disease (CWD, a transmissible spongiform encephalopathy (TSE that has become endemic. Should BSE infection have been introduced into the UK deer population, the CWD precedent could suggest that there is a danger for spread and maintenance of the disease in both free living and captive UK deer populations. This study compares the immunohistochemical and biochemical characteristics of BSE and CWD in experimentally-infected European red deer (Cervus elpahus elaphus. Results After intracerebral or alimentary challenge, BSE in red deer more closely resembled natural infection in cattle rather than experimental BSE in small ruminants, due to the lack of accumulation of abnormal PrP in lymphoid tissues. In this respect it was different from CWD, and although the neuropathological features of both diseases were similar, BSE could be clearly differentiated from CWD by immunohistochemical and Western blotting methods currently in routine use. Conclusion Red deer are susceptible to both BSE and CWD infection, but the resulting disease phenotypes are distinct and clearly distinguishable.

  13. Mercury and selenium binding biomolecules in terrestrial mammals (Cervus elaphus and Sus scrofa) from a mercury exposed area.

    Science.gov (United States)

    Ropero, M J Patiño; Fariñas, N Rodríguez; Krupp, E; Mateo, R; Nevado, J J Berzas; Martín-Doimeadios, R C Rodríguez

    2016-06-01

    Mercury (Hg) is likely bound to large biomolecules (e.g. proteins) in living organisms, and in order to assess Hg metabolic pathways and possible toxicological effects, it is essential to study these Hg containing biomolecules. However, the exact nature of most metal binding biomolecules is unknown. Such studies are still in their infancy and information on this topic is scarce because the analysis is challenging, mainly due to their lability upon digestion or extraction from the tissue. New analytical methods that allow complex Hg-biomolecules to be analysed intact are needed and only few very recent studies deal with this approach. Therefore, as an initial step towards the characterization of Hg containing biomolecules, an analytical procedure has been optimised using size-exclusion chromatography (SEC) with inductively coupled plasma mass spectrometry (ICP-MS) detection. We applied this technique to elucidate the distribution and elution profile of Hg and Se, and some physiological important elements such as Fe, Ni, Zn and Cu, to assess metal binding profiles in liver and kidney samples of red deer (Cervus elaphus) and wild boar (Sus scrofa) who roam freely within the largest Hg mining district on Earth, Almadén in Spain. Elemental fractionation profiles of the extracts from different tissues were obtained using two different SEC columns (BioSep-SEC-S2000 GL 300-1kDa and Superdex 75 10/300 GL 70-3kDa). Similar profiles of Hg were observed in red deer and wild boar; however, significant differences were evident for liver and kidney. Moreover, the profiles of Se showed a single peak at high-medium molecular weight in all investigated tissues, while co-elution of Hg with Fe, Ni, Zn and Cu was observed. PMID:27093497

  14. ANTIBODY RESPONSE TO EPSILON TOXIN OF CLOSTRIDIUM PERFRINGENS IN CAPTIVE RED DEER (CERVUS ELAPHUS) OVER A 13-MONTH PERIOD.

    Science.gov (United States)

    Scala, Christopher; Duffard, Nicolas; Beauchamp, Guy; Boullier, Séverine; Locatelli, Yann

    2016-03-01

    Deer are sensitive to clostridial diseases, and vaccination with clostridial toxoids is the method of choice to prevent these infections in ruminants. The purpose of this study was to evaluate the serologic responses in red deer (Cervus elaphus) over a 13-mo period after vaccination with a multivalent clostridial vaccine, containing an aluminium hydroxide adjuvant. Antibody production to the Clostridium perfringens type D epsilon toxin component of the vaccine was measured using an indirect enzyme-linked immunosorbent assay. Animals from group 1 (9 mo old; n = 6) were naïve and received an initial vaccination with a booster vaccine 4 wk apart and one annual booster. Animals from group 2 (21 mo old; n = 10) had been previously vaccinated 12 mo prior and received a first annual booster at the beginning of this study and a second annual booster 12 mo later. The multivalent clostridial vaccine induced a high antibody response that peaked after each injection and then slowly decreased with time. In group 1, a booster vaccine was required to obtain an initial high humoral response. The annual booster injection induced a strong, rapid, and consistent anamnestic response in both groups. The serologic responses persisted significantly over the baseline value for 9-12 mo in group 1, but more than 12 mo in group 2. It is unknown whether the measured humoral immune responses would have been protective as no challenge studies were performed. Further investigation is needed to determine the protective antibody titers to challenge and how long this immunity might persist after vaccination. PMID:27010263

  15. Effect of the association of cattle and rusa deer (Cervus timorensis russa) on populations of cattle ticks (Boophilus microplus).

    Science.gov (United States)

    Barre, N; Bianchi, M; De Garine-Wichatitsky, M

    2002-10-01

    The wild population of rusa deer (Cervus timorensis russa) in New Caledonia (South Pacific) is nearly as large as the cattle population. The cattle tick is widespread and occurs all year round. Opinions are divided on the role of deer in the biological cycle of the tick: i) Do they maintain a sustainable tick population that is secondarily available for cattle? ii) Do they decrease the infestation of the environment by collecting larvae on the pasture, but preventing their development to the engorged female stage? or iii) Do they contribute to both situations? An experiment was conducted in three groups of pastures, each seeded with 450 000 larvae/ha and allowed to be grazed only by cattle, only by deer, and by a mixed herd of deer and cattle (deer representing 30% of the biomass), at approximately the same stocking rate (470-510 kg/ha). After 15 months of exposure, the tick burden per weight unit of host was 42 ticks/kg for the steers-only herd and 0.01/kg for the deer-only herd. The steers in the "mixed group" harbored 7 times fewer ticks (6.2/kg) than the cattle-only group, and the deer in the "mixed group," 130 times more (1.3/kg) than the deer-only group. Five emergency acaricide treatments had to be applied in the cattle-only group, but none in the other groups. The long-term sustainability of a viable tick population on deer as well as the potential benefit resulting from the association of deer and susceptible cattle in the tick control of cattle are highlighted. PMID:12381606

  16. 梅花鹿 LHβ基因的克隆及序列分析%The Cloning and Sequence Analysis of Cervus nippon LHβ Gene

    Institute of Scientific and Technical Information of China (English)

    竭航; 陈彬龙; 吴楠; 李地艳; 雷美艳; 张承露; 曾德军

    2015-01-01

    【目的】克隆梅花鹿 LHβ基因 CDS 区并进行序列分析。【方法】采用 PCR 克隆测序的方法获得梅花鹿 LHβ基因 CDS 区全序列,采用 ProtParam tool 等分子生物学工具对梅花鹿 LHβ蛋白的分子量、等电点、二级结构、蛋白功能等进行预测,并采用 MEGA 6.0软件构建进化树以确定其系统发育地位。【结果】梅花鹿 LHβ基因 CDS 区全长462 bp (GenBank 序列号为 KT199365),包含了 ATG 起始密码子和 TAA 终止密码子,共编码141个氨基酸,蛋白质分子量为15.17 kDa,等电点为8.00。梅花鹿 LHβ蛋白均位于膜外,无跨膜结构,平均疏水性(GRAVY)为0.391,蛋白功能预测显示,该蛋白最有可能为激素,这与本研究的目的基因相符。进化树分析结果表明,梅花鹿LHβ基因与山羊、绵羊和牛等反刍动物较近,其中与绵羊最近。【结论】梅花鹿 LHβ基因 CDS 区序列与绵羊 LHβ基因最近。%Objective]The aim of this study is to clone the LHβ gene CDS of Cervus nippon and analyze the structure and features of LHβprotein.[Method]The LHβ gene CDS of Cervus nip-pon was obtained by PCR,cloning and sequencing.Then,the structure and features of LHβpro-tein,including molecular weight,isoelectric point,secondary structure,function were predicted by online molecular biological tool,such as ProtParam tool.Meanwhile,we constructed a phylo-genetic tree by MEGA 6.0 software to further explain the genetic basis for this gene.[Results]The full CDS sequence of Cervus nippon LHβ gene was 462 bp (GenBank Accession No. KT199365),encoding 141 amino acids,which contained ATG start codon,and TGA stop codon, with a calculated molecular weight of 15.17 kDa and an isoelectric point of 8.00.No conserved transmembrane region was detected and all of the amino acids were located outside the membrane. The average of hydrophobicity (GRAVY)was 0.391.Function predicted results showed that the function of

  17. Glycolytic potential and ultimate muscle pH values in red deer (Cervus elaphus and fallow deer (Dama dama

    Directory of Open Access Journals (Sweden)

    Eva Wiklund

    2004-04-01

    Full Text Available The ultimate pH value of meat (measured at approx. 24 hours post slaughter gives information about the technological quality, i.e. shelf life, colour, water-holding properties and tenderness and is a direct consequence of muscle glycogen (energy levels at slaughter. It may therefore also indicate whether or not the animal has been exposed to stressful energy depleting events prior to slaughter. In the present study, 141 animals (130 red deer (Cervus elaphus and 11 fallow deer (Dama dama were included to investigate the relationship between ultimate pH and residual glycogen concentration in red deer and fallow deer M. longissimus. In addition, the muscle glycogen content and ultimate pH values in three red deer muscles (Mm. triceps brachii, longissimus and biceps femoris were studied. M. triceps brachii had higher ultimate pH and lower glycogen content compared with the other two studied muscles. The frequency of intermediate DFD (5.8≤ pH<6.2 was 5.4% in red deer M. longissimus, compared with 9.1% in fallow deer, while the frequency of DFD (pH≥ 6.2 was much lower in red deer (3.8% than in fallow deer (54.5%. A curvilinear relationship between ultimate pH and total glucose concentration (glycogen and glucose 30 min post slaughter in red deer and fallow deer M. longissimus was found. The relationship between muscle pH and lactic acid concentration however, was indicated to be linear. A significant variation in total glucose concentration at ultimate pH below 5.80 was observed, including values in the range from 18 to 123 mmol/kg wet tissue. It was concluded that further studies are needed to further explore the relationship between muscle glycogen content and technological and sensory quality attributes of meat from different deer species.Abstract in Swedish / Sammanfattning:Köttets pH-värde (mätt ca 24 timmar efter slakt har stor betydelse för den teknologiska kvaliteten som t. ex. hållbarhet, färg, vattenhållande förmåga och m

  18. Vaccination of elk (Cervus canadensis with Brucella abortus strain RB51 overexpressing superoxide dismutase and glycosyltransferase genes does not induce adequate protection against experimental Brucella abortus challenge

    Directory of Open Access Journals (Sweden)

    Pauline eNol

    2016-02-01

    Full Text Available In recent years, elk (Cervus canadensis have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area. In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the development of effective disease management strategies for wild elk herds is of utmost importance, not only for the prevention of reintroduction of brucellosis to cattle, but also for the overall health of the Greater Yellowstone Area elk populations. In two studies, we evaluated the efficacy of B. abortus strain RB51 over-expressing superoxide dismutase and glycosytransferase for protecting elk from infection and disease caused by B. abortus after experimental infection with a virulent B. abortus strain. Our data indicate that the recombinant vaccine does not protect elk against brucellosis. Further work is needed for development of an effective brucellosis vaccine for use in elk

  19. Oral vaccination with microencapsuled strain 19 vaccine confers enhanced protection against Brucella abortus strain 2308 challenge in red deer (Cervus elaphus elaphus).

    Science.gov (United States)

    Arenas-Gamboa, Angela M; Ficht, Thomas A; Davis, Donald S; Elzer, Philip H; Kahl-McDonagh, Melissa; Wong-Gonzalez, Alfredo; Rice-Ficht, Allison C

    2009-10-01

    Bison (Bison bison) and elk (Cervus elaphus nelsoni) in the Greater Yellowstone Area (GYA), USA, are infected with Brucella abortus, the causative agent of bovine brucellosis, and they serve as a wildlife reservoir for the disease. Bovine brucellosis recently has been transmitted from infected elk to cattle in Montana, Wyoming, and Idaho and has resulted in their loss of brucellosis-free status. An efficacious Brucella vaccine with a delivery system suitable for wildlife would be a valuable tool in a disease prevention and control program. We evaluated Strain 19 (S19) in a sustained release vehicle consisting of alginate microspheres containing live vaccine. In a challenge study using red deer (Cervus elaphus elaphus) as a model for elk, alginate, a naturally occurring polymer combined with a protein of Fasciola hepatica vitelline protein B was used to microencapsulate S19. Red deer were orally or subcutaneously immunized with 1.5 x 10(10) colony-forming units (CFUs) using microencapsulated S19. Humoral and cellular profiles were analyzed bimonthly throughout the study. The vaccinated red deer and nonvaccinated controls were challenged 1 yr postimmunization conjunctivally with 1 x 10(9) CFUs of B. abortus strain 2308. Red deer vaccinated with oral microencapsulated S19 had a statistically significant lower bacterial tissue load compared with controls. These data indicate for the first time that protection against Brucella-challenge can be achieved by combining a commonly used vaccine with a novel oral delivery system such as alginate-vitelline protein B microencapsulation. This system is a potential improvement for efficacious Brucella-vaccine delivery to wildlife in the GYA. PMID:19901378

  20. Acoustic behaviour of two large terrestrial mammals in relation to resources maintenance and mating systems: wolf(Canis lupus) and red deer (Cervus elaphus) as model species

    OpenAIRE

    Passilongo, Daniela

    2013-01-01

    The high variability of vocalization is due to their function, the habitat where they evolved and the physical constraints of the emitters. The aim of this study were to analyse the acoustic behaviour of two large terrestrial mammals, wolf (Canis lupus) and red deer (Cervus elaphus), in relation to resources maintenance and mating systems. Firstly, I analysed the Italian wolf howl. I found two forms of howl; both types are uttered within the lowest frequencies of the wolf’s vocal range,...

  1. PREVALENCE OF ANTIBIOTIC RESISTANT STRAINS OF ESCHERICHIA COLI AND ENTEROCOCCUS SPP. IN ROE DEER (CAPREOLUS CAPREOLUS) AND RED DEER (CERVUS ELAPHUS) AT THE PARCO NAZIONALE DEI MONTI SIBILLINI, ITALY

    OpenAIRE

    B. Cenci Goga; A. Vizzani; C. Monticelli; I. Nicchiarelli; P. Sechi; I. Pisano

    2009-01-01

    A case control study was performed in the Parco Nazionale dei Monti Sibillini, Italy, to find out whether roe deer (Capreolus capreolus) and red deer (Cervus elaphus) were more likely to harbour antibiotic resistant Escherichia coli in their faeces, compared to Enterococcus spp. Ten areas were selected and samples were collected during a fourmonths (May to August, 2008) sampling period. Samples of water (n=12) and feces (n=59), collected at 10 different sites, were cultured for E. coli and En...

  2. Chromoendoscopy with red phenol in the diagnosis of Helicobacter pylori infection Cromoendoscopia con rojo fenol en el diagnóstico de la infección por Helicobacter pylori

    Directory of Open Access Journals (Sweden)

    Héctor Rubén Hernández-Garcés

    2012-01-01

    Full Text Available An analytic study to validate a diagnostic test was carried out at the Institute of Gastroenterology in Havana, Cuba in adult patients of both sexes in whom chromoendoscopy was carried out with red phenol at 0.1% over the gastric mucosa for the detection of Helicobacter pylori infection between November 2008 and December 2010. The staining with red phenol at 0.1% is included in the invasive tests for the diagnosis of Helicobacter pylori infection and of the reactive techniques. The sensibility of red phenol dye in the diagnosis of Helicobacter pylori infection in the patients studied was of 72.6% with a confidence interval (C.I. of 95% (64.9 to 79.2% and a specificity of 75.5% C.I. 95% (61.9 to 85.4%. The positive predictive value was of 89.8% C.I. 95% (83.1 to 94.1% and the negative predictive value of 48.1% C.I. 95% (37.3 to 59.0%. The proportion of false positives was of 24.5% C.I. 95% (14.6 to 38.1% and the proportion of false negatives was of 27.4% C.I. 95% (20.8 to 35.1%. The diagnostic accuracy of the dye on the patients studied was 73.3% C.I. 95% (66.7 to 79.0%. The diagnostic odds ratio was 8.17 C.I. 95% (3.88 to 17.23, the J Youden ratio of 0.5 and the Kappa coefficient of 0.40 C.I. 95% (0.27 to 0.54. The staining dye with red phenol at 0.1% resulted in a useful method in the diagnosis of Helicobacter pylori infection in the gastric mucosa,it can be applied in our environment and has multiple advantages (topographic localization, avoids contamination and fast and immediate reading.Se realizó un estudio analítico de validación de prueba diagnóstica a pacientes adultos de ambos sexos, en el Instituto de Gastroenterología de La Habana. Cuba, a los cuales se les realizó cromoendoscopia con rojo fenol al 0,1% sobre la mucosa gástrica para la detección de infección por Helicobacter pylori, entre noviembre de 2008 y diciembre de 2010. La tinción con rojo fenol al 0,1% se encuentra dentro de las pruebas invasivas para la detecci

  3. ESTUDIO DE LA ASOCIACIÓN Gluconacetobacter diazotrophicus-VIANDAS TROPICALES EN SUELO FERRALÍTICO ROJO.I. SELECCIÓN DE CEPAS EFECTIVAS PARA LA BIOFERTILIZACIÓNDE BONIATO, YUCA Y MALANGA

    Directory of Open Access Journals (Sweden)

    B. Dibut

    2010-01-01

    Full Text Available El interés de la comunidad científica internacionalpor la bacteria endófita Gluconacetobacter diazotrophicus,microorganismo fijador de nitrógeno atmosférico y productorde sustancias promotoras del crecimiento vegetal, se haincrementado en los últimos años. Por lo que teniendo en cuentasu potencial agrobiológico y los escasos estudios sobre elefecto que puede provocar la aplicación de productos elaboradosa partir de la fermentación de cepas efectivas, se diseñó estainvestigación, con el objetivo de seleccionar una cepa deGluconacetobacter diazotrophicus efectiva para estimular elcrecimiento, desarrollo y rendimiento de viandas tropicales,como son el boniato (Ipomea batatas Lam., la yuca (Manihotesculenta, Crantz y la malanga (Xanthosoma spp., cultivadossobre suelo un Ferralítico Rojo. La cepa INIFAT Abn1, aisladadel cultivo del boniato, fue la más promisoria para incrementarlos diferentes indicadores en los tres cultivos, con incrementosen valores de estimulación entre 23 y 46 %. Se demostró laimportancia de contar con una colección de amplia diversidadpara realizar una selección adecuada, así como la no existenciade una relación directa cultivo de procedencia-efectividad dela cepa.

  4. EVALUACIÓN ECONÓMICA DE DIFERENTES FORMULACIONES QUÍMICAS EN EL CULTIVO DE LA PAPA (Solanum tuberosum L. EN UN SUELO FERRALÍTICO ROJO DE LA PROVINCIA LA HABANA

    Directory of Open Access Journals (Sweden)

    Josefa Ruiz

    2003-01-01

    Full Text Available Durante el período 1999-2001, se llevaron a cabo dos experimentos de campo y una extensión agrícola, con el objetivo de evaluar el efecto de diferentes formulaciones de fertilizantes químicos sobre el cultivo de la papa en las condiciones de suelos Ferralíticos Rojos de La Habana. Los resultados mostraron una alta respuesta de la papa a las formulaciones aplicadas, dada por el efecto de estas sobre el crecimiento, el rendimiento y sus componentes. Los más altos rendimientos del cultivo se obtuvieron con la aplicación combinada de las fórmulas complejas de nitrato chileno (en plantación y nitratos simples (N-0-K a los 30 ddp, en especial con la utilización de las fórmulas 14-20-20-2-2 en plantación y 15-0-14 a los 30 ddp, obteniéndose incrementos en los rendimientos por encima de la variante de producción de 14.67 t.ha-1 (rendimiento total, 13.75 t.ha-1 (rendimiento comercial, norma cubana y 15.45 t.ha-1 (rendimiento comercial, norma internacional; en condiciones de producción, estos incrementos fueron de 2.29 t.ha- 1.

  5. Efectividad biológica de la tecnología Oxadiargyl– Oxadiazón en el control de arroz rojo y otras malezas en el cultivo de arroz.

    Directory of Open Access Journals (Sweden)

    Jorge García de la Osa

    2014-12-01

    Full Text Available El trabajo fue realizado en un campo de producción comercial de arroz de la Empresa Agroindustrial de Granos “Sur del jíbaro”, Sancti Spíritus, Cuba, con la finalidad de evaluar la efectividad biológica de la tecnología que combina la aplicación de Oxadiargyl sobre lámina de agua con aniego después de fangueo del suelo y aspersión de Oxadiazón en estado de germinación del arroz. Se determinó que el tratamiento compuesto por la aplicación del herbicida Oxadiargyl (400 g ia/ℓ a dosis de 600 g ia/ha, aniego durante 15 días, siembra con semilla sin tratar y aplicación del herbicida Oxadiazón (380 g ia/ℓ a dosis de 684 g ia/ha en estado de germinación del arroz, fue el que mejor comportamiento tuvo en cuanto a rendimiento agrícola y control de arroz rojo (92.5 %, gramíneas (100 %, hojas anchas (95 % y ciperáceas (100 %. El herbicida Oxadiargyl a dosis de 400 y 600 g ia/ha ocasionó afectación en la germinación y daño fitotóxico en los estados iniciales de crecimiento del arroz, pero éste se recuperó en el transcurso del ciclo del cultivo sin efecto negativo sobre el rendimiento agrícola.

  6. PARTICIPACIÓN DEL NITRÓGENO DE LOS ABONOS VERDES EN LA NUTRICIÓN NITROGENADA DEL MAÍZ (Zea mays L. CULTIVADO SOBRE SUELO FERRALÍTICO ROJO

    Directory of Open Access Journals (Sweden)

    Gloria M. Martín

    2002-01-01

    Full Text Available El presente trabajo se realizó con el objetivo de estudiar la eficiencia del nitrógeno incorporado con los abonos verdes, utilizados como precedente en el cultivo del maíz en un suelo Ferralítico Rojo de La Habana. Para ello, se estudió el grado de participación de diferentes fuentes de nitrógeno (abonos verdes y fertilizante mineral en la nutrición nitrogenada del maíz, mediante los métodos isotópico y de las diferencias. El experimento se condujo en condiciones de macetas (5 kg y se estudió comparativamente el efecto de la Canavalia ensiformis y del fertilizante mineral (sulfato de amonio, así como estas dos fuentes mezcladas sobre la nutrición nitrogenada del maíz. Se pudo observar que la presencia de las plantas de maíz intensifica el proceso de mineralización y disponibilidad del nitrógeno de los abonos verdes; además, este cultivo tiene una fuerte y significativa respuesta a la fertilización nitrogenada, destacándose el tratamiento que combina el uso de abono verde y fertilizante mineral, con el cual se obtuvo un mayor rendimiento en masa seca y contenido de nitrógeno, lográndose con esta combinación coeficientes de aprovechamiento del nitrógeno de los abonos verdes de hasta 68 %. La mineralización del N aplicado ocurrió rápidamente y a los 30 días (ddg prácticamente no se encontró N mineral en las macetas, consecuencia directa de la activa absorción de este elemento por las plantas de maíz.

  7. Variación espacio-temporal de la densidad poblacional de erizo rojo Strongylocentrotus franciscanus (Echinodermata: Echinoidea: Strongylocentrotidae en Baja California Spatial and temporal variation of the population density of the red sea urchin Stronngylocenntrotus franciscanus (Echinodermata: Echinoidea: Strongylocentrotidae in Baja California

    Directory of Open Access Journals (Sweden)

    Julio S. Palleiro-Nayar

    2012-04-01

    Full Text Available Se estimó la densidad poblacional de erizo rojo, Strongylocentrotus franciscanus, en 10 localidades de la costa occidental de Baja California, México, donde se realiza la extracción comercial de este recurso pesquero. Se compararon las estimaciones realizadas en cuatro años muestreados: 2003, 2005, 2006 y 2008. Las variaciones observadas en las localidades analizadas indicaron diferencias espacio-temporales para la densidad de erizo rojo y diferencias en la estructura de tallas, las cuales estuvieron influenciadas principalmente por la intensidad de la pesca y al esporádico reclutamiento en cada sitio. Se encontraron dos localidades (Isla San Jerónimo y Arrecife Sacramento que destacaron por presentar una alta densidad de erizo rojo y una amplia estructura de tallas, predominando individuos de tallas entre 50 a 80 mm diámetro de caparazón, lo que podría indicar que la intensidad de pesca aparentemente tiene un menor efecto que en los otros sitios.Density estimations of red sea urchin Strongylocentrotus franciscanus were recorded in ten sites with commercial fisheries on the west coast of Baja California, Mexico. The estimations for the years 2003, 2005, 2006 and 2008 were compared. The variations observed in the study sites indicate important spatial and temporal differences in density and size structure, influenced by fishing intensity and sporadic recruitment in each site. We found two sites (San Jeronimo Island and Sacramento Reef with a high density and wide size structure; with a predominance of individuals of sizes from 50 to 80 mm with lest impact possible in fishing mortality for all sites.

  8. På vej mod en dansk krondyrforvaltning (Cervus elaphus): Hvad mangler vi at vide, og hvad mangler vi at gøre?

    DEFF Research Database (Denmark)

    Sunde, Peter; Haugaard, Lars

    2014-01-01

    bestanden og jagtudbyttet på, vil være at frede de unge hjorte mod at have fri jagt på dem, som har nået ”høstklar” alder. Ud over at sikre jægerne et bedre udbytte vil en sådan ”mindstemålsmodel” modvirke selektion for tidligere kønsmodenhed og mindre kropstørrelse for hjorte. In Denmark, red deer (Cervus....... We compared the harvest outcome and demographic composition of these theoretical models with two Danish red deer populations with contrasting land owner structure and hunting regimes (Djursland and Oksbøl). Djursland (hunting seasons 2008/9-2012/13) represents a ‘typical’ Danish landscape, comprising...... of maintaining a stable red deer population with a high proportion of mature stags. We demonstrate that the harvest pattern on Djursland (with an annual mortality of 50% of 2-7 year old stags wherefore less than 1 % of male calves survive until 8 years of age) result in far fewer mature stags in the...

  9. A relapsing fever group Borrelia sp. similar to Borrelia lonestari found among wild sika deer (Cervus nippon yesoensis) and Haemaphysalis spp. ticks in Hokkaido, Japan.

    Science.gov (United States)

    Lee, Kyunglee; Takano, Ai; Taylor, Kyle; Sashika, Mariko; Shimozuru, Michito; Konnai, Satoru; Kawabata, Hiroki; Tsubota, Toshio

    2014-10-01

    A relapsing fever Borrelia sp. similar to Borrelia lonestari (herein referred to as B. lonestari-like) was detected from wild sika deer (Cervus nippon yesoensis) and Haemaphysalis ticks in the eastern part of Hokkaido, Japan. The total prevalence of this Borrelia sp. in tested deer blood samples was 10.6% using conventional PCR and real-time PCR. The prevalence was significantly higher in deer fawns compared to adults (21.9% and 9.4%, respectively). Additionally, there was significant regional difference between our two sampling areas, Shiretoko and Shibetsu with 17% and 2.8% prevalence, respectively. Regional differences were also found in tick species collected from field and on deer. In the Shiretoko region, Haemaphysalis spp. were more abundant than Ixodes spp., while in Shibetsu, Ixodes spp. were more abundant. Using real-time PCR analysis, B. lonestari-like was detected from 2 out of 290 adult Haemaphysalis spp. ticks and 4 out of 76 pools of nymphs. This is the first report of a B. lonestari-like organism in Haemaphysalis spp. ticks, and the first phylogenetic analysis of this B. lonestari-like organism in Asia. Based on our results, Haemaphysalis spp. are the most likely candidates to act as a vector for B. lonestari-like; furthermore, regional variation of B. lonestari-like prevalence in sika deer may be dependent on the population distribution of these ticks. PMID:25108784

  10. X- and Y-chromosome specific variants of the amelogenin gene allow sex determination in sheep (Ovis aries and European red deer (Cervus elaphus

    Directory of Open Access Journals (Sweden)

    Brenig B

    2005-03-01

    Full Text Available Abstract Background Simple and precise methods for sex determination in animals are a pre-requisite for a number of applications in animal production and forensics. However, some of the existing methods depend only on the detection of Y-chromosome specific sequences. Therefore, the abscence of a signal does not necessarily mean that the sample is of female origin, because experimental errors can also lead to negative results. Thus, the detection of Y- and X-chromosome specific sequences is advantageous. Results A novel method for sex identification in mammals (sheep, Ovis aries and European red deer, Cervus elaphus is described, using a polymerase chain reaction (PCR and sequencing of a part of the amelogenin gene. A partial sequence of the amelogenin gene of sheep and red deer was obtained, which exists on both X and Y chromosomes with a deletion region on the Y chromosome. With a specific pair of primers a DNA fragment of different length between the male and female mammal was amplified. Conclusion PCR amplification using the amelogenin gene primers is useful in sex identification of samples from sheep and red deer and can be applied to DNA analysis of micro samples with small amounts of DNA such as hair roots as well as bones or embryo biopsies.

  11. Complete mitochondrial genome sequence of a Hungarian red deer (Cervus elaphus hippelaphus) from high-throughput sequencing data and its phylogenetic position within the family Cervidae.

    Science.gov (United States)

    Frank, Krisztián; Barta, Endre; Bana, Nóra Á; Nagy, János; Horn, Péter; Orosz, László; Stéger, Viktor

    2016-06-01

    Recently, there has been considerable interest in genetic differentiation in the Cervidae family. A common tool used to determine genetic variation in different species, breeds and populations is mitochondrial DNA analysis, which can be used to estimate phylogenetic relationships among animal taxa and for molecular phylogenetic evolution analysis. With the development of sequencing technology, more and more mitochondrial sequences have been made available in public databases, including whole mitochondrial DNA sequences. These data have been used for phylogenetic analysis of animal species, and for studies of evolutionary processes. We determined the complete mitochondrial genome of a Central European red deer, Cervus elaphus hippelaphus, from Hungary by a next generation sequencing technology. The mitochondrial genome is 16 354 bp in length and contains 13 protein-coding genes, two rRNA genes, 22 tRNA genes and a control region, all of which are arranged similar as in other vertebrates. We made phylogenetic analyses with the new sequence and 76 available mitochondrial sequences of Cervidae, using Bos taurus mitochondrial sequence as outgroup. We used 'neighbor joining' and 'maximum likelihood' methods on whole mitochondrial genome sequences; the consensus phylogenetic trees supported monophyly of the family Cervidae; it was divided into two subfamilies, Cervinae and Capreolinae, and five tribes, Cervini, Muntiacini, Alceini, Odocoileini, and Capreolini. The evolutionary structure of the family Cervidae can be reconstructed by phylogenetic analysis based on whole mitochondrial genomes; which method could be used broadly in phylogenetic evolutionary analysis of animal taxa. PMID:27165525

  12. A Molecular and Serological Survey of Rickettsiales Bacteria in Wild Sika Deer (Cervus nippon nippon) in Shizuoka Prefecture, Japan: High Prevalence of Anaplasma Species.

    Science.gov (United States)

    Wu, Dongxing; Wuritu; Yoshikawa, Yuko; Gaowa; Kawamori, Fumihiko; Ikegaya, Asaka; Ohtake, Masayoshi; Ohashi, Masataka; Shimada, Masahiko; Takada, Ayumi; Iwai, Katsuki; Ohashi, Norio

    2015-01-01

    We surveyed Rickettsiales bacteria, including Rickettsia, Ehrlichia, Anaplasma, and Neoehrlichia, in wild sika deer (Cervus nippon nippon) from Shizuoka prefecture, Japan. In spleen samples from 187 deer, Anaplasma phagocytophilum (deer type), A. bovis, and A. centrale were successfully detected by PCR assay targeting to 16S rDNA or p44/msp2, and their positive rates were 96.3% (180/187), 53.5% (100/187), and 78.1% (146/187), respectively. Additionally, 2 or 3 Anaplasma species could be detected from a single deer in 165 spleen samples (88.2%), indicating dual or triple infection. In contrast, A. phagocytophilum (human type) 16S rDNA, Rickettsia gltA, Ehrlichia p28/omp-1, and Neoehrlichia 16S rDNA could not be amplified. The serological test of 105 deer serum samples by immunofluorescence assay showed that the detection of antibodies against antigens of A. phagocytophilum HZ (US-human isolate) and Rickettsia japonica YH were 29.5% (31/105) and 75.2% (79/105), respectively. These findings suggest that A. phagocytophilum (deer type), A. centrale, and A. bovis are highly dominant and prevalent in wild sika deer from Shizuoka, a central region of Japan, and that the antibodies against some Rickettsiales bacteria have also been retained in deer blood. PMID:25971318

  13. Mismatch repair mRNA and protein expression in intestinal adenocarcinoma in sika deer (Cervus nippon) resembling heritable non-polyposis colorectal cancer in man.

    Science.gov (United States)

    Jahns, H; Browne, J A

    2015-01-01

    Intestinal adenocarcinomas seen in an inbred herd of farmed sika deer (Cervus nippon) morphologically resembled human hereditary non-polyposis colorectal cancer (HNPCC). Features common to both included multiple de novo sites of tumourigenesis in the proximal colon, sessile and non-polyposis mucosal changes, the frequent finding of mucinous type adenocarcinoma, lymphocyte infiltration into the neoplastic tubules and Crohn's-like lymphoid follicles at the deep margin of the tumour. HNPCC is defined by a germline mutation of mismatch repair (MMR) genes resulting in their inactivation and loss of expression. To test the hypothesis that similar MMR gene inactivation occurs in the deer tumours, the expression of the four most important MMR genes, MSH2, MLH1, MSH6 and PMS2, was examined at the mRNA level by reverse transcriptase polymerase chain reaction (n = 12) and at the protein level by immunohistochemistry (n = 40) in tumour and control tissues. All four genes were expressed equally in normal and neoplastic tissues, so MMR gene inactivation could not be implicated in the carcinogenesis of this tumour in sika deer. PMID:25678423

  14. Effect of the Velvet Antler of Formosan Sambar Deer (Cervus unicolor swinhoei on the Prevention of an Allergic Airway Response in Mice

    Directory of Open Access Journals (Sweden)

    Ching-Yun Kuo

    2012-01-01

    Full Text Available Two mouse models were used to assay the antiallergic effects of the velvet antler (VA of Formosan sambar deer (Cervus unicolor swinhoei in this study. The results using the ovalbumin- (OVA- sensitized mouse model showed that the levels of total IgE and OVA-specific IgE were reduced after VA powder was administrated for 4 weeks. In addition, the ex vivo results indicated that the secretion of T helper cell 1 (Th1, regulatory T (Treg, and Th17 cytokines by splenocytes was significantly increased (P<0.05 when VA powder was administered to the mice. Furthermore, OVA-allergic asthma mice that have been orally administrated with VA powder showed a strong inhibition of Th2 cytokine and proinflammatory cytokine production in bronchoalveolar fluid compared to control mice. An increase in the regulatory T-cell population of splenocytes in the allergic asthma mice after oral administration of VA was also observed. All the features of the asthmatic phenotype, including airway inflammation and the development of airway hyperresponsiveness, were reduced by treatment with VA. These findings support the hypothesis that oral feeding of VA may be an effective way of alleviating asthmatic symptoms in humans.

  15. Predisposition assessment of mountainous forests to bark peeling by red deer (Cervus elaphus L. as a strategy in preventive forest habitat management

    Directory of Open Access Journals (Sweden)

    Friedrich Reimoser

    2011-06-01

    Full Text Available This paper presents a method to assess the predisposition of mountainous forests to bark peeling by red deer (Cervus elaphus, which illustrates options in preventive forest habitat management. We developed an expert system, based on expert interviews and literature analyses. We selected the most important site- and stand-related predisposing factors for bark peeling of red deer, considering the relation of food dependent and food independent settling stimuli. Within the mechanistic expert system, knowledge on predisposing effects of certain site and stand features is represented in the form of an award-penalty point system. In the current paper, we present the predisposition assessment system for bark peeling and the verification of the system with data of the inventory of natural resources of the Limestone Alps National Park (Upper Austria. Three site-related indicators, i.e. terrain features, roughness/smoothness of relief, and local climate, and six stand-related indicator, i.e. tree age, canopy cover, proportion of conifers, cover of herb layer, method of final cutting, and harassment, were included in the system. Both the chosen indicators and the overall assessment clearly reflected the predisposition in terms of relative frequencies of peeled and unpeeled sample plots. A supplemental logistic regression run with the occurrence/absence of bark peeling as response variable and the assessed predisposition scores from the PAS as explanatory variable proved the discriminatory value of the PAS.

  16. Population genetic structure of wild and farmed rusa deer (Cervus timorensis russa) in New-Caledonia inferred from polymorphic microsatellite loci.

    Science.gov (United States)

    de Garine-Wichatitsky, M; de Meeûs, T; Chevillon, C; Berthier, D; Barré, N; Thévenon, S; Maillard, J-C

    2009-12-01

    Historical records indicate that 12 rusa deer (Cervus timorensis russa) were introduced in New-Caledonia during the 1870s. We used eight polymorphic microsatellite DNA loci to assess the genetic differentiation and diversity of farmed and wild deer populations. Past genetic bottlenecks were detected in both sub-populations, although higher genetic diversity was maintained in farmed populations, probably due to the regular introduction of reproducers from wild populations and from other farms. The genetic structure of farmed and wild populations differed significantly. There was a significant isolation by distance for wild populations, whereas farmed populations were significantly differentiated between farms independently from their geographical proximity. Wild rusa deer consisted of small populations (with effective population sizes ranging between 7 and 19 individuals depending on the methods used), with a low parent-offspring dispersion range (0.20-2.02 km). Genetic tools and direct observations provided congruent estimates of dispersion and population sizes. We discuss the relevance of our results for management purposes. PMID:19680748

  17. EVALUACION DEL POTENCIAL DE LOS BIOSÓLIDOS PROCEDENTES DEL TRATAMIENTO DE AGUAS RESIDUALES PARA USO AGRÍCOLA Y SU EFECTO SOBRE EL CULTIVO DE RABANO ROJO (Raphanus sativus L.). EVALUATION OF THE POTENTIAL FOR BIOSOLIDS OBTAINED FROM WASTEWATER TREATMENT FOR AGRICULTURAL USE AND THEIR EFFECT ON CULTIVATION OF RED RADISH (Raphanus sativus L.)

    OpenAIRE

    Ramiro Ramírez Pisco; Martha Inés Pérez Arenas

    2006-01-01

    El trabajo se adelantó en predios de la planta de tratamiento de aguas residuales “El Salitre”, en la ciudad de Bogotá, con el propósito de evaluar el potencial del subproducto del tratamiento de aguas residuales “biosólido”, para su aplicación en la agricultura por medio de la valoración del crecimiento, desarrollo y producción del cultivo de rábano rojo, y establecer una posible alternativa al problema de disposición final de 3900 toneladas de este material generado mensualmente en las plan...

  18. Niveles de nitrógeno y su fraccionamiento en el cultivo del gladiolo para suelos Ferralíticos Rojos Nitrogen levels and their fractioning in gladiolus cultivation for Ferralitic Red soils

    Directory of Open Access Journals (Sweden)

    María Isabel Hernández Díaz

    2008-01-01

    Full Text Available El objetivo del presente estudio fue evaluar niveles crecientes de nitrógeno y momentos de aplicación del fertilizante nitrogenado en el cultivo del gladiolo. La experiencia se desarrolló en el Instituto de Investigaciones Hortícolas Liliana Dimitrova (Municipio de Quivicán, La Habana, Cuba, en un suelo Ferralítico Rojo, entre los meses de octubre y febrero de las campañas 2004/2005 y 2005/2006. Se evaluaron los componentes de la calidad de las espigas y del material de plantación, así como el efecto de los tratamientos en el estado nutricional de la planta y en la vida en anaquel de las espigas. No se observaron diferencias entre las dosis de nitrógeno y los momentos de aplicación del fertilizante en las variables de calidad de la espiga y del cormo. No obstante, con la variante 70 kg ha-1 de N, aplicada ½ en plantación y ½ a los 60 días posteriores, se logra un mayor porcentaje de espigas ubicadas en las categorías comerciales y un menor número de tallos florales de calidad inferior. En cuanto al estado nutricional de la plantación, existe una relación positiva entre los niveles y los contenidos foliares de nitrógeno aplicados.The objective of this study was to evaluate growing nitrogen levels and application time of the nitrogen fertilizer in gladiolus cultivation. The experiment was carried out at Instituto de Investigaciones Hortículas Liliana Dimitrova (in the Municipality of Quivicán, La Habana, Cuba in an Oxisol soil, from October to February of the 2004-2005 and 2005-2006 crop seasons. The quality components of the spikes and plant material were evaluated, as well as the effect of the treatments on the plant nutritional state and the shelf life of the spikes. No differences between nitrogen doses and fertilizer application time in quality variables of spikes and corms were observed. Nevertheless, with the variant 70 kg ha-1 of N, one half applied in plantation and the other half applied 60 days later, a higher

  19. A Possible Role for Rusa Deer (Cervus timorensis russa and Wild Pigs in Spread of Trypanosoma evansi from Indonesia to Papua New Guinea

    Directory of Open Access Journals (Sweden)

    SA Reid

    1999-03-01

    Full Text Available Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were monitored each second day for 120 days. Trypanosomes were observed in haematocrit tubes at the plasma-buffy coat interface of jugular blood of deer and pigs on 86% and 37% of sampling occasions respectively. Parasitaemia was at a high level in deer for 35% of the time but for only 11.5% of the time in pigs. Results indicate that both Rusa deer and pigs have a high tolerance for infection with T. evansi. The deer suffered mild anaemia evidenced by a 25% reduction in packed cell volume (PCV 14 days after infection which coincided with the initial peak in parasitaemia. However, PCV had returned to pre infection values by the end of the experiment. The pigs showed no change in PCV. There were no visual indications of disease in either species and appetite was not noticeably affected. It was concluded that both Rusa deer and pigs were capable reservoir hosts for T. evansi but that Rusa deer, with their more persistent higher levels of parasitaemia, have more potential to spread T. evansi into Papua New Guinea from West Irian than pigs.

