WorldWideScience

Sample records for ciervo colorado cervus

  1. Ataxia enzoótica en ciervo rojo (Cervus elaphus) en Argentina Enzootic ataxia in red deer (Cervus elaphus) in Argentina

    OpenAIRE

    J P Soler; S B Cseh

    2007-01-01

    Se describe un caso de ataxia enzoótica (AE) en ciervos rojos en cautiverio ocurrido en Argentina. La AE es una patología de los ciervos que causa parálisis lenta y progresiva de las extremidades posteriores y ha sido asociada a la deficiencia de cobre. Su presentación suele ser a partir de los 9 meses de edad. El problema afectó a dos ciervas rojas con debilidad de los miembros posteriores. Se realizó necropsia a una hembra preñada. Se tomaron muestras de órganos en formol al 10%, de suero y...

  2. Ataxia enzoótica en ciervo rojo (Cervus elaphus en Argentina Enzootic ataxia in red deer (Cervus elaphus in Argentina

    Directory of Open Access Journals (Sweden)

    J P Soler

    2007-01-01

    Full Text Available Se describe un caso de ataxia enzoótica (AE en ciervos rojos en cautiverio ocurrido en Argentina. La AE es una patología de los ciervos que causa parálisis lenta y progresiva de las extremidades posteriores y ha sido asociada a la deficiencia de cobre. Su presentación suele ser a partir de los 9 meses de edad. El problema afectó a dos ciervas rojas con debilidad de los miembros posteriores. Se realizó necropsia a una hembra preñada. Se tomaron muestras de órganos en formol al 10%, de suero y sangre entera. Al feto también se le realizó necropsia y se le tomó una muestra de hígado. A partir de muestras de pasto se determinaron los niveles de Cu, Fe, Zn, Mo y SO4. En el agua se analizaron los valores de sales totales, SO4, Ca, Mg, Na y Cl. La prevalencia de esta enfermedad en el establecimiento fue del 0,14%. Los valores de Cu hepático hallados en la hembra y su feto fueron 14,6 ppm y 337 ppm MS, respectivamente. El nivel de Cu en sangre de la cierva fue de 0,5 μg/ml y el hematocrito de 46%. En mιdula espinal se encontró degeneración mielínica generalizada con pérdida de la vaina de mielina, siendo de mayor severidad en las regiones dorsales de la médula. Se observó también vacuolización de la sustancia blanca sin respuesta inflamatoria. Los niveles hepáticos de Cu en la hembra necropsiada se encontraban por debajo del valor considerado como límite, pero a pesar de esto la cupremia se hallaba dentro del rango de referencia siendo ésta una característica comúnmente observada en los casos de deficiencia de Cu. Los valores de Cu hepático fetal también estaban por debajo del rango considerado como normal. A pesar de que los parámetros medidos en pasto y agua al momento del problema estaban dentro de valores de referencia, es probable que los ciervos hayan estado expuestos previamente a bajos valores de Cu dietario durante un tiempo prolongado, lo cual pudo verse agravado por la gran demanda de Cu que ejerce el

  3. Composición y calidad de la dieta del ciervo (Cervus elaphus L. en el norte de la península ibérica

    Directory of Open Access Journals (Sweden)

    Garin, I.

    2001-06-01

    Full Text Available Plant composition and quality of the red deer (Cervus elaphus L. diet in the northern Iberian peninsula The feeding pattern of red deer varies greatly among the different European populations. The aim of our study was to elucidate the plant composition and the quality of the red deer diet in the Pyrenees (Northern Iberian peninsula. Over a one-year period, the red deer fed mainly on browse, pines being the main food. However, unlike other populations on the Iberian peninsula, consumption of herbaceous plants was higher than browse in the spring-summer period. Nevertheless, the diet of Pyrenean red deer shared some features with the Mediterranean populations such as browsing on woody legumes. Fecal nitrogen content, as an index of diet quality, showed low annual values with a marked decrease in winter. The overall feeding pattern was similar to that of other Central European populations. The large size of the surveyed population probably affected its high level of browse consumption and poor quality diet.

  4. Guía para la determinación de la edad del ciervo ibérico (Cervus elaphus hispanicus) a través de su dentición: revisión metodológica y técnicas de elección

    OpenAIRE

    Azorit Casas, Concepción E.

    2011-01-01

    La determinación de la edad de los ciervos cazados es fundamental e imprescindible para valorar tanto la calidad individual como la calidad de la población en su conjunto y pone en perspectiva cuestiones sobre gestión y manejo. La determinación de la edad es la mejor fuente de información para evaluar los resultados de la gestión desarrollada, monitorizar el cumplimiento de los objetivos marcados a medio y largo plazo, y valorar las consecuencias de prácticas de manejo anteriores. También con...