  20. A field survey on the status of gastrointestinal helminth parasites in hangul (Cervus elaphus hanglu) in Dachigam National Park of Kashmir.

    Science.gov (United States)

    Lone, Bashir A; Chishti, M Z; Ahmad, Fayaz; Tak, Hidayatullah; Bandh, Suhaib A; Khan, Abida

    2016-09-01

    One year crossectional survey was carried out to determine and describe the prevalence and intensity of gastrointestinal parasite infections in hangul (Cervus elaphus hanglu) in Dachigam National Park of Kashmir through faecal examinations. Out of 153 faecal samples examined, 82 (53.59 %) were found infected with GIT helminthes. In present study seven helminth species were found, including five nematode [Haemonchus contortus (55.39 %), Trichuris ovis (39.75 %), Dictyocaulus viviparus (28.4.00 %), Oesophogostomum circumcincta (13.7 %) and Chabertia ovina (4.02 %)] one trematode [Fasciola hepatica (17.3 %)] and one cestode species [Moneizia expansa (6.05 %)]. Based on the severity of infection 81.7 % of hangul positive samples were severely infected (epg > 1,500), 8.3 % heavily infected (epg = 1,100-1,500), 3.8 % moderately infected (epg = 800-1,000) and 7.2 % mildly infected (epg = 500). Season, sex and age were the factors that influenced the epidemiological prevalence of GIT helminths in hangul in the present study. The maximum helminth infection was observed in summer season and lowest in winter (P = 0.003). Lower age groups were more infected than adult animals (P > 0.05). Prevalence was higher in males than females (P > 0.05). The present study will initially be of great significance to add to existing knowledge of the epidemiology of GIT helminth of hangul which is the pioneering study on this animal in the valley and the findings will be quite helpful to devise the appropriate control and prophylactic strategies for GIT helminthiasis of hangul in the Dachigam national park. PMID:27605778

  1. Pragmatic perspective on conservation genetics and demographic history of the last surviving population of Kashmir red deer (Cervus elaphus hanglu in India.

    Directory of Open Access Journals (Sweden)

    Mukesh

    Full Text Available The hangul (Cervus elaphus hanglu is of great conservation concern because it represents the easternmost and only hope for an Asiatic survivor of the red deer species in the Indian subcontinent. Despite the rigorous conservation efforts of the Department of Wildlife Protection in Jammu & Kashmir, the hangul population has experienced a severe decline in numbers and range contraction in the past few decades. The hangul population once abundant in the past has largely become confined to the Dachigam landscape, with a recent population estimate of 218 individuals. We investigated the genetic variability and demographic history of the hangul population and found that it has shown a relatively low diversity estimates when compared to other red deer populations of the world. Neutrality tests, which are used to evaluate demographic effects, did not support population expansion, and the multimodal pattern of mismatch distribution indicated that the hangul population is under demographic equilibrium. Furthermore, the hangul population did not exhibit any signature of bottleneck footprints in the past, and Coalescent Bayesian Skyline plot analysis revealed that the population had not experienced any dramatic changes in the effective population size over the last several thousand years. We observed a strong evidence of sub-structuring in the population, wherein the majority of individuals were assigned to different clusters in Bayesian cluster analysis. Population viability analysis demonstrated insignificant changes in the mean population size, with a positive growth rate projected for the next hundred years. We discuss the phylogenetic status of hangul for the first time among the other red deer subspecies of the world and strongly recommend to upgrade hangul conservation status under IUCN that should be discrete from the other red deer subspecies of the world to draw more conservation attention from national and international bodies.

  2. Prevalence of Liver Fluke (Fasciola hepatica) in Wild Red Deer (Cervus elaphus): Coproantigen ELISA Is a Practicable Alternative to Faecal Egg Counting for Surveillance in Remote Populations.

    Science.gov (United States)

    French, Andrew S; Zadoks, Ruth N; Skuce, Philip J; Mitchell, Gillian; Gordon-Gibbs, Danielle K; Craine, Alexandra; Shaw, David; Gibb, Stuart W; Taggart, Mark A

    2016-01-01

    Red deer (Cervus elaphus) are hosts of liver fluke (Fasciola hepatica); yet, prevalence is rarely quantified in wild populations. Testing fresh samples from remote regions by faecal examination (FE) can be logistically challenging; hence, we appraise frozen storage and the use of a coproantigen ELISA (cELISA) for F. hepatica surveillance. We also present cELISA surveillance data for red deer from the Highlands of Scotland. Diagnoses in faecal samples (207 frozen, 146 fresh) were compared using a cELISA and by FE. For each storage method (frozen or fresh), agreement between the two diagnostics was estimated at individual and population levels, where population prevalence was stratified into cohorts (e.g., by sampling location). To approximate sensitivity and specificity, 65 post-slaughter whole liver examinations were used as a reference. At the individual level, FE and cELISA diagnoses agreed moderately (κfrozen = 0.46; κfresh = 0.51), a likely reflection of their underlying principles. At the population level, FE and cELISA cohort prevalence correlated strongly (Pearson's R = 0.89, p advantages of cELISA over FE: i) the ability to store samples long term (frozen) without apparent loss in diagnostic power; and ii) reduced labour and the ability to process large batches. Further evaluation of cELISA sensitivity in red deer, where a range of fluke burdens can be obtained, is desirable. In the interim, the cELISA is a practicable diagnostic for F. hepatica surveillance in red deer, and its application here has revealed considerable geographic, temporal, sex and age related differences in F. hepatica prevalence in wild Scottish Highland red deer. PMID:27598003

  3. A possible role for rusa deer (Cervus timorensis russa) and wild pigs in spread of Trypanosoma evansi from Indonesia to Papua New Guinea.

    Science.gov (United States)

    Reid, S; Husein, A; Hutchinson, G; Copeman, D

    1999-01-01

    Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa) and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were monitored each second day for 120 days. Trypanosomes were observed in haematocrit tubes at the plasma-buffy coat interface of jugular blood of deer and pigs on 86% and 37% of sampling occasions respectively. Parasitaemia was at a high level in deer for 35% of the time but for only 11.5% of the time in pigs. Results indicate that both Rusa deer and pigs have a high tolerance for infection with T. evansi. The deer suffered mild anaemia evidenced by a 25% reduction in packed cell volume (PCV) 14 days after infection which coincided with the initial peak in parasitaemia. However, PCV had returned to pre infection values by the end of the experiment. The pigs showed no change in PCV. There were no visual indications of disease in either species and appetite was not noticeably affected. It was concluded that both Rusa deer and pigs were capable reservoir hosts for T. evansi but that Rusa deer, with their more persistent higher levels of parasitaemia, have more potential to spread T. evansi into Papua New Guinea from West Irian than pigs. PMID:10224527

  4. Relaciones nitrógeno-potasio en fertirriego para el cultivo protegido del tomate en suelo Ferralítico Rojo Nitrogen-potassium ratios in fertirrigation for protected cultivation of tomato in Red Ferralitic soil

    Directory of Open Access Journals (Sweden)

    María Isabel Hernández Díaz

    2009-05-01

    Full Text Available El objetivo del presente trabajo fue evaluar el efecto de soluciones nutritivas en el fertirriego, con diferentes relaciones entre el nitrógeno y el potasio, en la productividad y calidad de los frutos del tomate (híbrido Hazera 3019, en suelo Ferralítico Rojo. La experiencia se desarrolló en el Instituto de Investigaciones Hortícolas Liliana Dimitrova (La Habana, Cuba. Se estudiaron cuatro soluciones nutritivas, que se diferenciaron en su relación NO3-+NH4+/K+ en términos de meq L-1 (N/K, con una relación K+/Ca2++Mg2+ en todas las variantes de 0,75. Los tratamientos resultantes (T1, 1:0,45; T2, 1:0,60 o testigo de producción, T3, 1:0,75 y T4, 1:0,90 fueron distribuidos en un diseño completamente aleatorizado con cuatro réplicas. La variación de la relación N/K en la solución nutritiva influyó en el rendimiento, la calidad externa y la vida en anaquel de los frutos de tomate, sin afectar la calidad bromatológica. La mejor combinación entre estructura del rendimiento y calidad de los frutos se obtiene con la relación N/K 1:0,75, al presentar rendimientos superiores en las categorías de calidad comercial extra, primera y extra más primera, así como frutos con mayor firmeza y grosor del endocarpio, menor porcentaje de frutos fuera de norma y valores inferiores de pérdidas postcosecha.The objective of the present work was to evaluate the effect of nutrient solutions in fertirrigation, with different nitrogen-potassium ratios, on yield and quality of tomato fruits (hybrid Hazera 3019 in Red Ferralitic soil (Oxisol. The trial was performed at Instituto de Investigaciones Hortícolas Liliana Dimitrova (La Habana, Cuba. Four nutrient solutions were studied, which were different in their NO3-+NH4+/K+ ratios in terms of meq L-1 (N/K, keeping a K+/Ca2++Mg2+ ratio of 0,75 in every variant. The resulting treatments (T1, 1:0.45; T2, 1:0.60 or production test control, T3, 1:0.75 and T4, 1:0.90 were distributed in a completely randomized

  5. ESTATUS DE LA POBLACIÓN DE MONOS AULLADORES ROJOS EN EL CAÑÓN DEL BARBAS, FRAGMENTO MONTANO, CORDILLERA CENTRAL, Colombia Status of the red howler monkeys population in the Barbas canion, montane fragment, central mountains, Colombia

    Directory of Open Access Journals (Sweden)

    Jorge Mario Londoño

    Full Text Available Los bosques de montaña en Colombia han sufrido fuerte degradación por causas antrópicas y en la actualidad la mayoría son remanentes aislados e inmersos en hábitat antropogénicos. Los aulladores rojos han persistido en estas condiciones pero poco se conoce sobre su biología y respuesta a la alteración de su ambiente. Durante cinco meses en el 2005, evaluamos densidad y estatus poblacional de esta especie en la cuenca del río Barbas (Departamentos de Quindío y Risaralda, fragmento aislado de bosque montano bajo de 790 ha . Estimamos la densidad empleando censos por transectos lineales repetidos. Adicionalmente seguimos tropas de aulladores y evaluamos variables de vegetación teniendo en cuenta los requerimientos ecológicos de la especie. Estimamos una densidad de 11.7±6 grupos y 132.1±68 individuos/km2, superior a la usualmente reportada en bosques continuos. Esta alta densidad probablemente se deba al aislamiento del fragmento, que limita las posibilidades de dispersión de los aulladores. El tamaño promedio por tropa fue 11.3±2.5 individuos, con más de cinco machos y siete hembras adultas, y de uno a cuatro inmaduros. En general el bosque ofrece buena disponibilidad de recursos estructurales y alimenticios para los aulladores. Esta población no se encuentra amenazada en la actualidad por actividades antrópicas. El fragmento ha sido recientemente protegido bajo la figura de Parque Regional Natural y se adelantan corredores de conexión con otros remanentes cercanos. Sin embargo, esta población de aulladores se encuentra aislada de otras poblaciones y por tanto es urgente desarrollar medidas de manejo del paisaje para atenuar los efectos del aislamiento.The montane forests in Colombia have suffered strong degradation due to human activities; currently, most of them are remnants isolated and immersed in anthropogenic habitats. The red howler monkeys have persisted in these conditions but little is known on their biology and

  6. Reactividad Química de los Azo Colorantes Amarillo Anaranjado y Rojo Allura mediante Descriptores Globales y la Función de Fukui Chemical Reactivity of the Azo dyes Sunset Yellow and Allura Red by Global Descriptors and the Fukui Function

    Directory of Open Access Journals (Sweden)

    Adolfo E Ensuncho

    2012-01-01

    Full Text Available Se calcularon descriptores globales y locales de la reactividad para los colorantes amarillo anaranjado y rojo allura con el fin de analizar su reactividad química intrínseca. Los cálculos computacionales se llevaron a cabo tanto en vacio como en la fase acuosa, la cual se representó por medio de una constante dieléctrica de 78.5 e introducida por el modelo de solvente del continuo polarizado. Los resultados mostraron que el colorante rojo allura es menos susceptible a la adición nucleofílica que el amarillo anaranjado, ya que los sustituyentes electrodonadores metilo y metoxilo disminuyen la capacidad del grupo azo para aceptar electrones. El análisis de la función condensada de Fukui para el ataque nucleofílico e índice de electrofilicidad local, mostraron que el sitio preferido de ataque del agente reductor (ión bisulfito fue C4, lo cual estuvo en concordancia con los reportes experimentales.In the present work local and global descriptors of the reactivity were calculated for sunset yellow and allura red to analyze its intrinsic reactivity. The computational calculations were carried out in vacuum and aqueous phase. The aqueous phase is represented by a dielectric constant of 78.5, introduced by polarizable continuum model. The results show that allura red is less susceptible to nucleophilic addition than sunset yellow, because the electrodonor substituents methyl and methoxy decrease the capability of the azo group to accept electrons. The analysis of condensed Fukui function for a nucleophilic attack and local electrophilicity index showed that the preferred direction of attack the reducing agent (bisulfite ion occurs on C4, which was in good agreement with experimental reports.

  7. Induction of Sperm Acrosome Reaction wti h Calcium Ionophore A23187 in Wapiti (Cervus elaphus)%钙离子载体诱发马鹿精子顶体反应效果1)

    Institute of Scientific and Technical Information of China (English)

    李和平; 邹琦; 商兰; 刘伟石

    2014-01-01

    Wapiti (Cervus elaphus) sperm was capacitated in vitro by swimming-up and the acrosome reaction (AR) was in-duced by Calcium ionophore A23187 to choose an optimal A23187 system during AR.A23187 of 0.01-100 μmol/L can enhance the ratio of AR on the capacitated sperm and 0.1μmol/L A23187 can obtain the highest ratio of AR (74.00%± 2.62%) for 5-min treatment time.AR of capacitated sperm can, but the uncapacitated sperm cannot, be induced by A23187 in wapiti.%以马鹿( Cervus elaphus)为试验动物,采用上浮法诱导马鹿精子体外获能,以钙离子载体( A23187)诱导马鹿精子顶体反应,进而摸索钙离子载体( A23187)诱发其顶体反应的适宜体系。结果表明:0.01~100.00μmol/L的A23187可提高获能马鹿精子的顶体反应率;其中适宜的A23187浓度为0.10μmol/L,反应的时间为5 min,顶体反应率为(74.00±2.62)%。 A23187能促进获能马鹿精子的顶体反应,但不能显著(P>0.05)促进未获能马鹿精子的顶体反应。

  8. Estudio Computacional de la Cinética y Mecanismos de Reducción del Colorante Rojo Allura por Bisulfito de Sodio en Fase Acuosa Computational Study of the Kinetics and Mechanism of the Reduction of Allura Red Dye by Sodium Bisulfite in Aqueous Phase

    Directory of Open Access Journals (Sweden)

    Adolfo E Ensuncho

    2013-01-01

    Full Text Available Se determinó la cinética de la reducción del colorante rojo allura (E-129, C.I. 16035 por bisulfito de sodio al nivel B3LYP/6-31G(d en solución acuosa. Esto con el fin de evaluar una ruta mecanística plausible para la reacción de reducción de este importante azo colorante usado en la industria de alimentos. Las constantes de velocidad predichas para la etapa de sulfonación (kSulf estuvieron en buen acuerdo con respecto a las constantes de velocidad experimentales reportadas para algunos colorantes de estructura química similar a rojo allura. Se localizaron cinco puntos estacionarios sobre la superficie de energía potencial B3LYP. Los estados de transición para la primera y segunda etapa de la reacción de reducción son presentados por primera vez y caracterizados mediante cálculos de la coordenada intrínseca de reacción y frecuencias vibracionales. Los parámetros termodinámicos de activación indicaron que la reacción fue estable, endotérmica y no espontánea.The reduction kinetics of allura red dye (E-129, C.I. 16035 by sodium bisulfite at level B3LYP/6-31G(d in aqueous phase was determined. This was done to evaluate a plausible mechanistic path for the reduction reaction of this important azo dye used in the food industry. The predicted rate constants (kSulf for the sulfonation step were in good agreement with respect to experimental rate constants reported for some dyes of chemical structure similar to Allura red. On the B3LYP potential energy surface, were located five stationary points corresponding to reactants, transition states and products. The transition states for the first and second step of the reduction reaction are presented for the first time and characterized by calculations of intrinsic reaction coordinate and vibrational frequencies. The activation thermodynamic parameters indicated than the reaction was stable, endothermic and non-spontaneous.

  9. Analysis of Nutritional Components and Active Components in Cervus elaphus kansuensis Meat%甘肃马鹿肉营养成分及活性物质分析

    Institute of Scientific and Technical Information of China (English)

    张爱萍; 谢宗平; 李君兰; 郭兆斌; 余群力

    2013-01-01

    以甘肃马鹿肉为实验材料,检测分析了甘肃马鹿肉的营养成分及活性物质.结果表明:甘肃马鹿水分含量为72.88g/100g,蛋白质27.49g/100g,脂肪2.13g/100g,灰分1.09g/100g;铁14.96mg/100g,锌0.84mg/100g,铜0.199mg/100g,硒1.22μg/100g,磷15.72mg/100g;总氨基酸含量为81.08g/100g,必需氨基酸占总氨基酸的38.87%;过氧化物歧化酶63.42U/mg,雌二醇157.88pg/mL,睾酮0.78ng/mL.生长激素0.76ng/mL.甘肃马鹿肉具有高蛋白、低脂肪、丰富的矿物质、氨基酸含量全面等特点,并含有一定量的活性物质,对人体有较高的营养和滋补价值,是优质的动物性食品资源.%Healthy,adult,pasture-raised Cervus elaphus kansuensis ere slaughtered and Longissimus dorsi samples were taken for the measurement of nutritional components and active components by routine methods.The results showed that the Longissimus dorsi of Cervus elaphus kansuensis contained 72.88 g of water,27.49 g of protein,2.13 g of fat,1.09 g of ash,14.96 mg of Fe,0.84 mg of Zn,0.199 mg of Cu,1.22 μg of Se,and 15.72 mg of P per 100 g.The total amino acid content was 81.08% with the essential amino acids together accounting for 38.87% of the total amino acids.Additionally,the levels of SOD,estradiol,testosterone and growth hormone were detected to be 63.42 U/mg,157.88 pg/mL,0.78 ng/mL and 0.76 ng/mL,respectively.These data demonstrate that the meat of Cervus elaphus kansuensis has good quality characteristics such as high protein,low fat,abundant minerals and a full range of amino acids in large quantities,and also contain some active substances,indicating high nutritional and nourishing value for the human body as an excellent source of animal-derived food.

  10. Time Budget and Behavior Pattern of Semi-free Cervus nippon in spring%散放条件下春季梅花鹿行为时间分配的研究

    Institute of Scientific and Technical Information of China (English)

    刘振生; 吴建平; 滕丽微

    2002-01-01

    From April to May in 1998, time budget and behavior patterns of semi-free Cervus nippon were studied in Pingshan Wildlife Experimental Farm. The results showed that grazing behavior accounts the most for activity time in spring, next for ruminating and bedding behaviors, and the least for alerting and moving behaviors. In a day, there are three grazing peaks (namely, 7:00~10:00, 12:00~14:00 and 16:00~17:00). The female spend more moving time than the male do. The male spend more alert and bedding time than the female. C. nippong spend more grazing time in cloudy days than in fine and rainy days, whileC. nippon spends less alert and moving time in cloudy days. Sex and weather influence activity time budget of C. nippon. More significant differences exist between male and female's moving behaviors (F = 10.09,P < 0.01 ), while significant differences exist between bedding ( F = 5.96, P < 0.05) and alert ( F = 4.52, P < 0.05) be haviors. More significant differences exist between grazing ( F = 8.39, P < 0.01) and alert ( F = 6.11, P < 0.01 ) behav iors due to weather factor, while significant differences exist between bedding ( F = 4.27, P < 0.05) and moving ( F =5.32, P<0.05) behaviors.

  11. Association of the red reflex in newborns with neonatal variables Asociación del reflejo rojo con variables neonatales en recién nacidos Associação do reflexo vermelho em recém-nascidos com variáveis neonatais

    Directory of Open Access Journals (Sweden)

    Adriana Sousa Carvalho de Aguiar

    2011-04-01

    Full Text Available The aim of this study was to investigate the results of the red reflex test and to associate these results with neonatal variables. This descriptive study was conducted with 190 newborns in a public maternity hospital. A total of 187 infants presented no alteration and three presented suspect results. Different shades of reflex color were observed: 50 (26.3% presented red; 34 (17.9% orange-red, 92 (48.4% orange, 11 (5.8% light yellow and three (1.6% milky white spots. Statistically significant associations between the color gradient instrument and neonatal variables were found: weight (p=0.03, gestational age (p=0.019 and oxygen therapy (p=0.024. Nurses trained to practice and evaluate this test may become professionals in the potential for the prevention of childhood blindness.Se objetivó investigar el resultado de la prueba del reflejo rojo, conocido como prueba del ojito, y asociar las impresiones del reflejo con variables neonatales. Se trata de un estudio descriptivo, cuantitativo, realizado con 190 recién nacidos de una maternidad pública; de los cuales 187 presentaron resultados no alterados y tres sospechosos. Se observaron diferentes matices de coloración del reflejo: en 50 (26,3% se presentó rojo; 34 (17,9% naranja rojizo; 92 (48,4% anaranjado; 11 (5,8% amarillo claro y tres (1,6% con manchas blanquecinas. Se encontraron asociaciones estadísticamente significativas entre el instrumento gradiente de colores y las variables neonatales: peso (p=0,03, edad de gestación (p=0,019 y oxigenoterapia (p=0,024. Enfermeros capacitados para la práctica y evaluación de esa prueba pueden tornarse profesionales en potencial para la prevención de la ceguera infantil.Objetivou-se investigar o resultado do teste do reflexo vermelho, conhecido como teste do olhinho, e associar as impressões do reflexo com variáveis neonatais. Este é um estudo descritivo, quantitativo, realizado com 190 recém-nascidos de uma maternidade pública, dos quais

  12. ESTUDIO DE LA ASOCIACIÓN Gluconacetobacter diazotrophicus-VIANDAS TROPICALES ESTABLECIDAS SOBRE SUELO FERRALÍTICO ROJO. II. DETERMINACIÓNDEL MÉTODO DE INOCULACIÓN MÁS EFICIENTE PARA LA INCORPORACIÓN DE G. diazotrophicus EN LOS CULTIVOS DE BONIATO, YUCA Y MALANGA Ministerio

    Directory of Open Access Journals (Sweden)

    Bernardo Dibut Álvarez

    2011-01-01

    Full Text Available El trabajo ofrece la estrategia de inoculación de labacteria en las viandas tropicales, aspecto este que, exceptoen boniato, constituye un primer reporte para la especialidad.Desde el punto de vista agrobiológico, abre nuevos caminosal diseño de inoculantes comerciales que hoy no existen en elmercado para el beneficio de estos cultivos, de ahí los impactoscientífico, tecnológico y medio ambiental de la investigación.Los experimentos se desarrollaron en áreas del INIFAT sobresuelo Ferralítico Rojo, empleando un diseño de Bloques alAzar y un tamaño de parcela de 50 m2 con cuatro réplicas portratamiento. La concentración final del bioproducto fue de3.5x1011 UFCxmL-1. Se aplicó utilizando una dosis de 0.2 mL/m2.El método de inoculación más efectivo (aplicación foliar y alsuelo permite obtener incrementos en el rendimiento de entre3 y 5 t/ha en plantaciones de yuca, boniato y malanga. Ellorepresenta un beneficio económico promedio de 720 pesospor cada hectárea bacterizada, con la presencia de raíces ytubérculos de mayor calidad comercial. Se formula además unnuevo medio de cultivo (objeto de patente que permite que elbioproducto se aplique a una dosis reducida por unidad desuperficie y que disminuye el tiempo de fermentación.

  13. Study on the Changes in Enzyme and Insulin-like Growth Factor-1 Concentrations in Blood Serum and Growth Characteristics of Velvet Antler during the Antler Growth Period in Sika Deer (Cervus nippon).

    Science.gov (United States)

    Park, Jaehyun; Jeon, Byongtae; Kang, Sungki; Oh, Mirae; Kim, Myonghwa; Jang, Seyoung; Park, Pyojam; Kim, Sangwoo; Moon, Sangho

    2015-09-01

    This study was conducted to investigate changes in blood enzyme parameters and to evaluate the relationship between insulin-like growth factor-1 (IGF-1), antler growth and body weight during the antler growth of sika deer (Cervus nippon). Serum enzyme activity and IGF-1 concentrations were measured in blood samples collected from the jugular and femoral veins at regular intervals during the antler growth period. Blood samples were taken in the morning from fasted stags (n = 12) which were healthy and showed no clinical signs of disease. Alfalfa was available ad libitum and concentrates were given at 1% of body weight to all stags. The experimental diet was provided at 9 am with water available at all times. There were no significant differences in alkaline phosphatase, aspartate aminotransferase, and alanine aminotransferase during antler growth, but alkaline phosphatase concentrations increased with antler growth progression, and the highest alkaline phosphatase concentration was obtained 55 days after antler casting. Serum IGF-1 concentrations measured from blood samples taken from the jugular vein during antler growth, determined that levels of IGF-1 was associated with body weight and antler growth patterns. Serum IGF-1 concentrations were higher at the antler cutting date than other sampling dates. Antler length increased significantly during antler growth (p<0.001), and there was a similar trend to between right and left beams. Body weight increased with antler growth but was not significant. Consequently it appeared that serum alkaline phosphatase concentration was related to antler growth and both antler growth and body weight were associated positively with IGF-1 concentrations during antler growth. PMID:26194228

  14. PREVALENCE OF ANTIBIOTIC RESISTANT STRAINS OF ESCHERICHIA COLI AND ENTEROCOCCUS SPP. IN ROE DEER (CAPREOLUS CAPREOLUS AND RED DEER (CERVUS ELAPHUS AT THE PARCO NAZIONALE DEI MONTI SIBILLINI, ITALY

    Directory of Open Access Journals (Sweden)

    B. Cenci Goga

    2009-09-01

    Full Text Available A case control study was performed in the Parco Nazionale dei Monti Sibillini, Italy, to find out whether roe deer (Capreolus capreolus and red deer (Cervus elaphus were more likely to harbour antibiotic resistant Escherichia coli in their faeces, compared to Enterococcus spp. Ten areas were selected and samples were collected during a fourmonths (May to August, 2008 sampling period. Samples of water (n=12 and feces (n=59, collected at 10 different sites, were cultured for E. coli and Enterococcus spp. The resulting colonies were screened for tetracycline, ampicillin and kanamycin resistance using the Lederberg Replica Plating method (breakpoint 4 μg/ml. All resistant isolates were then selected, and subjected to the CLSI antimicrobial plate susceptibility test (7. Among the water specimens contaminated by E. coli, 80% were found to be resistant to ampicillin, 80% to tetracycline and 40% to kanamycin. Among the water specimens contaminated by Enterococcus spp., 14.29% were found to be resistant to ampicillin, 14.29% to tetracycline and 71.3% to kanamycin. Among the 39 strains of E. coli isolated from red deer feces, 12 were resistant to ampicillin (30.77%, 5 to tetracycline (12,82% and 3 to kanamycin (7.69%. Among the 19 strains of Enterococcus spp. isolated from red deer feces, 0 were resistant to ampicillin (0%, 1 to tetracycline (5.26% and 19 to kanamycin (100. These are significant findings, indicating that antibiotic resistance can be found in naïve animal populations and that red deer and fallow deer could act as sentinels for antimicrobial resistance. Key words Antibiotic-resistance, red deer, fallow deer, Escherichia

  15. Investigação do reflexo vermelho em recém-nascidos e sua relação com fatores da história neonatal Investigación del reflejo rojo en recién nacidos y su relación con factores de la historia neonatal Investigation of the related factors between newborn history and red reflex

    Directory of Open Access Journals (Sweden)

    Ingrid Martins Leite Lúcio

    2007-06-01

    Full Text Available O teste do reflexo vermelho é parte importante do exame ocular do recém-nascido. Buscou-se investigá-lo em recém-nascidos prematuros (RNPT e sua relação com fatores da história neonatal. Estudo descritivo, exploratório, quantitativo, realizado numa maternidade pública, em Fortaleza-CE, em março, abril e maio de 2004, com 114 RNPTs. Para o registro dos dados, utilizou-se um formulário próprio e para a realização do exame, um oftal-moscópio direto. Considerou-se pertinente os seguintes achados da história neonatal: 68% dos RNPTs obtiveram Apgar inferior a sete no primeiro minuto; 112 utilizaram oxigenoterapia e 68, fototerapia. Quanto ao reflexo vermelho, 13 (11% apresentaram alteração, com associação estatística significativa entre este e o Apgar no primeiro minuto de vida (p= 0,041. Os achados preocuparam, pois, dez dos 13 RNPTs, com alteração no reflexo vermelho, tinham retinopatia da prematuridade.El examen del reflejo rojo es parte importante del examen ocular del recién nacido. Se lo investigó en recién nacidos prematuros (RNPT y su relación con factores de la historia neonatal. Estudio descriptivo, cuantitativo realizado en una maternidad pública, en Fortaleza-CE, en marzo, abril y mayo de 2004 con 114 RNPT. Para el registro de los datos se utilizó un formulario propio y para realización del examen un oftalmoscopio directo. Se consideró pertinente los siguientes hallazgos de la historia neonatal: un 68% de los RNPT obtuvieron Apgar inferior a siete en el primer minuto; 112 utilizaron oxígeno y 68 fototerapia. Cuanto al reflejo rojo, 13 (un 11% presentaron alteración, con asociación estadística significativa entre éste y el Apgar en el primer minuto de vida (p= 0,041. Los hallazgos han causado preocupación, ya que 10 de los 13 RNPT con alteración en el reflejo rojo tenían retinopatía de la edad prematura.The red reflex test is an important part of the newborn's ocular exam. This study investigated the

  16. Las sedimentitas que apoyan en no concordancia sobre el "granito rojo"en el angosto de la Quesera (Cordillera Oriental, Salta: una revisión crítica a más de 60 años de los trabajos pioneros de J. Keidel

    Directory of Open Access Journals (Sweden)

    R.A. Astini

    2005-09-01

    Full Text Available A más de 60 años de la obra de J. Keidel se discute la edad y naturaleza de los depósitos paleozoicos apoyados sobre el "granito rojo" en el angosto de La Quesera, (Cordillera Oriental, provincia de Salta, perteneciente al batolito de Santa Rosa de Tastil. Trabajos recientes han puesto en duda las interpretaciones acerca de la discordancia descripta por dicho autor y reasignado parte de la estratigrafía al Grupo Mesón cámbrico. Este trabajo pretende aclarar las relaciones estratigráficas ratificando la naturaleza discordante de las unidades suprayacentes al granito y su edad ordovícica. Keidel (1943 no sólo describió con acierto la estratigrafía y las relaciones de yacencia en la zona sino que realizó observaciones puntuales que al día de hoy no pueden ser desestimadas. La estratigrafía aflorante en el angosto está constituida por las Formaciones Cardonal, Devendeus y Saladillo. Se discute el arreglo y el significado estratigráfico de las unidades expuestas en esta región y compara con unidades estratigráficas expuestas en las regiones vecinas, a los efectos de proponer un marco de correlación estratigráfico para el borde occidental de la Cordillera Oriental. Se descarta la existencia del Grupo Mesón y la suposición de magmatismo concomitante con su sedimentación. La situación particular de esta región hace que en una misma superficie se amalgamen los efectos de la orogenia tilcárica e irúyica y, además, se verifique una importante actividad de la fase diastrófica intra-ordovícica denominada fase tumbaya. La propuesta de un hiato de extensión reducida para la discordancia tilcárica es desestimada.

  17. 海南坡鹿栖息地的外来植物调查%Field Survey of Alien Plants in Habitats of Hainan Eld's Deer ( Cervus eldi hainanus )

    Institute of Scientific and Technical Information of China (English)

    符明利; 吴琳琳; 侯荣; 林思亮

    2012-01-01

    Hainan Eld's deer ( Cervus eldi hainanus ) is a national - level protected species and endemic to China. The stability and development of Eld's deer habitats play a significant role in population growth. Alien invasive plants can affect habitats ir- reversibly over long time periods. We surveyed the alien plants in Hainan Datian National Nature Reserve, where Hainan Eld's deer occur, using line transects and quadrats from 2009 to 2011. We recorded 115 alien plant species of 40 families and 95 genera. Among these, 80 herbs accounted for 70% and most are tropical species, 50% were introduced from the Americas and were mainly distributed in grasslands. The widely distributed alien plants impact the abundance and distribution of native spe- cies and may have a negative effect on Eld's deer food resource in future. We make several recommendations for effective man- agement and conservation. Our survey results can provide a basis for maintaining the stability of Hainan Eld's deer habitat.%海南坡鹿是中国特有的国家Ⅰ级重点保护野生动物,其栖息地的稳定和发展对该物种种群有重要意义。潜在的外来入侵植物会对栖息地产生长期不可恢复的影响。因此,我们于2009—2011年采用样方调查和线路调查相结合的方法对海南坡鹿的栖息地海南大田国家级自然保护区内的外来植物进行了调查,共记录外来植物40科95属115种。其中,草本植物80种,占总物种数的69.6%;不论从科区系还是属区系上看,外来植物的区系分布都具有热带性;50.4%的外来植物产自美洲,在草地中分布最多。保护区内分布广泛的外来植物已对乡土物种产生一定的影响,也将可能对坡鹿的食物资源产生不利影响。根据调查结果,我们提出了一些保护管理建议。

  18. EVALUACION DEL POTENCIAL DE LOS BIOSÓLIDOS PROCEDENTES DEL TRATAMIENTO DE AGUAS RESIDUALES PARA USO AGRÍCOLA Y SU EFECTO SOBRE EL CULTIVO DE RABANO ROJO (Raphanus sativus L.. EVALUATION OF THE POTENTIAL FOR BIOSOLIDS OBTAINED FROM WASTEWATER TREATMENT FOR AGRICULTURAL USE AND THEIR EFFECT ON CULTIVATION OF RED RADISH (Raphanus sativus L.

    Directory of Open Access Journals (Sweden)

    Ramiro Ramírez Pisco

    2006-12-01

    Full Text Available El trabajo se adelantó en predios de la planta de tratamiento de aguas residuales “El Salitre”, en la ciudad de Bogotá, con el propósito de evaluar el potencial del subproducto del tratamiento de aguas residuales “biosólido”, para su aplicación en la agricultura por medio de la valoración del crecimiento, desarrollo y producción del cultivo de rábano rojo, y establecer una posible alternativa al problema de disposición final de 3900 toneladas de este material generado mensualmente en las planta de tratamiento de aguas. El diseño experimental empleado correspondió a bloques completos al azar, con cinco tratamientos y tres repeticiones, dispuesto en parcelas de 2 m x 2 m. Los tratamientos correspondieron a mezclas de biosólidos con suelo en las siguientes proporciones: 100 % biosólido (equivalente a 294 ton ha-1, 75 % biosólido (220 ton Ha-1, 50 % biosólido (147 ton ha-1, 25 % biosólido (73 ton ha-1 y 100 % suelo como control. Se sembró rábano rojo Raphanus sativus L. Las variables evaluadas fueron: porcentaje de germinación, peso seco de hojas y raíz, longitud de la planta, área foliar y producción. Además, se midió la acumulación de elementos traza en los rábanos cosechados, para determinar su riesgo para el consumo. Los resultados evidenciaron que los tratamientos 50 % biosólido y 25 % biosólido, son los que favorecen el crecimiento, desarrollo y producción del cultivo de rábano, mientras que los tratamientos 75 % biosólido y 100% suelo presentaron un menor desarrollo, crecimiento y producción del cultivo. El tratamiento 100% biosólido provoco una baja germinación, además no presentó acumulación en la raíz, que es el producto cosechable. Los niveles de acumulación de metales pesados sobrepasaron los máximos permitidos con el tratamiento 75 % biosólido. Se evidenció como, la utilización del biosólido en la agricultura puede acarrear un gran riesgo, ya que a pesar de presentar una gran cantidad

  19. Libro rojo de los invertebrados marinos de Colombia.

    OpenAIRE

    2002-01-01

    La fauna de invertebrados marinos continúa recibiendo menos atención que la de los terrestres y de agua dulce, como un reflejo de sus amplios Rangel 1995, Chaves y Arango 1998). En el mar Caribe, el país cuenta con 1600 km de costa y en el océano Pacífico con 1300 km, en donde se encuentra una gran diversidad de ecosistemas marinos y costeros como los arrecifes coralinos, manglares y bosques de transición, sistemas de playas y acantilados, estuarios, deltas y lagunas costeras, lechos de pasto...

  20. Albarracín y el yeso rojo

    Directory of Open Access Journals (Sweden)

    de Villanueva, Luis

    2004-10-01

    Full Text Available The recent economic and cultural development of Albarracín, a town located in the Spanish province of Teruel, has been driven by the tourist trade, which has grown thanks particularly to its architectural heritage, one of whose most prominent features is the salmon-hued plaster exteriors of its buildings. Following secular regional tradition, plaster is manufactured in domed furnaces. The resulting laboratory tested product is suitable for use in exteriors. The present article contains a summary of the manufacturing procedure and a report of the results of the laboratory tests.El desarrollo económico-cultural de los últimos años de Albarracín (Teruel, ha estado marcado por un vuelco al turismo a través de su Patrimonio Arquitectónico, en el que destacan por su singularidad los revestimientos exteriores de yeso de color asalmonado. El yeso se fabrica de modo artesano siguiendo la tradición yesera de la comarca, en hornos de bóveda. El producto resultante ensayado en laboratorio presenta unas características apropiadas para su empleo en exteriores. En el presente artículo se resume el sistema de fabricación y se presentan resultados de ensayos de laboratorio.

  1. Los espacios vectoriales, el amarillo, el rojo y el azul

    OpenAIRE

    Moreno, Miguel

    2001-01-01

    El objetivo de este artículo será el de facilitar a los alumnos la comprensión y memorización del tema de los espacios vectoriales mediante una bella analogía existente a nuestro alrededor. Para tal fin haremos uso de los colores y de la mezcla de sus pigmentos. Aclararemos conceptos como el de combinación lineal de vectores (mezcla de colores), el de dependencia e independencia lineal, el de sistema generador (conjunto de colores con los que se puede pintar un cuadro), el de base (en el cuad...

  2. Evaluación objetiva de la motilidad de los espermatozoides epididimarios de ciervo ibérico. Relaciones con la congelabilidad y la calidad del semen

    OpenAIRE

    Peña Hernández, Antonia Elena

    2013-01-01

    El análisis de motilidad espermática es una de las pruebas más utilizadas en la valoración de la calidad seminal. No obstante, la valoración subjetiva realizada con los análisis de calidad rutinarios puede estar sesgada por los técnicos, especialmente las determinaciones de motilidad, pues siendo muy susceptibles al error humano, llevan a obtener distintos grados de imprecisión. Además, con la valoración subjetiva de la motilidad, no es posible conocer algunos aspectos muy importantes de la ...

  3. Melatonin promotes superovulation in sika deer (Cervus nippon).

    Science.gov (United States)

    Wang, Liang; Zhuo, Zhi-Yong; Shi, Wen-Qing; Tan, Dun-Xian; Gao, Chao; Tian, Xiu-Zhi; Zhang, Lu; Zhou, Guang-Bin; Zhu, Shi-En; Yun, Peng; Liu, Guo-Shi

    2014-01-01

    In this study, the effects of melatonin (MT) on superovulation and reproductive hormones (melatonin, follicle-stimulating hormone (FSH), luteinizing hormone (LH) and PRL) were investigated in female sika deer. Different doses (40 or 80 mg/animal) of melatonin were subcutaneously implanted into deer before the breeding season. Exogenous melatonin administration significantly elevated the serum FSH levels at the time of insemination compared with levels in control animals. During superovulation, the serum LH levels in donor sika deer reached their highest values (7.1±2.04 ng/mL) at the point of insemination, compared with the baseline levels (4.98±0.07 ng/mL) in control animals. This high level of LH was sustained until the day of embryo recovery. In contrast, the serum levels of PRL in the 80 mg of melatonin-treated group were significantly lower than those of control deer. The average number of corpora lutea in melatonin-treated deer was significantly higher than that of the control (p0.05), which may be related to the relatively small sample size. In addition, embryonic development in melatonin-treated groups was delayed. PMID:25007067

  4. Melatonin Promotes Superovulation in Sika Deer (Cervus nippon)

    OpenAIRE

    Liang Wang; Zhi-Yong Zhuo; Wen-Qing Shi; Dun-Xian Tan; Chao Gao; Xiu-Zhi Tian; Lu Zhang; Guang-Bin Zhou; Shi-En Zhu; Peng Yun; Guo-Shi Liu

    2014-01-01

    In this study, the effects of melatonin (MT) on superovulation and reproductive hormones (melatonin, follicle-stimulating hormone (FSH), luteinizing hormone (LH) and PRL) were investigated in female sika deer. Different doses (40 or 80 mg/animal) of melatonin were subcutaneously implanted into deer before the breeding season. Exogenous melatonin administration significantly elevated the serum FSH levels at the time of insemination compared with levels in control animals. During superovulation...

  5. Melatonin Promotes Superovulation in Sika Deer (Cervus nippon

    Directory of Open Access Journals (Sweden)

    Liang Wang

    2014-07-01

    Full Text Available In this study, the effects of melatonin (MT on superovulation and reproductive hormones (melatonin, follicle-stimulating hormone (FSH, luteinizing hormone (LH and PRL were investigated in female sika deer. Different doses (40 or 80 mg/animal of melatonin were subcutaneously implanted into deer before the breeding season. Exogenous melatonin administration significantly elevated the serum FSH levels at the time of insemination compared with levels in control animals. During superovulation, the serum LH levels in donor sika deer reached their highest values (7.1 ± 2.04 ng/mL at the point of insemination, compared with the baseline levels (4.98 ± 0.07 ng/mL in control animals. This high level of LH was sustained until the day of embryo recovery. In contrast, the serum levels of PRL in the 80 mg of melatonin-treated group were significantly lower than those of control deer. The average number of corpora lutea in melatonin-treated deer was significantly higher than that of the control (p < 0.05. The average number of embryos in the deer treated with 40 mg of melatonin was higher than that of the control; however, this increase did not reach significant difference (p > 0.05, which may be related to the relatively small sample size. In addition, embryonic development in melatonin-treated groups was delayed.

  6. Enterocytozoon bieneusi in sika deer (Cervus nippon) and red deer (Cervus elaphus): deer specificity and zoonotic potential of ITS genotypes.

    Science.gov (United States)

    Zhao, Wei; Zhang, Weizhe; Wang, Rongjun; Liu, Weishi; Liu, Aiqin; Yang, Dong; Yang, Fengkun; Karim, Md Robiul; Zhang, Longxian

    2014-11-01

    As the most common cause of the human microsporidiosis, Enterocytozoon bieneusi has been found in a wide variety of animal hosts. Deers are the ruminant mammals living in a variety of biomes, and the distribution of deer species differ by geography. To understand the prevalence of natural infection of E. bieneusi in deer and to assess their epidemiological role in the transmission of microsporidiosis caused by E. bieneusi, 91 fecal specimens were collected from 86 sika deers and five red deers in the northeast of China. By PCR and sequencing of the internal transcribed spacer (ITS) region of the ribosomal RNA (rRNA) gene of E. bieneusi, an average infection rate of 31.9% (29/91) was observed in deer, with 32.6% (28/86) for sika deer, and 20% (1/5) for red deer. Six ITS genotypes were identified: one known genotype BEB6 (n = 20) and five novel genotypes HLJD-I to HLJD-IV (one each) and HLJD-V (n = 5). A phylogenetic analysis based on a neighbor-joining tree of the ITS gene sequences of E. bieneusi indicated that genotypes HLJD-II and HLJD-III fell into group 1 of zoonotic potential, while the other genotypes (BEB6, HLJD-I, HLJD-IV, HLJD-V) were clustered into so-called bovine-specific group 2. This is the first report of E. bieneusi in deer in China. The observation of genotype BEB6 in humans previously and in deer here and also the findings of the two novel genotypes (HLJD-II to HLJ-III) belonging to potential zoonotic group 1 suggested the possibility of deer in the transmission of E. bieneusi to humans. PMID:25185666

  7. Relatos en Rojo y Negro: Aportes de Jorge Ricardo Masetti al periodismo contrahegemónico

    OpenAIRE

    Daniel González Almandoz

    2016-01-01

    Este trabajo pretende aproximarse a los aportes que Jorge Ricardo Masetti realizó a la construcción de experiencias periodísticas contrahegemónicas. Masetti fue un periodista argentino que en 1958 ascendió a Sierra Maestra para cubrir el levantamiento del M 26-7. Allí obtuvo entrevistas exclusivas con Fidel Castro y Ernesto Guevara. Luego, ya como partícipe de la Revolución Cubana, fundó y fue el primer director de la agencia de noticias Prensa Latina. Desde ese medio provocó rupturas...

  8. Relatos en Rojo y Negro: Aportes de Jorge Ricardo Masetti al periodismo contrahegemónico

    Directory of Open Access Journals (Sweden)

    Daniel González Almandoz

    2016-03-01

    Full Text Available Este trabajo pretende aproximarse a los aportes que Jorge Ricardo Masetti realizó a la construcción de experiencias periodísticas contrahegemónicas. Masetti fue un periodista argentino que en 1958 ascendió a Sierra Maestra para cubrir el levantamiento del M 26-7. Allí obtuvo entrevistas exclusivas con Fidel Castro y Ernesto Guevara. Luego, ya como partícipe de la Revolución Cubana, fundó y fue el primer director de la agencia de noticias Prensa Latina. Desde ese medio provocó rupturas con el modelo de comunicación mediática dominante en la época, y generó síntesis novedosas que dieron lugar a aportes a la reflexión y a la práctica periodística. Sin embargo, Masetti está ausente del imaginario colectivo del Periodismo. Esta investigación se instala en un encuentro entre los Estudios sobre Periodismo y la Historia de las Ideas, y es atravesada en su enfoque teórico por la Teoría de la Hegemonía.

  9. Estudio de la fiabilidad de diodos LEDs rojos mediante ensayos acelerados

    OpenAIRE

    García Pereda, Iván

    2014-01-01

    El objetivo de este Proyecto Final de Carrera es la realización de un ensayo de fiabilidad de componentes electrónicos, más concretamente de diodos LED, con el fin de estudiar su comportamiento a lo largo del tiempo de vida. Debido a la larga duración de los LEDs, un ensayo de este tipo podría durar años, por lo que es necesario realizar un ensayo acelerado que acorte significativamente el tiempo del experimento, para ello, han de someterse a esfuerzos mayores que en condiciones normales d...

  10. Automation of the works over coke oven; Kokusu ro rojo sagyo no jidoka

    Energy Technology Data Exchange (ETDEWEB)

    Kitayama, Y.; Saji, T. [Sumitomo Metal Industries Ltd., Osaka (Japan)

    1995-06-25

    As a recent trend on the coke manufacture, some requirements for environmental countermeasures and working environment improvements have become stronger. As a countermeasure against such requirements, automation of moving machines is cited. Recently, Kashima Iron works conducted automation of the works over the coke oven. Here is introduced its outline. As its basic concept, it was adopted following items; all coal waggons was renewed with manless operation, all works over coke oven were mechanized and became manless, integrated monitoring and controlling from central control room were conducted, simplification of system was conducted by the co-ownership of information with present automation system, and so forth. As a result, energy saving of the operators was established. As its system construction, in order to use effectively interlocks and information transfers with each moving machine, a construction to cooperate with the present system and to execute automatic remote operation of new equipments was built up. At present, some countermeasures have been examined mainly on improvement of unsufficient items in the program, and its automation ratio is above 99%. 6 figs., 4 tabs.

  11. Automatic operation systems for the coke oven top; Cokes ro rojo sagyo no jidoka tachiage jokyo

    Energy Technology Data Exchange (ETDEWEB)

    Saji, T.; Kitayama, Y. [Sumitomo Metal Industries, Ltd., Osaka (Japan)

    1994-10-13

    This paper describes an outline of automatic operation on the coke oven top, which has been conducted at the Kashima Steel Works, Sumitomo Metal Industries, Ltd. For the automatic operation on the oven top, unmanned operation of the charging car, mechanization of works on the oven top, centralized control, and simplification of the system were introduced. This automatic system consists of the charging car, central station, charging car station, and quenching car automation system. For the automatic travel motion control, braking by the electric regenerative brake and disk brake was adopted. The oven center standing control is carried out by using the position and distance information of interlock cable and the oven center sensor. Standing accuracy of the oven center of charging car was designed to be up to {plus_minus}10 mm. High detection accuracy can be obtained through the optical cutting image processing. The carbon removing apparatus for inlet port, oven top cleaner dust treatment apparatus, and charging level measurement apparatus were added to the charging car, which were required for the automatic operation on the oven top. As a result, the automatic ratio more than 99% could be achieved. 6 figs., 4 tabs.

  12. Comportamiento de tejas de diferente color (rojo y paja) frente al biodeterioro

    OpenAIRE

    Gazulla Barreda, María Fernanda; Sánchez Vilches, Enrique Javier; González, J M; Orduña, Mónica

    2014-01-01

    La colonización biológica es un fenómeno que afecta de forma negativa a la durabilidad de los materiales de construcción. A nivel industrial se ha observado que las tejas de color paja muestran mayor tendencia a la colonización biológica que las tejas de coloración rojiza, incluso cuando ambas presentan características similares. El objetivo de este trabajo es determinar la causa de las diferencias de biocolonización entre tejas de diferente color. Para ello, se ha determinado la composición ...

  13. ESI-PR55, Cabo Rojo, Puerto Rico 2000 (Environmental Sensitivity Index Map)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Environmental Sensitivity Index (ESI) maps are an integral component in oil-spill contingency planning and assessment. They serve as a source of information in the...

  14. Comparison and overlap of sympatric wild ungulate diet in Cazorla, segura and las Villas Natural Park

    Directory of Open Access Journals (Sweden)

    Martínez Martínez, T.

    2002-12-01

    superposition puisque tous deux broutaient une grande quantité de matière ligneuse. Le mouflon et le daim montraient des habitudes similaires au niveau de l'alimentation, mangeant des herbes et consommant une grande quantité de graminées. Les diètes du bouquetin et du cerf ne se superposaient que très peu avec celles, respectivement, du daim et mouflon. Le mouflon consommait beaucoup de mégaphorbes tandis que le daim consommait surtout des chamaephytes et le cerf principalement arbres et arbrisseaux. Aucun des quatre ongulés étudiés montrait des diètes très strictes (broutage ou consommateur de graminées; cependant, on peut signaler que le bouquetin et le cerf présentaient plus des caractères de brouteurs tandis que le mouflon et le daim mangeaient casi-exclusivement des herbes.
    [es]
    En el presente estudio se analiza la relación trófica y el grado de solapamiento de dieta entre la cabra montés fCapra pyrenaica, el ciervo (Cervus elaphus, el gamo (Dama dama y el muflón (Ovis musimon en el Parque Nacional de Cazorla, Segura y Las Villas. La dieta se evaluó a partir de los contenidos gástricos. La especies más consumidas por los cuatro herbívoros fueron Quercus rotundifolia, Phillyrea latifolia, Rosmarinus officinalis, Oryzopsis paradoxa y Festuca arundinacea. Los dos ungulados con la dieta más similar fueron el ciervo y la cabra montés (53,7% de solapamiento, de hábitos ramoneadores y consumidores de grandes cantidades de leñosas. El gamo y el muflón tienen dietas similares, comportándose como pastadores y consumiendo principalmente gramíneas. Los niveles de solapamiento entre la dieta de la cabra montés y el ciervo por un lado, y el gamo y muflón por otro, son muy bajos. El muflón ha sido el mayor consumidor de herbáceas no graminoides, el gamo consume mayoritariamente caméfitos y el ciervo árboles y arbustos principalmente. Ninguno de los cuatro mostró una dieta estrictamente ramoneadora o

  15. Environ: E00332 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00332 Cervus male sex organ Crude drug Cervus elaphus [TAX:9860], Cervus nippon [T...AX:9863] Cervidae Cervus male sex organ Crude drugs [BR:br08305] Animals Mammals E00332 Cervus male sex organ ...

  16. Efectos en la calidad espermática del ciervo de la exposición a plomo y otros metales pesados: aplicación de modelos de exposición in vitro con espermatozoides.

    OpenAIRE

    Castellanos Expósito, Pilar

    2014-01-01

    El plomo (Pb) uno de los tóxicos ambientales e industriales más difundidos en el planeta debido al uso con muy variados fines que se ha hecho de este metal por diferentes civilizaciones a lo largo de la historia, lo que explica la intensa actividad de extracción minera de Pb que se ha tenido que asegurar cantidades suficientes de este metal. En lo que a nuestro país se refiere, la comarca minera del Valle de Alcudia y Sierra Madrona durante los siglos XX y XX se encontraba a la cabeza de pr...

  17. Mejoramiento genético del frijol rojo y negro mesoamericano para Centroamérica y El Caribe

    OpenAIRE

    Juan C. De Rosas; Aracely Castro; Edwin Flores

    2000-01-01

    La producción de frijol en Centroamérica es llevada a cabo mayormente en laderas de suelos marginales, limitada por diversos factores bióticos y abióticos. Más de 350,000 t de este grano se producen en cerca de 0,5 millones de hectáreas, con rendimientos promedios de 678 kg/ha. La mayoría de los productores de frijol utilizan bajos insumos y muy pocas fincas están mecanizadas. El autoconsumo es alto; sin embargo, una alta proporción de este grano es comprado por interm...

  18. Román Gubern et Paul Hammond, Los años rojos de Buñuel

    Directory of Open Access Journals (Sweden)

    Nancy Berthier

    2010-01-01

    Full Text Available Les ouvrages publiés sur Luis Buñuel sont très nombreux. En effet, la richesse de l’œuvre de ce cinéaste a naturellement conduit de nombreux auteurs et chercheurs à apporter leur pierre à son édifice bibliographique, depuis l’époque surréaliste jusqu’à nos jours. Approches esthétiques, psychanalytiques, deleuziennes, structuralistes ou biographiques, les regards sont variés et le vertige saisit qui tente d’établir une bibliographie à jour de l’œuvre de Buñuel étudiée partout dans le monde. Ce...

  19. Densidad y estatus poblacional de monos aulladores rojos en un guadual, fragmento aislado, La Tebaida, Quindío, Colombia

    OpenAIRE

    Carolina Gómez-Posada; Zulima Álvarez; Paoloa Giraldo-Chavarriaga

    2009-01-01

    Density and population status of red howler monkeys in an isolated bamboo forest fragment in La Tebaida, Quindío, Colombia.The majority of forest remnants in the coffee growing region in Colombia are guaduales, forests with a predominance of thorny bamboos(Guadua spp.). These remnants support the last remaining populations of red howler monkeys found between 800 and 1,300 m of altitudein the Central Cordillera of Colombia. Objective: To assess the population status of howler monkeys in a 51.4...

  20. Densidad y estatus poblacional de monos aulladores rojos en un guadual, fragmento aislado, La Tebaida, Quindío, Colombia

    Directory of Open Access Journals (Sweden)

    Carolina Gómez-Posada

    2009-04-01

    Full Text Available Density and population status of red howler monkeys in an isolated bamboo forest fragment in La Tebaida, Quindío, Colombia.The majority of forest remnants in the coffee growing region in Colombia are guaduales, forests with a predominance of thorny bamboos(Guadua spp.. These remnants support the last remaining populations of red howler monkeys found between 800 and 1,300 m of altitudein the Central Cordillera of Colombia. Objective: To assess the population status of howler monkeys in a 51.4 ha-bamboo forest fragmentat 1,100 m of altitude. Methods and results: The estimated howler population density in the fragment, based on direct counts, was of 163.4individuals and 16.9 groups per km2, which is higher than that commonly reported for this species in continuous forests, although similarto the estimated density in isolated fragments of mountain forests. In spite of the high density, the group size and composition are similarto those usually reported for this species, with more immature individuals than female adults (1.13:1. This finding suggests that thepopulation is under a stable condition. We estimated an abundance of just 84 howlers in the fragment. The guadual, narrow and elongated,is isolated by surrounding productive systems and has a low plant diversity. Nevertheless, guadua plants provide a suitable structure for thedisplacement and shelter of howlers. Conclusion: Our results demonstrate the tolerance of this species to the fragmentation and its plasticity in persisting in altered environments. However, the high density of individuals, low plant diversity, forest isolation, edge effect, and closecontact with anthropic productive systems, are all possible threats to the persistence of this population.

  1. El rojo crítico : expansión de la literatura catalana bajo censura (1962-1977)

    NARCIS (Netherlands)

    van den Hout-Huijben, Lidwina

    2015-01-01

    Het doel van deze dissertatie is de werking van de Spaanse staatscensuur gedurende de dictatuur van Francisco Franco (1939-1975) te analyseren en te beschrijven evenals haar invloed op de ontwikkeling van de Catalaanse literatuur tussen 1962 en 1977. Bovendien documenteert deze studie de inspanninge

  2. Benthic Habitats of Puerto Rico and the U.S. Virgin Islands; Photomosaic of Puerto Rico (Cabo Rojo), 1999

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of Puerto Rico and the U.S. Virgin Islands were created by visual interpretation of aerial photographs using the Habitat Digitizer Extension. Aerial...

  3. Los grabados y pinturas rupestres de la cueva de El Rincón, en el contexto artístico del desfiladero del río Carranza (Bizkaia-Cantabria

    Directory of Open Access Journals (Sweden)

    César GONZÁLEZ SÁINZ

    2009-12-01

    Full Text Available RESUMEN: La cueva de El Rincón, inmediata a las de Venta de la Perra y El Polvorín, forma parte del grupo de cavidades con manifestaciones parietales paleolíticas del desfiladero del río Carranza. El conjunto rupestre localizado recientemente es tan pequeño como diverso: cuenta con grabados lineales exteriores y, en zonas centrales o de fondo, con tres figuras animales grabadas y algunos motivos pintados en rojo, resto de representaciones desvaídas o, acaso, simples manchas de color. Una figura de ciervo herido facilita algunos paralelos, tanto en lo referido a su construcción y a la perspectiva empleada en las extremidades, como a la morfología inusual del venablo. El estudio que presentamos permite establecer una estrecha vinculación con el arte premagdaleniense de otras cuevas de ese mismo entorno, y facilita una discusión actualizada sobre la modificación temporal en la perspectiva de las representaciones animales durante el Paleolítico superior.ABSTRACT: The Rincón cave, immediate to those of Venta de la Perra and Polvorín, is part of the wide group of cavities with Palaeolithic parietal art of the narrow pass of the Carranza river. The rock art has been located recently and it is as small as diverse: it has external lineal engravings and, in central or background areas, three recorded engraving animals and some paintings in red, maybe rest of faded representations or, simple colour stains. A figure of wounded deer facilitates some parallel referred to its construction and the perspective used in the extremities, or to the unusual morphology of the weapon. This study allows to establish a narrow linking with the premagdalenian art of other caves nearby, and facilitates an up-to-date discussion on the temporary modification in the perspective in animal representations during the Upper Palaeolithic.

  4. Taxonomy Icon Data: wapiti [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Cervus_canadensis_L.png Cervus_canadensis_NL.png Cervus_canadensis_S.png Cervus_canadensis_NS.png http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Cervus+canadensis&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?...i=Cervus+canadensis&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Cervus+...canadensis&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Cervus+canadensis&t=NS ...

  5. Antibody Responses of Cervids (Cervus elaphus) following Experimental Mycobacterium bovis Infection and the Implications for Immunodiagnosis

    Science.gov (United States)

    Captive and free-ranging wildlife are implicated in the maintenance and transmission of bovine tuberculosis (TB) and therefore pose a significant obstacle to eradication of the disease from domestic livestock. The current ante-mortem diagnostic method, the intradermal tuberculin skin test, has seri...

  6. Roe (Capreolus capreolus) and red (Cervus elaphus) deer foraging habits under snow conditions

    Czech Academy of Sciences Publication Activity Database

    Prokešová, Jarmila; Barančeková, Miroslava; Homolka, Miloslav

    Hamburg: DSV-Verlag, 2005 - (Pohlmeyer, K.), s. 447-449 ISBN 3-88412-431-5. [IUGB Congress /27./. Hannover (DE), 28.08.2005-03.09.2005] R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z60930519 Keywords : deer * winter diet * browsing impact Subject RIV: EG - Zoology

  7. Long-term dynamics of Coxiella burnetii in farmed red deer (Cervus elaphus

    Directory of Open Access Journals (Sweden)

    David eGonzález-Barrio

    2015-12-01

    Full Text Available Several aspects of the dynamics of Coxiella burnetii that are relevant for the implementation of control strategies in ruminant herds with endemic Q-fever are unknown. We designed a longitudinal study to monitor the dynamics of exposure to C. burnetii in a red deer herd with endemic infection in order to allow the design of Q fever specific control approaches. Other relevant aspects of the dynamics of C. burnetii - the effect of herd immune status, age, season and early infection on exposure, the average half-life of antibodies, the presence and duration of maternal humoral immunity and the age of first exposure - were analysed. The dynamics of C. burnetii in deer herds seems to be modulated by host herd and host individual factors and by particular host life history traits. Red deer females become exposed to C. burnetii at the beginning of their second year since maternal antibodies protect them after birth and during the main pathogen shedding season - at the end of spring-early summer. Infection pressure varies between years, probably associated to herd immunity effects, determining inter-annual variation in the risk of exposure. These results suggest that any strategy applied to control C. burnetii in deer herds should be designed to induce immunity in their first year of life immediately after losing maternal antibodies. The short average life of C. burnetii antibodies suggests that any protection based upon humoral immunity would require re-vaccination every 6 months.

  8. The content of selected metals in muscles of the red deer (Cervus elaphus) from Poland.

    Science.gov (United States)

    Skibniewski, Michał; Skibniewska, Ewa M; Kośla, Tadeusz

    2015-06-01

    The aim of this study was to evaluate the concentrations of Pb, Cu, Zn, Rb, Cs, Sr and Ba in the muscles of red deer that were hunted in two regions of Poland (south-western and north-eastern). The data obtained were evaluated with regards to benefits and potential risk to consumers' health. Samples for the investigations were collected in 2008 and 2009 from 50 female red deer, and the metal concentrations were determined by using the inductively coupled plasma-mass spectrometric (ICP-MS) method. The mean concentrations of Pb did not differ statistically between regions and were equal to that permitted for farm animals. The results of this study support the conclusion that the meat of the analysed animals does not pose a risk of lead intoxication. Statistically higher mean concentrations of Cu and Zn were found in the muscles of red deer from the south-western region (namely, 2.99 and 25.78 mg kg(-1)) than those in animals from north-eastern Poland (namely, 2.61 and 23.39 mg kg(-1) wet weight). In terms of human nutritional needs, the meat of red deer can be considered as a good source of Cu and Zn. Furthermore, Rb, Cs, Sr and Ba concentrations did not differ statistically between regions. Their mean concentrations were 4.50, 0.09, 0.16 and 0.31 mg kg(-1) wet weight, respectively. Although high Cs, Sr and Ba concentrations were found, the meat of red deer does not pose a risk for adult consumers. Only high Ba content may potentially result in negative health effects for children. PMID:25548020

  9. Seasonal and age related changes in size of reproductive structures of red deer hinds (Cervus elaphus

    Directory of Open Access Journals (Sweden)

    Rolf Langvatn

    1992-10-01

    Full Text Available Morphometric studies of uteri, ovary weights, and follicle diameters were carried out to investigate possible methodological applications. Size and anatomical appearance of the uterus varied with age and phase in the estrous cycle, both in parous and nulliparous females. The uterus thus may provide valuable information on reproductive status for known-aged animals. Weight of ovaries increased in young, but declined in old females, showing significant covariance with body weight in young and prime ages. Ovary weights increased from low levels shortly after parturition to a maximum towards the end of the gestation period. Ovaries containing a corpus luteum were heavier than those without. Compared to ovary weights, mean diameter of largest ovarian follicle varied in an opposite pattern during the yearly cycle. Maximum follicle diameter was largest in non-ovulated females. Weight of ovaries and follicle size appear to be of limited value as criteria in analysis of reproductive status and performance.

  10. The construction of cloned Sika deer embryos (Cervus nippon hortulorum) by demecolcine auxiliary enucleation.

    Science.gov (United States)

    Yin, Y; Mei, M; Zhang, D; Zhang, S; Fan, A; Zhou, H; Li, Z

    2014-02-01

    The objective of our study was to establish the feasibility of experimental protocols for cloning sika deer. We performed auxiliary enucleation to improve the efficiency of nuclear transfer operation by optimizing the demecolcine concentration to induce cytoplasmic protrusions in the sika deer oocytes. In the present study,we had studied the impact of different demecolcine concentrations on cytoplasmic protrusions and enucleation rates. We determined that 95.9% of the sika deer oocytes formed cytoplasmic protrusions when treated for 1 h with 0.8 μg/ml demecolcine. The lowest observed rate of protrusion was 19.3% after overnight treatment with demecolcine. When the oocytes aged or had a poor cumulus expansion, they exhibited a significant decrease in the ability to form cytoplasmic protrusions. The rates of enucleation (94.9% vs 85.8%, p sika deer oocytes could be enucleated quickly and effectively using demecolcine auxiliary enucleation, which could enhance the enucleation rate, cell fusion rate and blastocyst rate of cloned embryos in vitro. PMID:24138424

  11. Maintenance Crude Protein Requirement of Penned Female Korean Spotted Deer (Cervus nippon)

    OpenAIRE

    Yang, S Y; Oh, Y. K.; Ahn, H. S.; Kwak, W. S.

    2014-01-01

    This study was conducted to evaluate the protein requirement for maintenance of 2-year-old female Korean spotted deer. In the course of the experiment, each of three hand-reared female spotted deer was fed three diets that were iso-calorically formulated to contain low (approximately 7%), medium (12%), and high (17%) levels of crude protein (CP). Each of six trials included a 5-day transition, a 10-day preliminary, and a 7-day collection period. Dietary protein levels affected the apparent di...

  12. Tuberculosis, genetic diversity and fitness in the red deer, Cervus elaphus.

    Science.gov (United States)

    Queirós, João; Vicente, Joaquín; Alves, Paulo C; de la Fuente, José; Gortazar, Christian

    2016-09-01

    Understanding how genetic diversity, infections and fitness interact in wild populations is a major challenge in ecology and management. These interactions were addressed through heterozygosity-fitness correlation analyses, by assessing the genetic diversity, tuberculosis (TB) and body size in adult red deer. Heterozygosity-fitness correlation models provided a better understanding of the link between genetic diversity and TB at individual and population levels. A single local effect was found for Ceh45 locus at individual level, enhancing the importance of its close functional genes in determining TB presence. At population level, the ability of the red deer to control TB progression correlated positively with population genetic diversity, indicating that inbred populations might represent more risk of deer TB severity. Statistical models also gained insights into the dynamics of multi-host interaction in natural environments. TB prevalence in neighbouring wild boar populations was positively associated with deer TB at both individual and population levels. Additionally, TB presence correlated positively with red deer body size, for which "general and local effect" hypotheses were found. Although body size might be correlated with age, an indirect genetic effect on TB presence could be implied. This study provides new insights towards understanding host-pathogen interactions in wild populations and their relation to fitness traits. PMID:27245150

  13. Elk (Cervus elaphus) Seasonal Habitat Selection in a Heterogeneous Forest Structure

    OpenAIRE

    Popp, Jesse N.; McGeachy, David N. C.; Josef Hamr

    2013-01-01

    Seasonal habitat selection by the reintroduced Burwash elk population, approximately 30 km south of Sudbury, Ontario, has been analysed in order to assist in the development of future management. Twenty-five adult females were radio-collared and tracked 1–3 times a week for 3 years. The most prominent patterns included selection of intolerant hardwood forests (trembling aspen, white birch, and balsam poplar) during all seasons, while Great Lakes-St. Lawrence pines (white and red pine dominate...

  14. Prevalence of antibody to hepatitis E virus among wild sika deer, Cervus nippon, in Japan.

    Science.gov (United States)

    Matsuura, Y; Suzuki, M; Yoshimatsu, K; Arikawa, J; Takashima, I; Yokoyama, M; Igota, H; Yamauchi, K; Ishida, S; Fukui, D; Bando, G; Kosuge, M; Tsunemitsu, H; Koshimoto, C; Sakae, K; Chikahira, M; Ogawa, S; Miyamura, T; Takeda, N; Li, T C

    2007-01-01

    We examined 976 sika deer serum samples, 159 liver tissue samples and 88 stool samples collected from 16 prefectures in Japan, and performed ELISA and RT-PCR assays to detect antibodies to HEV and HEV RNA, respectively. Although 25 (2.6%) of 976 samples were positive for anti-HEV IgG, the antibody titers were very low. The OD values ranged between 0.018 and 0.486, forming a single distribution rather than a bimodal distribution, suggesting that the antibody detected in this study was not induced by HEV infection, or that deer have low sensitivity to HEV. HEV RNA was not detected in these samples, also suggesting that deer may not play a role as an HEV reservoir. PMID:17431737

  15. Seroprevalence of Neospora caninum infection in farmed sika deer (Cervus nippon) in China.

    Science.gov (United States)

    Meng, Qing-Feng; Li, Ying; Zhou, Yu; Bai, Ya-Duo; Wang, Wei-Lin; Wang, Wei-Li; Cong, Wei

    2015-07-30

    Neospora caninum is a worldwide protozoan that can induce neuromuscular disease in dogs and reproductive failure in domestic and wild ruminants. The objective of the present investigation was to determine the seroprevalence of N. caninum infection in farmed sika deer in China as little is known of this host-parasite relationship. A total of 1800 serum samples were collected during 2013 and 2014 from farmed sika deer in the major production areas of Liaoning, Jilin and Heilongjiang provinces.Assay by ELISA for N. caninum antibodies indicated a seroprevalence of 13.6% in 2013 and 15.8% in 2014, varying in different regions from 9.5% to 27.5%. Statistical analysis revealed that prevalence in animals aged >4 years (20.4%) was significantly higher than in the age ranges sika deer in herds with a history of miscarriage (41.9%) had a significantly higher seroprevalence than in those without (12.6%) (Psika deer in China and provides base-line data for the design and evaluation of measures for its control and prevention in this host. PMID:26073107

  16. Molecular detection and genetic characterization of Toxoplasma gondii infection in sika deer (Cervus nippon) in China.

    Science.gov (United States)

    Cong, Wei; Qin, Si-Yuan; Meng, Qing-Feng; Zou, Feng-Cai; Qian, Ai-Dong; Zhu, Xing-Quan

    2016-04-01

    The objective of the present study was to investigate the prevalence and genetic characterization of Toxoplasma gondii infection in sika deer in China. During August 2014 to November 2014, a total of 450 tissue samples coming from 150 sika deer were collected to detect the T. gondii B1 gene using a nested PCR, and the positive samples were genotyped at 11 genetic markers (SAG1, 5'- and 3'-SAG2, alternative SAG2, SAG3, BTUB, GRA6, L358, PK1, c22-8, c29-2, and Apico) using multilocus polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) technology. Seventeen of 150 sika deer (11.33%) were tested positive by nested PCR. Six DNA samples from the 17 positive samples were completely typed, in which 4 samples from lung tissues, and 2 from muscular tissues, were identified as ToxoDB Genotype #9 (http://toxodb.org/toxo/). The results of the present study revealed the existence of T. gondii infection in sika deer in China, which provided the information of T. gondii genetic diversity in this host species. This study also indicated that ToxoDB Genotype #9 has a wide distribution in sika deer that could be potential reservoirs for T. gondii transmission, which may pose a threat to human health. PMID:26772153

  17. Intestinal adenocarcinoma in a herd of farmed Sika deer (Cervus nippon): a novel syndrome.

    Science.gov (United States)

    Kelly, P A; Toolan, D; Jahns, H

    2015-01-01

    Intestinal adenocarcinomas were identified in 76 adult deer from a closed herd of 193 breeding animals grazing pasture heavily infested with bracken fern (Pteridium aquilinum). Tumors were observed postmortem in 32 animals with rapid weight loss, and similar neoplasms were detected in a further 44 clinically normal deer at "cull." Tumors were located in distal ileum, cecum, and proximal colon and presented as single (26%) or multiple (74%), variably sized, pale-gray, firm, poorly circumscribed neoplasms with associated intestinal strictures. Histopathologically tumors were well-differentiated, locally infiltrative, low-grade adenocarcinomas of tubular (51%), mucinous (33.5%), or mixed (15.5%) types. Extraintestinal metastases were not observed. The high incidence of intestinal adenocarcinoma within this herd suggests a specific and novel syndrome, and genetic and/or environmental factors may be involved in the pathogenesis. PMID:24503440

  18. Isolation and characterization of novel microsatellite markers from the sika deer (Cervus nippon) genome.

    Science.gov (United States)

    Li, Y M; Bai, C Y; Niu, W P; Yu, H; Yang, R J; Yan, S Q; Zhang, J Y; Zhang, M J; Zhao, Z H

    2015-01-01

    Microsatellite markers are widely and evenly distributed, and are highly polymorphic. Rapid and convenient detection through automated analysis means that microsatellite markers are widely used in the construction of plant and animal genetic maps, in quantitative trait loci localization, marker-assisted selection, identification of genetic relationships, and genetic diversity and phylogenetic tree construction. However, few microsatellite markers remain to be isolated. We used streptavidin magnetic beads to affinity-capture and construct a (CA)n microsatellite DNA-enriched library from sika deer. We selected sequences containing more than six repeats to design primers. Clear bands were selected, which were amplified using non-specific primers following PCR amplification to screen polymorphisms in a group of 65 unrelated sika deer. The positive clone rate reached 82.9% by constructing the enriched library, and we then selected positive clones for sequencing. There were 395 sequences with CA repeats, and the CA repeat number was 4-105. We selected sequences containing more than six repeats to design primers, of which 297 pairs were designed. We next selected clear bands and used non-specific primers to amplify following PCR amplification. In total, 245 pairs of primers were screened. We then selected 50 pairs of primers to randomly screen for polymorphisms. We detected 47 polymorphic and 3 monomorphic loci in 65 unrelated sika deer. These newly isolated and characterized microsatellite loci can be used to construct genetic maps and for lineage testing in deer. In addition, they can be used for comparative genomics between Cervidae species. PMID:26436393

  19. Molecular Cloning and Gene Expression Analysis of Ercc6l in Sika Deer (Cervus nippon hortulorum)

    OpenAIRE

    Yin, Yupeng; Tang, Lina; Zhang, Jiabao; Tang, Bo; Li, Ziyi

    2011-01-01

    Background One important protein family that functions in nucleotide excision repair (NER) factors is the SNF2 family. A newly identified mouse ERCC6-like gene, Ercc6l (excision repair cross-complementing rodent repair deficiency, complementation group 6-like), has been shown to be another developmentally related member of the SNF2 family. Methodology/Principal Findings In this study, Sika deer Ercc6l cDNA was first cloned and then sequenced. The full-length cDNA of the Sika deer Ercc6l gene ...

  20. Neutron activation analysis of trace metals in the livers of Japanese sika deer (cervus Nippon)

    International Nuclear Information System (INIS)

    Neutron activation analysis facilities at the JMTR reactor was used to determine the levels of trace metals in the livers of nine Japanese sika deer. The samples were cut into pieces, pulverized in liquid nitrogen, freeze-dried, and finally fractionated through a stainless steel sieve of 200 mesh. Then the samples were irradiated for 6 or 24 hours by a neutron flux of 1.0x1014 n·cm-2·sec-1. In the present work, we analysed the concentrations of six elements (Ag, Co, Fe, Rb, Se, and Zn) in the livers of nine deer. (author)

  1. Spent Mushroom Substrate Influences Elk (Cervus Elaphus Canadensis) Hematological and Serum Biochemical Parameters

    OpenAIRE

    Park, Jae Hong; Kim, Sang Woo; DO, YOON JUNG; Kim, Hyun; Ko, Yeoung Gyu; Yang, Boh Suk; Shin, Daekeun; Cho, Young Moo

    2012-01-01

    The objective of this study was to evaluate the effect of spent mushroom substrate (SMS) derived from Pleurotus eryngii on the hematological and biochemical blood properties of elk. A total of 18, two and three-year-old elk were fed three different levels of SMS (0, 15 and 20%) in a corn-wheat bran diet for 80 days. The results indicated significantly high levels of blood monocytes, hemoglobin (Hb), and hematocrit (HCT) in elk fed 15% or 20% SMS (p

  2. Dybowski's sika deer (Cervus nippon hortulorum): genetic diversity of native Primorian and introduced Czech populations

    Czech Academy of Sciences Publication Activity Database

    Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Vallo, Peter; Voloshina, I. V.; Koubek, Petr

    Moscow : IUGB, 2009, s. 1-5. ISBN 978-5-7035-2118-2. [IUGB Congress /29./. Moscow (RU), 17.08.2009-22.08.2009] R&D Projects: GA ČR GA524/09/1569; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Dybowski's sika deer * genetic diversity Subject RIV: EB - Genetics ; Molecular Biology http://www.iugb-moscow2009.ru/cd/docs/ps/Krojerova_poster_1_report_eng.pdf

  3. Grazing Habitat of the Rusa Deer (Cervus timorensis) in the Upland Kebar, Manokwari

    OpenAIRE

    AGUSTINA YOHANA SETYARINI AROBAYA; FREDDY PATTISELANNO

    2009-01-01

    The general objective of the study was to provide current information on grassland communities as deer habitat and its future development plan for a sustainable forage management in upland Kebar, Papua. Quantitative estimation of forage production was carried out by measuring a biomass harvest in fresh weight bases, while occasional observations on ranging deer were done within habitat range with the aid of 7x50 binoculars verified by actual visitation of grazed area. The study indicated that...

  4. CONSERVATION DEVELOPMENT OF TIMOR DEER (Cervus timorensis AS COMMERCIAL PURPOSE(WITH OPTIMISTIC RATE ESTIMATION

    Directory of Open Access Journals (Sweden)

    N. Hanani

    2012-09-01

    Full Text Available The aim of this research was to determine the profit obtained from breeding of Timor deer commercially. This research was done in East Java. Survey method was used to answer the objective. The study location were selected by purposive sampling. Usually deer was develop in conservation area, but because the area was decrease so the number of deer also decrease. Model of deer raising development should be improved not only for conservation but also for commercial purpose. The optimum deer raising were considered and monitored with a purpose to maximize commercial Timor deer by using Multiple Objective Goal Programming (MOGP to find the Optimistic Rate Estimation. The result of this study showed to get the optimum benefit, it had to be applied together with conservation and commercial effort at the same time. Results of study showed that profit was taken from selling velvet was 164.46%. Profits taken from selling antler was 350.56%, from selling alive deer was 394.28%, from selling recreation tickets was 259.08%, from selling venison1 was 135.98%, and from selling deer leather was 141.24%. Operational cost spent were 168.46% for feeding cost, 213.23% for maintenance cost, and 232.04% for labors’ salaries. The amount of operational cost required in MOGP model, with lower expenses and commercial priority were 185.54% for feeding cost, 253.13% for maintenance cost, and 246.95% for paying labors’ salaries. The MOGP model result with commercial priority reached 335.21%, while in MOGP model with lower costs and commercial priority gave profit for breeders up to 381.26%.

  5. CONSERVATION DEVELOPMENT OF TIMOR DEER (Cervus timorensis) AS COMMERCIAL PURPOSE(WITH OPTIMISTIC RATE ESTIMATION)

    OpenAIRE

    N. Hanani; B. A. Nugroho; Z. Fanani; S.I. Santoso

    2012-01-01

    The aim of this research was to determine the profit obtained from breeding of Timor deer commercially. This research was done in East Java. Survey method was used to answer the objective. The study location were selected by purposive sampling. Usually deer was develop in conservation area, but because the area was decrease so the number of deer also decrease. Model of deer raising development should be improved not only for conservation but also for commercial purpose. The optimum deer raisi...

  6. Grazing Habitat of the Rusa Deer (Cervus timorensis in the Upland Kebar, Manokwari

    Directory of Open Access Journals (Sweden)

    AGUSTINA YOHANA SETYARINI AROBAYA

    2009-07-01

    Full Text Available The general objective of the study was to provide current information on grassland communities as deer habitat and its future development plan for a sustainable forage management in upland Kebar, Papua. Quantitative estimation of forage production was carried out by measuring a biomass harvest in fresh weight bases, while occasional observations on ranging deer were done within habitat range with the aid of 7x50 binoculars verified by actual visitation of grazed area. The study indicated that Kebar was the only grazing area of deer varies in low layer vegetation composition that comprised of eleven grass species and five legume species. Imperata cylindrica, Paspalum conjugatum, Themeda arguens, Melinis minutiflora and Cyperus rotundus were identified as food plant of deer in Kebar. Among these species T. arguens, M. minutiflora, C. rotundus and I. cylindrica were the most preferred species consumed by deer. The biomass harvest (species productivity was 30.36 kg/ha fresh weight, while deer food productivity in the grassland was slightly lower (26.70 kg/ha than total productivity of the grassland. The major drainage area is Kasi River, but two other rivers across this valley (Api River, Apriri River are also supply water to the swampy area.

  7. Campylobacter hyointestinalis-associated enteritis in Moluccan rusa deer (Cervus timorensis subsp. Moluccensis).

    Science.gov (United States)

    Hill, B D; Thomas, R J; Mackenzie, A R

    1987-11-01

    A morphological and bacteriological study on a Campylobacter hyointestinalis-associated enteritis in adult Moluccan rusa deer is described. Necropsied deer were 2 to 2.5 years of age and had been scouring for 1 to 2 months. There was distension of the ileum and excessive corrugation of the mucosa. Microscopic lesions in the small intestine were confined to the ileum. Stunting and fusion of villi, patchy erosion of epithelium and a predominantly neutrophilic infiltrate were features. The inflammatory reaction in caecum and colon was much less severe. Light and scanning electron-microscopical examination of small and large intestine showed large numbers of Gram-negative curved rods colonizing surface mucus and moderate numbers in close association with gland epithelium. No salmonellae or other enteropathogenic bacteria were isolated on aerobically-incubated media. C. hyointestinalis was isolated from the faeces, ileum, caecum, colon and mesenteric lymph nodes from 2 cases and one farm-collected faecal sample. PMID:3443691

  8. Estudio comparativo del comportamiento electroquímico del hierro en medio alcalino en presencia de lodos rojos y lodos grises. Efecto del Al3+

    OpenAIRE

    Abreu, C. M.; Freire, L.; Nóvoa, X. R.; Pena, G.; Pérez, M. C.

    2009-01-01

    Red mud (RM) is the main by-product of the Bayer process for alumina extraction from bauxite, and grey slurries (GS) are generated during the granite rocks transformation processes. The huge volume of those wastes generated every year suppose a serious environmental problem. Recent works by our group demonstrate the efficiency of both types of muds as corrosion inhibitors for iron and steel in alkaline media containing chlorides. The elemental analysis of these slurries shows that Al

  9. Reanimación con glóbulos rojos Rh positivo y sin prueba cruzada en emergencias médicas

    Directory of Open Access Journals (Sweden)

    Armando Corté

    2004-12-01

    Full Text Available Introduction: Three-year’s experience in the use of un-cross-matched group O Rh positive RBC for emergency transfusion in severely injured and hypovolemic patients a civilian clinical. Design and methods: Blood requests were for patients with trauma, unexpected massive intraoperative hemorrhage, or ruptured aneurysm. Group O Rh positive RBC is our first choice to support patients who cannot wait for type specific or crossmatched blood. Transfusion was ordered on clinical signs of class III or class IV hemorrhage who could not be adequately resuscitated with crystalloid solutions. Results: One hundred nineteen patients entered the protocol, receiving a total of 568 units of blood (4.77 units/patient. There were no adverse effects noted even though complete serologic testing had not been done. There were no deaths related to transfusion incompatibility. None of the patients presented with anti-D. Only 14 patients who were Rh negative received group O Rh positive RBC, and most of these patients were male. There were no acute hemolytic reactions or sensitization of young females. Overall, 38 patients (31.9% died, 24 within hours of arrival. No death was attributable to transfusion reaction or blood incompatibility. Complications included two dysrhythmia, four patients developed ARDS (3.36%, and seven patients (5.8% had DIC. None of the ‘DIC’ cases were related to incompatible blood transfusion. Those who do survive the emergency conditions can be reverted to blood of their own type without problem. Conclusions: Group O Rh positive RBC used as an immediate resuscitative blood component is safe.