  5. Caballos y ciervos : Una aproximación a la evolución climática y económica del Paleolítico superior en el Mediterráneo peninsular

    Directory of Open Access Journals (Sweden)

    Xavier Esteve

    2005-01-01

    Full Text Available Caballos y ciervos son las principales presas de caza mayor en los yacimientos del Paleolítico superior en la cuenca mediterranea de la Península Ibérica. Sólo las cabras monteses pueden llegar a tener mayor importancia en yacimientos situados en áreas abruptas o montañosas. A pesar de los pocos requerimientos climáticos de ambas especies, podemos comprobar una clara relación entre los episodios más fríos del final del Pleistoceno y la caza del caballo y la presencia de los restos de ciervo en los yacimientos arqueológicos durante los momentos más templados. Nuestros resultados indican la existencia de una especie de frontera bioclimática Equus/Cervus que se desplazó de sur a norte en la cuenca medietrranea de la peninsula Ibérica a lo largo del Paleolítico superior.

  6. La captura del ciervo vivo en el arte prehistórico

    Directory of Open Access Journals (Sweden)

    Pilar Utrilla

    2005-01-01

    Full Text Available Se hace un recorrido por la representaciones de ciervos en el arte prehistórico que no presentan heridas sino que parecen ser objeto de una captura mediante armas arrojadizas, lazos o directamente a mano. Se insertan algunos de ellos en un ritual ceremonial que quizá tuviera relación con ritos de iniciación.

  7. Colorado

    Directory of Open Access Journals (Sweden)

    Gerardo Rodríguez Quiroz

    2008-01-01

    Full Text Available La conservación de la biodiversidad cuenta, entre sus principales mecanismos de intervención, con las áreas naturales protegidas. En el alto Golfo de California (AGC se ubica la Reser-va de la Biosfera del Alto Golfo de California y Delta del Río Colorado, en la que subsisten especies de alto valor económico, así como especies en peligro de extinción. Este último factor justificó el establecimiento de la reserva. El estudio analiza la efectividad de la Reserva del Alto Golfo como mecanismo de protección de los recursos naturales, en particular de las que están en riesgo de desaparecer, así como de comprobar si los pescadores han mejorado sus condiciones de vida tras la operación de esa área natural. La exploración se llevó a cabo mediante la aplicación de una encuesta a los pescadores. Se sugiere que es indispensable un gran esfuerzo, de autoridades y grupos organizados, para encontrar soluciones al manejo de la Reserva, a fin fijar un programa que permita la recuperación de las especies en peligro de extinción, elevar la calidad de vida de los pescadores y con ello garantizar un equilibrio entre la conservación y la sustentabilidad de la pesca y de los pescadores en el Alto Golfo de California.

  8. A Novel Polypeptide from Cervus elaphus Linnaeus

    Institute of Scientific and Technical Information of China (English)

    LiangWENG; QiuLiZHOU; 等

    2002-01-01

    A novel polypeptide having stimulant effect on some cell proliferation was isolated from the velvet antler (Cervus elaphus Linnaeus). The velvet antler polypeptide consists of a single chain of 32 amino acid residues. Amino acid sequence of the polypeptide was identified as:VLSAADKSNVKAAWGKVGGNAPAFGAEALLRM.

  9. Hybridisation and introgression of exotic Cervus (nippon and canadensis) with red deer (Cervus elaphus) in the British Isles

    OpenAIRE

    Smith, Stephanie Lindsay

    2013-01-01

    Europe’s largest population of wild red deer (Cervus elaphus) resides in the British Isles and has been present since the end of the last ice age, c. 11,000BP. Since the mid-19th century, multiple introductions of Japanese sika (Cervus nippon) and wapiti (Cervus canadensis) have taken place across the British Isles. While wapiti introductions have generally gone extinct, sika have thrived and expanded and now often live in sympatry with red deer. Hybridisation between these spe...