  10. MACROINVERTEBRADOS ASOCIADOS A LAS RAÍCES SUMERGIDAS DEL MANGLE ROJO (Rhizophora mangle EN LAS BAHÍAS TURBO Y EL UNO, GOLFO DE URABÁ (CARIBE COLOMBIANO

    Directory of Open Access Journals (Sweden)

    GARCÍA PADILLA JESÚS MARÍA

    2010-05-01

    Full Text Available Con el fin de establecer el comportamiento de la salinidad y las características de la fauna de macroinvertebrados asociados a las raíces de Rhizophora mangle en las Bahías de Turbo y El Uno, se realizaron cuatro muestreos entre septiembre del 2004 y febrero del 2005, en tres sectores de las Bahías. Los valores de salinidad experimentaron cambios muy importantes en el tiempo y fluctuaron entre 2 y 32 unidades. En total, se cuantificaron 26 especies en Bahía Turbo y 28 en Bahía El Uno. Mientras la diversidad en la Bahía Turbo varió entre 0,77 en septiembre y 2,22 noviembre, en Bahía El Uno, los valores fluctuaron entre 1,14 en noviembre y 1,95 en septiembre. La mayoría de las especies son frecuentes en las raíces de mangle de la región caribe y poseen un carácter eurihalino.

  11. Abonos verdes e inoculación micorrízica de posturas de cafeto sobre suelos Fersialíticos Rojos lixiviados

    Directory of Open Access Journals (Sweden)

    R. Rivera

    2010-01-01

    presencia del sustrato conformado por la crotalaria. No obstante, aún en presencia de dicho sustrato, las posturas inoculadas no mostraron una micorrización efectiva y fueron inferiores a las obtenidas con el tratamiento de referencia suelo/humus (3/1. Por tanto, para obtener posturas vigorosas y una micorrización efectiva, fue necesario, además de inocular, adicionar cantidades complementarias de humus de lombriz en una relación de 9/1 sobre el sustrato de crotalaria incorporada.

  12. Bio deterioration behaviour in different colour roofing tiles (red and straw coloured); Comportamiento de tejas de diferente color (rojo y paja) frente al biodeterioro

    Energy Technology Data Exchange (ETDEWEB)

    Guzulla, M. F.; Sanchez, E.; Gonzalez, J. M.; Orduna, M.

    2014-07-01

    Bio colonization of building materials is a critical problem for the durability of constructions. Industrial experience shows that straw coloured roofing tiles are more prone to colonization than red roofing tiles, even having similar characteristics. The aim of this work is to explain the difference of bio colonization between different colour roofing tiles. The chemical composition of the surface of straw coloured and red roofing tiles, the phase composition and the microstructure of the roofing tiles were determined by WD-XRF, XRD and SEM-EDX, respectively. The pore size distribution was carried out by Hg porosimetry. The solubility was studied by determining the soluble salts (Ca, Mg, Na, K, Cl and SO{sub 4} 2-) by ICP-OES and ionic chromatography. Roofing tile bio receptivity was evaluated by determining fluorescence intensity using a pulse amplitude- modulated (PAM) fluoro meter, and cyanobacteria Oscillator sp. The results obtained show higher concentration of calcium and sulphur in straw coloured roofing tiles surface, and higher solubility than red roofing tiles. Moreover, according to the results obtained in bio receptivity assays, straw coloured roofing tiles are more prone to colonization than red roofing tiles, so, there is a relationship between surface properties of roofing tiles and bio colonization, as it is observed in industrial products. (Author)

  13. COLONIZACIÓN DE MOLUSCOS Y CRUSTÁCEOS EN RAÍCES DE MANGLE ROJO EN UNA LAGUNA COSTERA DE LA PUNTA NORTE DEL GOLFO DE MORROSQUILLO

    Directory of Open Access Journals (Sweden)

    PRÜSMANN JOHANNA

    2010-05-01

    Full Text Available Se evaluaron la colonización y sucesión de moluscos y crustáceos en un sustrato de raíces de mangle en tres estaciones en la ciénaga La Boquilla, Punta San Bernardo en la parte norte del Golfo de Morrosquillo. Para el seguimiento del proceso de colonización se ubicaron tres sitios en las márgenes occidental, norte y oriental, y se fijaron en cada estación seis raíces aéreas deshojadas de Rhizophora mangle. Luego de 76 y 200 días de exposición, se retiraron tres raíces de cada sitio y se identificaron los organismos por morfoespecie. Después de 200 días de exposición, se determinaron 19 especies de moluscos y cinco de crustáceos. El anfípodo Corophium sp. y el bivalvo Brachidontes exustus fueron las especies mas numerosas y agruparon una fracción muy importante de la totalidad de los individuos recolectados. La mayoría de las especies encontradas son típicas de la fauna acompañante de las raíces de mangle en el Caribe colombiano.

  14. Synthesis of a red pigment from gold nanoparticles; Sintesis de un pigmento rojo a partir de nanopartIculas de oro

    Energy Technology Data Exchange (ETDEWEB)

    Mestre, S.; Palacios, M. D.; Agut, P.

    2012-07-01

    A simple method of synthesising red pigments for ceramic glazes, based on gold nanoparticles protected by a refractory oxide capsule, was developed. Gold nanoparticles of an appropriate size were obtained by reaction in an aqueous medium between an Au(III) solution and an ammonium bromide solution, keeping the Br- concentration low during the process. The gold nanoparticles were encapsulated by adding the protective oxide in colloid form and subsequently coagulating it, alkalinising the medium. Diethylen triamine was then added to encourage the interaction between the gold nanoparticles and the oxide nanoparticles. This was followed by adding carboxymethylcellulose to raise medium viscosity, and to avoid segregation and subsequent agglomeration of the gold nanoparticles during drying. The dry residue was directly usable as a glaze pigment without requiring further thermal treatments. Three protective oxides, namely SiO{sub 2}, Al{sub 2}O{sub 3}, and SnO{sub 2}, were tested. In the three cases, pigments with a high colouring strength were obtained, which gave rise to reds of different shades in the resulting test glaze. (Author)

  15. Uso de trampas de pelo y caracterización de los pelos de la ardilla de vientre rojo. Callosciurus erythraeus

    Directory of Open Access Journals (Sweden)

    Laura Fasola

    2005-01-01

    Full Text Available Use of hair tubes and hair characterization of the Red-Bellied Squirrel Callosciurus erythraeus. The Asiatic Red-Bellied Squirrel has been introduced into the Pampas Region, where a wild population has now been established and it is colonizing new areas. Hair tubes have been successfully used to assess the presence/absence of other species of squirrel through the identification of the collected hairs. The objectives of this study were to characterize the hairs of the Red-Bellied Squirrel and to test the use of hair tubes to detect the presence of this species. The study was conducted in the province of Buenos Aires, Argentina, from January to July 2004. Hairs from the back, head and tail have dark and light stripes while hairs from the belly are uniformly reddish brown. A multi-seriated medullar pattern was observed in the hairs of the back, head and belly, while the tail’s hairs showed a different medullar pattern that can be described as overlapped dark rings. Cuticle scales patterns corresponded to the normal mosaic type in the hairs of the tail, back, head and belly, and for the last three regions a different pattern was observed next to the hair bulb. Hair tubes were made of PVC tubes (25x6 cm opened at both extremes. The tubes had an adhesive tape attached at both extremes and bait (peanuts and nuts was offered in the centre. Given the arboreal habits of this squirrel, traps were placed on tree branches and inspected weekly. The hair tubes were successful in collecting hairs of the Red-Bellied Squirrel that can be distinguished from those of other mammals inhabiting the same area. Because this is quite a simple and inexpensive technique, we consider it an appropriate method to evaluate the presence of this alien species in the region.

  16. Longitudinal Pathogenesis Study of Young Red Deer (Cervus elaphus after Experimental Challenge with Mycobacterium avium subsp. paratuberculosis (MAP

    Directory of Open Access Journals (Sweden)

    Colin Mackintosh

    2012-01-01

    Full Text Available Paratuberculosis progresses more quickly in young red deer than in sheep or cattle. This study describes the clinical, immunological and pathological changes over a 50-week period in fourteen 4-month-old red deer that received heavy oral challenge with Mycobacterium avium subsp. paratuberculosis (MAP. At 4 and 12 weeks post challenge they were anaesthetized and a section of jejunal lymph node was surgically removed for culture, histopathology, and genetic studies. All 14 deer became infected, none were clinically affected, and they had varying degrees of subclinical disease when killed at week 50. Week 4 biopsies showed no paratuberculosis lesions, but MAP was cultured from all animals. At weeks 12 and 50 histopathological lesions ranged from mild to severe with corresponding low-to-high antibody titres, which peaked at 12–24 weeks. IFN-γ responses peaked at 8–15 weeks and were higher in mildly affected animals than in those with severe lesions.

  17. Three finger palpation technique of vas deferens for keyhole vasectomy in spotted (Axis axis and sambar deer (Cervus unicolor

    Directory of Open Access Journals (Sweden)

    B. J. William

    2014-09-01

    Full Text Available Aim: Vasectomy is performed in deer for population control, maintain pedigreed animals and prevent inbreeding. Conventional procedure of vasectomy required a long-term anesthesia and longer duration of hospitalization, which often result in stress, morbidity and mortality. A study was conducted to capture, neuter and release the deer with minimal hospitalization and stress by adopting three finger palpation technique of vas deferens and performing vasectomy through a key-hole incision. Materials and Methods: The study was conducted on three spotted male deer and three sambar male deer, which were immobilized with a mixture of xylazine at the dose of 1.00 mg/kg and ketamine at the dose of 5.00 mg/kg. The vas deferens could be palpated as a piece of cooked spaghetti at the neck of the scrotum on the anterior aspect by three finger palpation technique and was able to fix the vas deferens between the thumb and middle finger. Through a key-hole incision of <5 mm length, the vas deferens was exteriorized and resected using electrocautery and the skin incision was sealed with methyl methacrylate. The deer were released on the same day, and no post-operative complication was noticed. Conclusion: The study revealed that three finger palpation technique of vas deferens provided guidance for easy access to vas deferens for vasectomy in deer with less hospitalization, and the deer could be released on the same day.

  18. Damage caused by red deer (Cervus elaphus & wild boar (Sus scrofa in forest hunting grounds in Serbia

    Directory of Open Access Journals (Sweden)

    Gačić Dragan P.

    2009-01-01

    Full Text Available The systematic study and assessment of the damage by big game in forest hunting grounds in Serbia was infrequent, although the damage was evident. The objective of this paper is to identify the rates and types of damage by red deer and wild boar at three localities: (1 fenced part of the hunting ground 'Crni Lug' (Srem, (2 fenced part of the hunting ground 'Podunavsko Lovište Plavna' (Southwestern Bačka, and (3 fenced rearing centre 'Lomnička Reka' (Mt. Veliki Jastrebac. The damage was not recorded on locality (1. The damage on locality (2 (new polar plantations and locality (3 (beech forests was caused by red deer. The main causes of the damage were excessive density and disturbed population structure (sex and age, nonharmonised forest and hunting management, shortage of natural food, especially of pasture areas.

  19. Optimizing the conditions for in vitro maturation and artificial activation of sika deer (Cervus nippon hortulorum) oocytes.

    Science.gov (United States)

    Yin, Y; Tang, L; Zhang, P; Kong, D; Wang, Z; Guan, J; Song, G; Tang, B; Li, Z

    2013-02-01

    With the goal of establishing experimental protocols for cloning sika deer, various conditions for in vitro maturation (IVM) and artificial activation of sika deer oocytes were examined. In vitro maturation was evaluated in seven different culture media. The highest rate of oocyte maturation was 75.4% in 10 μg/ml follicle-stimulating hormone (FSH), 1 μg/ml LH, 0.2 mm cysteamine and 50 ng/ml epidermal growth factor (EGF) after 24 h of IVM. The efficiency after 24 h of IVM did not differ significantly (p > 0.05) from that observed after 20 h. Cysteamine (0.2 mm) significantly increased the maturation rates after 20 h (from 59.1% to 67.2%, p sika deer oocytes to the blastocyst stage (32.4%). Our results indicate that in vitro matured sika deer oocytes are good candidates for parthenogenetic activation and that chemical treatment is needed for relatively efficient activation of the oocytes. These optimized conditions for IVM and parthenogenetic activation may be useful for efforts to restore populations of the endangered sika deer using the somatic cell nuclear transfer technique. PMID:22458270

  20. Serum hormone concentrations and ovarian follicular wave emergence in Jilin sika deer (Cervus nippon hortulorum) after synchronization of estrous cycles.

    Science.gov (United States)

    Chen, X M; Wei, H J; Yang, Y F; Xue, H L; Zhao, W G; Zhao, M

    2015-02-01

    The study was conducted to investigate the serum hormone concentrations and follicular dynamics present after synchronous treatment (CIDR) in female Jilin sika deer (n = 15) of estrous cycles. Blood samples were collected to analyze the FSH, LH, estradiol and progesterone during the estrous cycles. Manual transrectal ultrasonography examination was conducted at least thrice weekly to monitor the follicular wave. Ultrasonography showed that follicle development occurred in waves, and most estrous cycles in Jilin sika deer consist of one, two, or three waves. The largest follicles of the interwaves of two- and three-wave cycles were different (P sika deer is characterized by one, two, or three waves of follicular development after synchronization. PMID:25563157

  1. Steroid hormones profile during an ovarian synchronization procedure in different age categories of red deer hinds (Cervus elaphus L.

    Directory of Open Access Journals (Sweden)

    Šperanda Marcela

    2012-01-01

    Full Text Available The objective of the present study was to compare estradiol/progesterone ratios of different age categories of red deer hinds and use it as a predictor of estrus synchronization success and consequently conception rate. To accomplish this we used 38 red deer hinds to establish serum progesterone and estradiol levels in young (21 animals, mature (10 animals and old (7 animals hinds during the estrus synchronization procedure (transvaginal/cervical AI. The following estrus synchronization was used: at the start of the experiment each hind received a controlled intravaginal drug-releasing device (CIDR, Pharmacia&Upjohn, New Zealand containing 0.3 g of progesterone. The device was removed on day 11, simultaneously with an application of 250 IU of Pregnant Mare Serum Gonadotropin (PMSG, Folligon® Intervet International, Boxmeer, Holland. Transvaginal/ cervical AI (artificial insemination was performed 48 hours after CIDR withdrawal (day 13. Blood samples were obtained from the jugular vein using a Venoject® vacutainer without an anticoagulant for hormonal tests on the same experimental day (0, 11th and 13th day. A statistically (p<0.01 higher progesterone level was found in young hinds on the 11th day after controlled intravaginal drug-releasing device insertion. A significantly higher (p<0.01 estrogen level was observed in the young in regard to mature and old hinds on the expected day of estrus (13th day. Estradiol/progesterone ratios showed a statistically significant difference (p<0.01 on insemination day (13th day between old and young hinds (98.67 : 46.59 and between old and mature hinds (98.67 : 51.79. Out of a total of 38 hinds only 9 had their offspring, 6 of the young and 3 of the mature hinds.

  2. Detection of Lyme disease spirochetes in the skin of naturally infected wild sika deer (Cervus nippon yesoensis) by PCR.

    Science.gov (United States)

    Kimura, K; Isogai, E; Isogai, H; Kamewaka, Y; Nishikawa, T; Ishii, N; Fujii, N

    1995-04-01

    We demonstrated the presence of Borrelia burgdorferi sensu lato DNA in the skin tissues of naturally infected wild sika deer, using PCR. The risk of transmission of B. burgdorferi sensu lato is recognized in sika deer. PMID:7747979

  3. Caprine herpesvirus-2 in association with naturally occurring malignant catarrhal fever in captive sika deer (Cervus nippon).

    Science.gov (United States)

    Keel, M Kevin; Patterson, J Gage; Noon, Ted H; Bradley, Gregory A; Collins, James K

    2003-03-01

    Three female sika deer from a single captive herd were submitted for postmortem examination over a 139-day period. The first 2 deer submitted were reported to have lost body mass for 20 days to 1 month before euthanasia. One of these deer had diarrhea, the other had a crusting dermatitis on the nasal planum and inner aspects of both pinnae. The third hind did not have any signs of disease before it was found seizuring and was immediately euthanatized. Microscopically, all 3 animals had a lymphocytic vasculitis typical of malignant catarrhal fever (MCF), with the most severe lesions in the brain. All 3 deer were polymerase chain reaction (PCR) positive for caprine herpesvirus 2 (CpHV-2) and were negative for ovine herpesvirus 2 (OHV-2). Two healthy goats that were housed adjacent to the deer were also PCR positive for CpHV-2 and PCR negative for OHV-2. The CpHV-2, PCR amplicons from the hinds, and the 2 healthy goats had an identical single base polymorphism. A male sika deer that was housed with the hinds and a fawn from 1 of the hinds remained asymptomatic and were PCR negative for CpHV-2. This represents the first report of mortality with MCF-like lesions in association with CpHV-2. PMID:12661731

  4. Prevalence and molecular analyses of hemotrophic Mycoplasma spp. (hemoplasmas) detected in sika deer (Cervus nippon yesoensis) in Japan.

    Science.gov (United States)

    Tagawa, Michihito; Matsumoto, Kotaro; Yokoyama, Naoaki; Inokuma, Hisashi

    2014-03-01

    Hemotropic mycoplasmas (hemoplasmas) are cell-wall deficient, epierythrocytic bacteria that cause infectious anemia in several mammalian species. The prevalence of hemoplasma species was examined by screening and species-specific PCR using blood samples collected from 51 sika deer in Hokkaido, Japan. Molecular analyses were performed for the 16S rRNA, 23S rRNA and RNase P RNA (rnpB) gene sequences. A total of 23/51 (45%) deer DNA samples were positive for hemoplasmas in the screening PCR. Using species-specific PCR, 12 and 17 samples were positive for 'Candidatus Mycoplasma haemocervae' and 'Candidatus M. erythrocervae', respectively. Sequencing and phylogenetic trees of those three genes indicate that the 'Candidatus M. haemocervae' and 'Candidatus M. erythrocervae' detected in Japanese deer are potentially different species from the cervine hemoplasma found in deer from America and Brazil. PMID:24270803

  5. Prevalence and Molecular Analyses of Hemotrophic Mycoplasma spp. (Hemoplasmas) Detected in Sika Deer (Cervus nippon yesoensis) in Japan

    OpenAIRE

    TAGAWA, Michihito; MATSUMOTO, Kotaro; Yokoyama, Naoaki; INOKUMA, Hisashi

    2013-01-01

    ABSTRACT Hemotropic mycoplasmas (hemoplasmas) are cell-wall deficient, epierythrocytic bacteria that cause infectious anemia in several mammalian species. The prevalence of hemoplasma species was examined by screening and species-specific PCR using blood samples collected from 51 sika deer in Hokkaido, Japan. Molecular analyses were performed for the 16S rRNA, 23S rRNA and RNase P RNA (rnpB) gene sequences. A total of 23/51 (45%) deer DNA samples were positive for hemoplasmas in the screening...

  6. Response of the Rumen Microbiota of Sika Deer (Cervus nippon) Fed Different Concentrations of Tannin Rich Plants.

    Science.gov (United States)

    Li, Zhipeng; Wright, André-Denis G; Liu, Hanlu; Fan, Zhongyuan; Yang, Fuhe; Zhang, Zhigang; Li, Guangyu

    2015-01-01

    High throughput sequencing was used to examine the rumen microbiota of sika deer fed high (OLH) and low concentration (OLL) of tannin rich oak leaves. The results showed that Prevotella spp. were the most dominant bacteria. The most predominant methanogens were the members of the order Methanoplasmatales. The dominant rumen protozoa were Entodinium longinucleatum, Eudiplodinium maggii, and Epidinium caudatum, and the fungal communities were mostly represented by Piromyces spp. Moreover, the relative abundance of Pseudobutyrivibrio spp. (P=0.026), unidentified bacteria (P=0.028), and Prevotella spp. (P=0.022) was lower in the OLH group than in the OLL group. The concentration of propionate in the OLH group was greater than in the OLL group (P=0.006). Patterns of relationships showed that methanogens belonging to the order Methanoplasmatales were negatively correlated with Treponema spp., Ent. Longinucleatum, and acetate. Methanosphaera stadtmanae was positively correlated to propionate, while Methanobrevibacter ruminantium was negatively associated with Methanobrevibacter thaueri and Methanobrevibacter millerae. Tannins altered the rumen microbes and fermentation patterns. However, the response of the entire rumen microbiota and the relationship between rumen microorganisms and the fermentation parameters were not fully understood. PMID:25955033

  7. Collagen from Tendon of Yezo Sika Deer (Cervus nippon yesoensis) as By-Product

    OpenAIRE

    Takeshi Nagai; Nobutaka Suzuki; Yasuhiro Tanoue; Norihisa Kai

    2012-01-01

    Collagen from tendon of Yezo sika deer was prepared by limited pepsin digestion. The yield of collagen was very high; 35.7% on the basis of lyophilized dry weight. The secondary structure of this collagen was different from that of porcine skin by ATR-FTIR analysis, although it was the same characteristics, e.g. SDS-PAGE, subunit composition, ther-mal behavior, as porcine collagen. Since taking up a problem of bovine spongiform encephalopathy infection in land animals such as calf or bovine, ...

  8. First Evidence that Sika Deer (Cervus nippon) Velvet Antler Extract Suppresses Migration of Human Prostate Cancer Cells.

    Science.gov (United States)

    Tang, YuJiao; Jeon, Byong-Tae; Wang, Yanmei; Choi, Eun-Ju; Kim, Yon-Suk; Hwang, Jin-Woo; Park, Pyo-Jam; Moon, Sang Ho; Kim, Eun-Kyung

    2015-01-01

    Deer velvet antler (DVA) is one of the most popular medicines in China. Numerous studies have demonstrated that velvet antler possess biological effects. However, data regarding its anti-migration activity on prostate cancer is scarce. In this study, we investigated the inhibitory effect of top DVA (T-DVA) on the expression of prostate-specific antigen (PSA) and migration-related genes in the human prostate cancer cell, LNCaP. The T-DVA down-regulated the expression of PSA. In addition, the Radius(TM) assay revealed that T-DVA inhibited the migration behavior of prostate cancer cells. Furthermore, the expression of matrix metalloproteinase (MMP)-9 and vascular endothelial growth factor (VEGF) was also decreased with T-DVA. On the contrary, T-DVA increased the tissue inhibition of metalloproteinase (TIMP)-1 and (TIMP)-2. Taken together, our findings indicate that the T-DVA possesses anti-migration activity on prostate cancer cells. This is the first study of DVA to report the anti-migration activity on prostate cancer. PMID:26761873

  9. Gastrin-Releasing Peptide (GRP) in the Uteroplacenta of the Sika Deer (Cervus nippon)

    OpenAIRE

    Junpei Kimura; JoonHyuk Sohn

    2012-01-01

    The localization of GRP in the uterus and/or placenta of non-pregnant or pregnant Sika deer was studied immunohistochemically. The strong immunoreactions were identified in the supra-nuclear region of the epithelial cells of the uterine glands of the placenta, however, no reaction was observed in the uterus of non-pregnant or immature animals. GRP may play an important role as the critical signals or nutrients for the growth of fetus in the synepitheliochorial placenta.

  10. Seroprevalence and risk factors of Toxoplasma gondii infection in domestic sika deer (Cervus nippon) in northeastern China.

    Science.gov (United States)

    Qin, Si-Yuan; Zhang, Xiao-Xuan; Cong, Wei; Zhou, Dong-Hui; Wang, Jin-Lei; Yin, Ming-Yang; Tan, Qi-Dong; Zhao, Quan; Zhu, Xing-Quan

    2014-12-01

    Toxoplasmosis is a worldwide zoonosis caused by Toxoplasma gondii, which can infect warm-blooded animals and humans. A serological survey was undertaken to examine the seroprevalence and risk factors associated with T. gondii infection in sika deer in northeastern China. 114 (13.46%, 95% CI 11.16-15.76) out of 847 serum samples were positive to T. gondii by modified agglutination test (MAT) at a 1:25 cut-off, with titers of 1:25 in 44, 1:50 in 32, 1:100 in 17, 1:500 in 11, 1:1500 or higher in 10. These samples were collected between November 2012 and October 2013 from Inner Mongolia, Jilin and Heilongjiang provinces in China. However, statistically significant differences were not observed between T. gondii seroprevalence and genders or regions of sika deer in the logistic regression analysis (P>0.05) and left out of the final model. Seroprevalence of T. gondii infection in male sika deer was 14.07% (95% CI 11.14-17.01), slightly higher than that in the female (12.38%) (95% CI 8.69-16.06) and seroprevalence of T. gondii infection in Harbin, Changchun city, Jilin city and Chifeng city were 12.02% (95% CI 7.60-16.44), 15.51% (95% CI 11.52-19.50), 12.27% (95% CI 7.23-17.31) and 12.50% (95% CI 7.38-17.63), respectively. Seasons of sampling were considered as main risk factors associated with T. gondii infection, autumn (15.32%) were more than two times (OR=1.98, 95% CI=1.18-3.33, P=0.01) at risk of acquiring T. gondii infection compared to winter (8.37%). Our results indicated a widespread exposure to T. gondii among sika deer in China. To our knowledge, this is the first report of T. gondii seroprevalence in sika deer in China. PMID:25201489

  11. Detection of Lyme disease spirochetes in the skin of naturally infected wild sika deer (Cervus nippon yesoensis) by PCR.

    OpenAIRE

    Kimura, K.; Isogai, E; Isogai, H; Kamewaka, Y; Nishikawa, T.; Ishii, N; Fujii, N

    1995-01-01

    We demonstrated the presence of Borrelia burgdorferi sensu lato DNA in the skin tissues of naturally infected wild sika deer, using PCR. The risk of transmission of B. burgdorferi sensu lato is recognized in sika deer.

  12. Response of the Rumen Microbiota of Sika Deer (Cervus nippon) Fed Different Concentrations of Tannin Rich Plants

    OpenAIRE

    Li, Zhipeng; Wright, André-Denis G.; Liu, Hanlu; Fan, Zhongyuan; Yang, Fuhe; Zhang, Zhigang; Li, Guangyu

    2015-01-01

    High throughput sequencing was used to examine the rumen microbiota of sika deer fed high (OLH) and low concentration (OLL) of tannin rich oak leaves. The results showed that Prevotella spp. were the most dominant bacteria. The most predominant methanogens were the members of the order Methanoplasmatales. The dominant rumen protozoa were Entodinium longinucleatum, Eudiplodinium maggii, and Epidinium caudatum, and the fungal communities were mostly represented by Piromyces spp. Moreover, the r...

  13. Contrary seasonal changes of rates of nutrient uptake, organ mass, and voluntary food intake in red deer (Cervus elaphus).

    Science.gov (United States)

    Arnold, Walter; Beiglböck, Christoph; Burmester, Marion; Guschlbauer, Maria; Lengauer, Astrid; Schröder, Bernd; Wilkens, Mirja; Breves, Gerhard

    2015-08-01

    Northern ungulates acclimatize to winter conditions with restricted food supply and unfavorable weather conditions by reducing energy expenditure and voluntary food intake. We investigated in a study on red deer whether rates of peptide and glucose transport in the small intestines are also reduced during winter as part of the thrifty phenotype of winter-acclimatized animals, or whether transport rates are increased during winter in order to exploit poor forage more efficiently. Our results support the latter hypothesis. We found in a feeding experiment that total energy intake was considerably lower during winter despite ad libitum feeding. Together with reduced food intake, mass of visceral organs was significantly lower and body fat reserves were used as metabolic fuel in addition to food. However, efficacy of nutrient absorption seemed to be increased simultaneously. Extraction of crude protein from forage was higher in winter animals, at any level of crude protein intake, as indicated by the lower concentration of crude protein in feces. In line with these in vivo results, Ussing chamber experiments revealed greater electrogenic responses to both peptides and glucose in the small intestines of winter-acclimatized animals, and peptide uptake into jejunal brush-border membrane vesicles was increased. We conclude that reduced appetite of red deer during winter avoids energy expenditure for unproductive search of scarcely available food and further renders the energetically costly maintenance of a large gut and visceral organs unnecessary. Nevertheless, extraction of nutrients from forage is more efficient in the winter to attenuate an inevitably negative energy balance. PMID:26017492

  14. Body dimensions and coloration of the winter pelage of a Moravian population of sika deer, Cervus nippon

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Zejda, J.

    2002-01-01

    Roč. 51, č. 3 (2002), s. 253-256. ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/3/253-256.pdf

  15. Co-phylogeography and morphological evolution of sika deer lice (Damalinia sika) with their hosts (Cervus nippon)

    OpenAIRE

    Mizukoshi, Atsushi; Johnson, Kevin P.; Yoshizawa, Kazunori

    2012-01-01

    Lice are obligate parasites of mammals and birds and have become an important model for studies of host-parasite co-evolution and co-phylogenetics. Population genetic and phylogeographic studies represent an important bridge between microevolution and co-phylogenetic patterns. We examine co-phylogeographic patterns in sika deer and their parasitic lice. Co-phylogeographic patterns in deer and lice were evaluated using homologous regions of mitochondrial COI sequences. The phylogeographic brea...

  16. Co-phylogeography and morphological evolution of sika deer lice (Damalinia sika) with their hosts (Cervus nippon).

    Science.gov (United States)

    Mizukoshi, Atsushi; Johnson, Kevin P; Yoshizawa, Kazunori

    2012-10-01

    Lice are obligate parasites of mammals and birds and have become an important model for studies of host-parasite co-evolution and co-phylogenetics. Population genetic and phylogeographic studies represent an important bridge between microevolution and co-phylogenetic patterns. We examine co-phylogeographic patterns in sika deer and their parasitic lice. Co-phylogeographic patterns in deer and lice were evaluated using homologous regions of mitochondrial COI sequences. The phylogeographic breaks recovered for deer populations matched those of previous studies. Comparisons of the phylogeographic tree topology for deer lice with that of their hosts revealed a significant level of congruence. However, comparisons of genetic distances between deer and lice suggested that one of the estimated co-divergence events is more likely a recent host switch. Taking into account genetic divergence, there is not strong evidence for complete phylogeographic co-divergence between deer and their parasitic lice. However, mitochondrial phylogenies only track genetic structure of female lineages, and the incongruence between deer and louse phylogeography may be explained by louse migration mediated by male deer. Morphological analysis of head shape variation based on an elliptic Fourier descriptor showed that overall morphological variation contained phylogenetic signal, suggesting that in general morphology of these lice evolves congruent to population history. PMID:22835817

  17. Effects of highways on elk (Cervus elaphus) habitat in the Western United States and proposed mitigation approaches

    OpenAIRE

    Ruediger, William Bill C.; Wall, Ken; Wall, Robin

    2005-01-01

    Why Elk? Elk are an excellent species to use as a “terrestrial wildlife indicator” for highway impacts. First, they are widespread and exist in all western states as well as several midwestern and eastern states. They are prevalent on many National Forest lands, Bureau of Land Management lands, USDI Fish and Wildlife Service and National Park Service lands. Much elk habitat is on public lands in the western United States (Flathers and Hoekstra 1989, Peek undated, Thomas and Toweill 1982). Elk...

  18. Antibody Responses of Cervids (Cervus elaphus) following Experimental Mycobacterium bovis Infection and the Implications for Immunodiagnosis ▿

    OpenAIRE

    Harrington, Noel P.; Surujballi, Om P.; Prescott, John F.; Duncan, J. Robert; Waters, W. Ray; Lyashchenko, Konstantin; Greenwald, Rena

    2008-01-01

    Captive and free-ranging wildlife animals are implicated in the maintenance and transmission of bovine tuberculosis and therefore pose a significant obstacle to eradication of the disease from domestic livestock. The current antemortem diagnostic method, the intradermal tuberculin skin test, is impractical for routine use with many wild animals. Antibody-based assays are particularly attractive because the animals are handled only once and immediate processing of the sample is not required. T...

  19. [Blood biological constants in the deer Rusa (Cervus timorensis russa) in New-Caledonia. I. Hematologic constants].

    Science.gov (United States)

    Audigé, L

    1990-01-01

    Since the beginning of year 1987, the deer "Rusa" breeding has been developing in New Caledonia. In 1988, during a slaughter operation amidst the herds, nearly ninety blood samples were collected in order to define the blood biological parameters (or constants) of this species. Regarding haematology, the study concerns the following parameters: erythrocyte count (9.32 x 10(12)/l), leucocyte count (4.51 x 10(9)/l), various leucocyte lines and their formula, i.e. (neutrophile polymorphonuclear: 2.08 x 10(9)/l [46.6 p. 100]; lymphocytes: 1.75 x 10(9)/l [38.4 p. 100]; monocytes: 0.33 x 10(9)/l [7.5 p. 100]; eosinophiles polymorphonuclear leucocytes: 0.4 x 10(9)/l [7.46 p. 100]; basophile polymorphonuclear leucocytes: 0.01 x 10(9)/l [0.28 p. 100]), hematocrite (36.8 l/l), hemoglobin ratio (14.1 g/dl), mean corpuscular volume (40.3 dl), mean corpuscular hemoglobin rate (15.3 pg/cell), mean corpuscular hemoglobin concentration (38.7 g/dl). In the course of the study, variations of these parameters were detected according to various physiological criteria and to the sampling conditions as deer is a stress sensitive animal. PMID:2218039

  20. [Blood biological constants in the deer Rusa (Cervus timorensis russa) in New-Caledonia. II. Biological constants].

    Science.gov (United States)

    Audigé, L

    1990-01-01

    Since the beginning of the year 1987, the deer "Rusa" breeding has been developing in New Caledonia. In 1988, during a slaughter operation in the herds, nearly 90 blood samples were collected in order to define the blood biological parameters (or constants) of this species. As for biochemistry, the following parameters have been search for: urea (6.8 mmol/l), creatinin rate (151.7 mmol/l), the activity of the creatin kinase (295.2 U/l), transaminase (ALAT: 60.1 UI/l; ASAT: 22.3 UI/l) and alcalin phosphatases (115.1 U/l), total bilirubin rate (2.76 mumol/l), total proteins rate (61.4 g/l) and albumin (32.6 g/l), calcium (2.42 mmol/l) and phosphorus (3.08 mmol/l). In course of the study, fluctuations of these parameters were detected, according to various criteria and to sampling conditions. PMID:2218040

  1. Role of Rusa deer Cervus timorensis russa in the cycle of the cattle tick Boophilus microplus in New Caledonia.

    Science.gov (United States)

    Barré, N; Bianchi, M; Chardonnet, L

    2001-01-01

    Two field experiments were conducted to evaluate the efficiency of Rusa deer in the development of the cattle tick Boaphilus microplus in comparison with that of steers in the same pastures and under the same conditions of infestation. No difference was noted between a mixed steer/deer herd and a pure steer or pure deer herd in the infestation pattern of each host, suggesting that attachment to the alternative host is mechanical and not affected by the simultaneous presence of the primary host on the pasture. Deer are capable of producing engorged viable females, with weight and reproductive performances similar to or even better than females fed on steers. For moderate levels (1 million larvae per hectare) and high levels (32 million larvae per hectare) of pasture infestation, tick burdens on steers were not very different (e.g. average 1,911 and 2,681 ticks per m2 skin, respectively, on day 24). This may be because of saturation of steer skin sites at the moderate larval dose. Deer harboured 2.7-33 times fewer ticks than steers and produce no engorged females at the moderate larval level and 32 times fewer engorged females than steers at the high larval level. Infestation of deer was dose-dependent with averages of 12 and 399 ticks per m2 skin on day 25 at the moderate and high larval levels, respectively. At a high infestation level of the environment, Rusa deer may contribute, but to a limited extent, to infestation of pastures and, consequently, of cattle. However, their role in sustaining a viable tick population requires further investigation. PMID:11508531

  2. Dybowski’s sika deer (Cervus nippon hortulorum): genetic divergence between natural Primorian and introduced Czech populations

    Czech Academy of Sciences Publication Activity Database

    Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Voloshina, I.; Myslenkov, A.; Lamka, J.; Koubek, Petr

    2013-01-01

    Roč. 104, č. 3 (2013), s. 312-326. ISSN 0022-1503 R&D Projects: GA ČR GA524/09/1569 Institutional support: RVO:68081766 Keywords : bottleneck * founder effect * genetic diversity * inbreeding * microsatellites * mtDNA Subject RIV: GI - Animal Husbandry ; Breeding Impact factor: 1.969, year: 2013

  3. Suvi toob Eestisse tantsuresidendid / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2004-01-01

    Hollandi koreograaf Paz Rojo valmistab koos brasiillase Cristian Duarte'ga ette oma uut, septembris esietenduvat tööd "Basic dance". Rojo viibib Tallinnas Kanuti gildi saali residendina. Ka teistest Eesti "residentuuridest" ja residentidest-koreograafidest

  4. Poliploidia en moluscos de importancia comercial (almeja catarina Argopecten ventricosus Sowerby ii, 1842; almeja mano de leon Nodipecten subnodosus Sowerby 1835; y abulón rojo Haliotis rufescens Swainson 1822)

    OpenAIRE

    Maldonado, R.

    2003-01-01

    La poliploidía ha sido una de las biotecnologías más empleadas en la ultima década para el mejoramiento genético de moluscos bivalvos por ser una de las mejores alternativas a corto plazo para incrementar la producción. Los organismos triploides presentan tres juegos completos de cromosomas homólogos que afectan la sinapsis, lo cual da como resultado una esterilidad parcial o total, la cual teóricamente repercute favorablemente en el crecimiento. Sin embargo, la inducción a la triploidía pres...

  5. Macroinvertebrados asociados a las raíces sumergidas del mangle rojo (rhizophora mangle) en las bahías turbo y el uno, golfo de urabá (caribe colombiano)

    OpenAIRE

    GARCÍA PADILLA JESÚS MARÍA; PALACIO JAIME

    2010-01-01

    Con el fin de establecer el comportamiento de la salinidad y las características de la fauna de macroinvertebrados asociados a las raíces de Rhizophora mangle en las Bahías de Turbo y El Uno, se realizaron cuatro muestreos entre septiembre del 2004 y febrero del 2005, en tres sectores de las Bahías. Los valores de salinidad experimentaron cambios muy importantes en el tiempo y fluctuaron entre 2 y 32 unidades. En total, se cuantificaron 26 especies en Bahía Turbo y 28 en Bahía El Uno. Mientr...

  6. Rojo Sierra M., Psicología y psicopatología de la percepción, memoria y fantasía : EUNIBAR, Barcelona, 1980

    OpenAIRE

    Barbera de Cuesta, Lía

    1983-01-01

    En el presente volumen, el autor que se desempeña como Catedrático de Psiquiatría y Director del Departamento de Psiquiatría y Psicología Medica de la Universidad de Valencia, plantea, que en el transcurso de su labor docente, descubrió la disparidad abismática de intereses de conocimientos, que existía entre la Psicología General que estudian los Psicólogos y la Psicología que el como psiquiatra considera que necesita la especialidad y los médicos en general. (Párrafo extraído del texto ...

  7. Análisis de la unión del rotavirus a los glóbulos rojos y el efecto que tiene dicha unión en la capacidad infecciosa en líneas tumorales.

    OpenAIRE

    Martín Bautista, Liliana

    2015-01-01

    Los virus oncolíticos (VO) son una alternativa prometedora para el tratamiento del cáncer. Estos virus se caracterizan por ser partículas no patógenas que infectan específicamente células cancerosas provocando su muerte, mientras que no afectan los tejidos sanos. El grupo de biología molecular de virus de la Universidad Nacional de Colombia ha realizado trabajos que evalúan la capacidad oncolitica del rotavirus. Inicialmente se seleccionaron 5 aislados de rotavirus, que fueron cultivados en...

  8. Interacciones macho-hembra del pulpo rojo patagónico Enteroctopus megalocyathus (Cephalopoda: Octopodidae durante el comportamiento de apareamiento Male-female interactions of Patagonian red octopus Enteroctopus megalocyathus (Cephalopoda: Octopodidae during mating behavior

    Directory of Open Access Journals (Sweden)

    Ranferi Gutiérrez

    2012-09-01

    Full Text Available Se evalúa, en condiciones de laboratorio, el comportamiento de apareamiento de ocho parejas de Enteroctopus megalocyathus mediante videograbaciones durante 24 h. El comportamiento precopulatorio (CP se caracterizó por presentar tres eventos (natación, exhibición y contacto y el comportamiento copulatorio (CC se caracterizó por mostrar un solo evento (cópula. Del tiempo total de interacción de las parejas, el 34,4% correspondió al CP y el 65,6% correspondió al CC. Entre los tiempos de machos y hembras no hubo diferencias significativas por evento. Al compararse todos los eventos entre sí en relación al tiempo de duración, se presentó el siguiente orden: cópula > contacto > exhibición > natación. Se observó una tendencia a periodos de apareamiento más largos donde el peso de la hembra fue superior al macho, sugiriendo que el peso de la hembra es un factor determinante en la duración de los encuentros de apareamiento.The mating behavior of eight couples of Enteroctopus megalocyathus was evaluated under laboratory conditions by videotaping for 24 h. The precopulatory behavior (CP was characterized by three patterns (swimming, exhibition and contact and copulatory behavior (CC was characterized by display of a single pattern (copulation. Of the total interaction time between octopuses, 34.4% corresponds to CP and 65.6% corresponds to CC. Between times of males and females were not significantly different by pattern. In all events, compared to each other for the duration, presented the following order: copulation > contact > exhibition > swimming. There was a trend towards longer periods of mating where the female weight was higher than the male, suggesting that female weight is a determining factor in the duration of mating encounters.

  9. Efecto inhibidor de metabolitos y compuestos fenólicos de extractos de arándano rojo frente a la adherencia de E. coli uropatógena

    OpenAIRE

    Esteban-Fernández, Adelaida; Martín-Álvarez, Pedro J.; Bartolomé, Begoña; Moreno-Arribas, M. Victoria; González de Llano, Dolores

    2014-01-01

    Trabajo presentado al XIX Congreso Nacional de Mirobiología de los alimentos: "Avances en Microbiología de los alimentos" celebrado en Zaragoza del 24 al 26 de septiembre de 2014.-- Premio a la mejor comunicación de interés médico.

  10. An Assessment of Agricultural Damage Caused by Red Deer (Cervus elaphus L.and Fallow Deer (Dama dama L. in Southwest England

    Directory of Open Access Journals (Sweden)

    Charles John Wilson

    2009-12-01

    Full Text Available The impact of deer grazing on agricultural grassland and cereal crops was assessed at two locations with medium to high deer densities in the Exmoor area of southwest England. Red deer impact on early spring grazing was measured at one site by comparing samples of herbage cut from inside and outside deer-proof exclosure cages, just prior to turn out of livestock, on 1 March 1989. Fallow deer impact on first-cut silage grass production was similarly measured using exclosure cages at a second site by cutting samples on 31 May 1990 and on 6 June 1995. In addition, impact of fallow deer on cereal crops was assessed at this site by measuring sample grain yields from areas of the crop used or unused by deer in 1995 (winter wheat, 1996 (winter barley and 1997 (winter wheat. Significant dry matter yield losses were recorded for red deer impact on spring grazing in 1989 (14.5% and for fallow deer impact on first-cut silage (15.9% in 1995 but not in 1990. In 1995 a small but significant yield loss (7.1% was recorded for winter wheat at the fallow deer site but no loss in cereal yield was recorded in 1996 or 1997. These assessments, carried out in response to complaints about deer damage, suggest that the impacts of deer in this area, where they occur at relatively high density, are only moderate. This highlights the need for careful assessment of cost-benefits when considering deer management strategies to reduce perceived agricultural damage.

  11. Application of a hybrid model to reduce bias and improve precision in population estimates for elk (Cervus elaphus) inhabiting a cold desert ecosystem

    OpenAIRE

    Kathryn A. Schoenecker; Bruce C. Lubow

    2016-01-01

    Accurately estimating the size of wildlife populations is critical to wildlife management and conservation of species. Raw counts or “minimum counts” are still used as a basis for wildlife management decisions. Uncorrected raw counts are not only negatively biased due to failure to account for undetected animals, but also provide no estimate of precision on which to judge the utility of counts. We applied a hybrid population estimation technique that combined sightability modeling, radio coll...

  12. Application of a hybrid model to reduce bias and improve precision in population estimates for elk (Cervus elaphus inhabiting a cold desert ecosystem

    Directory of Open Access Journals (Sweden)

    Kathryn A. Schoenecker

    2016-07-01

    Full Text Available Accurately estimating the size of wildlife populations is critical to wildlife management and conservation of species. Raw counts or “minimum counts” are still used as a basis for wildlife management decisions. Uncorrected raw counts are not only negatively biased due to failure to account for undetected animals, but also provide no estimate of precision on which to judge the utility of counts. We applied a hybrid population estimation technique that combined sightability modeling, radio collar-based mark-resight, and simultaneous double count (double-observer modeling to estimate the population size of elk in a high elevation desert ecosystem. Combining several models maximizes the strengths of each individual model while minimizing their singular weaknesses. We collected data with aerial helicopter surveys of the elk population in the San Luis Valley and adjacent mountains in Colorado State, USA in 2005 and 2007. We present estimates from 7 alternative analyses: 3 based on different methods for obtaining a raw count and 4 based on different statistical models to correct for sighting probability bias. The most reliable of these approaches is a hybrid double-observer sightability model (model MH, which uses detection patterns of 2 independent observers in a helicopter plus telemetry-based detections of radio collared elk groups. Data were fit to customized mark-resight models with individual sighting covariates. Error estimates were obtained by a bootstrapping procedure. The hybrid method was an improvement over commonly used alternatives, with improved precision compared to sightability modeling and reduced bias compared to double-observer modeling. The resulting population estimate corrected for multiple sources of undercount bias that, if left uncorrected, would have underestimated the true population size by as much as 22.9%. Our comparison of these alternative methods demonstrates how various components of our method contribute to improving the final estimate and demonstrates why each is necessary.

  13. Reducing Reliance on Supplemental Winter Feeding in Elk (Cervus canadensis): An Applied Management Experiment at Deseret Land and Livestock Ranch, Utah

    OpenAIRE

    Mangus, Dax L

    2011-01-01

    Wildlife managers have fed elk in North America for nearly 100 years. Giving winter feed to elk can compensate for a shortage of natural winter range and may boost elk populations while also helping prevent commingling with livestock and depredation of winter feed intended for livestock. In contrast to these benefits of supplemental feeding, there are economic and environmental costs associated with feeding, and elk herds that winter on feeding grounds have a higher risk of contracting and ...

  14. Influence of human activities on the activity patterns of Japanese sika deer (Cervus nippon) and wild boar (Sus scrofa) in Central Japan

    NARCIS (Netherlands)

    Doormaal, van N.; Ohashi, H.; Koike, S.; Kaji, K.

    2015-01-01

    Human ageing and population decline in Japan are causing agricultural field abandonment and providing new habitats for Japanese sika deer and wild boar. These species have expanded their distribution and increased in abundance across Japan and are causing increased agricultural damage. Effective cou

  15. Dexamethasone-induced recrudescence of malignant catarrhal fever and associated lymphosarcoma and granulomatous disease in a Formosan sika deer (Cervus nippon taiouanus).

    Science.gov (United States)

    Heuschele, W P; Nielsen, N O; Oosterhuis, J E; Castro, A E

    1985-07-01

    Malignant catarrhal fever (MCF) was diagnosed in a 2-week-old Formosan sika deer. The fawn had been previously exposed to a clinically normal neonatal wildebeest calf from which alcelaphine herpesvirus-1 was isolated. Alcelaphine herpesvirus-1 was isolated from buffy coat leukocytes and nasal and ocular secretions of the fawn during the acute illness. The fawn clinically recovered after 3 weeks. Virus was not recovered from blood at this time. Dexamethasone, given 4 months after clinical recovery, resulted in reisolation of MCF virus from blood and recrudescence of clinical MCF. The deer was euthanatized. At necropsy, pathognomonic lesions of MCF, granulomatous disease, and malignant lymphoma were observed. Antibodies to bovine leukosis viral antigens were not detected in the serum. The epidemiologic and pathogenetic importance of the findings are discussed. PMID:3839641

  16. Accessory corpora lutea formation in pregnant Hokkaido sika deer (Cervus nippon yesoensis) investigated by examination of ovarian dynamics and steroid hormone concentrations.

    Science.gov (United States)

    Yanagawa, Yojiro; Matsuura, Yukiko; Suzuki, Masatsugu; Saga, Shin-Ichi; Okuyama, Hideto; Fukui, Daisuke; Bando, Gen; Nagano, Masashi; Katagiri, Seiji; Takahashi, Yoshiyuki; Tsubota, Toshio

    2015-01-01

    Generally, sika deer conceive a single fetus, but approximately 80% of pregnant females have two corpora lutea (CLs). The function of the accessory CL (ACL) is unknown; moreover, the process of ACL formation is unclear, and understanding this is necessary to know its role. To elucidate the process of ACL formation, the ovarian dynamics of six adult Hokkaido sika deer females were examined ultrasonographically together with peripheral estradiol-17β and progesterone concentrations. ACLs formed in three females that conceived at the first estrus of the breeding season, but not in those females that conceived at the second estrus. After copulation, postconception ovulation of the dominant follicle of the first wave is induced by an increase in estradiol-17β, which leads to formation of an ACL. A relatively low concentration of progesterone after the first estrus of the breeding season is considered to be responsible for the increase in estradiol-17β after copulation. PMID:25482110

  17. Accessory corpora lutea formation in pregnant Hokkaido sika deer (Cervus nippon yesoensis) investigated by examination of ovarian dynamics and steroid hormone concentrations

    OpenAIRE

    YANAGAWA, Yojiro; Matsuura, Yukiko; Suzuki, Masatsugu; SAGA, Shin-ichi; OKUYAMA, Hideto; FUKUI, Daisuke; BANDO, Gen; NAGANO, Masashi; Katagiri, Seiji; Takahashi, Yoshiyuki; TSUBOTA, Toshio

    2014-01-01

    Generally, sika deer conceive a single fetus, but approximately 80% of pregnant females have two corpora lutea (CLs). The function of the accessory CL (ACL) is unknown; moreover, the process of ACL formation is unclear, and understanding this is necessary to know its role. To elucidate the process of ACL formation, the ovarian dynamics of six adult Hokkaido sika deer females were examined ultrasonographically together with peripheral estradiol-17β and progesterone concentrations. ACLs formed ...

  18. Effect of supplementation of lysine and methionine on growth performance, nutrients digestibility and serum biochemical indices for growing sika deer (Cervus Nippon) fed protein deficient diet

    OpenAIRE

    Jian Huang; Tie-Tao Zhang; Bao Kun; Guang-Yu Li; Kai-Ying Wang

    2015-01-01

    This study was conducted to investigate the effect of supplementation of lysine (Lys) and methionine (Met) on growth performance, nutrients digestibility and serum biochemical indices for growing sika deer fed crude protein (CP) deficient diet. Sixteen 5-month-old growing male sika deer were randomly assigned to 4 groups receiving diets (n=4): i) CP-adequate (16.63%) diet; ii) CP-deficient (13.77%) diet with 3 g/kg Lys; iii) CP-deficient with 3 g/kg Lys and 1 g/kg Met; iv) CP-deficient diet w...

  19. Sex and age differences in meat composition of Yeso sika deer (Cervus nippon yesoensis) reared for a short period after capture in the wild.

    Science.gov (United States)

    Hayashida, Maki; Souma, Kousaku; Sugo, Kazuki; Araki, Shin-Ichi; Ishizaka, Fumiaki; Ueda, Masami; Kasai, Takamasa; Masuko, Takayoshi

    2015-02-01

    Yeso sika deer captured in winter around Lake Akan in Hokkaido were reared for 8-10 months at Tokyo University of Agriculture in Abashiri. Six 1-year-old females and males and six 2-year-old or older (adult) females and males were slaughtered and their carcasses were processed. The chemical composition, mineral contents and fatty acid composition of the loin were measured. No marked influence of gender or age was noted in the chemical composition of loin. In the mineral contents, significant differences were noted. The potassium and sulfur contents were lower and the sodium content was higher in adult deer meat (P < 0.05, respectively) and the potassium content was higher in male deer meat (P < 0.05). Arsenic, cadmium or lead were not detected. In the unsaturated fatty acid, a significant interaction was detected (P < 0.05), and it was high in 1-year-old female deer meat and low in 1-year-old male deer meat. Significant gender or age differences were noted only in the mineral contents in the loin of deer reared for a short period after capture. PMID:25186458

  20. Classification and phylogeny of sika deer (Cervus nippon) subspecies based on the mitochondrial control region DNA sequence using an extended sample set.

    Science.gov (United States)

    Ba, Hengxing; Yang, Fuhe; Xing, Xiumei; Li, Chunyi

    2015-06-01

    To further refine the classification and phylogeny of sika deer subspecies, the well-annotated sequences of the complete mitochondrial DNA (mtDNA) control region of 13 sika deer subspecies from GenBank were downloaded, aligned and analyzed in this study. By reconstructing the phylogenetic tree with an extended sample set, the results revealed a split between Northern and Southern Mainland Asia/Taiwan lineages, and moreover, two subspecies, C.n.mantchuricus and C.n.hortulorum, were existed in Northern Mainland Asia. Unexpectedly, Dybowskii's sika deer that was thought to originate from Northern Mainland Asia joins the Southern Mainland Asia/Taiwan lineage. The genetic divergences were ranged from 2.1% to 4.7% between Dybowskii's sika deer and all the other established subspecies at the mtDNA sequence level, which suggests that the maternal lineage of uncertain sika subspecies in Europe had been maintained until today. This study also provides a better understanding for the classification, phylogeny and phylogeographic history of sika deer subspecies. PMID:24063645

  1. An examination of the origin and evolution of additional tandem repeats in the mitochondrial DNA control region of Japanese sika deer (Cervus Nippon).

    Science.gov (United States)

    Ba, Hengxing; Wu, Lang; Liu, Zongyue; Li, Chunyi

    2016-01-01

    Tandem repeat units are only detected in the left domain of the mitochondrial DNA control region in sika deer. Previous studies showed that Japanese sika deer have more tandem repeat units than its cousins from the Asian continent and Taiwan, which often have only three repeat units. To determine the origin and evolution of these additional repeat units in Japanese sika deer, we obtained the sequence of repeat units from an expanded dataset of the control region from all sika deer lineages. The functional constraint is inferred to act on the first repeat unit because this repeat has the least sequence divergence in comparison to the other units. Based on slipped-strand mispairing mechanisms, the illegitimate elongation model could account for the addition or deletion of these additional repeat units in the Japanese sika deer population. We also report that these additional repeat units could be occurring in the internal positions of tandem repeat regions, possibly via coupling with a homogenization mechanism within and among these lineages. Moreover, the increased number of repeat units in the Japanese sika deer population could reflect a balance between mutation and selection, as well as genetic drift. PMID:24621225

  2. Antemortem detection of PrP-CWD in preclinical, ranch-raised Rocky Mountain elk (Cervus elaphus nelsoni) by biopsy of the rectal mucosa

    Science.gov (United States)

    Chronic wasting disease is a transmissible spongiform encephalopathy or TSE of deer and elk in North America. All diseases in this family are characterized by long preclinical incubation periods following by a relatively short clinical course. The abnormal isoform of the normal cellular prion prot...

  3. Bioimformatic Analysis on GHR Gene of Cervus nippon%梅花鹿GHR基因完整编码区序列生物信息学分析

    Institute of Scientific and Technical Information of China (English)

    宋兴超; 杨福合; 巴恒星; 邢秀梅; 魏海军

    2012-01-01

    为了研究梅花鹿生长激素受体基因的结构和功能,从GenBank中下载梅花鹿、牛、山羊、猪、北极狐、大熊猫、人、猕猴、小鼠、大鼠、鸡、家鹅、绿头野鸭及金鱼的生长激素受体基因完整编码区及氨基酸序列,对梅花鹿与其他13个物种生长激素受体基因的完整编码区及其编码氨基酸序列进行相似性比对,并基于氨基酸序列构建系统进化树,利用BioEdit 7.0等软件对梅花鹿生长激素受体基因的碱基组成及其编码蛋白的理化性质和结构特征进行生物信息学分析.结果表明,梅花鹿与山羊、牛的生长激素受体基因氨基酸序列相似性较高,亲缘关系最近;梅花鹿生长激素受体基因完整编码区长度为1 905bp,编码634个氨基酸,A+T含量高于G+C;其编码的蛋白是一种分子质量为70.927 8ku、等电点为4.56的疏水性不稳定酸性蛋白;该蛋白含有1个信号肽,属于一种分泌型蛋白;存在1个强跨膜区、36个广泛磷酸化位点,二级结构元件以无规则卷曲为主.研究结果可为梅花鹿生长激素受体基因的进一步分析提供详细的生物信息学基础资料.%In order to study the structure and function of GHR gene of sika deer, coding sequences(CDS)of GHR gene in sika deer, cattle, goat, pig,arctic fox,giant panda,human,macaque, house mouse,norway rat,chicken,goose,mallard and goldfish were downloaded from GenBank as experimental materials. The similarity of GHR gene CDS and amino acid sequence between sika deer and other 13 species were analyzed. Phylo-genetic tree of the homologous gene based on the amino acid of GHR gene was constructed. In addition, we made bioinformatic analysis on basic information and encoding protein structure and physic - chemical property were predicted by means of biological software and online took.The results showed that the similarity comparison and phylogeneb'c tree indicated that the evolution distance of sika deer GHR gene was the most homogeneous to goat and cattle.The length of GHR gene coding sequence in sika deer is 1 905 bp, which encodes 634 amino acids.The estimated molecular weight of GHR protein is 70.927 8 ku.with an isoelectric point of 4.56 and 52.79 in instability index, belonging to the unstable acid protein with hydrophobieity. The GHR protein contained one signal peptide was probably being secreting type.The GHR protein had 1 obvious strong transmembrane region,36 phosphorylation sites.The secondary structure of GHR protein was mainly random coil.The research provides detailed bioinformatic informations for further study on GHR gene of sika deer.

  4. Effect of supplementation of lysine and methionine on growth performance, nutrients digestibility and serum biochemical indices for growing sika deer (Cervus Nippon fed protein deficient diet

    Directory of Open Access Journals (Sweden)

    Jian Huang

    2015-02-01

    Full Text Available This study was conducted to investigate the effect of supplementation of lysine (Lys and methionine (Met on growth performance, nutrients digestibility and serum biochemical indices for growing sika deer fed crude protein (CP deficient diet. Sixteen 5-month-old growing male sika deer were randomly assigned to 4 groups receiving diets (n=4: i CP-adequate (16.63% diet; ii CP-deficient (13.77% diet with 3 g/kg Lys; iii CP-deficient with 3 g/kg Lys and 1 g/kg Met; iv CP-deficient diet with 3 g/kg Lys and 2 g/kg Met. The digestibility of dry matter P<0.01, organic matter (P<0.01, CP (P<0.01, serum albumin (P<0.01, and total protein (P<0.01 concentrations of groups receiving CP-adequate or Met supplementation were improved. The average daily gain (P=0.10, gain to feed ratio (P=0.07, the digestibility of acid (P=0.07 and neutral detergent fibre (P=0.09, and the serum globulin (P=0.08 concentrations had a tendency to increase as the Met or CP level increased. Meanwhile, blood urea nitrogen (P<0.01 and alanine aminotransferase (P<0.01 were decreased for CP-deficient, but no response to Met-added diets; aspartate aminotransferase (P=0.04 depressed for both CP-deficient and Met-added diets. Therefore, amino acids added to CP-deficient diets show high efficiency: they remain among the simplest ways for growth performance, while cutting down environmental waste and economic consumption.

  5. Structural changes in fluorosed dental enamel of red deer (Cervus elaphus L.) from a region with severe environmental pollution by fluorides

    International Nuclear Information System (INIS)

    A macroscopic, microradiographic and scanning electron microscope study was performed on the structure of fluorosed dental enamel in red deer from a fluoride polluted region (North Bohemia, Czech Republic). As was revealed by analysis of mandibular bone fluoride content, the rate of skeletal fluoride accumulation in the fluorotic deer was about 6 times that in controls taken from a region not exposed to excessive fluoride deposition. In all fluorosed mandibles, the 1st molar was consistently less fluorotic than the other permanent teeth. This was related to the fact that crown formation in the M1 takes place prenatally and during the lactation period. Fluorosed teeth exhibited opaque and posteruptively stained enamel, reduction or loss of enamel ridges, moderately to grossly increased wear and, in more severe cases, also enamel surface lesions of partly posteruptive, partly developmental origin. Microradiographically, fluorosed enamel was characterised by subsurface hypomineralisation, interpreted as a result of fluoride interference with the process of enamel maturation. In addition, an accentuation of the incremental pattern due to the occurrence of alternating bands with highly varying mineral content was observed in severely fluorosed teeth, denoting fluoride disturbance during the secretory stage of amelogenesis. A corresponding enhancement of the incremental pattern was also seen in the dentine. The enamel along the more pronounced hypoplasias consisted of stacked, thin layers of crystals arranged in parallel, indicating that the ameloblasts in these locations had lost the distal (prism-forming) portions of their Tomes processes. The findings of the present study indicate that red deer are highly sensitive bioindicators of environmental pollution by fluorides

  6. A Non-Destructive Method for Distinguishing Reindeer Antler (Rangifer tarandus) from Red Deer Antler (Cervus elaphus) Using X-Ray Micro-Tomography Coupled with SVM Classifiers

    Science.gov (United States)

    Lefebvre, Alexandre; Rochefort, Gael Y.; Santos, Frédéric; Le Denmat, Dominique; Salmon, Benjamin; Pétillon, Jean-Marc

    2016-01-01

    Over the last decade, biomedical 3D-imaging tools have gained widespread use in the analysis of prehistoric bone artefacts. While initial attempts to characterise the major categories used in osseous industry (i.e. bone, antler, and dentine/ivory) have been successful, the taxonomic determination of prehistoric artefacts remains to be investigated. The distinction between reindeer and red deer antler can be challenging, particularly in cases of anthropic and/or taphonomic modifications. In addition to the range of destructive physicochemical identification methods available (mass spectrometry, isotopic ratio, and DNA analysis), X-ray micro-tomography (micro-CT) provides convincing non-destructive 3D images and analyses. This paper presents the experimental protocol (sample scans, image processing, and statistical analysis) we have developed in order to identify modern and archaeological antler collections (from Isturitz, France). This original method is based on bone microstructure analysis combined with advanced statistical support vector machine (SVM) classifiers. A combination of six microarchitecture biomarkers (bone volume fraction, trabecular number, trabecular separation, trabecular thickness, trabecular bone pattern factor, and structure model index) were screened using micro-CT in order to characterise internal alveolar structure. Overall, reindeer alveoli presented a tighter mesh than red deer alveoli, and statistical analysis allowed us to distinguish archaeological antler by species with an accuracy of 96%, regardless of anatomical location on the antler. In conclusion, micro-CT combined with SVM classifiers proves to be a promising additional non-destructive method for antler identification, suitable for archaeological artefacts whose degree of human modification and cultural heritage or scientific value has previously made it impossible (tools, ornaments, etc.). PMID:26901355

  7. Uzgoj običnoga jelena (Cervus elaphus L.) u kontroliranim uvjetima u ograđenom prostoru Šeprešhat

    OpenAIRE

    Grubešić, Marijan; Urošević, Branko; Mihaljević, Zlatan; Tomljanović, Kristijan

    2011-01-01

    Ograđeni prostor Šeprešhat namijenjen je intenzivnomu uzgoju običnoga jelena u kontroliranim uvjetima. Svrha je takva uzgoja proizvodnja visokovrijednoga baranjskoga jelena s mogućnošću distribucije kvalitetnoga rasplodnoga materijala u druga lovišta Republike Hrvatske. Uzgoj je jelena započeo još 2002. godine s prvim hvatanjima i ispuštanjima teladi u ograđeni prostor. Ograđeni prostor Šeprešhat u međuvremenu se postupno širio te od početnih 53 ha danas ima 380 ha. Prostor je razdijeljen na ...

  8. The Influence of Snow Cover Changes on Red Deer (Cervus elaphus L. Migrations in the Western Part of Gorski Kotar Region in Croatia

    Directory of Open Access Journals (Sweden)

    Josip Malnar

    2015-06-01

    Full Text Available Background and Purpose: Animal migrations are a direct result of reproduction, behaviour characteristics, predators, population density, disturbance, loss of habitat, climatic, vegetational and nutritional factors. The availability and accessibility of natural food in winter months is dependent on snow cover. The main objective of this study was to determine the migrational activities of red deer and to examine the dependency between migrations and climatic factors. Materials and Methods: The study was carried out in the northwest Dinarid mountains, i.e. in the western part of Gorski Kotar region, which represents a large integral forest complex, distinctive due to its significant vertical drops, diverse relief characteristics and habitat conditions. Data on red deer migrations was collected over a 12 year period from hunting records, gamekeeper logs and records from game counting and monitoring. Results and Conclusions: The results of the macroclimatic analysis show a statistically significant difference (p<0.05 between the monitored weather stations in the study area. The Klana site stood out as the most appropriate red deer winter habitat, based on climatic conditions. Climatic conditions play a key role in seasonal red deer migrations or non-migrations. The Crni Lug site was assessed to be the least favourable due to macroclimatic conditions (snow depth.

  9. Viability of Timor deer stag (Cervus timorensis spermatozoa extended in tris egg yolk diluent with different sources of carbohydrate and storage at room temperature

    Directory of Open Access Journals (Sweden)

    W. Marlene Mesang-Nalley

    2007-12-01

    Full Text Available The successful sperm preservation, influenced by the capability of its extender on the maintenance the sperm quality during storage. The carbohydrate such as glucose and fructose were the common sugar added on the mammalian sperm extender to support their live and motility. The sucrose was the main carbohydrate in Timor deer stag seminal plasma. The experiment was conducted to evaluate the effect of carbohydrates in Tris egg yolk (TEY extender on the motility and viability of stag sperm, stored in room temperature (27-28 oC. The semen was collected using electro ejaculator from five Timor deer stags at hard antler stage, 3-5 years old, body weight of 64-102 kg with normal testes. The semen was than evaluated macro-and microscopically and divided into 3 aliquots. Each of them was diluted with TEY-glucose (TEYG, TEY-fructose (TEYF and TEY-Sucrose (TEYS with the concentration of spermatozoa 100 x 106 ml-1. The extended semen was than stored at room temperature. The sperm motility and viability were evaluated every 3 hours. Result of the experiment showed that the semen volume was 2.06 ± 0.63 ml, pH 7.03±0.13, yellow white until creamy in color and the consistency ranged from normal to thick. The mass movement between ++ to +++ and the sperm motility was 68.67 ± 7.4%. The average of sperm concentration was 842.35 ± 258.14x106 ml-1, the viable sperm was 78.11 ± 3.61%, the sperm abnormality was 7.31 ± 2.98%. The percentages of sperm motility on TEYG (18.00 ± 17.63% and TEYS (21.83 ± 15.92% were higher compare to TEYF (4,00 ± 0,00% extender in 24 hours observation. The percentage of sperm viability showed the same pattern. The sperm viability in TEYG (28.17 ± 20.06 and TEYS (24.00 ± 22.59% (P<0.05 were significantly higher compare to TEYF (4.00 ± 0.00%. It is concluded that the deer stag sperm can use the three sugars for their nutrition source. The diluted sperm still can be used for artificial insemination after 12 hour storage.

  10. Viability of Timor deer stag (Cervus timorensis) spermatozoa extended in tris egg yolk diluent with different sources of carbohydrate and storage at room temperature

    OpenAIRE

    2007-01-01

    The successful sperm preservation, influenced by the capability of its extender on the maintenance the sperm quality during storage. The carbohydrate such as glucose and fructose were the common sugar added on the mammalian sperm extender to support their live and motility. The sucrose was the main carbohydrate in Timor deer stag seminal plasma. The experiment was conducted to evaluate the effect of carbohydrates in Tris egg yolk (TEY) extender on the motility and viability of stag sperm, ...

  11. Genetic variability of sika and red deer populations in the Czech Republic based on mitochondrial DNA

    Czech Academy of Sciences Publication Activity Database

    Prokešová, Jarmila; Vallo, Peter; Barančeková, Miroslava; Koubek, Petr

    Primiero : Parco Naturale Paneveggio, 2007. s. 98. [International conference on genus Cervus 2007 /1./. 14.09.2007-17.09.2007, Primiero] R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Cervus nippon * Cervus elaphus * control region * cytochrome b gene * genetic variability Subject RIV: EB - Genetics ; Molecular Biology

  12. Exploration of the taxonomy of some Pleistocene Cervini (Mammalia, Artiodactyla, Cervidae) from Java and Sumatra (Indonesia): a geometric- and linear morphometric approach

    Science.gov (United States)

    Gruwier, Ben; de Vos, John; Kovarovic, Kris

    2015-07-01

    Third molars of extant- and fossil Southeast Asian deer were metrically compared using a linear- and geometric morphometric approach and discussed in relation to known taxonomic information from the literature. Our analysis suggests the presence of medium sized deer of the genus Axis and large sized taxa of the genus Cervus s. l. in Java. Axis lydekkeri and Axis javanicus are considered valid taxa, with A. lydekkeri probably related to the subgenus Hyelaphus. The large deer, such as Cervus kendengensis, Cervus stehlini and Cervus problematicus are most likely of the subgenus Rusa, the former two closely related to extant Cervus timorensis. The Sumatran fossils are members of the subgenus Rusa, but not necessarily conspecific with extant Cervus (Rusa) unicolor.

  13. Welfare pro velké cervidy - zohlednění potřeb jelenovitých (Cervidae) a možnosti jejich naplnění v expozicích zoo Brno

    OpenAIRE

    Přichystalová, Michala

    2010-01-01

    Many species of deer family (Cervidae) are common among the inmates zoos and similar livestock farms. Center of radiation biungulates deer family was Asia, deer now inhabit all continents except Antarctica. The zoo in Brno kepts following species: Siberian deer (Cervus elaphus sibiricus) inhabit the forested areas of Southeast Asia. In the older literature is cited as subspecies of deer (Cervus elaphus), modern science provides evidence of a greater relationship with wapiti (Cervus canadensis...

  14. Identification by R-banding and FISH of chromosome arms involved in Robertsonian translocations in several deer species

    OpenAIRE

    Bonnet-Garnier, Amelie; Claro, F.; Thevenon, S.; Gautier, Mathieu; Hayes, Hélène

    2003-01-01

    We constructed and analyzed the RBG-banded karyotype of ¢ve deer species: Chital (Axis axis), White-lipped deer (Cervus albirostris), Rusa deer (Cervus timorensis russa), Sambar deer (Cervus unicolor) and Eld’s deer (Cervus eldi siamensis). Among these ¢ve species, only Eld’s deer had been previously karyotyped using R-banding. In order to identify all the chromosome correspondences with cattle and precisely which chromosome arms are involved in Robertsonian translocations, we compared the ka...

  15. Modelli di valutazione ambientale per i Bovidi (Capra ibex, Rupicapra rupicapra e i Cervidi (Capreolus capreolus, Cervus elaphus nel Parco Nazionale del Gran Paradiso

    Directory of Open Access Journals (Sweden)

    C. Oppio

    2003-10-01

    Full Text Available La conservazione delle popolazioni di stambecco ha grande rilevanza a livello italiano ed europeo, a causa della distribuzione concentrata in poche aree, mentre le consistenti popolazioni di camoscio hanno importanza economica e gestionale. L?espansione dell?areale di distribuzione dei cervidi in territorio alpino, è un fenomeno ormai consolidato e legato all?abbandono dei territori collinari e montani ma anche alle reintroduzioni e alle azioni di tutela nei confronti delle specie. I modelli d?idoneità ambientale rappresentano un efficace strumento per il confronto a livello qualitativo (numero di specie e quantitativo (abbondanza delle popolazioni tra l?attuale popolamento faunistico dei territori alpini e la loro situazione potenziale. Il Parco Nazionale del Gran Paradiso si estende per oltre 700 km² sul territorio di Piemonte e di Valle d?Aosta; gli affioramenti rocciosi ne occupano il 37.0%, la vegetazione rada il 20.1% e le praterie sommitali e le brughiere il 17.3%. L?analisi ambientale del Parco è stata effettuata mediante Arcview 3.2 per Windows misurando il valore di 20 variabili ambientali (Corine Land Cover III Liv., 27 fisiche (DTM e 17 di complessità paesaggistica in 2925 Unità Campione di 0,5 km di lato. Per la formulazione dei modelli relativi alla distribuzione (presenza/assenza dello stambecco sono stati utilizzati i dati dei censimenti (1999 effettuati nel Parco; per il camoscio ed il capriolo sono stati utilizzati i dati rilevati nelle province di Vercelli e Biella (1997 e in quella di Verbania (1999, mentre per il cervo sono stati utilizzati quelli relativi alla sola provincia di Verbania (1999. I modelli sono stati formulati mediante Analisi di Funzione Discriminante (Magnusson, 1983; Massolo & Meriggi, 1995 e Analisi di Regressione Logistica (Norusis, 1994. Per lo stambecco i dati sono stati suddivisi in due sets, di cui uno utilizzato per la formulazione del modello e l?altro per la sua validazione. Mediante un test del chi-quadrato sono state confrontate le percentuali di casi classificati nei due sets. Per le altre specie i modelli formulati sono stati applicati al territorio del parco e la validità dei modelli è stata valutata dalla percentuale di casi originali riclassificati correttamente. Per i bovidi il modello a maggior capacità predittiva è stato quello discriminante (classificazioni corrette: 73.0% per stambecco e 82.8% per camoscio. La non significatività del test Χ² (P=0.470 indica che non esistono differenze significative tra la distribuzione reale dello stambecco e quella ottenuta dal modello. L'81.1% del territorio del Parco è idoneo al camoscio alpino e l'area vocata include il 93.6% del territorio realmente occupato dalla specie. Per il capriolo il modello logistico è stato quello a maggior capacità predittiva (88.1% dei casi originali classificati correttamente, individuando il 50.7% del territorio realmente occupato dalla specie. Anche per il cervo quello logistico è preferibile per la maggiore percentuale di casi totali classificati correttamente (AFD: 74.9%; ARL: 76.0%.

  16. Výskyt jelena siky (Cervus nippon) v České republice a vyhodnocení orientace škod se zaměřením na Náchodsko

    OpenAIRE

    Regnerová, Kateřina

    2013-01-01

    This Bachelor degree paper deals with the occurrence of sika deer, damages that causes and magnetism problem of these animals together. It is based on the observation of the damages and the sleeping beds of the deer game. Recently questions concerning magnetism are often discussed. Are animals really sensitive to the earth´s magnetic field ? Are they able to feel and use it for their orientation for example? These and other questions are discussed based on the observations already performed a...

  17. Podiel drevín v potrave jeleňa lesného (Cervus elaphus) a srnca hôrneho (Capreolus capreolus) v lužnom lese

    Czech Academy of Sciences Publication Activity Database

    Prokešová, Jarmila; Barančeková, Miroslava

    Zvolen: Technická univerzita, 2003, s. 161-166. [Nové trendy v ochrane lesa. Zvolen (SK), 23.01.2003-24.01.2003] R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : deer * floodplain forest * food Subject RIV: EH - Ecology, Behaviour

  18. Selezione invernale dell'habitat e densità del cervo (Cervus elaphus e del capriolo (Capreolus capreolus nel Parco Nazionale d'Abruzzo

    Directory of Open Access Journals (Sweden)

    R. Latini

    2003-10-01

    Full Text Available Nel Parco Nazionale d'Abruzzo è stata studiata la selezione dell'habitat invernale di cervo e capriolo da aprile a maggio del 2000 e del 2002, in un'area caratterizzata da boschi di faggio, rimboschimenti a pino nero e pascoli. È stata utilizzata la tecnica del pellet group count, su transetti lineari larghi 2 metri, individuati ogni 100 m di quota, lungo le isoipse da 1350 a 1950 m s.l.m. Sono stati percorsi 61 km ed è stata campionata un'area di 12 ha. Per ogni gruppo di escrementi (1583 per il cervo e 946 per il capriolo sono state rilevate l'altitudine, la pendenza, l'esposizione e il tipo di vegetazione. È stato assunto che tutti gli habitat fossero ugualmente disponibili ed accessibili e che le disponibilita fossero conosciute (Alldredge et al., 1998. I dati raccolti sono stati elaborati applicando il test del Χ², la statistica di Bonferroni (Neu et al., 1974 e l'indice Jacobs (Jacobs, 1974. Il cervo ha selezionato aree comprese tra 1300 e 1500 m s.l.m. (p<0.01, un range altimetrico più ristretto rispetto al capriolo che seleziona anche le quote piu elevate, comprese cioè tra 1300 e 1700 m s.l.m. (p<0.01. Entrambi i cervidi selezionano le zone più scoscese (21°-60° (p<0.01: Il cervo seleziona le classi d'esposizione comprese tra sud-est ed ovest (p<0.01, mentre il capriolo i versanti sud-ovest e ovest (p<0.01. Entrambe le specie preferiscono ambienti di transizione ed evitano le zone di bosco maturo ed i pascoli d'alta quota (p<0.01. Utilizzando il tasso di defecazione è stata calcolata la densità delle due specie (Mayle, 1999 che è risultata di 2.7 cervi/100 ha e 1.0 caprioli/100 ha. Le due specie selezionano le stesse risorse, suggerendo, così come riscontrato da altri autori (Welch, 1989, una convergenza per quanto riguarda l'uso invernale dell'habitat. La scelta d'aree poste a quote medio-basse, di zone scoscese e di versanti meridionali potrebbe essere legata alla minore altezza e persistenza del manto nevoso (Mysterud et al., 1997. La scelta di aree ecotonali e zone di bosco con soprassuolo forestale articolato potrebbe essere messo in relazione sia al più elevato valore trofico di questi habitat, sia alla maggiore disponibilità di siti di riparo. I risultati trovano riscontro in uno studio analogo condotto nel Parco Naturale Adamello-Brenta (Pedrotti & Mustoni, 1994 e rappresentano il primo contributo alla conoscenza di queste due popolazioni all'interno del Parco a 30 anni dalla loro reintroduzione.

  19. 马鹿生长激素(GH)基因生物信息学预测及分析%Bioinformatics Prediction and Analysis on GH Gene of Cervus elaphus

    Institute of Scientific and Technical Information of China (English)

    宋兴超; 杨福合; 刘汇涛; 徐超; 魏海军; 邢秀梅

    2012-01-01

    In order to study the structure and function of GH gene of wapiti, coding sequences(CDS) of GH gene in wapiti, sika deer, chevrotain, cattle, goat, sheep, pig, human, chimpanzee, Norway rat, house mouse, arctic fox, dog, chicken and zebrafish were downloaded from GenBank as experimental ma- terials. Bioinformaties analysis was made on basic information and encoding protein structure, physic- chemical property, signal peptide, transmembrane structure, generic phosphorylation sites, secondary structure and subcellular localization were predicted by means of biologic software and online tools. In ad- dition, the similarity of GH gene CDS sequence and amino acid between those of wapiti and other 14 species were also analyzed. Phylogentic tree of the homologous gene based on the amino acid of GH gene was constructed. The results showed that the length of wapiti GH gene was 2 100 bp, which included 5 exons, 4 introns, partial 5'UTR and 3'UTR, and it contained an open reading frame of 654 bp, which encoded 217 amino acids. The estimated molecular weight of GH protein was 24.588 4 ku, with a iso- electric point of 7.62 and 31.04 in stability index, belonging to the stable alkalinous protein with hy- drophobicity. The GH protein had two obvious strong transmembrane region, eight phosphorylation sites. The secondary structure of GH protein was mainly α-helix and irregular curly. The extracellular protein contained one signal peptide was probably being secreting type. The similarity comparison and phyloge- netic tree indicated that the evolution distance of wapiti GH gene was the most homogeneous to sika deer, chevrotain, cattle, goat and sheep. The research provided detailed bioinformatics information for further study on GH gene of wapiti.%为研究马鹿生长激素(GH)基因的结构和功能,从GenBank中下载马鹿、梅花鹿、鼷鹿、牛、山羊、绵羊、猪、人、黑猩猩、挪威大鼠、小家鼠、北极狐、狗、鸡和斑马鱼的GH基因完整编码区(CDS)及氨基酸序列,利用DNAStar 7.0、BioEdit 7.0生物软件与相关在线工具对马鹿GH基因核苷酸序列的基本信息及其编码蛋白的理化特性和结构特征进行了生物信息学预测及分析,对马鹿与其他14个物种GH基因的CDS序列及其编码氨基酸序列进行相似性分析,并基于氨基酸序列构建了15个物种的系统进化树。结果表明:马鹿GH基因DNA序列长度为2 100 bp,包括完整的5个外显子和4个内含子,部分5′UTR和3′UTR,CDS全长654 bp,编码217个氨基酸;其编码的蛋白是一种分子质量为24.588 4 ku,等电点为7.62的疏水性稳定碱性蛋白;存在2个强跨膜区、8个广泛磷酸化位点,二级结构元件以α-螺旋和无规则卷曲为主;该蛋白位于细胞外,含有1个信号肽,属一种分泌型蛋白;马鹿与梅花鹿、牛、绵羊、山羊和鼷鹿等动物的GH基因氨基酸序列相似性较高,亲缘关系最近。该研究结果可为马鹿GH基因的进一步分析提供详细的生物学基础信息。

  20. Složení potravy jelena lesního (Cervus elaphus) a srnce lesního (Capreolus capreolus) v NP a CHKO Šumava a Bavorský les

    Czech Academy of Sciences Publication Activity Database

    Barančeková, Miroslava; Krojerová-Prokešová, Jarmila; Šustr, P.; Heurich, M.

    Brno: Ústav biologie obratlovců AV ČR, 2009 - (Bryja, J.; Řehák, Z.; Zukal, J.). s. 27-28 ISBN 978-80-87189-03-0. [Zoologické dny. 12.02.2009-13.02.2009, Brno] Institutional research pla n: CEZ:AV0Z60930519 Keywords : analyses * deer browse * faeces Subject RIV: GK - Forestry

  1. Fernández Rodríguez, Carlos J.; Ibáñez Rojo, Rafael; Romero Balsas, Pedro (2012. Sociología de la empresa, el trabajo y las organizaciones. Un enfoque crítico. Editorial Grupo 5, Madrid

    Directory of Open Access Journals (Sweden)

    Ernesto R. Gantman

    2013-07-01

    Full Text Available Texto esencial para asignaturas como sociología de las organizaciones, pero además aborda procesos de transformación del orden capitalista, relaciones industriales y enfoques conceptuales para entender el ámbito empresarial.