  10. La ¡nasibilidad de lo real: el ciervo huidizo de la identidad The Inaccessibility of Truth: The Elusive Deer of Identity

    Directory of Open Access Journals (Sweden)

    Lola Proaño Gómez

    2008-12-01

    Full Text Available Este artículo responde a la pregunta por la posibilidad de una lectura política de los productos teatrales latinoamericanos de los últimos años, enfatizando la presencia de «lo político» en forma de rupturas lógicas y de sentido que dislocan el escenario teatral desde adentro. El grupo cubano El Ciervo Encantado, (2005-2008 busca -según el programa de mano- encontrar en Visiones de la cubanosofía, «ese ciervo escurridizo que es la identidad». La escena despliega, mediante múltiples técnicas teatrales, la incapacidad del lenguaje -lo simbólico- para captarla. La propuesta escenifica lo que se niega: la imposibilidad de aprehender la identidad exhibiendo sólo las sucesivas identificaciones que no la alcanzan. La escena señala que ellas han sido solamente un espejismo, resultado del reflejo de los discursos culturales producidos a través de la historia.This article is an answer to the question on the possibility of a political interpretation of recent Latin American dramatic products, emphasising on «political issues» through meaningful and logical ruptures that dislocate the stage from within. The Cuban theatre troupe El Ciervo Encantado (2005-2008, based on its programme, aims to find in Visiones de la cubanosofía, «the elusive deer that is identity». On stage is displayed, through various theatrical techniques, the incapacity of language -its symbolic aspect- to capture it. The proposal stages what is denied: the impossibility to apprehend identity by only presenting the successive identifications that cannot reach it. The scene states that it has only been an illusion caused by the reflection of the cultural discourses created through history.

  11. La composición y propiedades mecánicas de cuernas y huesos de ciervo como fuente de información para gestionar ecosistemas

    OpenAIRE

    T. Landete-Castillejos; Garcia, A.; F. Ceacero; Gallego, L.

    2013-01-01

    Este estudio hace una revisión de una línea de investigación que muestra cómo, en el ciervo, la composición mineral, propiedades mecánicas del material óseo de la cuerna, estructura e incluso histología de las cuernas están influidos por un juego de factores interrelacionados tales como la nutrición, tipo de gestión, calidad del hábitat, y densidad de población. Así, evaluar estas características se convierte en una herramienta diagnóstica que aporta información sobre las deficiencias mineral...

  12. The population size, demography and the harvest strategy for the red deer (Cervus elaphus L. in the Polish eastern Carpathians

    Directory of Open Access Journals (Sweden)

    Merta, D.

    2002-12-01

    sex-ratio était de 1:1,6, et la relation faon/femelle était de 31 faons pour 100 femelles. En appliquant un modèle de dynamique de population, nous avons calculé le taux de recrutement, lequel peut aller de 10,5% à 18,1 % du total de la population au mois de mars; il était négativement corrélé avec la densité de population de loups. La simulation sur ordinateur des différentes stratégies d'extraction a montré que le has pourcentage de vieux mâles observé dans la population actuelle était dû à la surchasse des mâles âgés de 2-5 ans. Nous pouvons recommander que la pression de chasse sur les jeunes mâles ne dépasse pas 30% du nombre total de mâles chassés.
    [es]
    Durante febrero del 2000 se estimó la densidad de población y el número de ciervos (Cervus elaphusL. en 8 distritos forestales (Baligród, Cisna, Dukla, Lutowiska, Komacza, Stuposiany, Rymanów y Wetlina por medio del índice de intercepción lineal de huellas en la nieve. Se obtuvo un total de 4081 individuos para el área de estudio (134.000 ha de bosque. La densidad media fue de 30,4 ciervos/1000 ha y su rango osciló de 10,1 ciervos/1000 ha (Distrito Forestal de Wetlina a 39,3 individuos/ 1000 ha (Distrito Forestal de Dukla. En septiembre de 2000 la observación de 952 individuos arrojó una sex-ratio de 1:1,6 (machos: hembra y un índice de 31 crías por cada 100 hembras. La tasa de reclutamiento anual se calculó mediante un modelo de dinámica poblacional, oscilando ésta entre el 10,5% y el 18,1% del tamaño poblacional en marzo y estando correlacionada negativamente con la densidad de lobos. Un programa informático de simulación de distintas estrategias de aprovechamiento cinegético mostró que el bajo porcentaje de machos viejos era debido a un exceso de caza de los venados de 2 a 5 años de edad. Por lo tanto, se recomendó que la proporción de machos jóvenes en el cupo no debería superar el 30% del total de machos cazados.

  13. Validación y uso de Espectrocopía de Infrarrojo Cercano (NIRS) para el estudio de alimentación de ciervo (Cervus elaphus hispanicus) y gamo (Dama dama) en ecosistemas mediterráneos

    OpenAIRE

    Tellado-Ruiz, María-Sierra

    2016-01-01

    [ES]En este estudio desarrollamos y validamos un método de Espectroscopía de Reflectancia en la región del infrarrojo cercano (NIRS) para determinar, de forma indirecta a partir de heces, la calidad de la dieta de dos especies de cérvidos en ambiente mediterráneo. Se estudió el contenido de fibra ácido detergente (ADF) y fibra neutro detergente (NDF), el contenido de lignina, el índice de carbono/nitrógeno (C:N), la digestibilidad enzimática (EDOM) y de la pared celular (CWD), la cantidad de ...

  14. Genetic structure of the Danish red deer (Cervus elaphus)

    DEFF Research Database (Denmark)

    NIELSEN, ELSEMARIE KRAGH; OLESEN, CARSTEN RIIS; PERTOLDI, CINO;

    2008-01-01

    The red deer (Cervus elaphus) population in Denmark became almost extinct in recent historical times due to over-hunting. The species has subsequently recovered within remote areas, but non-Danish individuals have been introduced at several localities. To assess genetic structure, past demographi...

  15. Successful low dose insemination of flow cytometrically sorted Sika (Cervus nippon) sperm in Wapiti (Cervus elaphus).

    Science.gov (United States)

    Gao, Q H; Wei, H J; Han, C M; Du, H Z; Zhang, Z G; Zhao, W G; Zhang, Y; Li, S

    2010-03-01

    The purpose of this study was to determine a practical method in Wapiti (Cervus elaphus) of using predetermined sexed Sika (Cervus nippon) semen. Semen was collected by electro-ejaculation from one stag of proven fertility and transported to the laboratory where it was retained as unsorted (control) or was separated into X- and Y-chromosome-bearing sperm using a modified high-speed cell sorter. Wapiti hinds (n=81) were inseminated into the uterus by rectum manipulation with 1 x 10(6) (X1 and Y1 group, respectively) or 2 x 10(6) (X2 and Y2 group, respectively) of sorted frozen-thawed and 1 x 10(7) non-sorted frozen-thawed (a commercial dose control) Sika motile sperm 60-66h after removal of intra-vaginal progesterone-impregnated CIDR devices and administration of 700IU of PMSG at the time of CIDR removal. The percentage of hinds calving after insemination was similar for X1 (38.5%), X2 (41.7%), Y1 (44.4%), Y2 (38.9%) groups (P>0.05), but higher for control (75%) treatment (PSika and Wapiti-hybrid calves produced by Wapiti hinds inseminated with Y-sorted sperm were male (93.7%) and 10/10 (100%) Sika and Wapiti-hybrid calves from hinds inseminated with X-sorted sperm were female. The sex ratio of the Sika and Wapiti-hybrid calves born to hinds inseminated with sex-sorted sperm deviated significantly (PSika and Wapiti-hybrid calves were born between 237 and 250d of gestation. Male and female calves in the control group had similar birth weights and weaning weights as calves from hinds inseminated with X- or Y-sorted sperm. In conclusion it can be said that normal Sika and Wapiti-hybrid calves of predicted sex can be produced after artificial insemination of Wapiti does with low numbers of sex-sorted cryopreserved Sika sperm. PMID:19619965

  16. Lactation curves in captive Iberian red deer (Cervus elaphus hispanicus)

    OpenAIRE

    García Díaz, Andrés; Landete Castillejos, Tomás; Molina Casanova, Ana María; Albiñana, Bernardo; Fernández, Carlos; Garde López-Brea, José Julián; Gallego Martínez, Laureano

    1999-01-01

    This study examines milk production and the effect of milk production and sex of calf on body weights and gains of red deer calves and hinds of the Iberian subspecies (Cervus elaphus hispanicus). Milk production was assessed in 14 hinds by weighing calves before and after suckling and by adjusting these values to the Gamma function. Gamma estimates of total milk production up to d 105 were similar to the amounts computed directly from double weighing. Hinds showed two types of lactation cu...

  17. Risk assessment of Sika deer Cervus nippon in the Netherlands

    OpenAIRE

    Lammertsma, D.R.; Groot Bruinderink, G.W.T.A.; Griffioen, A.J.

    2012-01-01

    Sika Deer (Cervus nippon) is considered an invasive alien species in Europe. They were introduced in the 19th and 20th century in Europe and have established self-sustaining populations in various countries. Main concerns for Sika, without preventive measures taken and without population control, are about damage to forestry (silviculture, timber production), agriculture, Natura 2000 areas, competition with native ungulates and hybridization and introgression with native Red Deer. Risk assess...

  18. Reprodukce siky (Cervus nippon) na Plzeňsku

    OpenAIRE

    Husinec, Václav

    2013-01-01

    This thesis examines the impact of the age of female sika deer on the weight of embryos of sika deer Cervus nippon nippon in the North Pilsen Region. From 2011 to the start of 2013 hunted down female sika deer were examined to establish the presence of embryos. Embryos were subsequently taken out of the hunted deer and analysed. The location of Košetice was selected to collate the data necessary. The location and the method of collation of data has been described in one of the chapters of thi...