  2. Distribución, abundancia y estructura poblacional del langostino rojo de profundidad Haliporoides diomedeae (Crustácea: Decapoda: Solenoceridae frente a la zona norte de Perú (2007-2008 Distribution, abundance, and population structure of deep red shrimp Haliporoides diomedeae (Crustacea: Decapoda: Solenoceridae off northern Peru (2007-2008

    Directory of Open Access Journals (Sweden)

    Edward Barriga

    2009-01-01

    Full Text Available Se determinó la distribución, abundancia relativa y estructura poblacional de Haliporoides diomedeae frente a la zona norte de Perú (3°30'S-10°00'S, con los resultados de dos cruceros desarrollados en 2007 y 2008 a bordo del B/O Miguel Oliver, que realizó investigaciones de la fauna bentodemersal entre 200 y 1.500 m de profundidad, mediante un muestreo al azar estratificado de arrastre de fondo. En 122 lances realizados en cuatro sectores y tres estratos se capturó un total de 48.056 kg, compuestos por ~347 especies de peces e invertebrados. H. diomedeae fue la especie de langostino más importante en las capturas (411 kg, con los mayores niveles de abundancia entre 600 y 1.600 m al norte de los 7°S, con valores medios de captura por unidad de área (CPUA entre 83,4 y 211 kg km-2 y una biomasa total estimada de 1.139,74 ton (± 245,6 ton. Las hembras presentaron una longitud cefalotorácica media de 40,6 mm, rango de 14,5 y 74,5 mm y grupo modal dominante de 30 mm, mientras que en los machos la media fue de 30,6 mm, rango 16 a 33 mm y grupo modal principal de 27 mm; para ambos sexos se identificaron seis grupos modales, dimorfismo sexual y gradiente batimétrica. La relación talla-peso fue de tipo alométrico. En general, las características de distribución, abundancia y estructura poblacional de H. diomedeae permiten considerarla como una especie potencialmente explotable en el norte del mar peruano.The distribution, relative abundance, and population structure of Haliporoides diomedeae was determined off northern Peru (3°30'S-10°00'S by analyzing data from two cruises carried out in 2007 and 2008 on board the B/O Miguel Oliver to assess the bentho-demersal fauna between 200 and 1,500 m depth, us-ing a stratified random bottom trawl design. The total catch from the 122 hauls (covering four sectors and three strata was 48,056 kg, with ~347 fish and invertebrate species. H. diomedeae was the most important shrimp in the catches (411 kg, with the highest abundance levéis between 600 and 1,600 m depth north of 7°00'S. The mean catch per unit área (CPUA was between 83.4 and 211 kg km" . The total biomass was esti-mated to be 1,139.74 ton (± 245.6 ton. The mean carapace length of the females was 40.6 mm, with a range of 14.5 to 74.5 mm and a main modal group of 30 mm; the mean carapace length of the males was 30.6 mm, with a range of 16 to 63 mm and a main modal group of 27 mm. Males and females showed six modal groups, sexual dimorphism, and a bathymetric gradient. The length-weight relationship was allometric. Given the distribution, abundance, and size structure oíH. diomedeae off the northern Peruvian coast, it can be considered a potentially exploitable species inthe sea off northern Peru.

  3. Comparative study of the electrochemical behaviour of iron in alkaline media containing red mud and grey slurries. the effect of Al{sup 3}+; Estudio comparativo del comportamiento electroquimico del hierro en medio alcalino en presencia de lodos rojos y lodos grises. Efecto del Al{sup 3}+

    Energy Technology Data Exchange (ETDEWEB)

    Abreu, C. M.; Freire, L.; Novoa, X. R.; Pena, G.; Perez, M. C.

    2009-07-01

    Red mud (Rm) is the main by-product of the Bayer process for alumina extraction from bauxite, and grey slurries (GS) are generated during the granite rocks transformation processes. the huge volume of those wastes generated every year suppose a serious environmental problem. Recent works by our group demonstrate the efficiency of both types of muds as corrosion inhibitors for iron and steel in alkaline media containing chlorides. The elemental analysis of these slurried shows that Al{sup 3}+ is the main common element. Therefore, the aim of this paper is to study the effect of the soluble Al{sup 3}+ in the electrochemical behaviour of iron in alkaline media, in presence and absence of chlorides. The electrochemical study using Cyclic Voltammetry (CV) and Electrochemical Impedance Spectroscopy (EIS) together with surface analysis techniques allowed to conclude that Al{sup 3}+ blocks the surface of steel in alkaline media chloride increasing the steel resistance to chlorides attack. (Author) 15 refs.

  4. Genetic roots of sika deer in the Czech Republic inferred from mitochondrial gene for cytochrome b

    Czech Academy of Sciences Publication Activity Database

    Barančeková, Miroslava; Vallo, Peter; Prokešová, Jarmila; Koubek, Petr

    Primiero : Parco Naturale Paneveggio, 2007. s. 68. [International conference on genus Cervus 2007 /1./. 14.09.2007-17.09.2007, Primiero] R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Cervus nippon * cytochrome b * genetic origin Subject RIV: EB - Genetics ; Molecular Biology

  5. Tantsupäev toob priimad tantsijad / Stuart Sweeney

    Index Scriptorium Estoniae

    Sweeney, Stuart

    2006-01-01

    Rahvusvahelisel tantsupäeval 29. aprillil esinevad Vanemuises nimekad Euroopa tantsijad. Neist tuntumad on Londoni Kuningliku balleti priimabaleriin Tamara Rojo ja Rootsi Kuningliku Balleti koosseisus tantsiv Jan-Erik Wikström

  6. 78 FR 26246 - Special Local Regulation, 50 Aniversario Balneario de Boqueron, Bahia de Boqueron; Boqueron, PR

    Science.gov (United States)

    2013-05-06

    .... SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice..., 2013, Municipio de Cabo Rojo is sponsoring the 50 Aniversario Balneario de Boqueron, a series of...

  7. Tantsupäev toob publiku ette säravaid balletitähti / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2006-01-01

    29. apr. esinevad Vanemuises rahvusvaheliselt tuntud tantsijad - Tamara Rojo, Jan-Erik Wikström, Inaki Urlezaga, Anna Valev, Olga Volobujeva, Priit Kripson, Diana Cuni ja Kristoffer Sakurai -, et tähistada rahvusvahelist tantsupäeva

  8. CONSTRAINING THE DARK ENERGY EQUATION OF STATE USING ALTERNATIVE COSMIC TRACERS

    Directory of Open Access Journals (Sweden)

    R. Chávez

    2011-01-01

    Full Text Available Proponemos el uso de la relaci n corrimiento al rojo - distancia de las galaxias H II, medida mediante su correlaci n L(H -B, con el fin de determinar la funci on de Hubble a corrimientos al rojo intermedios y altos, con la intenci n de restringir el espacio de soluciones de los par metros de la ecuaci n de estado de la energ a oscura, esto como una alternativa al empleo cosmol gico de supernovas de tipo Ia.

  9. Ecología espacial y estructura social del venado de las pampas (Ozotoceros bezoarticus Linnaeus, 1758) en los pastizales semiáridos de la provincia de San Luis, Argentina: relaciones con el uso de la tierra

    OpenAIRE

    Semeñiuk, María Belén

    2013-01-01

    El venado de las pampas (Ozotoceros bezoarticus) es un ciervo endémico de Sudamérica típico de ambientes abiertos, especialmente pastizales y sabanas al sur de la cuenca Amazónica. Hasta mediados del siglo XIX se encontraba ampliamente distribuido, pero sus poblaciones comenzaron a sufrir una gran retracción geográfica y numérica a principios del siglo XX, causada por las modificaciones en el hábitat. En Argentina, el venado de las pampas ocupaba una amplia área de distribución en las regi...

  10. Lymphoproliferation in captive wild ruminants affected with malignant catarrhal fever: 25 cases (1977-1985).

    Science.gov (United States)

    Blake, J E; Nielsen, N O; Heuschele, W P

    1990-04-01

    The severity of lymphoproliferative disease associated with malignant catarrhal fever was extremely variable among 25 animals at the San Diego Wild Animal Park. Severe lymphoproliferative disease was seen in 3 of 10 Formosan Sika deer (Cervus nippon taiouanus), 3 of 6 Indian Axis deer (Cervus a axis), 3 of 6 Barasingha deer (Cervus d duvauceli), and 1 of 3 Nilgai (Boselaphus tragocamelus). Two Sika deer and 2 Barasingha deer had lesions morphologically indistinguishable from lymphosarcoma. Our findings were consistent with the hypothesis that alcelaphine herpesvirus-1 has oncogenic potential. PMID:2329087

  11. Environ: E00319 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00319 Deer velvet Crude drug Collagen, Calcium phosphate, alcium carbonate , Prote...TAX:9865] Cervidae Cervus nippon and Manchurian wapiti velvet Crude drugs [BR:br08305] Animals Mammals E00319 Deer velvet ...

  12. Food Habits of St. Vincent Island Sambars and Hogs

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Sambar deer Cervus unicolor and feral hogs Sus scrofs coninhabit St. Vincent Island, Florida. Rumen samples were analyzed to assess the dietary overlap of the two...

  13. Migrations and management of the Jackson elk herd

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From April 1978 to April 1982, 85 adult (~2. 7 years-old) elk (Cervus elaphus nelsoni) were captured and radio-collared on the National Elk Refuge in northwestern...

  14. Investigação do reflexo vermelho em recém-nascidos e sua relação com fatores da história neonatal Investigación del reflejo rojo en recién nacidos y su relación con factores de la historia neonatal Investigation of the related factors between newborn history and red reflex

    OpenAIRE

    Ingrid Martins Leite Lúcio; Maria Vera Lúcia Moreira Leitão Cardoso; Paulo César de Almeida

    2007-01-01

    O teste do reflexo vermelho é parte importante do exame ocular do recém-nascido. Buscou-se investigá-lo em recém-nascidos prematuros (RNPT) e sua relação com fatores da história neonatal. Estudo descritivo, exploratório, quantitativo, realizado numa maternidade pública, em Fortaleza-CE, em março, abril e maio de 2004, com 114 RNPTs. Para o registro dos dados, utilizou-se um formulário próprio e para a realização do exame, um oftal-moscópio direto. Considerou-se pertinente os seguintes achados...

  15. Solar Radiation Determines Site Occupancy of Coexisting Tropical and Temperate Deer Species Introduced to New Zealand Forests

    OpenAIRE

    Robert B Allen; Forsyth, David M.; Allen, Roy K. J.; Affeld, Kathrin; MacKenzie, Darryl I.

    2015-01-01

    Assemblages of introduced taxa provide an opportunity to understand how abiotic and biotic factors shape habitat use by coexisting species. We tested hypotheses about habitat selection by two deer species recently introduced to New Zealand’s temperate rainforests. We hypothesised that, due to different thermoregulatory abilities, rusa deer (Cervus timorensis; a tropical species) would prefer warmer locations in winter than red deer (Cervus elaphus scoticus; a temperate species). Since adult m...

  16. Is there any evidence of their crossbreeding in captive and/or in free-living populations?

    Czech Academy of Sciences Publication Activity Database

    Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Voloshina, I. V.; Kawata, Y.; Oshida, T.; Igota, H.; Lamka, J.; Koubek, Petr

    Huilo Huilo: Fundacion Huilo Huilo, 2010 - (Werner-Flueck, J.; Charrier, A.). s. 38-39 [International Deer Biology Congress /7./. 02.08.2010-07.08.2010, Huilo Huilo] R&D Projects: GA ČR GA524/09/1569 Institutional research plan: CEZ:AV0Z60930519 Keywords : Cervus nippon * Cervus elaphus * hybridization * microsatellite loci * conservation Subject RIV: EG - Zoology http://www.travelsolutions.cl/idbc/media/idbc_abstracts.pdf

  17. Mayo del 68 y los católicos catalanes

    Directory of Open Access Journals (Sweden)

    Martínez Hoyos, Francisco

    2013-06-01

    Full Text Available In 1968, the catalonian Church lived in a full post-council crisis. The most progressive sections felt themselves disappointed because the expected changes after the Second Vatican Council did not achieve. The parisian events affect this ecclesiastic context, which is accentuated by division and the marxism influence. This article is focused on the responses of Alfonso Carlos Comín, «El Ciervo» magazine and the clergy represented by the «Correspondència» review.En 1968, la Iglesia catalana vivía en plena crisis postconciliar. Los sectores más progresistas se sentían decepcionados porque no se habían producido los cambios que esperaban tras el Vaticano II. Los acontecimientos parisinos inciden sobre este contexto eclesial, marcado por la división y el influjo del marxismo. El artículo se centra en las reacciones de Alfonso Carlos Comín, El Ciervo y el clero representado por la revista Correspondència.

  18. Fauna de mamíferos del yacimiento costero de Herriko Barra (Zarautz, País Vasco.

    Directory of Open Access Journals (Sweden)

    K. Mariezkurrena

    1995-01-01

    Full Text Available Se cuenta de los restos de Mamíferos hallados en el yacimiento costero al aire libre de Herriko Barra (Zarautz, País Vasco, formado durante el Holoceno (C14:5.810 +170 BP. Aunque algunos elementos de la industria lítica apuntan hacia una tipología neolítica, la economía de los pobladores de Herriko   Barra era mesolítica, ya que no hay ningún indicio de domesticación animal ni de agricultura. La inmensa mayoría de los restos son de ciervo (92,2%. El resto está compuesto por restos de corzo, jabalí y uro. Por la edad de muerte de los cervatillos, alugunos recien nacidos, se prueba la presencia del hombre en el yacimiento a finales de primavera-comienzos de verano, pero no puede excluirse esa presencia en otras épocas del año. Estos animales apoyan la idea de un paisaje de bosque caducifolio con claros, dentro de un clima templado y húmedo, que da la palinología del yacimiento. El material muestra incisiones y fracturas típicas de los restos de origen antrópico. Se dan las medidas de los restos mensurables, comparando los de ciervo con poblaciones magdalenienses, postwürmienses y   actuales de esta especie.

  19. 鹿瓜多肽注射液对去卵巢大鼠骨密度及松质骨中骨形态发生蛋白表达的影响%Influence of cervus and cucumis polypeptide injection on expression of bone morphogenetic proteins-2 in cancellated bone and bone mineral density of ovariectomized rats

    Institute of Scientific and Technical Information of China (English)

    段永宏; 刘建; 胡蕴玉; 郭飞; 李强; 袁志; 孟国林

    2006-01-01

    目的 探讨鹿瓜多肽(松梅乐)注射液肌肉注射对去卵巢大鼠骨密度及松质骨中骨形态发生蛋白(BMP2)表达的影响.方法 将8月龄未经产雌性二级SD大鼠30只,随机分为假手术(SHAM)组、去势(VOX)组、去势+鹿瓜多肽(VOX+SML)组.VOX+SML组大鼠术后第2天开始给药.术后20周处死各组大鼠,对各组大鼠骨密度进行检测.利用免疫组织化学染色及图像分析方法对各组大鼠松质骨切片图像进行灰度分析,观察鹿瓜多肽注射对去势大鼠腰椎松质骨中BMP2表达的影响.结果 ①去势组与SHAM组相比较,灰度值降低,而(VOX+SML)治疗组较VOX组灰度值降低,表明VOX大鼠松质骨中骨小梁周围及髓腔内BMP2表达阳性细胞数明显多于SHAM组;而(VOX+SML)治疗组骨小梁周围及髓腔内BMP2表达阳性细胞数多于VOX组,且染色加深.②与SHAM组相比,VOX组股骨近端、股骨干、腰椎的骨密度明显降低(P<0.01);(VOX+SML)治疗组各部位的骨密度高于VOX组(P<0.05),但未达到SHAM组水平(P>0.05).结论 鹿瓜多肽注射液可抑制和延缓骨质疏松形成,对雌激素缺乏引起的骨质疏松具有预防作用.

  20. Mass and star formation rate evolution of infrared selected galaxies in the COSMOS field = Evolución de la masa y de la tasa de formación estelar de galaxias seleccionadas en el infrarrojo en el campo COSMOS

    OpenAIRE

    Domínguez Sánchez, Helena

    2012-01-01

    En esta Tesis se pretende estudiar la evolución de la masa y de la tasa de formación estelar de galaxias seleccionadas en el infrarrojo utilizando datos multi-banda del campo COSMOS. En la primera parte de la tesis hemos analizado una muestra de aproximadamente 80000 galaxias en el campo COSMOS seleccionadas en la banda 3.6 μm de IRAC con mag3.6 < 22.0 y hemos calculado sus desplazamientos al rojo a partir de la información fotométrica. Una vez calculados sus desplazamientos al rojo, hemos es...

  1. La ruta del atún

    OpenAIRE

    Oliva Rodríguez, María

    2015-01-01

    Este trabajo trata del intento de creación de una ruta cultural y turística cuyo protagonista es el atún rojo, pescado muy cotizado en los mercados actuales. Se basa en un trayecto especial denominado "Ruta del Atún", porque ese es su objetivo principal, conocer cómo se pesca, dónde se crían y como se degustan, es decir, la gastronomía generada con este tipo de pescado rojo de nuestra Región de Murcia.

  2. Identification by R-banding and FISH of chromosome arms involved in Robertsonian translocations in several deer species.

    Science.gov (United States)

    Bonnet-Garnier, A; Claro, F; Thévenon, S; Gautier, M; Hayes, H

    2003-01-01

    We constructed and analyzed the RBG-banded karyotype of five deer species: Chital (Axis axis), White-lipped deer (Cervus albirostris), Rusa deer (Cervus timorensis russa), Sambar deer (Cervus unicolor) and Eld's deer (Cervus eldi siamensis). Among these five species, only Eld's deer had been previously karyotyped using R-banding. In order to identify all the chromosome correspondences with cattle and precisely which chromosome arms are involved in Robertsonian translocations, we compared the karyotypes of these five species with those of the closely related and well-characterized species, cattle (Bos taurus) and Vietnamese Sika deer (Cervus nippon pseudaxis). Among these six deer species (the five above plus the Vietnamese Sika deer), we found thirteen different Robertsonian translocations involving nineteen different chromosome arms. Thirteen chromosome arms were identified by comparison of R-banding patterns only and the remaining six were either confirmed or identified by FISH-mapping of bovine or caprine probes previously localized in cattle. Finally, we observed that five of the thirteen Robertsonian translocations are shared by at least two species and that some chromosome arms are more frequently involved in Robertsonian translocations than others. PMID:14606627

  3. Estudio arqueozoológico de la fauna del Yacimiento de Cubío Redondo (Matienzo, Cantabria

    Directory of Open Access Journals (Sweden)

    Pedro Castaños

    2001-01-01

    Full Text Available Se estudia la serie ósea de macromamíferos del yacimento del Cubío Redondo, pequeña cavidad situada en el vlle de Matienzo (Cantabria. Se trata de una serie reducida y muy fracturada por lo que sus medidas son escasas y poco indicativas. Aparecen cinco especies de ungulados-ciervo, corzo, cabra montés, rebeco y jabalí-y dos de carnívoros-gato montés y garduña-, dominando ampliamente los primeros. El cuadro de fecuencias encaja bien en el marco paleoecológico en que se desarrollan las ocupaciones mesolíticas de la Cornisa Cantábrica, destacando la importancia de especies de apetencia forestal.

  4. Faune magdalénienne de la Grande Grotte de Labastide. (Hautes - Pyrénées, France.

    Directory of Open Access Journals (Sweden)

    André Clot

    1988-01-01

    Full Text Available La cueva de Labastide (Altos Pirineos, francia ha proporcionado una fauna del Magdaleniense medio (datada en 14.260 ± 440 BP, con especies de gran tamaño, el caballo (Equus caballus cf. gallicus, el bisonte y el uro, el reno. Algunos restos señalan la presencia de la cabra de los Pirineos y del sarrio, sin embargo el ciervo está ausente. Entre los carnívoros, se deben anotar numerosos huesos de zorro   común, y algunos de restos de zorro polar, de línce nórdico y de gato montés. Unos treinta restos pertenecen al glotón, pocas veces citado en los Pirineos.

  5. El veterinario forense. Caza clandestina en fauna silvestre. Análisis forense y situacional de dos casos en el municipio de Tandil, Argentina (The Forensic Veterinary. Clandestine hunt in wild fauna. Forensic and situational studies in two cases. Tandil county. Argentina

    Directory of Open Access Journals (Sweden)

    Schettino, D.M.

    2007-04-01

    Full Text Available ResumenDos casos de caza clandestina de fauna silvestre ocurren con diferencia de meses en el municipio de Tandil, en los años2005 y 2006. Ambos afectaron a ciervos dama (Dama dama que fueron cazados en diferentes circunstancias. La utilización de perros entrenados para matar como también el uso de armas de guerra en áreas suburbanas está tácitamente prohibida en la legislación actual. Ambos casos son peritados en la FCV-UNCPBA y se analizan las condiciones de cada situación, el respaldo legal y los resultados obtenidos en amboscasos.

  6. Sobre los llamados silbatos celtibéricos. Una propuesta de interpretación

    Directory of Open Access Journals (Sweden)

    Escudero Navarro, Zoa

    1990-12-01

    Full Text Available In this study we propose a new interpretation for those objects made of deer antler, wich traditionally have been identified as whistles or musical instruments. Starting from other similar European examples, we think that the pieces from the Iberian Peninsula correspond with the cheekpieces of horsebits, psalia, and at the present time must be surely dated to the Second lron Age.

    En el presente artículo proponemos una nueva interpretación para los objetos realizados en asta de ciervo que tradicionalmente se han identificado con silbatos o instrumentos musicales. A partir de otros elementos europeos semejantes, creemos que las piezas de la Península Ibérica se corresponden con camas de bocado de caballo, psalia, y que, hoy por hoy, deben fecharse claramente en la Segunda Edad del Hierro.

  7. Los lagartos de malpelo (colombia): aspectos sobre su ecología y amenazas

    OpenAIRE

    López-Victoria, Mateo

    2012-01-01

    Se aportan nuevos aspectos sobre la historia natural de los saurios de la Isla deMalpelo y, como complemento al Libro Rojo de reptiles de Colombia, se plantea sunivel de amenaza y clasificación según los criterios de la UICN.

  8. LQAI_Cuali_G6_Calcio_Magnesio

    OpenAIRE

    Cervera Sanz, Maria Luisa

    2012-01-01

    Análisis cualitativo inorgánico. Marcha Analítica del carbonato sódico. Ensayos de identificación de calcio en el Grupo VICa (II)Precipitación de oxalato cálcicoMg (II)Reacción con magnesón (azul claro) y con amarillo de titano (rojo)

  9. Census of the star-forming galaxy population at Z < 1.5

    OpenAIRE

    de Mello, D. F.

    2006-01-01

    Una cuesti on clave en la evoluci on de galaxias es la naturaleza f sica de galaxias de corrimiento al rojo inter- medio y de sus actuales contrapartes. Se sabe que la densidad de la tasa de formaci on estelar se incrementa r apidamente desde z = 0 a z = 1...

  10. Census of the star-forming galaxy population at Z < 1.5

    Directory of Open Access Journals (Sweden)

    D. F. de Mello

    2006-01-01

    Full Text Available Una cuesti on clave en la evoluci on de galaxias es la naturaleza f sica de galaxias de corrimiento al rojo inter- medio y de sus actuales contrapartes. Se sabe que la densidad de la tasa de formaci on estelar se incrementa r apidamente desde z = 0 a z = 1...

  11. Hea energia festival / Margaret Tali

    Index Scriptorium Estoniae

    Tali, Margaret

    2006-01-01

    Augusti tantsufestivali 2005 lavastustest - Rasmus Ölme "Rasmus Kosmos", Paz Rojo "Basic Dance", Eddie Laddi "Sawn-off Scarface", Krõõt Juuraku, Raido Mägi, Mart Kangro ja Merle Saarva ning saksofonist Ursula Saali ühisprojekt "Positsioonid", "ZUGA müüt ja tegelikkus", Xavier Le Roy "Projekt" ja Jo Str̤mgreni "The Hospidal"

  12. Gas exchange and water relations responses of spring wheat to full-season infrared warming

    Science.gov (United States)

    Gas exchange and water relations responses to full-season in situ infrared (IR) warming were evaluated for hard red spring wheat (Triticum aestivum L. cv. Yecora Rojo) grown in an open field in a semi-arid desert region of the Southwest USA. A Temperature Free-Air Controlled Enhancement (T-FACE) ap...

  13. Development of multiplex PCR assay for authentication of Cornu Cervi Pantotrichum in traditional Chinese medicine based on cytochrome b and C oxidase subunit 1 genes.

    Science.gov (United States)

    Gao, Lijun; Xia, Wei; Ai, Jinxia; Li, Mingcheng; Yuan, Guanxin; Niu, Jiamu; Fu, Guilian; Zhang, Lihua

    2016-07-01

    This study describes a method for discriminating the true Cervus antlers from its counterfeits using multiplex PCR. Bioinformatics were carried out to design the specific alleles primers for mitochondrial (mt) cytochrome b (Cyt b) and cytochrome C oxidase subunit 1 (Cox 1) genes. The mt DNA and genomic DNA were extracted from Cervi Cornu Pantotrichum through the modified alkaline and the salt-extracting method in addition to its counterfeits, respectively. Sufficient DNA templates were extracted from all samples used in two methods, and joint fragments of 354 bp and 543 bp that were specifically amplified from both of true Cervus antlers served as a standard control. The data revealed that the multiplex PCR-based assays using two primer sets can be used for forensic and quantitative identification of original Cervus deer products from counterfeit antlers in a single step. PMID:26287950

  14. Habitat acoustics of Rocky Mountain elk in Colorado and European Red deer in Denmark

    DEFF Research Database (Denmark)

    Riede, Tobias; Jensen, Kenneth Kragh; Larsen, Ole Næsbye;

      Male vocal displays are rarely so dramatically different in closely related subspecies as in Cervus elaphus. Many studies investigated the evolution of the European Red deer low pitched roaring sounds, but little is known about why the Rocky Mountain elk evolved high pitched bugles. We investig......  Male vocal displays are rarely so dramatically different in closely related subspecies as in Cervus elaphus. Many studies investigated the evolution of the European Red deer low pitched roaring sounds, but little is known about why the Rocky Mountain elk evolved high pitched bugles. We...

  15. Brucellosis in the United States: Role and Significance of Wildlife Reservoirs

    Science.gov (United States)

    Regulatory programs for brucellosis in domestic livestock have been active in the United States for almost 80 years. Wildlife reservoirs of brucellosis include bison (Bison bison) and elk (Cervus elaphus nelsonii) for B. abortus whereas B. suis is the predominant species infecting feral swine. The...

  16. Dry season diets of sympatric ungulates in lowland Nepal: competition and facilitation in alluvial tall grasslands

    NARCIS (Netherlands)

    Wegge, P.; Shrestha, A.K.; Moe, S.R.

    2006-01-01

    Based on microhistological analyses of faecal material, we compared the early dry season diets of greater one-horned rhinoceros Rhinoceros unicornis, swamp deer Cervus duvauceli and hog deer Axis porcinus, which inhabit the same alluvial grassland habitat complex in lowland Nepal. Their diets were q

  17. Eurasian lynx hunting red deer: is there an influence of a winter enclosure system?

    Czech Academy of Sciences Publication Activity Database

    Belotti, E.; Kreisinger, Jakub; Romportl, D.; Heurich, M.; Bufka, L.

    2014-01-01

    Roč. 60, č. 3 (2014), s. 441-457. ISSN 1612-4642 Institutional support: RVO:68081766 Keywords : Cervus elaphus * Habitat heterogeneity * Lynx lynx * Predation probability * Prey density * Supplementary feeding Subject RIV: EG - Zoology Impact factor: 1.634, year: 2014

  18. Native red deer and introduced chamois: foraging habits and competition in a subalpine meadow-spruce forest area

    Czech Academy of Sciences Publication Activity Database

    Homolka, Miloslav; Heroldová, Marta

    2001-01-01

    Roč. 50, č. 2 (2001), s. 89-98. ISSN 0139-7893 R&D Projects: GA ČR GA206/97/0172; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cervus elaphus * Rupicapra rupicapra * foraging strategy Subject RIV: EG - Zoology Impact factor: 0.287, year: 2001

  19. Application of mitochondrial DNA sequence analysis in the forensic identification of Chinese sika deer subspecies.

    Science.gov (United States)

    Wu, Hua; Wan, Qiu-Hong; Fang, Sheng-Guo; Zhang, Shu-Yan

    2005-03-10

    As a direct and indirect consequence of human activities, only two subspecies, Cervus nippon sinchuanicus and Cervus nippon kopschi, currently subsist in the wild of China. However, a large population of Cervus nippon hortulorum and Cervus nippon nippon is raised in order to gain deer parts for Chinese traditional medicine. According to Chinese Wild Animal Conservation Law, hunting, capturing and trading of the wild sika deer are strictly banned, however, raising and trading of the domestic individual are permitted. Thus, it is very necessary to identify the subspecies of sika deer in China in forensic tests. In our study, we used mitochondrial DNA control region sequence analysis and phylogenetic analysis to identify the subspecies of sika deer. Mitochondrial DNA control region sequences analysis revealed that two haplotypes came from the unknown samples. One is the same as the haplotype that came from the samples of wild population of C. n. kopschi. Phylogenetic analysis indicated that the two haplotypes of unknown samples clustered with the haplotypes of C. n. kopschi, and had significant difference from the haplotypes of the other subspecies. These results together revealed that the unknown samples came from two individuals that belong to the wild population of C. n. kopschi living in the Qinglingfeng State Natural Reserve of Zhejiang province. Therefore, the results provide forensic evidence of illegal wild animal hunting. PMID:15639603

  20. The origin and genetic variability of the Czech sika deer population

    Czech Academy of Sciences Publication Activity Database

    Barančeková, Miroslava; Krojerová-Prokešová, Jarmila; Voloshina, I. V.; Myslenkov, A. I.; Kawata, Y.; Oshida, T.; Lamka, J.; Koubek, Petr

    2012-01-01

    Roč. 27, č. 6 (2012), s. 991-1003. ISSN 0912-3814 R&D Projects: GA ČR GA524/09/1569 Institutional support: RVO:68081766 Keywords : Cervus nippon * Cytochrome b gene * Control region * Introduced species Subject RIV: EG - Zoology Impact factor: 1.552, year: 2012

  1. Crecimiento y habilidad decolorante potencial de Hyphomycetes (Deuteromycetes de Río Santiago sobre medio agarizado suplementado con cromóforos sintéticos Growth and potential decolorizing ability of Hyphomycetes (Deuteromycetes from Río Santiago on agar medium supplemented with synthetic chromophores

    Directory of Open Access Journals (Sweden)

    Romina Liberto

    2005-12-01

    Full Text Available Se analizó la capacidad de Dictyosporium triramosum, Minimidochium parvum y Tetraploa aristata, aisladas de materia orgánica colectada en Río Santiago (Provincia de Buenos Aires, Argentina, para crecer y decolorar medios agarizados y suplementados con diferentes cromóforos sintéticos al 0,01 % (p v-1. Cristal violeta y verde brillante redujeron el crecimiento de las 3 cepas revelando los mayores porcentajes de inhibición. Mientras que eosina y rosa de bengala no afectaron a D. triramosum, valores superiores al 50 % de inhibición se observaron en M. parvum y T. aristata. Rojo congo y rojo neutral redujeron a D. triramosum y M. parvum en un 12-17 %, pero no a T. aristata. D. triramosum y T. aristata no resultaron afectados por azul de toluidina, mientras M. parvum fue inhibido por el colorante. Rojo de metilo sólo inhibió a M. parvum y T. aristata. Las 3 cepas probadas revelaron capacidad para decolorar el medio suplementado con azul de toluidina y rojo de metilo. D. triramosum decoloró además el medio suplementado con cristal violeta y rojo congo, y T. aristata el medio con cristal violeta y rojo neutral. Ninguno de los hongos estudiados decoloró los medios con eosina, rosa de bengala y verde brillante.The ability of Dictyosporium triramosum, Minimidochium parvum and Tetraploa aristata, isolated from organic matter collected in Río Santiago (Buenos Aires Province, Argentina, to grow and decolorize agar media supplemented with different synthetic chromophores at 0.01% (w v-1 was analyzed. Crystal violet and brilliant green reduced the growth of the three strains showing the highest inhibition percentages. While eosin and rose bengal did not affect D. triramosum, growth inhibition values superior to 50 % were observed for M. parvum and T. aristata. Congo red and neutral red inhibited growth of both D. triramosum and M. parvum in a 12-17%, but those dyes did not reduced T. aristata growth. D. triramosum and T. aristata were not affected

  2. Comparación de la citotoxicidad del amaranto en dos líneas celulares de mamífero utilizando bioensayos colorimétricos rápidos

    Directory of Open Access Journals (Sweden)

    A. Santa María

    2001-01-01

    Full Text Available El amaranto es un colorante de color rojo ampliamente utilizado en alimentación y cosmética. En la bibliografía consultada no se han encontrado referencias sobre la citotoxicidad de este colorante por lo que se ha creído oportuno abordar su estudio. Este estudio se ha llevado a cabo en dos líneas celulares de naturaleza fibroblástica: línea celular 3T3 (fibroblastos de origen embrionario de ratón y línea celular FP (fibroblastos de origen embrionario humano. La citotoxicidad fue evaluada mediante dos bioensayos: a ensayo de rojo neutro (RN; b ensayo de proteína total (PT. Se han calculado las IC50 del amaranto en ambas líneas celulares, observándose mayor sensibilidad al colorante con las células 3T3 que con los fibroblastos humanos.

  3. Un nuevo medio de cultivo para evaluar la calidad de las desinfecciones en las unidades pecuarias (A new culture medium to evaluate the quality of the disinfections in a livestock center

    Directory of Open Access Journals (Sweden)

    Silveira Prado, Enrique A

    2011-03-01

    Full Text Available ResumenSe realizaron varios experimentos con un medio de cultivo líquido con rojo fenol indicador y glucosa al 1% (Caldo Rojo de fenol-Glucosa, CRFG, utilizando un cultivo estandarizado de Escherichia coli como indicador de la contaminación, a 37 y 43°C de incubación y se evaluó, en condiciones controladas de campo, la calidad de la desinfección en una unidad pecuaria.SummarySome tests were performed using a liquid culture medium with phenol red and glucose 1% (PRGB and a standard culture of Escherichia coli as a pollution index at 37 and 43°C. Another test was made under controlled field conditions to evaluate the quality of disinfection in a livestock center.

  4. Escrito con Tinta Roja: The Mexicana Feminist Detective in the Fiction of María Elvira Bermúdez, Myriam Laurini and Patricia Valladares

    OpenAIRE

    Ruiz, Sandra

    2014-01-01

    In my dissertation, I examine Mexican detective fiction of the twentieth and twenty-first centuries written by Mexican feminist writers whose literary works include Mexican female detective characters. Writers and works I analyze in this dissertation are María Elvira Bermúdez's "Detente, sombra," (1962) and "Las cosas hablan" (1985) in conjunction with Bermúdez's socio-historical study, La vida familiar del mexicano (1955), argenmex writer Myriam Laurini's Morena en rojo (1994), and Patricia ...

  5. Searching for distant blazars with GLAST and the Large Millimeter Telescope

    Directory of Open Access Journals (Sweden)

    Alberto Carramiñana

    2008-01-01

    Full Text Available El Gran Telescopio Milimétrico estudiará el universo a altos corrimientos al rojo, incluyendo la formación de las primeras galaxias masivas y sus núcleos activos. El GTM puede ser usado en conjunto con GLAST en la búsqueda de los blazares más distantes para explorar la época de formación de los primeros hoyos negros.

  6. The most luminous radio galaxies

    OpenAIRE

    Malcolm S. Longair

    2006-01-01

    Se discuten las propiedades de las fuentes de radio extragal acticas m as brillantes y de sus galaxias an trionas. Estas fuentes est an asociadas con las galaxias m as masivas conocidas hasta el corrimiento al rojo de al menos 2. Resultan ser una clase unica de objetos para estudiar los n ucleos gal acticos extremadamente activos y sus galaxias an trionas, y representan retos para entender la formaci on de las galaxias m as masivas.

  7. The most luminous radio galaxies

    Directory of Open Access Journals (Sweden)

    Malcolm S. Longair

    2006-01-01

    Full Text Available Se discuten las propiedades de las fuentes de radio extragal acticas m as brillantes y de sus galaxias an trionas. Estas fuentes est an asociadas con las galaxias m as masivas conocidas hasta el corrimiento al rojo de al menos 2. Resultan ser una clase unica de objetos para estudiar los n ucleos gal acticos extremadamente activos y sus galaxias an trionas, y representan retos para entender la formaci on de las galaxias m as masivas.

  8. Antonio Piñana Segado (Piñana padre) in memoriam (1913-2013).

    OpenAIRE

    Francisco Javier, Piñana Conesa

    2013-01-01

    Antonio Piñana Segado, considerado el patriarca de los cantes mineros, es el heredero de una tradición musical que parte del mítico Antonio Grau “Rojo el Alpargatero”. Este año de 2013 se ha cumplido el centenario de su nacimiento, motivo por el cual la Peña Flamenca de Cartagena ha editado un CD con 23 estilos fundamentales.

  9. Fundamentos y límites de los sistemas de verificación automática de la sintaxis y el estilo

    OpenAIRE

    Gómez Guinovart, Xavier

    1997-01-01

    Resumen de la Tesis doctoral presentada el 28 de junio de 1996 en la Facultad de Filología de la Universidad de Santiago de Compostela. Director: Dr. Juan Carlos Ruiz Antón. Ponente: Dr. Guillermo Rojo Sánchez. Tribunal: Dr. Joseba Abaitua Odriozola, Dra. Irene Castellón Masalles, Dr. José María García- Miguel Gallego, Dr. Leonardo Gómez Torrego, Dr. Kepa Sarasola Gabiola.

  10. Análisis econométrico del riesgo de extinción del las especies de fauna en Colombia: reptiles y peces dulceacuícolas

    OpenAIRE

    Fabio Alberto Arias Arbeláez

    2004-01-01

    A species' risk of extinction is estimated by the deterioration state of the population. A wild and non extinct species could be evaluated and ranked as follows: Critically Endangered, Endangered, Vulnerable, Near Threatened, Of Minor Concern. This ranking has been applied in Colombia for some groups of fauna and flora. Information of the Red Books Series of Threatened Species of Colombia —Libros rojos de especies amenazadas de Colombia— (reptiles, fresh water fish), is used in this paper for...

  11. Moessbauer study of archaeological ceramics from Valle del Alto Sinu (Colombia)

    International Nuclear Information System (INIS)

    A physico-chemical characterization of ceramic samples from the arachaeological sites of El Cabrero, El Gallo, and El Frasquillo (Valle del Alto Sinu) is presented. Extensive use of Moessbauer spectroscopy data reveals that the currently used typological classification scheme of Dolmatoff is related to the production technology of the different artifacts. In addition, a model for firing conditions for ''Rojo Sencillo'', ''Tierra Impresa'', ''Tierra Incisa'', and ''Blanco'' types of ceramics is proposed. (orig.)

  12. Obras de Jesús Antonio Bejarano

    Directory of Open Access Journals (Sweden)

    Bejarano Jesús Antonio

    1999-12-01

    Full Text Available 1972 El capital monopolista y la inversión norteamericana en Colombia, Círculo Rojo Editores, Bogotá. 1974 Currie: diagnóstico y estrategia, Cuadernos ColombÚlnos 3, tercer trimestre, 405- 434, Bogotá. Desarrollo clásico y desarrollo dependiente: la cuestión del mercado interno, Cuadernos Colombianos 1, primer trimestre, 1-33, Bogotá. Lista Continua...

  13. Agua residual y complementada como sustituto del medio de cultivo "in vitro" de embriones de café

    OpenAIRE

    Ramos, RA.; Cabrera, M.; Gonzalez, ME.; Landazury, S.; Girón, F.; Mederos, Y.

    2001-01-01

    This work was carried out in Provincial Enterprise from Hydraulicai Resources of Santiago de Cuba and a Genetic Laboratory from Central Research Station of Coffee and Cacao, Tercer Frente, Santiago de Cuba province, from February to June of 1996 period. The "in vitro" culture of Coffea arabica L. 'Catuai Rojo' var. embryos was made as substitute the traditionally culture media using wastewater of Neat Enterprise of Santiago de Cuba as alone and mixed form with coconut milk and ammonium nitrat...

  14. Nuevos registros de hongos micorrizógenos arbusculares para México

    OpenAIRE

    Heriberto Méndez Cortés; José G. Marmolejo Monsivais; Víctor Olalde Portugal; César M. Cantú Ayala; Lucía Varela Fregoso

    2012-01-01

    Se describen cuatro nuevos registros de hongos micorrizógenos arbusculares para México, los cuales fueron extraídos de la rizósfera del cedro rojo (Cedrela odorata), en dos ecosistemas tropicales del estado de Veracruz. Rhizophagus custos se recolectó en el ecosistema de selva alta perennifolia; mientras que Glomus arenarium, G. aureum y G. hyderabadensis en la selva mediana subperennifolia.

  15. COMPONENTES NUTRICIONALES Y ANTIOXIDANTES DE DOS ESPECIES DE GUAJE (Leucaena spp.): UN RECURSO ANCESTRAL SUBUTILIZADO

    OpenAIRE

    Nallely Román-Cortés; María del Rosario García-Mateos; Ana María Castillo-González; Jaime Sahagún-Castellanos; Adelina Jiménez-Arellanes

    2014-01-01

    El guaje ( Leucaena spp.) es una planta de vaina y semillas comestibles, un recurso ancestral subutilizado por los pueblos mesoamericanos. El valor nutricional y nutracéutico del guaje se desconoce pese a su consumo vigente en las poblaciones rurales. El objetivo de este trabajo fue evaluar el contenido de minerales, compo - nentes nutricionales y antioxidantes para contribuir a la revalorización alimentaria del guaje rojo ( L. esculenta Benth.) y verde ( L. leucocephala Lam.). Los contenidos...