  19. Babesias of red deer (Cervus elaphus in Ireland

    Directory of Open Access Journals (Sweden)

    Zintl Annetta

    2011-01-01

    Full Text Available Abstract Blood samples were obtained from 38 wild red deer (Cervus elaphus at two sites in Ireland and subjected to PCR analysis of the 18S rRNA gene followed by sequencing. Two fragments of the 18S rRNA gene were generated by two different PCR protocols and subsequent sequencing suggested that at least six of the deer were infected by a babesia that, in those loci, is indistinguishable from Babesia divergens, an important tick-borne pathogen of cattle and of zoonotic significance. Additionally, a B. odocoilei-like parasite was detected in three samples and a babesia that did not match any sequences in the GenBank database was found in five samples. Neither B. capreoli nor B. venatorum (EU1 were found. There have been several reports of B. divergens occurring in deer species, including red deer, roe deer (Capreolus capreolus and reindeer (Rangifer tarandus. However, in view of recent re-sequencing of bovine-origin samples deposited previously in GenBank, it is unlikely that any of these sequences from deer are B. divergens. The present study describes the only deer piroplasm detected so far that shows complete identity with B. divergens, in just over half of the 18S rRNA gene. The entire gene of this deer parasite should be analysed and transmission experiments undertaken before the infectivity of B. divergens for red deer can be confirmed.

  20. Sarcocystosis in Cervus elaphus: Comparison of diagnostic methods

    Directory of Open Access Journals (Sweden)

    Mónica Luzón

    2015-12-01

    Full Text Available Red deer (Cervus elaphus from a National Wildlife Reserve near Toledo in central Spain were surveyed for Sarcocystis infection. A total of 61 deer were examined. Tissue compression and histology were used to examine samples from diaphragm and heart from each animal included in the study, and results from the two techniques and the two tissues were compared to determine the tissue and technique that provide the most accurate measure of prevalence and intensity. Prevalence and intensity were then compared between calves, yearlings and adults. Sarcocystis was detected in 59 (97% of the 61 deer. Comparison between tissues showed that (a prevalence based on histology was similar for heart and diaphragm, (b prevalence based on compression was significantly higher for heart than for diaphragm and (c intensity was significantly higher for heart than for diaphragm, regardless of the technique used. Comparison between techniques showed that (a both techniques rendered similar prevalences and intensities of Sarcocystis infection with heart samples and (b both techniques were not comparable with diaphragm samples (compression rendered lower prevalence but higher intensity than histology. Together these data suggest that heart is the preferable tissue for estimating prevalence and intensity, regardless of the technique used. A preliminary species identification of isolated cysts from three animals showed two morph types, corresponding to Sarcocystis cervicanis (syn. S. cf. grueneri; S. wapiti in the heart and diaphragm of three animals and S. hjorti, only in the diaphragm of two animals. Given the different location of those morph types, both heart and diaphragm should be sampled and preferably assessed using histology to most reliably detect infection. Based on histology of heart, prevalence and intensity of Sarcocystis were significantly lower in calves than in yearlings or adults.

  1. Sarcocystosis in wild red deer (Cervus elaphus) in Patagonia, Argentina.

    Science.gov (United States)

    Reissig, Elizabeth Chang; Moré, Gastón; Massone, Adriana; Uzal, Francisco A

    2016-05-01

    Sarcocystis spp. are protozoan parasites with a heteroxenous life cycle, which produce cysts in the muscle of herbivorous animals. In these animal species, sarcocystosis is frequently asymptomatic, although it may occur with high prevalence. Seven Sarcocystis spp. have been described in red deer (Cervus elephus). The aim of this study was to determine the prevalence of sarcocystosis, and to perform the morphological and molecular characterization of Sarcocystis spp. found in wild red deer of the Nahuel Huapi National Park (NHNP), Patagonia, Argentina. Full necropsies of 62 red deer killed by hunters in the NHNP and neighboring areas were performed. Samples of heart and skeletal muscle were examined histologically and selected samples were also examined by transmission electron microscopy (TEM), PCR and sequencing. Sarcocystis spp. thin walled cysts were detected in 62 % (38/62) of heart, and in 22 % (3/14) of skeletal muscle samples examined histologically. TEM revealed a smooth and thin cyst wall (≤1 μm), with scarce and separated ribbon-like protrusions. A total of three partial and one full 18S ribosomal RNA (rRNA) gene sequences were obtained, and showed the highest identity (≥99 %) with Sarcocystis taeniata, a species described in moose (Alces alces). The morphological and molecular results indicate that red deer in Argentina are frequently infected with S. taeniata, a species for which the definitive host is unknown. The present results also confirm that Sarcocystis spp. using cervids as intermediate host are not host-specific. Further studies are needed to improve the epidemiological knowledge of Sarcocystosis in red deer. PMID:26779923

  2. Sarcocystosis in Cervus elaphus: Comparison of diagnostic methods.

    Science.gov (United States)

    Luzón, Mónica; Domínguez-González, Julia; Soto-Carrión, Ana María; Alunda, José María; Fuente, Concepción de la

    2015-12-01

    Red deer (Cervus elaphus) from a National Wildlife Reserve near Toledo in central Spain were surveyed for Sarcocystis infection. A total of 61 deer were examined. Tissue compression and histology were used to examine samples from diaphragm and heart from each animal included in the study, and results from the two techniques and the two tissues were compared to determine the tissue and technique that provide the most accurate measure of prevalence and intensity. Prevalence and intensity were then compared between calves, yearlings and adults. Sarcocystis was detected in 59 (97%) of the 61 deer. Comparison between tissues showed that (a) prevalence based on histology was similar for heart and diaphragm, (b) prevalence based on compression was significantly higher for heart than for diaphragm and (c) intensity was significantly higher for heart than for diaphragm, regardless of the technique used. Comparison between techniques showed that (a) both techniques rendered similar prevalences and intensities of Sarcocystis infection with heart samples and (b) both techniques were not comparable with diaphragm samples (compression rendered lower prevalence but higher intensity than histology). Together these data suggest that heart is the preferable tissue for estimating prevalence and intensity, regardless of the technique used. A preliminary species identification of isolated cysts from three animals showed two morph types, corresponding to Sarcocystis cervicanis (syn. S. cf. grueneri; S. wapiti) in the heart and diaphragm of three animals and S. hjorti, only in the diaphragm of two animals. Given the different location of those morph types, both heart and diaphragm should be sampled and preferably assessed using histology to most reliably detect infection. Based on histology of heart, prevalence and intensity of Sarcocystis were significantly lower in calves than in yearlings or adults. PMID:26767167

  3. Effect of lunar phase on summer activity budgets of Rocky Mountain elk (Cervus elaphus nelsonii)

    Science.gov (United States)

    Rocky Mountain elk (Cervus elaphus) exist in a complex biological and social environment that is marked by necessary diurnal activities such as foraging, ruminating, and resting. It has long been understood that elk demonstrate circadian rhythms. One of the most predictable variables that could af...

  4. Effect of lunar phase on diurnal activity of Rocky Mountain Elk (Cervus Elaphus Nelsonii)

    Science.gov (United States)

    Rocky Mountain elk (Cervus elaphus nelsonii) are important components in many ecosystems across the western US and are integral with both Native American and contemporary western culture. They are prized by hunters and are the object of countless works of art. These magnificent creatures are studi...

  5. Sedici anni di censimenti del cervo sardo (Cervus elaphus corsicanus) nella riserva naturale WWF di Monte Arcosu

    OpenAIRE

    Murgia, Carlo; Murgia, Andrea; Deiana, Anna Maria

    2005-01-01

    This paper describes data collected about consistence, density and social structure of Sardinian deer (Cervus elaphus corsicanus Erxleben, 1777) subspecies of European deer (Cervus elaphus Linnaeus, 1758) from 1989 to 2004. The study area is located in the WWF Faunal Park of Monte Arcosu (south-western of Sardinia). The flora of the Reserve is typical Mediterranean vegetation. The data have been collected with two different methods, using both roaring census and direct observations. Results s...

  6. Colorado Library Program Assessment

    Science.gov (United States)

    Russell, Becky

    2012-01-01

    Colorado school librarians are in the midst of a crisis. According to a 2009-2010 survey of public schools in Colorado, just 23% of elementary schools have an endorsed librarian, while 37% of middle schools and 32% of high schools report having an endorsed librarian. This report also shows how these percentages have dropped in just a two-year…

  7. Kajian kualitas daging rusa sambar (cervus unicolor) buru dan dipeliharaan secara intensif

    OpenAIRE

    Sihombing, Juli Mutiara

    2012-01-01

    JULI MUTIARA SIHOMBING: The Meat Quality Sambar Deer (Cervus unicolor) Hunting and Intensive maintained deer, guided by RISTIKA HANDARINI and HERLA RUSMARILIN. Information about sambar meat quality is still lacking, especially the comparison between Sambar deer hunting and intensively maintained. The purpose of this study to examine differences in the quality of game and deer venison reared intensively given feed with crude protein 16%. The research was conducted in deer captivity at Univ...