  16. High-z Galaxies Through Gravitational Lensing

    Directory of Open Access Journals (Sweden)

    J. A. de Diego

    2007-01-01

    Full Text Available La gravedad es el motor clave de la evolución del universo y de la formación de sus principales estructuras: las galaxias, cúmulos de galaxias y filamentos. La gravedad es también una herramienta muy valiosa para explorar el universo a alto corrimientos al rojo a través del efecto relativista de las lentes gravitatorias. Los potenciales gravitatorios de los cúmulos de galaxias convierten a estos objetos en poderosos telescopios cósmicos que magnifican la señal de galaxias con alto corrimiento al rojo. En este trabajo presentamos un proyecto para estudiar tales galaxias con el Gran Telescopio Canarias (GTC y el instrumento OSIRIS. Describimos el fenómeno de lente gravitatorio, enfatizando el caso del régimen fuerte en cúmulos de galaxias. A continuación mostramos una aplicación de los códigos numéricos para estudiar el cúmulo MS2137.3-2353. Finalmente discutimos el uso del Gran Telescopio Milimétrico (GTM para hallar candidatos de galaxias lenteadas a muy alto corrimiento al rojo

  17. Reproductive biotechnologies: a new approach for Cervids conservation

    OpenAIRE

    Uccheddu, Stefania

    2012-01-01

    Reproductive biotechnologies have great potential as a tool for the conservation of endangered mammal species. We tried to apply some assisted reproductive techniques (ART) in the sardinian regional context, widely considered for its peculiar biodiversity. Our research had been driven in particular at cervids, Fallow deer (Dama dama, Linneus 1758) and Sardinian red deer (Cervus elaphus corsicanus, Exrleben 1777). This subspecies is strictly protected and is included as a Near Threatened on th...

  18. PLAG (1-Palmitoyl-2-Linoleoyl-3-Acetyl-rac-Glycerol) Modulates Eosinophil Chemotaxis by Regulating CCL26 Expression from Epithelial Cells

    OpenAIRE

    Jeong, Jinseon; Kim, Young-Jun; Yoon, Sun Young; Kim, Yong-Jae; Kim, Joo Heon; Sohn, Ki-Young; Kim, Heung-Jae; Han, Yong-Hae; Chong, Saeho; Kim, Jae Wha

    2016-01-01

    Increased number of eosinophils in the circulation and sputum is associated with the severity of asthma. The respiratory epithelium produces chemokine (C-C motif) ligands (CCL) which recruits and activates eosinophils. A chemically synthesized monoacetyl-diglyceride, PLAG (1-palmitoyl-2-linoleoyl-3-acetyl-rac-glycerol) is a major constituent in the antlers of Sika deer (Cervus nippon Temminck) which has been used in oriental medicine. This study was aimed to investigate the molecular mechanis...

  19. Prevalence of parasitic infection in captive wild animals in Bir Moti Bagh mini zoo (Deer Park), Patiala, Punjab

    OpenAIRE

    A. Q. Mir; Dua, K; Singla, L. D.; Sharma, S.; Singh, M.P.

    2016-01-01

    Aim: The study was conducted to know the prevalence of gastrointestinal parasites of captive wild animals at Bir Moti Bagh Mini Zoo (Deer Park), Patiala, Punjab. Materials and Methods: A total of 31 fecal samples from eight species of captive animals including Civet cat (Viverra zibetha), Porcupine (Hystrix indica), Nilgai (Boselaphus tragocamelus), Spotted deer (Axis axis), Black buck (Antelope cervicapra), Sambar deer (Cervus unicolor), Hog deer (Axis porcinus), and Barking deer (Muntiac...

  20. Cost–Benefit Analyses of Mitigation Measures Aimed at Reducing Collisions with Large Ungulates in the United States and Canada: a Decision Support Tool

    OpenAIRE

    Robert J. Ament; Anthony P. Clevenger; John W. Duffield; Huijser, Marcel P.; Pat T. McGowen

    2009-01-01

    Wildlife–vehicle collisions, especially with deer (Odocoileus spp.), elk (Cervus elaphus), and moose (Alces alces) are numerous and have shown an increasing trend over the last several decades in the United States and Canada. We calculated the costs associated with the average deer–, elk–, and moose–vehicle collision, including vehicle repair costs, human injuries and fatalities, towing, accident attendance and investigation, monetary value to hunters of the animal kil...

  1. Trophic facilitation by introduced top predators: grey wolf subsidies to scavengers in Yellowstone National Park

    OpenAIRE

    Wilmers, C C; Crabtree, R L; Smith, D. W.; Murphy, K M; Getz, Wayne M.

    2003-01-01

    1. The reintroduction of grey wolves Canis lupus (L.) to Yellowstone National Park provides a natural experiment in which to study the effects of a keystone predator on ecosystem function. 2. Grey wolves often provision scavengers with carrion by partially consuming their prey. 3. In order to examine how grey wolf foraging behaviour influences the availability of carrion to scavengers, we observed consumption of 57 wolf-killed elk Cervus elaphus (L.) and determined the percentage of edible bi...

  2. Using improved technology for filter paper-based blood collection to survey wild Sika deer for antibodies to hepatitis E virus

    OpenAIRE

    Yu, Claro; Zimmerman, Carl; Stone, Roger; Engle, Ronald E.; Elkins, William; Nardone, Glenn A.; Emerson, Suzanne U.; Purcell, Robert H.

    2007-01-01

    Recent reports from Japan implicated wild Sika deer (Cervus nippon) in the zoonotic transmission of hepatitis E to humans. Seroprevalence studies were performed to determine if imported feral populations of Sika deer in Maryland and Virginia posed a similar risk of transmitting hepatitis E virus (HEV). Hunters collected blood on filter paper disks from freshly killed deer. The disks were desiccated and delivered to a collection point. The dried filters were weighed to estimate the amount of b...

  3. First Report of Hepatitis E Virus Infection in Sika Deer in China

    OpenAIRE

    Xiao-Xuan Zhang; Si-Yuan Qin; Yuan Zhang; Qing-Feng Meng; Jing Jiang; Gui-Lian Yang; Quan Zhao; Xing-Quan Zhu

    2015-01-01

    Hepatitis E virus (HEV), a single stranded RNA, nonenveloped virus, belongs to the genus Hepevirus, in the family of Hepeviridae. In this study, 46 (5.43%) out of the 847 serum samples from sika deer (Cervus nippon) were detected as seropositive with hepatitis E virus (HEV) by enzyme linked immunosorbent assay (ELISA). These samples were collected from Inner Mongolia and Jilin and Heilongjiang provinces in China, between October 2012 and October 2013. Seroprevalence of HEV infection in male a...

  4. Distinct Distribution of Dicrocoelium dendriticum and D. chinensis in Iwate Prefecture, Japan, and a New Final Host Record for D. chinensis

    OpenAIRE

    OHTORI, Maiko; Aoki, Mikiko; ITAGAKI, Tadashi

    2014-01-01

    ABSTRACT This study dealt with the morphological and molecular identification of Dicrocoelium flukes obtained from Japanese serow (Capricornis crispus) and sika deer (Cervus nippon centralis) in the twelve districts of Iwate Prefecture, Japan. Dicrocoelium dendriticum and D. chinensis were exclusively detected in the western, and coastal and eastern areas of Iwate Prefecture, respectively. This geographically distinct occurrence of the two Dicrocoelium species would be associated with the dis...

  5. Habitatové preference jelena siky v Doupovských horách

    OpenAIRE

    Rohla, Jan

    2014-01-01

    This thesis focuses on habitat preferences of sika deer (Cervus nippon) in Doupov mountains. The aim was to recognise the area of residence of given individuals. This data could be used for easier reduction of sika deer population, thereby for decrease of damage in forest stands and agriculture crops. Because the population of sika deer is too high, more effective hunting practice is needed to reduce it to endurable levels. The collected data show, that although we followed three stags at ...

  6. Intraspecific evolution within an ecologically diverse species can be used to examine evolutionary trends observed in ruminant morphology: a review of case studies of the Japanese sika deer

    OpenAIRE

    Kubo, Mugino Ozaki

    2014-01-01

    This review addresses the question “Are interspecific and macroevolutionary trends observed in ruminant morphology found among populations of a single species?” Several case studies of the Japanese sika deer, Cervus nippon, are discussed. The Japanese sika deer is a suitable species for this purpose because it inhabits various environments from the northern subarctic forests to the southern subtropical forests. It shows conspicuous variations in feeding habits, body size, and other morphologi...

  7. Control of mycobacterium bovis infection in two sika deer herds in Ireland

    OpenAIRE

    Partridge Tom; Toolan Dónal; Egan John; More Simon

    2008-01-01

    Abstract In a number of countries, tuberculosis (due to infection with Mycobacterium bovis) is a significant health problem of captive deer. This paper describes outbreaks of bovine tuberculosis in sika deer (Cervus nippon) on two farms in Ireland and the methods used to control the disease. On Farm A, infection was first detected during 1993. The infection was eradicated using a programme of test and removal, in association with segregation of young animals. A second outbreak (also due to in...

  8. Sequence Length Polymorphisms within Cervid AmelogeninX and AmelogeninY Genes: Use in Sex Determination

    Directory of Open Access Journals (Sweden)

    Benson H. Morrill

    2009-12-01

    Full Text Available Sequence length polymorphisms between the amelogeninX and amelogeninY genes have been utilized for the design of rapid PCR sex determination assays for various mammalian species, including four cervid species (Capreolus capreolus, Cervus elaphus, Cervus nippon, and Dama dama. Several of these assays have been shown to be able to determine sex from non-invasively collected samples such as hair roots, feces, or skeletal remains. Such assays can be helpful for both zoo and wildlife biologists for sex determination, and could possibly be further developed to aid in species identification and SNP analyses if sequence information is also available. In order to further study the amelogeninX and amelogeninY gene polymorphisms that exist within cervids, partial sequences from these genes were generated and analyzed in multiple amelogeninX and amelogeninY samples of mule deer (Odocoileus hemionus and Rocky Mountain elk (Cervus elaphus nelsoni; and single amelogeninX and amelogeninY samples of sika deer (Cervus nippon, fallow deer (Dama dama and axis deer (Axis axis. Within these five species, three sequence length polymorphism regions (two or more nucleotides inserted or deleted between samples were found. The lengths of these polymorphisms were 45, 9, and 9 nucleotides. In addition, a SNP was found in the amelogeninY sequences of the mule deer samples that were analyzed. Lastly, the primers used to amplify the regions of the amelogeninX and amelogeninY sequences were able to determine sex in all five species that were studied.

  9. Genetic diversity of native Primorian and introduced Czech populations of Dybowski’s sika deer using microsatellite markers

    Czech Academy of Sciences Publication Activity Database

    Barančeková, Miroslava; Krojerová-Prokešová, Jarmila; Voloshina, I. V.; Lamka, J.; Koubek, Petr

    Huilo Huilo : Fundacion Huilo Huilo, 2010 - (Werner-Flueck, J.; Charrier, A.). s. 44-45 [International Deer Biology Congress /7./. 02.08.2010-07.08.2010, Huilo Huilo] R&D Projects: GA ČR GA524/09/1569 Institutional research plan: CEZ:AV0Z60930519 Keywords : Cervus nippon hortulorum * genotyping * genetic diversity * mtDNA * bottleneck Subject RIV: EG - Zoology http://www.travelsolutions.cl/idbc/media/idbc_abstracts.pdf

  10. Association analysis of PRNP gene region with chronic wasting disease in Rocky Mountain elk

    OpenAIRE

    Spraker Terry R; White Stephen N; Reynolds James O; O'Rourke Katherine I

    2010-01-01

    Abstract Background Chronic wasting disease (CWD) is a transmissible spongiform encephalopathy (TSE) of cervids including white-tailed (Odocoileus virginianus) and mule deer (Odocoileus hemionus), Rocky Mountain elk (Cervus elaphus nelsoni), and moose (Alces alces). A leucine variant at position 132 (132L) in prion protein of Rocky Mountain elk confers a long incubation time with CWD, but not complete resistance. However, variants in regulatory regions outside the open reading frame of PRNP h...

  11. Babesia spp. in European wild ruminant species: parasite diversity and risk factors for infection.

    OpenAIRE

    Michel, Adam O; Mathis, Alexander; Ryser-Degiorgis, Marie-Pierre

    2014-01-01

    Babesia are tick-borne parasites that are increasingly considered as a threat to animal and public health. We aimed to assess the role of European free-ranging wild ruminants as maintenance mammalian hosts for Babesia species and to determine risk factors for infection. EDTA blood was collected from 222 roe deer (Capreolus c. capreolus), 231 red deer (Cervus e. elaphus), 267 Alpine chamois (Rupicapra r. rupicapra) and 264 Alpine ibex (Capra i. ibex) from all over Switzerland and analysed by P...

  12. Babesia spp. in European wild ruminant species: parasite diversity and risk factors for infection

    OpenAIRE

    Michel, Adam O; Mathis, Alexander; Ryser-Degiorgis, Marie-Pierre

    2014-01-01

    Babesia are tick-borne parasites that are increasingly considered as a threat to animal and public health. We aimed to assess the role of European free-ranging wild ruminants as maintenance mammalian hosts for Babesia species and to determine risk factors for infection. EDTA blood was collected from 222 roe deer (Capreolus c. capreolus), 231 red deer (Cervus e. elaphus), 267 Alpine chamois (Rupicapra r. rupicapra) and 264 Alpine ibex (Capra i. ibex) from all over Switzerland and analysed by P...

  13. Immune Responses of Elk to Initial and Booster Vaccinations with Brucella abortus Strain RB51 or 19

    OpenAIRE

    S. C. Olsen; Fach, S. J.; Palmer, M. V.; Sacco, R. E.; Stoffregen, W. C.; Waters, W.R.

    2006-01-01

    Previous studies have suggested that currently available brucellosis vaccines induce poor or no protection in elk (Cervus elaphus nelsoni). In this study, we characterized the immunologic responses of elk after initial or booster vaccination with Brucella abortus strains RB51 (SRB51) and 19 (S19). Elk were vaccinated with saline or 1010 CFU of SRB51 or S19 (n = seven animals/treatment) and booster vaccinated with a similar dosage of the autologous vaccine at 65 weeks. Compared to nonvaccinate...

  14. Habitat Selection by Eld’s Deer following Relocation to a Patchy Landscape

    OpenAIRE

    Duo Pan; Yan-Ling Song; Zhi-Gao Zeng; Bravery, Benjamin D.

    2014-01-01

    An emerging issue in wildlife conservation is the re-establishment of viable populations of endangered species in suitable habitats. Here, we studied habitat selection by a population of Hainan Eld's deer (Cervus eldi) relocated to a patchy landscape of farmland and forest. Hainan Eld's deer were pushed to the brink of extinction in the 1970s, but their population expanded rapidly from 26 to more than 1000 individuals by 2003 through effective reserve protection. As part of a wider relocation...

  15. REVIEW: Baluran Nasional Park Savanna

    OpenAIRE

    M. YUSUF SABARNO

    2002-01-01

    One of the biodiversity richness in Indonesia is ecosystem of Baluran National Park savanna. This type of savanna is similar to African savanna that is included in tropical savanna. There are two types of savanna, namely flat and undulating savanna. The savanna ecosystem that covers about 40% of the total area of Baluran National Park has important role on supporting herbivore animals such as wild cattle (Bos javanicus), deer (Cervus timorensis) and wild buffalo (Bubalus bubalis). The variety...

  16. Deer Frozen Semen Quality in Tris Sucrose and Tris Glucose Extender with Different Glycerol Concentrations

    OpenAIRE

    W. M. M. Nalley; R. Handarini; R.I Arifiantini; T.L. Yusuf; B. Purwantara; G. Semiadi

    2011-01-01

    In order to improve Timor deer (Cervus timorensis) frozen semen quality, the influence of sugar and glycerol concentration on semen characteristics of sperm was investigated. The semen was collected from five sexually mature Timor deer using an electroejaculator. The semen was evaluated and divided into six equal tubes and diluted with Tris sucrose glycerol 10% (TSG10); Tris sucrose glycerol 12% (TSG12); Tris sucrose glycerol 14% (TSG14); Tris glucose glycerol 10% (TGG10); Tris glucose glyce...

  17. Fire behaviour and impact on heather moorland

    OpenAIRE

    Davies, Gwilym Matthew

    2006-01-01

    For roughly the past 200 years land-managers have used the practice of “muirburning” to manipulate the structure of heather (Calluna vulgaris) to create a patchwork of habitat structures able to provide forage and nesting sites for red grouse (Lagopus lagopus scoticus) as well as grazing for sheep (Ovis aries) and red deer (Cervus elaphus). This thesis investigates both the behaviour and impact of management fires in recognition of the need to develop multi-aim land management practices ...

  18. La fauna de mamíferos del yacimiento de la Campa Torres (Gijón, Asturias, España

    Directory of Open Access Journals (Sweden)

    Corina LIESAU VON LETTOW-VORBECK

    2009-12-01

    Full Text Available RESUMEN: El análisis de los restos faunísticos del castro astur de La Campa Torres ha permitido aproximarnos a las estrategias paleoeconómicas de uno de los asentamientos asturianos fortificados más importantes de la Edad del Hierro. El vacuno supone el principal recurso ganadero de la ocupación prerromana complementada, marginalmente, con el ganado lanar, caprino y porcino. La escasa frecuencia de los restos de caballo y perro constatan un patrón habitual en la mayoría de los yacimientos protohistóricos, aunque el despiece exhaustivo de algunos canes no descarta el consumo de estos carnívoros. La actividad cinegética resulta ser testimonial como complemento a la dieta, representada tan sólo por el ciervo.ABSTRACT: The study of the faunal remains of Campa Torres has allowed to approximate us to the paleoeconomical patterns of one of the most important fortified Iron Age hillforts in Asturias. The cattle supposes the main stock during the prerroman occupation, complemented marginally with the sheep, goat and pig. The low frequency of the horse and dog bones states a habitual pattern as in most of the prehistoric sites, although the exhaustive disarticulation marks of dogs do not discard the consume of these carnivores. The hunting activities are evidenced only by some testimonial remains of red dear.

  19. Prácticas rituales ibéricas en La Cueva del Sapo (Chiva, Valencia: más allá del caliciforme

    Directory of Open Access Journals (Sweden)

    Sonia MACHAUSE LÓPEZ

    2015-01-01

    Full Text Available Se presentan los resultados del estudio interdisciplinar del yacimiento ibérico de la Cueva del Sapo (Chiva, Valencia. Las características del conjunto estudiado muestran un contexto ritual que sería frecuentado entre los SS. V-II a. C. La diversidad cronológica y material así como el volumen de restos indican la existencia de varias actividades rituales intermitentes, no generalizadas y que se suceden en el tiempo. Nos acercamos a ellas a través de la presencia de restos de fauna, con escasas evidencias de consumo que reflejan un ritual principal en torno a la figura del ciervo, huesos humanos sin incinerar con marcas que demuestran un tratamiento concreto del cadáver ligado a un complejo ritual funerario en época ibérica y otros materiales –cerámicas, metales y carbones– que también son pruebas de una actividad ritual en la cueva, cuyas características difieren de los criterios tradicionales establecidos para las cuevas con materiales ibéricos. Todos estos factores nos hacen replantearnos la definición tradicional, todavía vigente, para este tipo de contextos rituales, cargada en algunas ocasiones de excesivas generalizaciones.

  20. Descriptive epidemiology of captive cervid herds in Michigan, USA.

    Science.gov (United States)

    Bruning-Fann, C S; Shank, K L; Kaneene, J B

    1997-01-01

    A study was designed to determine the species composition, disease period prevalence, and utilization of preventive practices in captive cervid herds in Michigan. This is the first description of cervid farming in the United States. Data for the 12 months preceding the study were collected by means of a mail questionnaire conducted from March 3 through June 28, 1993. Completed questionnaires were returned by 228 of 362 (63%) farms. Study respondents reported ownership of a total of 4972 (80.9%) white-tailed deer (Odocoileus virginianus), 766 (12.5%) elk (Cervus elaphus canadensis), 284 (4.6%) fallow deer (Dama dama), 114 (1.9%) sika deer (Cervus nippon), 6 (0.1%) red deer (Cervus elaphus), 4 (treatment of injuries (27.7% [44/159]), anthelmintic administration (25.2% [40/159]), issuance of health certificates (19.5% [31/159]), diagnosis and treatment of illnesses (17.6% [28/159]), vaccination (13.8% [22/159]), disease diagnosis (treatment provided by farmer) (8.8% [14/159]), foot care (3.8% [6/159]), and other purposes (ie, necropsy, dystocia, antler removal) (11.3% [18/159]). PMID:9208449

  1. Serosurvey for antibodies to malignant catarrhal fever-associated viruses in free-living and captive cervids in Germany.

    Science.gov (United States)

    Frölich, K; Li, H; Müller-Doblies, U

    1998-10-01

    A total of 486 serum samples collected from several species of both free-living and captive cervids in Germany was examined for antibodies against malignant catarrhal fever (MCF)-associated viruses (MCFV) by a competitive-inhibition enzyme-linked immunosorbent assay (CI-ELISA). Eleven (2%) of these samples were positive for antibodies against MCFV. Among 157 serum samples collected from 16 different species of captive deer including four (7%) of 54 fallow deer and one (7%) of 14 sika deer (Cervus nippon) were seropositive. Among 329 samples from three species of free-ranging deer, including 253 roe deer (Capreolus capreolus), 22 red deer (Cervus elaphus) and 54 fallow deer (Cervus dama), only fallow deer were antibody-positive. Of the 25 fallow deer samples collected between 1990 and 1993, four (16%) were seropositive. Among 29 free-ranging fallow deer samples collected in the hunting period 1996-1997, antibodies to MCFV were detected in two (7%) of these sera. All of these fallow deer samples were collected from a circumscribed area in northern Germany. In the same area a high seroprevalence (72%) to MCFV was observed in domestic sheep (n = 50). Among 20 sheep samples (buffy coat) and 15 fallow deer samples (spleen or lymph nodes) examined for ovine herpesvirus 2 (OvHV-2) by PCR, all 20 sheep samples examined were OvHV-2 positive, but all of the 15 fallow deer samples, including seven seropositive deer, were OvHV-2 negative. PMID:9813848

  2. Effects of Seasonal Upwelling on Inorganic and Organic Matter Dynamics in the Water Column of Eastern Pacific Coral Reefs.

    Science.gov (United States)

    Stuhldreier, Ines; Sánchez-Noguera, Celeste; Rixen, Tim; Cortés, Jorge; Morales, Alvaro; Wild, Christian

    2015-01-01

    The Gulf of Papagayo at the northern Pacific coast of Costa Rica experiences pronounced seasonal changes in water parameters caused by wind-driven coastal upwelling. While remote sensing and open water sampling already described the physical nature of this upwelling, the spatial and temporal effects on key parameters and processes in the water column have not been investigated yet, although being highly relevant for coral reef functioning. The present study investigated a range of water parameters on two coral reefs with different exposure to upwelling (Matapalo and Bajo Rojo) in a weekly to monthly resolution over one year (May 2013 to April 2014). Based on air temperature, wind speed and water temperature, three time clusters were defined: a) May to November 2013 without upwelling, b) December 2013 to April 2014 with moderate upwelling, punctuated by c) extreme upwelling events in February, March and April 2014. During upwelling peaks, water temperatures decreased by 7°C (Matapalo) and 9°C (Bajo Rojo) to minima of 20.1 and 15.3°C respectively, while phosphate, ammonia and nitrate concentrations increased 3 to 15-fold to maxima of 1.3 μmol PO43- L-1, 3.0 μmol NH4+ L-1 and 9.7 μmol NO3- L-1. This increased availability of nutrients triggered several successive phytoplankton blooms as indicated by 3- (Matapalo) and 6-fold (Bajo Rojo) increases in chlorophyll a concentrations. Particulate organic carbon and nitrogen (POC and PON) increased by 40 and 70% respectively from February to April 2014. Dissolved organic carbon (DOC) increased by 70% in December and stayed elevated for at least 4 months, indicating high organic matter release by primary producers. Such strong cascading effects of upwelling on organic matter dynamics on coral reefs have not been reported previously, although likely impacting many reefs in comparable upwelling systems. PMID:26560464

  3. Gestión de nuevos cultivares de frijol común en las condiciones de la UBPC “Santa Maria 4”

    Directory of Open Access Journals (Sweden)

    Juan Miguel Avila Concepción

    2013-11-01

    Full Text Available Esta investigación se real izó en la UBPC Santa Maria 4 perteneciente a la UEB Antonio Guiteras del municipio Puerto padre, provincia Las Tunas, en el período comprendido entre el 28 de noviembre de 2012 hasta el 16 de febrero de 2013, con el objetivo de evaluar el comportamiento agroproductivo de siete cultivares de frijol común (Phaseolus vulgaris, L. , en un suelo Pardo sialítico mullido carbonatado con vista a incrementar la biodiversidad y elevar el rendimiento agrícola de este cultivo. Los cultivares evaluados fueron (Velazco Largo, Colorado E-120, frijol Rayado, Rojo E-114, Frijol Crema Japones, Rojo E-130, frijol Blanco Español, se utilizó un diseño de bloques al azar con cuatro réplicas, la fitotecnia aplicada fue la tradicional establecida para este cultivo, los aspectos evaluados fueron los siguientes, altura de las plantas, número de hojas, grosor del tallo, altura de la primera vaina, granos por vainas, peso de 100 granos, rendimiento agrícola, incidencia de las principales plagas y valoración económica de la producción. El cultivar que obtuvo mayor rendimiento fue el Velazco Largo y los de menor el Rojo E-114 y el Rayado, los valores obtenidos permiten asegurar que desde el punto de vista económico es factible la realización de estas siembras, pues se pueden obtener incrementos en el ingreso por ventas de $ 6242.90 – 20108.85 pesos por hectárea. En el experimento las condiciones edafoclimáticas fueron favorables en todo el ciclo del cultivo, no se registraron altos niveles de infestación de plagas y enfermedades.

  4. Estabilidad química, física y microbiológica de lomo de atún (Thunnus sp.) rebanado. Empacado, congelado y almacenado a -20 ºC

    OpenAIRE

    Romaim De Berardinis; Myrna Luisa Medina Bracamonte; Marinela Barrero

    2012-01-01

    La globalización ha introducido en Venezuela el consumo de pescado crudo, principalmente atún rojo (Thunnus sp.) para elaborar sushi y sashimi. Esto ha despertado el interés en conservar el atún fresco, congelado, para disponer de él a lo largo del año con los atributos que definen la calidad del atún fresco. El pescado congelado se empaca para protegerlo del ambiente frío y seco del congelador, evitar su deshidratación y quemaduras en la superficie del tejido muscular que modificarían la ap...

  5. Nuevos derivados de quitosano funcionalizados en el grupo amino, de alto valor añadido

    OpenAIRE

    Jatunov Santamaría, Sorel Alexandervich

    2015-01-01

    Falta palabras clave La presente Tesis Doctoral es una contribución al avance de la química del quitosano como una vía de valorización y aprovechamiento de los residuos de cangrejo rojo Procambarus clarkii generados en las Marismas del Guadalquivir. Consta de cinco capítulos bien diferenciados, de los cuales los cuatro primeros tienen como objetivo común el desarrollo de nuevos derivados N-sustituidos de quitosano que por sus propiedades físico-químicas puedan tener aplicación práctica en ...

  6. Influencias del color de fondo sobre el procesamiento de patrones visuales jerárquicos en sujetos disléxicos, malos lectores y normolectores

    OpenAIRE

    Vidal, Joaquín; Elosúa de Juan, María Rosa; Luna Blanco, María Dolores

    2004-01-01

    El objetivo de este trabajo consistió en comprobar si los sujetos disléxicos muestran un déficit en el procesamiento de la información global en patrones organizados jerárquicamente, que está mediado por el sistema magnocelular. Además, se analizó si el color de fondo (rojo y verde) afecta de manera diferente al procesamiento de la información global en lectores normales, malos lectores y sujetos disléxicos. Los resultados muestran que el color de fondo parece deteriorar la precisión en el pr...

  7. Gêneros textuais e (ou) gêneros discursivos: uma questão de nomenclatura?

    OpenAIRE

    Dias, Eliana; Mesquita, Elisete; Finotti, Luísa; Otoni, Maria; Lima, Maria; Rocha, Maura

    2011-01-01

    Este artigo objetiva apresentar uma discussão teórica sobre a adoção das expressões gênero textual ou gênero discursivo. Ao assumirmos que há distintas consequências decorrentes do uso dessas expressões, discutimos diferentes posições de alguns autores a respeito dessa dicotomia. Para isso, contamos com a contribuição de Bakhtin (2003), Adam (2008), Bronckart (2003, 1999) e Rojo (2005), principalmente. Considerando que o conceito de competência discursiva não pode ser desvin...

  8. Propiedades Fisicoquímicas de Fresas (Fragaria sp) Cultivadas Bajo Filtros Fotoselectivos Physical and Chemical Properties of Strawberries (Fragaria sp) Grown Under Photoselective Filters

    OpenAIRE

    Fánor Casierra-Posada; Jaime Ernesto Peña-Olmos; Andrés Felipe Vargas-Martínez

    2011-01-01

    Se realizó un experimento para examinar los efectos de la calidad de luz sobre la calidad de la fruta en fresa (Fragaria sp cv. Chandler), establecida en invernadero. Se probaron cinco filtros de polipropileno de colores diferentes (rojo, amarillo, azul, verde, y transparente), con plantas sin cobertura como control. En los frutos se determinó el peso fresco y seco, longitud y ancho, sólidos solubles totales (SST), pH, acidez titulable (AT) e índice de madurez (IM). Todas las variables evalua...

  9. Propiedades fisicoquímicas de fresas (fragaria sp) cultivadas bajo filtros fotoselectivos

    OpenAIRE

    Casierra-Posada, Fánor; Peña Olmos, Jaime Eernesto; Vargas Martínez, Andrés Felipe

    2011-01-01

    Se realizó un experimento para examinar los efectos de la calidad de luz sobre la calidad de la fruta en fresa (Fragaria sp cv. Chandler), establecida en invernadero. Se probaron cinco filtros de polipropileno de colores diferentes (rojo, amarillo, azul, verde, y transparente), con plantas sin cobertura como control. En los frutos se determinó el peso fresco y seco, longitud y ancho, sólidos solubles totales (SST), pH, acidez titulable (AT) e índice de madurez (IM). Todas las variables evalua...

  10. Asma y alergia por el colorante carmín Asthma and allergy due to carmine dye

    OpenAIRE

    A.I. Tabar; S. Acero; Arregui, C. (Carla); M. Urdánoz; Quirce, S.

    2003-01-01

    El carmín de cochinilla o simplemente carmín (E120) es un colorante rojo que se obtiene de las hembras desecadas del insecto Dactylopius coccus Costa (cochinilla). Hemos evaluado la prevalencia de sensibilización y asma por carmín en una fábrica de colorantes naturales tras diagnosticar dos de sus trabajadores de asma ocupacional. La incidencia acumulada de sensibilización y asma ocupacional por carmín en nuestra fábrica es de 48,1% y 18,5% respectivamente, datos que obligan a implantar medid...

  11. Salida de campo a la laguna de La Nava (Fuentes de Nava, Palencia) los días 1, 2 y 3 de noviembre de 1952

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Salida de campo a la laguna de La Nava, en Fuentes de Nava, recorriendo también Grijota y Villamartín de Campos, en la provincia de Palencia, los días 1, 2 y 3 de noviembre de 1952, de la que se anotaron observaciones sobre el pez Carassius sp. (Pez rojo), el reptil Natrix maura (Culebra viperina, llamada Tropidonotus viperinus por el autor), los siguientes anfibios: Pelobates cultripes (Sapo de espuelas) y Pelophylax esculentus (Rana verde europea, llamada Rana sculenta o R.esculenta ridibun...

  12. Los efectos del tipo de cambio en el mercado de tomate en la zona del tlcan, 2005-2008

    OpenAIRE

    Mercedes Borja Bravo; José Alberto García Salazar

    2014-01-01

    México exportó 921 mil toneladas de tomate rojo al mercado de Estados Unidos de 2005 a 2008, lo que cubrió casi 90 por ciento de sus importaciones. Para analizar los efectos de modificaciones en la tasa de cambio sobre la competitividad de estas exportaciones mexicanas, se validó un modelo de equilibrio espacial e intertemporal, y los resultados indican que una apreciación del peso las disminuiría, mientras que una depreciación las aumentaría, ya que desplazaría la producción doméstica de ese...

  13. Salida de campo a Ribera del Cubo (o Torre Duero, en Torrecilla de Abadesa, Valladolid) el 21 y 22 de junio de 1953

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Salida de campo a Ribera del Cubo (seguramente, sinónimo de Torre Duero, que se halla en la localidad de Torrecilla de Abadesa, Valladolid) los días 21 y 22 de junio de 1953, de la que se anotaron observaciones sobre insectos de la familia Acrididae (orden Orthoptera), los siguientes peces: Barbus sp. (Barbo) y Carassius auratus (Pez rojo), el anfibio Pelophylax esculentus (Rana verde europea, llamada Rana sculenta o R.esculenta ridibunda por el autor), los siguientes reptiles: Lagartos y lag...

  14. Desarrollo de Comadia redtenbacheri (Lepidoptera: Cossidae) en condiciones de laboratorio.

    OpenAIRE

    Miranda Perkins, Kalina

    2013-01-01

    Comadia redtenbacheri, conocido como gusano rojo del maguey, es un insecto comestible sobreexplotado debido a su valor comercial, lo que ha originado interés por la conservación de las poblaciones silvestres y la formación de unidades de producción. Sin embargo, todavía existen grandes lagunas e información errónea para la identificación de la especie y en el estudio de su desarrollo. Para tratar de determinar qué factores son indispensables en la pupación y el apareamiento de la especie, baj...

  15. Estudio sobre la adopción de variedades mejoradas de frijol en las principales zonas productoras de frijol de la Región Brunca de Costa Rica

    OpenAIRE

    Juan Carlos Hern\\u00E1ndez-Fonseca; Flor Ivette Elizondo-Porras

    2006-01-01

    En Costa Rica, en el periodo 2000- 2004 se liberaron tres variedades de frijol grano rojo: Bribri (2000), Cabécar (2003) y Telire (2004). El proceso de generación y difusión de estas variedades, se efectuó bajo la estrategia de Fitomejoramiento Participativo (FP). En el estudio se entrevistaron 201 productores de cuatro localidades y 16 caseríos de la Región Brunca. El estudio consideró los años 2002, 2003 y 2004. En el periodo agrícola 2004 el 70% del área de siembra ...

  16. Propiedades del suelo y productividad de Pinus taeda L. en la Mesopotamia Argentina

    Directory of Open Access Journals (Sweden)

    Rodolfo Andrés Martiarena

    2014-05-01

    Full Text Available Nuestro objetivo fue establecer la vinculación entre  algunas características edáficas y el crecimiento de P. taeda, en su zona de plantación comercial en la Mesopotamia Argentina. La hipótesis es que la causa principal de la reducción de la productividad de las plantaciones es la profundidad de suelo y el volumen efectivo aprovechable por las plantas, y no el contenido de nutrientes. El trabajo se realizó entre los 28º 30’ S, en la provincia de Corrientes, hasta los 25º 30’ S, en la provincia de Misiones. Se seleccionaron 31 sitios donde, 1- se tomaron muestras de suelo para determinar nutrientes y densidad aparente, 2- se midieron las variables dasométricas de las plantaciones y se calculó el Índice de Sitio (IS, 3- se tomaron muestras foliares y se analizaron las concentraciones de C, N y P. El análisis estadístico se realizó con INFOSTAT 2.0. Los sitios se asignaron a tres grupos edafoclimáticos: 1 sitios con suelos rojos del Norte, 2 sitios con suelos pedregosos del Norte y, 3 sitios con suelos rojos del Sur. El crecimiento de las plantaciones de P. taeda fue menor (menor IS en los suelos pedregosos, con más nutrientes, una menor profundidad efectiva y un  menor volumen ocupado por la fracción fina. En la zona norte, la mayor oferta de nutrientes en los suelos pedregosos (respecto de los rojos, no resultó en un aumento en la concentración de nutrientes foliares. La menor capacidad de retención de agua y un menor volumen a ser explorado por las raíces de las plantas, constituyeron la principal limitante al crecimiento en los suelos pedregosos. A pesar de las diferencias en precipitación, todos los sitios correspondieron a la misma Zona de Vida Bosque Subtropical húmedo. Entre los suelos rojos profundos, de similar concentración y contenido de nutrientes, la zona Sur resultó la más favorable para el crecimiento (mayor IS. Esta respuesta en el menos lluvioso sur  puede relacionarse con una mayor demanda atmosf

  17. Transformación de la Vaquería Monticelo en Finca Integral para el desarrollo de la Docencia, Investigación y Producción

    OpenAIRE

    Rolando León Aguilar; Rolando Hernández Prieto; Roberto Domech Valera

    2010-01-01

    La Universidad de Matanzas posee una Vaquería a sólo un Km. de sus instalaciones, la cual se utiliza en lo fundamental para la producción y parte de la docencia de pregrado de las carrera de Agronomía y Veterinaria, la misma tiene una superficie de 52 ha, sobre suelo Ferralítico Rojo Típico, con topografía llana en un 80 porciento de su extensión. Dada la cercanía de esta a la alta casa de estudio y ser susceptible de modificaci&o...

  18. Reflectancia en hojas de chile manzano (Capsicum pubescens R. y P.) para estimar contenido de nitrógeno.

    OpenAIRE

    Gasga Peña, Rosalino

    2011-01-01

    Con la finalidad de encontrar un procedimiento económico, rápido y confiable que estime el contenido de nitrógeno (N), se estableció un experimento en los invernaderos del Colegio de Postgraduados. La unidad experimental consistió de una planta de chile manzano sembrada en maceta de polietileno negro calibre 600 de 40x45 cm a una distancia de 1.5 m entre hileras y 0.5 m entre macetas. Como sustrato se utilizó tezontle rojo. Se emplearon soluciones nutritivas con cuatro niveles de N: 4, 8, 12 ...

  19. Fenología, productividad de calidad de fruto con y sin semilla en Opuntia ficus-indica

    OpenAIRE

    Hernández Ramírez, Carlos

    2012-01-01

    El nopal tunero es una alternativa productiva importante para las zonas áridas y semiáridas de México. La superficie de cultivo es de 53 212 ha bajo riego y temporal. Un problema que enfrenta el productor es la estacionalidad de la producción y la presencia de semillas en la pulpa. Investigadores mexicanos han obtenido logros importantes en la producción de tuna sin semilla en Opuntia ficus-índica cv. CP-Azteca de frutos con pulpa color rojo, que también se utilizó en esta...

  20. APORTE AL CONOCIMIENTO DE LOS MACROINVERTEBRADOS ASOCIADOS A LAS RAICES DEL MANGLE (Rizophora mangle) EN LA CIENAGA LA BOQUILLA, MUNICIPIO DE SAN ONOFRE, SUCRE.

    OpenAIRE

    QUICENO CUARTAS PAULA ANDREA; PALACIO BAENA JAIME ALBERTO

    2010-01-01

    Con el fin de establecer la estructura de la comunidad de macroinvertebrados asociados a las raíces del mangle rojo Rizophora mangle en la ciénaga La Boquilla, se muestreó cuatro veces en cinco estaciones entre febrero y agosto de 1999. En cada estación, se retiraron de dos a cinco raíces y cuantificó el número y la cobertura de los macroinvertebrados asociados. En general, en la ciénaga La Boquilla se mantienen temperaturas altas con ligeras fluctuaciones a través del tiempo. En forma simila...

  1. Efectos secundarios de Spirotetramat sobre Cryptolaemus montrouzieri Mulsant (Coleoptera: Coccinellidae)

    OpenAIRE

    Planes, L.; Catalán Estellés, José; Montón, Helga; Izquierdo, J.; Jacas Miret, Josep Anton; Urbaneja, Alberto; Tena Barreda, Alejandro

    2013-01-01

    La conservación de los enemigos naturales es clave para poder llevar a cabo una Gestión Integrada de plagas eficaz en nuestros cítricos porque gran parte de las plagas están controladas de forma natural por alguno de estos enemigos naturales. Para ello es imprescindible que los nuevos plaguicidas sean respetuosos con los enemigos naturales. Spirotetramat es un nuevo insecticida sistémico eficaz contra el piojo rojo de California, Aonidiella aurantii (Maskell) (Hemiptera: Diaspididae), la prin...

  2. Aislamiento, filogenia e identificación bioquímica de una especie de Shigella de rumen con capacidad para degradar celulosa.

    OpenAIRE

    Luna Rodríguez, Lorena

    2013-01-01

    De una muestra tomada del rumen de un bovino se aisló una cepa de Shigella sp nov en condiciones anaerobias, y creció en medio selectivo cuya única fuente de carbono fue celulosa, a 39 °C y pH 6.8. La bacteria aislada es Gram negativa, en forma de coco bacilo, con actividad celulolítica cuando se utilizó la tinción con rojo congo en colonias de 10 d. Los resultados filogenéticos indican que se encuentra ubicada en el grupo monofilético perteneciente al género Shigella, pero con 98 % de simili...

  3. Contribución a la recuperación y normalización de un alimento tradicional canario: chorizo de Teror. Evaluación de riesgos

    OpenAIRE

    Guerrero Méndez, Rosa María

    2007-01-01

    [ES] Se plantea este estudio sobre el chorizo rojo de Teror, debido a la falta total y absoluta de definición de este alimento tradicional. Muchos elaboradores comercializan este alimento sin un referente de calidad y seguridad alimentaria básico, existiendo la necesidad de ofertar un producto de calidad contrastada al consumidor canario que demanda alimentos tradicionales para incorporar a su dieta. Por ello, se ha estudiado el proceso de elaboración, la evolución de los parámetros químicos ...

  4. THE MOLECULAR INTERSTELLAR MEDIUM ASSOCIATED WITH THE YOUNG COMPACT STELLAR CLUSTER WESTERLUND 1

    Directory of Open Access Journals (Sweden)

    A. Luna

    2011-01-01

    Full Text Available Analizamos el medio interestelar molecular en torno a Westerlund 1, el cúmulo estelar joven más masivo conocido en la Vía Láctea. Descubrimos una región molecular central evacuada entre dos complejos moleculares con corrimientos al rojo y azul con respecto al cúmulo. Nuestra definición de nube está basada en la cinemática del gas molecular y en un modelo de estructura espiral Galáctica. Estas regiones moleculares están asociadas con formación estelar activa posiblemente relacionada con la presencia de Westerlund 1.

  5. Estudio de una muestra completa de galaxias con emisiones en H"Alfa"

    OpenAIRE

    Gallego Maestro, Jesús

    1995-01-01

    Este trabajo consiste en caracterizar la muestra de galaxias con emisión en h "alfa" obtenida de la exploración UCM. En total 272 objetos hasta un desplazamiento al rojo de 0.045 analizados espectroscópicamente. Cada uno de ellos fue clasificado según ocho tipos espectroscópicos. Principalmente (47%) se trata de galaxias con intensos procesos de formación estelar. Por otro lado, se ha encontrado un 43% de objetos de baja ionización que no se detectan con otras técnicas. Los diferentes tipos o...

  6. Photometric and Spectroscopic Study of the Shakhbazian Compact Galaxy Groups ShCG 31, ShCG 38, ShCG 43, and ShCG 282

    OpenAIRE

    Tovmassian, H. M.; H. Tiersch; S. G. Navarro; V. H. Chavushyan; Tovmassian, G. H.; A. S. Amirkhanian; Neizvestny, S.

    2003-01-01

    Los grupos compactos de galaxias Shakhbazian son las configuraciones más densas que se conocen. Hace unos pocos años iniciamos un estudio fotométrico y espectroscópico de estos grupos. En este artículo presentamos los resultados de la investigación en los grupos ShCG 31, ShCG 38, ShCG 43 y ShCG 282. Presentamos los corrimientos al rojo de las galaxias miembro, los resultados de la fonometría BV R, las curvas de brillo superficial-radio efectivo, las masas estimadas, luminosidad...

  7. Photometric and spectroscopic study of seven shakhbazian compact galaxy groups

    OpenAIRE

    Tovmassian, Hrant M.; H. Tiersch

    2008-01-01

    En este artículo presentamos los resultados de un detallado estudio espectroscópico y fotométrico de siete grupos compactos de Shakhbazian (ShCGs), ShCG 285, ShCG 289, ShCG 322, ShCG 323, ShCG 327, ShCG 330, and ShCG 346. Determinamos el corrimiento al rojo de las galaxias miembros y las dispersiones de velocidad radial de los grupos. También estudiamos la distribución del brillo superficial de las galaxias miembros en la banda R y determinamos sus tipos morfológicos. Encon...

  8. DEEP after 15 years: lessons for GTC

    Directory of Open Access Journals (Sweden)

    David C. Koo

    2007-01-01

    Full Text Available DEEP2 es la mayor exploración espectroscópica del nuevo Keck de aproximadamente 35,000 galaxias de campo cuyo fin es el de proporcionar el censo y mapa detallados del cosmos en el corrimiento al rojo z 1. Presentamos revisión general de DEEP2 y de su predecesor, DEEP1. Varios resultados científicos y las ventajas de DEEP2 aseguran que el GTC será científicamente poderoso a pesar de su llegada tardía entre los telescopios de clase de 8-10 m.

  9. Photometric and spectroscopic study of Shakhbazian compact galaxy groups ShCG 104, ShCG 120, ShCG 223, and ShCG 245

    OpenAIRE

    Tovmassian, Hrant M.; H. Tiersch; Tovmassian, Gaghik H.; V. H. Chavushyan; Neizvestny, S.; Pramskij, A. G.; J. P. Torres-Papaqui; M Rozas

    2007-01-01

    Los grupos compactos de galaxias Shakhbazian son las configuraciones más densas que se conocen. Hace algunos años iniciamos un estudio fotométrico y espectroscópico de estos grupos. En este artículo presentamos los resultados de la investigación en los grupos ShCG 104, ShCG 120, ShCG 243 y ShCG 245. Presentamos los corrimientos al rojo de las galaxias miembro, los resultados de la fotometría R, las curvas de brillo superficial-radio efectivo, las masas estimadas, las luminosida...

  10. High-z Galaxies Through Gravitational Lensing

    OpenAIRE

    Diego, J A; T. Verdugo; De Leo, M. A.

    2007-01-01

    La gravedad es el motor clave de la evolución del universo y de la formación de sus principales estructuras: las galaxias, cúmulos de galaxias y filamentos. La gravedad es también una herramienta muy valiosa para explorar el universo a alto corrimientos al rojo a través del efecto relativista de las lentes gravitatorias. Los potenciales gravitatorios de los cúmulos de galaxias convierten a estos objetos en poderosos telescopios cósmicos que magnifican la señal de galaxias con alto...

  11. THE ASSEMBLY OF EARLY-TYPE GALAXIES: COMBINING CLUSTERING AND LUMINOSITY FUNCTION MEASUREMENTS

    OpenAIRE

    Padilla, N. D.

    2011-01-01

    Presentamos un estudio de la evolución de galaxias de tipo temprano (ETGs por sus siglas en ingl´es) que combina mediciones de acumulamiento y funciones de luminosidad. El acumulamiento nos permite inferir la masa de materia oscura de los halos anfitriones de las galaxias. Usamos predicciones del modelo ACDM para seguir estos halos hacia tiempos posteriores. Esta técnica demuestra que las ETGs de un dado corrimiento al rojo, evolucionan hacia galaxias más brillantes en un marco de referencia ...

  12. The formation epoch of ellipticals and other red-sequence galaxies

    OpenAIRE

    Marc Balcells

    2007-01-01

    En preparación del muestreo GOYA con GTC/EMIR, el equipo GOYA obtuvo cuentas de galaxias profundas en las bandas U, B y Ks en el campo de Groth. Mostramos modelos de evolución de galaxias que reproducen las cuentas en las tres bandas. Los precursores de las galaxias E y S0 del Universo local tuvieron que formarse a desplazamientos al rojo zf 1:5, para explicar el cambio de pendiente en las cuentas NIR de galaxias en Ks = 17:5. Con EMIR en GTC, planeamos observar espectroscopia en...

  13. "La política de reparto de bienes comunales en el municipio de San Juan Parangaricutiro (1861-1980)"

    OpenAIRE

    Saenz Gallegos, Catalina

    2012-01-01

    La historia de Michoacán no se concibe sin los movimientos sociales de la lucha por la tierra, en que las Comunidades indígenas no han sido ajenas, muestra de ello es que en la actualidad se sigan resistiendo a perder la posesión de sus territorios. Es por ello, que históricamente podemos entender que el Estado de Michoacán sea considerado por la Secretaría de la Reforma Agraria como uno de los focos Rojos del país, ya que el problema por la tierra ha sido un proceso hist...

  14. Valores hematológicos de referencia en tortuga terrestre argentina (Chelonoidis chilensis chilensis)

    OpenAIRE

    Troiano, Juan Carlos; M.C Silva

    1998-01-01

    Se tomaron muestras sanguíneas de 150 ejemplares sanos de tortuga terrestre argentina (Chelonoidis chilensis chilensis) por medio de punción de la vena coccígea superior. Las determinaciones que se realizaron incluyeron recuentos de glóbulos rojos, leucocitos y trombocitos, hematocrito, concentración de hemoglobina, índices hematimétricos y fórmulas leucocitarias relativas, las que se compararon con otras especies de Testudinidae. No se observaron cambios estadísticamente significativos en lo...

  15. Diseño de una red de corredores ecológicos para carnívoros forestales en la Comunidad Valenciana

    OpenAIRE

    Terrones Contreras, Beatriz; Bonet Jornet, Andreu

    2014-01-01

    El presente trabajo pretende sentar las bases para la creación de una red de corredores ecológicos entre las áreas de la Red Natura 2000 en la Comunidad Valenciana. Con este objetivo se han desarrollado modelos de conectividad ecológica para la creación de corredores destinados a un grupo funcional específico formado por carnívoros forestales presentes en la Comunidad Valenciana, como el zorro rojo Vulpes vulpes, la garduña Martes foina, la gineta Genetta genetta y el gato montés europeo Feli...

  16. Evaluación genética de cruzamientos de ganado Brahman para características de crecimiento y medidas de ultrasonido en la microrregión del Sur del Cesar / Genetic evaluation of Brahman cattle crossbreds for growth and ultrasound-measured traits in the microregion of Southern Cesar

    OpenAIRE

    Martínez Niño, Carlos Alberto

    2011-01-01

    En el presente estudio se obtuvieron estimadores de efectos de raza, heterosis, componentes de (co)varianza, parámetros genéticos y predicciones de valores genéticos para pesajes y medidas ultrasónicas de canal (repetidas en el tiempo) en una población multirracial bovina. La población se obtuvo mediante el apareamiento aleatorio de 37 toros de 9 razas (Brahman Gris, Brahman Rojo, Guzerat, Blanco Orejinegro, Romosinuano, Simmental, Braunvieh, Normando y Limousin) con hembras Br...

  17. Hábitos alimentarios de Dosidicus gigas (D' Orbigny, 1835) (Cephalopoda: Teuthoidea) frente a la costa centro-sur de Chile Feeding habits of Dosidicus gigas (D'Orbigny, 1835) (Cephalopoda: Teuthoidea) in the central-south coast off Chile

    OpenAIRE

    PATRICIO ULLOA; MARTA FUENTEALBA; VÍCTOR RUIZ

    2006-01-01

    Se estudiaron los hábitos alimentarios del calamar rojo Dosidicus gigas (D'Orbigny, 1835) frente a la costa de Chile centro-sur, durante el invierno del año 2005. Se examinaron un total de 52 estómagos, en todos los cuales había contenido alimentario. Los ejemplares provenían de pescas efectuadas por la flota arrastrera industrial que opera entre 36°39' S y 38°55'S sobre la merluza común Merluccius gayi (Guichenot 1848) y a una profundidad media de 290 m sobre la plataforma continental. Para ...

  18. Violencia y devoción en la reciente narrativa latinoamericana

    OpenAIRE

    Ernesto Pablo Ávila

    2014-01-01

    Las novelas la virgen de los sicarios (1994), de Fernando Vallejo y la esquina de los ojos rojos (2006) de rafael ramírez Heredia, constituyen dos obras representativas de la literatura latinoamericana contemporánea; la primera de ellas, focaliza al espacio co- lombiano y la segunda, al mexicano. estas obras narrativas se aventuran a describir una re- gión con dramáticos contrastes y tensiones sociales. establecen un diálogo abierto con otras visiones críticas, investigaciones sociales y obra...

  19. Granulomatosis sarcoidea necrosante con compromiso sistémico Necrotizing sarcoid granulomatosis with systemic involvement

    OpenAIRE

    María Elena Ceballos; José Hormazábal F; Carmen Torres; Maite Oyonarte W; Juan Carlos Rodríguez D; Manuel Meneses; Sara Chernilo S

    2006-01-01

    Mujer mapuche de 70 años quien en el curso de 1 año presentó baja de peso, ojo rojo bilateral y úlcera corneal que evolucionó hacia la perforación con herniación uveal y pérdida de la visión. Posteriormente se agregaron lesiones nodulares, violáceas, sensibles, algunas ulceradas en las zonas distales de ambas extremidades inferiores. La TAC de tórax demostró múltiples nódulos pulmonares. Tras un estudio exhaustivo se descartaron la tuberculosis y otras infecciones. Tanto la biopsia de las les...

  20. Soluciones y refrigeración para alargar la vida postcosecha de rosa CV. `black magic´

    OpenAIRE

    Luis A. Valdez Aguilar; Amando Espinosa Flores; Rogelio Castro Brindis; Gloria V. Cano García; Pablo Juárez Hernández; Ma. Teresa Colinas León

    2008-01-01

    La variedad de rosal (Rosa hybrida L.) ‘Black Magic’ por sus pétalos aterciopelados de color rojo intenso, es altamente apreciada por los productores del Estado de México debido a su demanda durante todo el año, en particular en fechas pico (14 de febrero, 10 de Mayo y 12 de diciembre). Debido a que su problema principal es el marchitamiento precoz en la fase postcosecha causado por una baja absorción de agua, en este trabajo se evaluaron tres soluciones preservantes con base en 8- citrato de...

  1. Monitoreo del manglar de Gandoca, Costa Rica (sitio CARICOMP)

    OpenAIRE

    Ana C Fonseca E; Jorge Cortés; Priscilla Zamora

    2007-01-01

    El manglar de Gandoca, Refugio Nacional de Vida Silvestre Gandoca-Manzanillo, Caribe de Costa Rica, se ha monitoreado desde 1999. La especie dominante es el mangle rojo Rhizophora mangle. El pico de productividad y producción de flores a lo largo de los años se dio en julio. La productividad del manglar disminuyó desde el 2001 y la temperatura del agua aparentemente aumentó. La biomasa (14 kg/m²) y densidad (9 árboles por 100 m²) en Gandoca son relativamente bajas comparados con otras manglar...

  2. Distribución y abundancia de la ascidia Ecteinascidia turbinata (Ascidiacea: Perophoridae) en Cuba

    OpenAIRE

    Aida Hernández-Zanuy; José Luis Carballo; Alida García-Cagide; Santiago Naranjo; Macario Esquivel

    2007-01-01

    Ecteinascidia turbinata está ampliamente distribuida en las áreas de mangle rojo (Rhizophora mangle) de tipo sobrelavados donde ocupa la porción permanentemente sumergida. Ocasionalmente se encontró sobre el coral negro Antipathes caribeana a 22 y 38 m de profundidad. Sin embargo no fue frecuente en los manglares de borde ni de ribera. Se muestrearon 58 localidades estando presente la especie en un 75 % de las mismas. Sus poblaciones son abundantes pues en el 57 % de las zonas prospectadas má...

  3. Efecto de cuatro ecotipos de Lepidium peruvianum Chacón sobre la producción de óxido nítrico in vitro

    OpenAIRE

    Libertad Alzamora; Evelyn Alvarez; Dina Torres; Hilda Solís; Erasmo Colona; Jenny Quispe; Magda Chanco

    2013-01-01

    Los macrófagos desempeñan un rol importante en la respuesta innata y adaptativa, durante su activación producen mediadores citotóxicos como Óxido Nítrico (NO). El objetivo fue evaluar la producción de NO por macrófagos peritoneales de ratón cultivados con extractos metanólicos (EM) de los ecotipos rojo, negro, morado y blanco de Lepidium peruvianum Chacón (también conocida como Lepidium meyenii Walp). Los EM se prepararon empleando maca pulverizada macerada en metanol (1:2) durante 10 días. L...

  4. Respuesta al glifosato de un aislamiento de Rhizoctonia solani agente causal del anublo de la vaina del arroz, y de cuatro aislamientos de Trichoderma, bajo condiciones in vitro In vitro response of one isolate of Rhizoctonia solani, the pathogen of the rice sheath blight and four isolates of Trichoderma to glyphosate

    OpenAIRE

    Vargas de Álvarez Amparo; Fuentes Cilia L.; Torres Torres Enrique

    2002-01-01

    El añublo de la vaina del arroz (Orysa saliva L.), cuyo agente causal es Rhizoctonia solani Kuhn, es una de las enfermedades más importantes en el cultivo del arroz en Colombia. En los cultivos de arroz con frecuencia se aplica glifosato ((ácido N-(fosfonometil) glicina) para controlar las malezas, particularmente el arroz rojo (O. saliva), antes de la siembra del arroz. Observaciones de campo anteriores parecían indicar relación entre el uso intensivo del glifosato y el incremento en la inci...

  5. SNØ

    OpenAIRE

    Larios, Israel; Serna, Rodrigo; Marina, Miguel; Blasco, Selina; Insúa Lintridis, Lila; Simón, Alejandro; Arias, Ana; Cinque, Alejandro; SNØ, (Colectivo)

    2014-01-01

    Organizadores: Israel Larios, Rodrigo Serna y Miguel Marina; textos, Colectivo SNØ y artistas. Contiene: Exposiciones.- La Cabaña, construcción del paisaje, SNØ. Tránsito Hostil, Asier Echevarría. Interludio, Nina Paszkowski - Presentaciones.- La montaña y otros dispositivos ópticos, Víctor Santamarina. Memorias de un caminante, Luis Rojo - Presentaciones.- 'De buenas intenciones está el infierno lleno, Jorge Diezma y Hugo Castigniani. SNØ es un colectivo artístico que ha trabajado en l...

  6. La transfusión sanguínea en el paciente crítico. Características y adecuación de la administración de concentrados de hematíes.

    OpenAIRE

    Amado Rodríguez, Lara

    2014-01-01

    La anemia es un problema frecuente en el paciente ingresado en una Unidad de Cuidados Intensivos, que habitualmente se trata con la transfusión de Concentrados de Hematíes con la finalidad de aumentar la cantidad de oxígeno arterial y el aporte de éste a los tejidos. En este sentido, la transfusión de glóbulos rojos ha demostrado su eficacia en determinadas patologías médicas y quirúrgicas, aumentando la supervivencia de estos pacientes que se encuentran en situaciones de anemia grave o shock...

  7. HIGH-REDSHIFT OBJECTS IN DUST ENVIRONMENTS

    Directory of Open Access Journals (Sweden)

    E. E. Martínez-García

    2011-01-01

    Full Text Available Se da una introducción para un proyecto relacionado con el estudio de objetos a alto corrimiento al rojo (principalmente galaxias formando estrellas, que pueden albergar grandes cantidades de polvo en su interior. La entrada de telescopios más poderosos en las longitudes de onda infrarrojas y submilimétricas (e.g., ALMA, JWST, junto con modelos de síntesis de poblaciones estelares, de transferencia radiativa, y de evolución del polvo, ayudarán a desenmascarar la evolución cósmica del contenido de polvo en las galaxias.

  8. HIGH-REDSHIFT OBJECTS IN DUST ENVIRONMENTS

    OpenAIRE

    E. E. Martínez-García; G. Bruzual; Magris, G.; González-Lópezlira, R. A.; M. Rosado

    2011-01-01

    Se da una introducción para un proyecto relacionado con el estudio de objetos a alto corrimiento al rojo (principalmente galaxias formando estrellas), que pueden albergar grandes cantidades de polvo en su interior. La entrada de telescopios más poderosos en las longitudes de onda infrarrojas y submilimétricas (e.g., ALMA, JWST), junto con modelos de síntesis de poblaciones estelares, de transferencia radiativa, y de evolución del polvo, ayudarán a desenmascarar la evolución cósmica del conten...

  9. El extraño caso del Dr. Subtitulado y Mr. Electrónico

    OpenAIRE

    Torregrosa Povo, Santiago

    2015-01-01

    La escena es una sala de cine casi vacía. En la última fila visualizamos a un tembloroso traductor con su ordenador portátil de más de cinco kilos de peso, presto para sincronizar manualmente (“lanzar” en la jerga) los subtítulos de una película rusa de género pseudofantástico. Bajo la pantalla de cine, un dispositivo al estilo de los paneles informativos que se ven en las autopistas o en las paradas de autobús, una pantalla de bombillitas de led de un intenso color rojo. Al lado del traducto...

  10. Caracterización farmacognóstica de Salvia officinalis L. Pharmacognostic characterization of Salvia officinalis L.

    OpenAIRE

    Ester Sánchez Govín; Ana María Pérez Lamas; Diosothys Chávez Figueredo; Carlos Alberto Rodríguez Ferradá

    2005-01-01

    Obtener drogas vegetales de calidad, que constituyan medicamentos herbarios o materias primas para la fabricación de formas farmacéuticas es la temática de la presente investigación y su objetivo de mayor relevancia, establecer las especificaciones de calidad, en este caso de Salvia officinalis L. cultivada en suelo ferralítico rojo hidratado. Se determinaron los índices de calidad siguientes: humedad, cenizas totales, sustancias solubles y aceite esencial, en lotes procedentes de la Estación...

  11. Propiedades nutraceúticas del licopeno Nutraceutical properties of lycopene

    OpenAIRE

    Krzysztof N Waliszewski; Gabriela Blasco

    2010-01-01

    Las recomendaciones dietarias en los últimos años proponen el incremento del consumo de alimentos que contienen fitoquímicos, ya que éstos proveen efectos benéficos para la salud humana y juegan un papel importante en la prevención de enfermedades crónicas. El licopeno, carotenoide responsable del color rojo de los tomates, ha atraído la atención debido a sus propiedades biológicas y fisicoquímicas en la prevención de enfermedades crónicas como cáncer, enfermedades cardiovasculares y neurodeg...

  12. Compatibilidad sexual entre dos tipos de Hylocerus (Cactaceae)

    OpenAIRE

    Roberta Castillo M.; Manuel Livera M.; Alicia E. Brechú F.; Judith Márquez-Guzmán

    2003-01-01

    Dos de los tipos de pitahaya mas cultivados en la Península de Yucatán, México, difieren principalmente por el color de su cáscara, el primero es de color rojo (Uqroo1), perteneciente a Hylocereus undatus, mientras que en el segundo es color amarillo claro (Uqroo2), hasta el momento también identificado como H. undatus; este último es mas dulce. En ambos tipos de pitahayas, se realizaron autopolinizaciones y polinizaciones cruzadas directas y recíprocas, con el propósito de evaluar el efecto ...

  13. Machine Learning and Knowledge Management for Decision Support. Applications in Promotional Efficiency and Healthcare

    OpenAIRE

    Soguero Ruiz, Cristina

    2015-01-01

    Tesis Doctoral leída en la Universidad Rey Juan Carlos de Madrid en 2015. Directores de la Tesis: José Luis Rojo Álvarez e Inmaculada Mora Jiménez El desarrollo alcanzado en las Tecnologías de la Información y las Comunicaciones en las últimas décadas, ha traído consigo la recopilación y almacenamiento creciente de datos en ámbitos tan diversos como pueden ser marketing, salud o seguridad. La disponibilidad de grandes cantidades de datos hace necesaria la búsqueda de nuevos paradi...

  14. Resumen de las excursiones realizadas a la laguna de La Nava (Fuentes de Nava, Palencia) entre 1950 y 1953, y listado de las especies observadas

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Resumen de las excursiones realizadas a la laguna de La Nava (Fuentes de Nava, Palencia) entre 1950 y 1953, y listado de las especies observadas, entre las que se encuentran los siguientes peces: Barbus sp. (Barbo), Carassius auratus (Pez rojo) y Tinca tinca (Tenca),los siguientes anfibios: Bufo bufo (Sapo común, llamado B.vulgaris por el autor), Epidalea calamita (Sapo corredor, llamado Bufo calamita por el autor), Molge sp. (que seguramente equivale a "Tritón" ,probablemente, Lissotriton sp...

  15. PRIMER INTENTO DE DATACIÓN DE PINTURAS MURALES MESOAMERICANAS (First Attempt to Date Mesoamerican Mural Paintings)

    OpenAIRE

    Avto Goguitchaichvili; Juan Morales; Rodrigo Esparza López; Ana María Soler; Jaime Urrutia Fucugauchi; Miguel Cervantes Solano

    2016-01-01

    Se reporta, por vez primera, el intento de datación de cuatro pinturas murales del centro de México: Templo de Venus (Cacaxtla), Templo Rojo (Templo Mayor, Tenochtitlan), Chapulines y Estrellas (Cholula). Estos sitios corresponden al periodo Clásico y Posclásico Temprano de la cronología mesoamericana. Las edades obtenidas para Chapulines (1105-1194 A. D.), Templo de Venus (1002-1308 A. D.) y Estrellas (340-649 A. D.) están dentro de la cronología y contexto arqueológico de los sitios estudia...

  16. Vacuna frente a infestaciones provocadas por artrópodos hematófagos

    OpenAIRE

    Fuente García, José de la; Villar, Margarita; Prudencio, Carlos Roberto; Pérez de Lastra, José Manuel

    2012-01-01

    [ES] La presente invención describe una vacuna frente a infestaciones provocadas por artrópodos hematófagos preferentemente garrapatas, mosquitos, flebótomos, ácaros rojos de las gallinas, pulgas, piojos, piojos de mar, etc. Así mismo, se protege un péptido capaz de inducir una respuesta inmune protectora y de reacción cruzada frente a una infestación provocada por artrópodos hematófagos, un polinucleótido, un vector de expresión, una célula hospedadora, un animal no humano, un anticuerpo, y ...

  17. Vacuna frente a infestaciones provocadas por artrópodos hematófagos

    OpenAIRE

    Fuente García, José de la; Villar, Margarita; Prudencio, Carlos Roberto; Pérez de Lastra, José Manuel

    2012-01-01

    La presente invención describe una vacuna frente a infestaciones provocadas por artrópodos hematófagos preferentemente garrapatas, mosquitos, flebótomos, ácaros rojos de las gallinas, pulgas, piojos, piojos de mar, etc. Así mismo, se protege un péptido capaz de inducir una respuesta inmune protectora y de reacción cruzada frente a una infestación provocada por artrópodos hematófagos, un polinucleótido, un vector de expresión, una célula hospedadora, un animal no hum...

  18. EFECTO DE INOCULANTES MICROBIANOS SOBRE LA PROMOCIÓN DE CRECIMIENTO DE PLÁNTULAS DE MANGLE Y PLANTAS DE Citrullus vulgaris SAN ANDRÉS ISLA, COLOMBIA Microbial Inoculantes Effects on Growth Promotion of Mangrove and Citrullus vulgaris San Andrés Isla, Colombia

    OpenAIRE

    TANIA GALINDO; JAIME POLANÍA; JIMENA SÁNCHEZ; NUBIA MORENO; VANEGAS JAVIER; GINA HOLGUÍN

    2006-01-01

    Con el fin de probar la efectividad de dos inoculantes microbianos (aislados a partir de raicillas de mangle rojo y negro) en el crecimiento y establecimiento de plántulas de mangle y de patilla, se realizaron cuatro pruebas en campo en San Andrés Isla, Colombia. Se aplicaron dichos inoculantes en: propágulos de Avicennia germinans colectados en un área de manglar y sembrados en macetas sobre sustrato solarizado (con el fin de disminuir la carga microbiana), plántulas de A. germinans y Rhizop...

  19. Efecto de los inoculantes microbianos sobre la promoción de crecimiento de plantulas de mangle y plantas de citrullus vulgaris san andrés isla, colombia

    OpenAIRE

    Galindo, Tania; Polanía, Jaime; Sánchez, Jimena; Moreno, Nubia; Vanegas, Javier; Holguín, Gina

    2011-01-01

    Con el fin de probar la efectividad de dos inoculantes microbianos (aislados a partir de raicillas de mangle rojo y negro) en el crecimiento y establecimiento de plántulas de mangle y de patilla, se realizaron cuatro pruebas en campo en San Andrés Isla, Colombia. Se aplicaron dichos inoculantes en: propágulos de Avicennia germinans colectados en un área de manglar y sembrados en macetas sobre sustrato solarizado (con el fin de disminuir la carga microbiana), plántulas de A. germinans y Rhizop...

  20. Velocidad de descomposición de la hojarasca en diferentes sustratos de manglar en San Andrés Isla, Caribe colombiano

    OpenAIRE

    Mancera P. José Ernesto; Medina Calderón Jairo; Sierra Rozo Omar Alfonso; Santos-Martínez Adriana

    2007-01-01

    La degradación de la hojarasca de manglar fue estudiada en diferentes sustratos de tres humedales de manglar
    en San Andrés isla, Caribe colombiano. Las tasas de descomposición de Rhizophora mangle (mangle rojo),
    Laguncularia racemosa (mangle blanco) y Avicennia germinans (mangle negro) fueron medidas en bolsas tipo
    malla. Algunas bolsas fueron dispuestas bajo el suelo, otras sumergidas en el agua, y otras sobre la superficie
    del suelo. Dos humedales...

  1. Evaluación de nuevos dispositivos en la interacción de niños con necesidades específicas de apoyo educativo

    OpenAIRE

    Pedraza Jurado, Jorge

    2013-01-01

    Durante la realización de este trabajo de fin de grado se realizará el diseño y desarrollo de un juego orientado a niños con necesidades específicas de apoyo educativo. Este grupo de usuarios repercute en el diseño de los elementos del juego los cuales han de ser simples, sin distracciones, textos de ayuda claros y bien definidos, alto contraste en los elementos, ayuda textual y visual, selección de colores evitando referencias conocidas (rojo como referencia a peligro); y una serie de patron...

  2. Microsatélites amplificados al azar (RAM) en estudios de diversidad genética vegetal Random amplified microsatellites (RAM´s) in plant genetic diversity studies

    OpenAIRE

    Jaime Eduardo Muñoz Flórez; Ana Cruz Morillo Coronado; Yacenia Morillo Coronado

    2008-01-01

    Se revisó el uso e importancia, ventajas, desventajas y características de la técnica Microsatélites Amplificados al Azar (RAM) en uchuva Physalis peruviana, mora Rubus spp, guayaba Psidium guajava y heliconias Heliconia spp. En mora se diferenciaron las especies R. glaucus, R. robustus y R. urticifolius, se detectaron duplicados y se encontró alta variabilidad genética en R. glaucus, la especie más importante. En uchuva se encontró alta diversidad y dos accesiones de fruto rojo que se difere...

  3. Envasado en atmósfera modificada de pimiento de carne gruesa

    OpenAIRE

    Escalona Contreras, Víctor Hugo; Aguayo Giménez, Encarnación Pilar; Artés Calero, Francisco

    2004-01-01

    Se ha estudiado la influencia de la composición gaseosa sobre la calidad comercial d pimientos rojos "Lamuyo" y "California" durante 14 y 21 días a 5 y 8 grados centígrados en atmósfera controlada (AC) y mediante envasado en atmósfera modificada (EAM). Se determinaron la tasa respiratoria y la emisión de etileno bajo aire y AC (5 kPa O2 y 5 kPa CO2) y la composición gaseosa, alteraciones fisiológicas, podredumbres, deformación y atributos sensoriales (apariencia, sabor y textura) bajo EAM....

  4. Miasis ocular por Oestrus ovis

    Directory of Open Access Journals (Sweden)

    María Beltrán F

    2006-01-01

    Full Text Available Se presentan tres casos de miasis ocular (dos adultos y un niñoprocedentes de zonas ganaderas de la provincia de Huaura,departamento de Lima,que acudieron al Hospital Regional de Huacho por presentar el ojo rojo,fotofobia, edema palpebral y sensación de cuerpo extraño;se extrajeron larvas adheridas al canto interno del ojo,las cuales se recibieron en el Instituto Nacional de Salud y fueron identificadas como Oestrus ovis .

  5. Direct comparison of the FibroScan XL and M probes for assessment of liver fibrosis in obese and nonobese patients

    OpenAIRE

    Durango E; Dietrich C; Seitz HK; Kunz CU; Pomier-Layrargues GT; Duarte-Rojo A; Beaton M; Elkhashab M; Myers RP; Mueller S.

    2013-01-01

    Esteban Durango,1,* Christian Dietrich,1,* Helmut Karl Seitz,1 Cornelia Ursula Kunz,2 Gilles T Pomier-Layrargues,3 Andres Duarte-Rojo,4 Melanie Beaton,5 Magdy Elkhashab,6 Robert P Myers,7 Sebastian Mueller1,3 1Department of Medicine and Center for Alcohol Research, Liver Disease and Nutrition, Salem Medical Center, 2Institute of Medical Biometry and Informatics, University of Heidelberg, Heidelberg, Germany; 3Liver Unit, Centre Hospitalier de l'Université de Montréal, H&ocir...

  6. Un análisis socio-geográfico de la oferta de "Entrentención para adultos" en la ciudad de Calama (Chile).

    OpenAIRE

    Marcelo Lufin Varas

    2015-01-01

    El objetivo principal del trabajo es describir los actores participantes y las características de la oferta espacial de “entretención para adultos” en la ciudad de Calama, y determinar qué tipo de negocio actúa como precursor de la formación de barrios rojos en dicha localidad. El trabajo utiliza información secundaria proveniente del registro de control sanitario mantenido por el Servicio de Salud, que incluye 791 prestadoras (incluyendo trabajadoras sexuales) en control desde el año 2006 a ...

  7. Clonación y expresión en Escherichia coli de genes de celulasas de Clostridium IBUN 22A

    OpenAIRE

    Vargas Pabón Lucy Carolina; Montoya Dolly; Aristizábal Fabio

    2002-01-01

    El propósito de este trabajo fue construir una librería genómica a partir de la cepa nativa Clostridium IBUN 22A, utilizando como vector de clonación el plásmido pBluescrip® IIKS+/- y su expresión en Escherichia coli. La detec-ción de ocho clones recombinantes con actividad enzimática se realizó empleando el tamizaje enzimático con tres sustratos: celobiosa, carboximetilcelulosa y celulosa pulverizada (nativa). Los halos de hidrólisis fueron detectados por la técnica de rojo congo. Se realiza...

  8. Role of Iron(III)-salen Chloride as Oxidizing Agent with Thiodiglycolic Acid: The Effect of Axial Ligands

    OpenAIRE

    Perumal Subramaniam; Thangadurai Vanitha; Thiruttimuthu Kodispathi; Chandra Raj Shanmuga Sundari

    2014-01-01

    En este trabajo se estudia la sulfoxidación del ácido tio - diglicólico con cloruro de Fe(III)-salen, que actúa como agente oxi - dante en un medio 50% acetonitrilo-agua. Se observa un desplaza - miento importante hacia el rojo del valor del λ max del FeIII-salen en medio acuoso. El estudio cinético espectrofotométrico indica que el [FeIII(salen)]+ es la especie oxidante activa y que se sigue una cinética Michaelis-Menten, con respecto al sustrato. La velocidad de reacción es altamente sensib...

  9. Conocimiento, actitudes y prácticas, sobre enfermedad renal crónica en habitantes de la comunidad “la isla” del municipio de Chichigalpa

    OpenAIRE

    Berrios Ballesteros, Alberto; Kulakova, Olga; Jirón, Alfredo; Martinez, Jahaira; Urcuyo, Nataly

    2013-01-01

    El riñón tiene como función principal el filtrar los productos metabólicos de desecho y el exceso de sodio y de agua de la sangre, así como facilitar su eliminación del organismo, regular la presión arterial y la producción de glóbulos rojos; sin embargo este pierde esta capacidad cuando existe ERC (enfermedad renal crónica). El desconocimiento sobre esta enfermedad lleva a muchos a tener una mala práctica en su vida sea que padezcan la enfermedad o no. El objetivo de este estudio fue identif...

  10. H2 Velocity Structure in HH 211

    OpenAIRE

    Salas, L.; I. Cruz González; Margarita Rosado

    2003-01-01

    Describimos la estructura en velocidad del chorro molecular HH211 en la línea 2.12 Um del H2. Las observaciones fueron obtenidas con un interferómetro Fabry-Pérot con resolución espectral de 24 km s_1. Se pudo observar que el lóbulo este del chorro está corrido al azul mientras que el del oeste está corrido al rojo. La mayor parte de la radiación se origina en bajas velocidades, en concordancia con la relación flujo-velocidad de Salas & Cruz-González (2002), pero estas bajas ...

  11. Moluscos; anélidos y crustáceos asociados a las raíces de rhizophora mangle linnaeus, en la región de santa marta, caribe colombiano

    OpenAIRE

    Reyes, Rosalba; Campos C, Néstor Hernando

    2012-01-01

    Se realizó un estudio trimestral cualitativo y cuantitativo de la comunidad de moluscos, anélidos y crustáceos asociados a las raíces sumergidas del mangle rojo, Rhizophora mangle Linnaeus, entre diciembre de 1988 y septiembre de 1989, en tres estaciones en la Ciénaga Grande de Santa Marta (CGSM) y tres en el Parque Nacional Natural Tayrona (PNNT, Bahía de Chengue y Bahía de Nenguange), Caribe colombiano. Se determinaron 181 especies: 99 crustáceos, 50 moluscos y 32 anélidos. En total se cont...

  12. Control de artrópodos fitófagos en cítricos con aldicarb y efectos sobre entomofauna auxiliar.

    OpenAIRE

    SOLER FELIU, JOSE-MARIA

    2009-01-01

    Aldicarb es un plaguicida utilizado en el cultivo de los agrios. Se ha estudiado su efecto con el objetivo de conocer la acción sobre ciertas plagas, el impacto sobre insectos beneficiosos, la influencia en el desarrollo vegetativo y la cosecha, así como la absorción y evolución de sus metabolitos en el suelo, hojas y frutos. Hemos observado que aldicarb controla de forma adecuada las siguientes plagas: aleiródidos, áfidos, el pseudoócido Planococcus citri Risso y el ácaro rojo Panonychus ...

  13. Modelado auto-consistente de la emisión de estrellas y polvo en galaxias luminosas en IR a redshift intermedio

    OpenAIRE

    Espino Briones, Néstor

    2015-01-01

    Las distribuciones espectrales de energía (SEDs) de galaxias con polvo y formación estelar a desplazamientos al rojo intermedio son caracterizadas usualmente con modelos que asumen un ́unico brote para representar las historia de formación estelar (SFH) de las distintas poblaciones que constituyen estos objetos. Adeḿas, la relación entre la atenuación de la emisión estelar en el espectro visible debida al polvo y su posterior re-emisi ́on en el infrarrojo lejano (FIR) ha sido desestimada cua...

  14. Consideraciones sobre restos de primates de un yacimiento arqueológico del Oriente de Venezuela (América del Sur): Bueva del Guácharo, estdo Monagas

    OpenAIRE

    Bernardo Urbani; Edgar Gil

    2001-01-01

    Es poco lo que se conoce sobre monos del Nuevo Mundo en depóstitos arqueológiocos. En el sitio Cueva del Guácharo, excavado por la Sociedad Venezolana de Espeleología en 1972 se hallaron restos de primates. La colección de primates está compuesta por un escápula, un canino, un premolar, dos mandíbulas y dos maxilares de araguatos o monos aulladores rojos (Alouatta seniculus) prehispánicos. Las fechas radiocarbónicas asociadas al material arqueológico se ubican entre el 3.485 +-200 y 2.925 +- ...

  15. Utilización de imágenes aéreas multiespectrales para evaluar la disponibilidad de nitrógeno en maíz

    OpenAIRE

    Isla Climente, Ramón; Quílez Sáez de Viteri, Dolores; Valentín, Francisco; Casterad Seral, María Auxiliadora; Aibar, Joaquín; Maturano, Marisa

    2011-01-01

    [ES] Utilizando información de dos ensayos de maíz realizados en Albacete y Zaragoza, se evaluó la utilidad de imágenes multiespectrales comerciales de alta resolución espacial (0.1 m) en el espectro del visible (azul, verde, y rojo) e infrarrojo cercano tomadas mediante avión para determinar el estado nutricional del maíz en fases intermedias (V15) del cultivo y en condiciones de regadío españolas. Considerando todas las parcelas de cada ensayo, los niveles digitales (ND) obtenidos en las cu...

  16. ESTUDIO COMPARATIVO DE DIFERENTES ESPECIES DE ABONOS VERDES Y SU INFLUENCIA EN EL CULTIVO DEL MAÍZ

    OpenAIRE

    Margarita García; Mayté Álvarez; Eolia Treto

    2002-01-01

    En el período mayo-noviembre de los años 1996-1997, se llevó a cabo un experimento de campo durante dos campañas consecutivas, sobre un suelo Ferralítico Rojo de la provincia La Habana, con el objetivo de evaluar la efectividad de diferentes especies de leguminosas utilizadas como abonos verdes en rotación sobre el cultivo del maíz, determinando asimismo la eficiencia del N aportado por estas. Se comparó el efecto de Crotalaria juncea, Stizolobium aterrimum, Canavalia ensiformis y Sesbania ro...

  17. Citotoxicidad del fungicida mancozeb en cultivos de CHO-K1

    OpenAIRE

    A.E. Bayoumi; Ordóñez, C.; Y. Pérez Pertejo; R. Balaña Fouce; Ordóñez, D.

    2002-01-01

    Se ha determinado la citotoxicidad del fungicida ditiocarbámico mancozeb, en cultivos celulares de ovario de hámster (CHO-K1), usando los bioensayos estandarizados de incorporación de rojo neutro (RN) y del contenido total de proteínas (PT). Las dos técnicas mostraron ser comparables en la determinación del efecto citotóxico, mostrando valores de RN50 menores de 15 mg/ml después de 24 h de exposición al plaguicida. La citotoxicidad fue mayor cuanto mayor fue el tiempo ...

  18. Estudio de algunos géneros bacterianos asociados a la rizosfera de los cultivos de gerbera (Gerbera jamesonii) y clavel (Dianthus barbatus, Dianthus caryophyllus)

    OpenAIRE

    Annia Hernández; Damarys García; María R. Soroa; Hernández, Ana N.

    2000-01-01

    En este trabajo se realizó la caracterización de algunos géneros bacterianos presentes en la rizosfera de los cultivos de gerbera (Gerbera jamesonii) y clavel (Dianthus barbatus y Dianthus caryophyllus), en un suelo Ferralítico Rojo compactado de San José de las Lajas. También se estudió la quimioatracción de los exudados radicales de estos cultivos hacia diferentes rizobacterias (Pseudomonas (Burkholderia) cepacia, P. fluorescens y Azospirillum brasilense). En ambos casos se utilizó el Model...

  19. Relación de medidas bovinométricas y de composición corporal in vivo con el peso de la canal en novillos Brahman en el valle del Sinú.

    OpenAIRE

    Álvarez F. L. A.; Velásquez Juan Carlos

    2004-01-01

    En dos hatos de cría y ceba de la costa caribe de Colombia (50 msnm, 28°C y 65% de humedad relativa) se formaron dos grupos contemporáneos de machos Brahman para evaluar el crecimiento posdestete y producción de carne (pesos, bovinometría, medidas de composición corporal y canal): Un grupo de 17 Brahman Rojo (BR) y otro de 23 Brahman Gris (BG) fueron cebados en praderas de Angleton Dichantium aristatum. El Peso Ajustado al Destete (PAD), Peso Ajustado al Año (PAA), Peso Ajustado a los 18 mese...

  20. Una actividad de educación ambiental basada en observaciones del cangrejo de río americano (Procambarus clarkii) en el Barranco del Cercado (Tenerife, Islas Canarias)

    OpenAIRE

    Mingorance Rodríguez, María del Carmen; Gómez Gómez, Juan Imeldo

    2002-01-01

    El Procambarus clarkii (cangrejo de río americano o cangrejo rojo de las marismas) es un ejemplo de la introducción de una especie en un ecosistema. En este trabajo se utiliza una población de esta especie en la isla de Tenerife para un conjunto de actividades educativas en un Instituto de Formación Profesional. Estas actividades incluyen muestreos y capturas de los cangrejos en el campo, la toma de sus medidas iniciales y su mantenimiento en el Instituto.