  8. Seasonal habitat selection of the red deer (Cervus elaphus alxaicus) in the Helan Mountains, China

    OpenAIRE

    Mingming Zhang; Zhensheng Liu; Liwei Teng

    2013-01-01

    We studied the seasonal habitat selection of the red deer, Cervus elaphus alxaicus Bobrinskii & Flerov, 1935, in the Helan Mountains, China, from December 2007 to December 2008. Habitat selection varied widely by season. Seasonal movements between high and low elevations were attributed to changes in forage availability, alpine topography, the arid climate of the Helan Mountains, and potential competition with blue sheep, Pseudois nayaur (Hodgson, 1833). The use of vegetation types varied sea...

  9. Detection of Rickettsia helvetica DNA from peripheral blood of Sika deer (Cervus nippon yesoensis) in Japan.

    Science.gov (United States)

    Inokuma, Hisashi; Seino, Nobutaka; Suzuki, Masatsugu; Kaji, Koichi; Takahashi, Hiroshi; Igota, Hiromasa; Inoue, Satoshi

    2008-01-01

    Partial nucleotide sequences of the citrate synthase and 17-kDa genes of Rickettsia helvetica were detected from peripheral blood samples of Sika deer (Cervus nippon yesoensis) in Hokkaido, Japan. Results suggest the presence of a rickettsiemia associated with R. helvetica. This is the first evidence of R. helvetica infection in Sika deer and indicates that this species may represent a potential reservoir host of R. helvetica in Japan. PMID:18263833

  10. Differential Immune Responses of Red Deer (Cervus elaphus) following Experimental Challenge with Mycobacterium avium subsp. paratuberculosis▿

    OpenAIRE

    Robinson, Mark; O'Brien, Rory; Mackintosh, Colin; Griffin, Frank

    2008-01-01

    Immune responses of red deer (Cervus elaphus) that presented with different levels of paucibacillary pathology were profiled to detail immune changes during the progression of Johne's disease. Immune responses were monitored using an immunoglobulin G1 (IgG1) antibody enzyme-linked immunosorbent assay (ELISA), a gamma interferon (IFN-γ) ELISA, and flow cytometry. Animals in the study were divided into outcome groups postmortem according to disease severity. All animals mounted IgG1 antibody an...

  11. Hybridisation between red deer (Cervus elaphus) and Japanese sika (C. nippon) on the Kintyre Peninsula, Scotland

    OpenAIRE

    Senn, Helen V.

    2009-01-01

    Hybridisation between introduced and endemic species causes conservation concerns, but also provides us with an opportunity to study the dynamics of gene flow between two species as they first meet. Japanese sika deer (Cervus nippon) were introduced to the British Isles at a number of locations at the beginning of the 20th century. In the intervening time, sika have spread and their range now extends across approximately 40% of Scotland, where they overlap with that of native red ...

  12. Určování domovského okrsku siky (Cervus nippon)

    OpenAIRE

    Janda, Jakub

    2012-01-01

    This Bachelor thesis deals with available methods of research leads to monitoring of sika deer (Cervus nippon nippon) home range, with preference for telelmetric research. The knowledges that are key for better understanding and approach to the sika deer behavior and life strategy – species that population is rising to the essential quantity. Quantity that is vital not only for management of this species but also for his influence to the forestry – harms on forest vegetation. In this th...

  13. Telemetrické sledování siky (Cervus nippon)

    OpenAIRE

    Dvořák, Stanislav

    2011-01-01

    In my thesis, I focused on the research of the spatial orientation of sika deer (Cervus nippon nippon) in Hradiste hunting using GPS devices. Research has been and still is carried on the forest Lomnica forest area. The first part is devoted to the description, morphology, biology, habitat and expansion of the sika deer, describe a device that is used to monitor and narcotization. The second part focuses on the experience I gained and assessed by telemetric monitoring and observation of this ...

  14. Haematological values of rusa deer (Cervus timorensis russa) in New Caledonia.

    Science.gov (United States)

    Audigé, L

    1992-11-01

    Blood samples were collected from 91 rusa deer (Cervus timorensis russa), immediately after being shot, to define their mean haematological values (red cell count, white cell count, differential leucocyte count, packed cell volume, haemoglobin concentration, mean cell volume, mean cell haemoglobin, and mean cell haemoglobin concentration). Male deer had a significantly higher red cell count and haemoglobin concentration, and a lower mean cell volume and mean cell haemoglobin content, than did female deer. PMID:1288471

  15. PENDUGAAN DAYA TAMPUNG RUSA LIAR (Cervus timorensis) DI PADANG RUMPUT MAR TAMAN NASIONAL WASUR MERAUKE

    OpenAIRE

    Bambang Tjahyono Hariadi; Thimotius Sraun

    2014-01-01

    The objective of this experiment was to know carrying capacity of rusa deer (Cervus timorensisi) at Mar, Wasur National Park Merauke district. The data collected were spesies of grasses, production each species and carrying capacity. The results showed species of grasses were Cynadon dactylon, Imperata cylindrica and Phragmites karka. Mar was dominated by Cynadon dactylon. The production of Cynodon dactylon was 2.183 kg/ha. The carryng capacity of rusa deer was 0.5 ha/head/year.

  16. Census Snapshot: Colorado

    OpenAIRE

    Romero, Adam P; Rosky, Clifford J; Badgett, M. V. Lee; Gates, Gary J.

    2008-01-01

    Using data from the U.S. Census Bureau, this report provides demographic and economic information about same-sex couples and same-sex couples raising children in Colorado. We compare same-sex “unmarried partners,” which the Census Bureau defines as an unmarried couple who “shares living quarters and has a close personal relationship,” to different-sex married couples in Colorado. In many ways, the almost 16,000 same-sex couples living in Colorado are similar to married couples. According t...

  17. Late Quaternary distribution dynamics and phylogeography of the red deer ( Cervus elaphus) in Europe

    Science.gov (United States)

    Sommer, R. S.; Zachos, F. E.; Street, M.; Jöris, O.; Skog, A.; Benecke, N.

    2008-04-01

    Here we present spatial-temporal patterns for European late Quaternary red deer (Cervus elaphus), based on radiocarbon-supported evidence derived mainly from archaeological sites. This is followed by an overview of the recent phylogeography of this species using haplogroup studies of recent molecular data. The implications of the synthesis of palaeontological and genetic data are discussed and we propose that present day European red deer haplogroup distributions are best explained against the history of late Quaternary population contractions into and expansions from glacial refugia. Around 800 records of Cervus elaphus were assigned to the period covering the later part of the Last Glacial and the Early to Middle Holocene. Red deer becomes increasingly visible in faunal assemblages dated to late OIS-3 (<40.0 ka 14C BP). The species persisted throughout the LGM on the Iberian Peninsula, in adjacent regions of South-Western France (Gascony, Dordogne, Languedoc), on the Italian Peninsula, in the Balkans and Greece, and east of the Carpathians in Moldavia. We suggest that genetic exchange between the populations of the Balkans and the East of the Carpathians remained uninterrupted during the LGM. The expansion of red deer from its southern refugia into Central and Northern Europe begins rapidly at 12,500 14C BP. The expansion of red deer coincides with the sudden rise in temperature at the onset of Greenland Interstadial 1e and the dispersion of open birch woodland into the northern half of Europe. Radiocarbon supported records show a more or less universal distribution of Cervus elaphus across Europe following the Pleistocene/Holocene climatic change at 10.0 ka 14C BP for the first time. Molecular data and fossil record combined provide a clearer temporal and spatial pattern for the Lateglacial recolonisation process of the northern part of Europe.

  18. Parelaphostrongylus tenuis-associated meningoencephalitis in a sika deer (Cervus nippon).

    Science.gov (United States)

    Gerhold, Richard W; Keel, M Kevin; Arnold, Kim; Hotton, Doug; Beckstead, Robert B

    2010-01-01

    An adult, female, free-ranging, sika deer (Cervus nippon yakushimae) from Wicomico County, Maryland, USA, was found circling and having no fear of humans. The animal was euthanized and submitted for a postmortem exam. There were no gross lesions and the deer was negative for rabies. Microscopic examination revealed lymphoplasmacytic, neutrophilic, and eosinophilic meningoencephalitis with intralesional adult nematodes, larvae, and eggs consistent with nematodes in the family Protostrongylidae. Parelaphostrongylus tenuis was identified by polymerase chain reaction and DNA sequencing. To our knowledge, this is the first report of P. tenuis-associated encephalitis in a sika deer. PMID:20090046

  19. Surveillance of chronic wasting disease in sika deer, Cervus nippon, from Tokachi district in Hokkaido.

    Science.gov (United States)

    Kataoka, Natsumi; Nishimura, Masakazu; Horiuchi, Motohiro; Ishiguro, Naotaka

    2005-03-01

    Surveillance of chronic wasting disease (CWD) was conducted by performing Western blot analysis of tissue samples from 136 sika deer (Cervus nippon) killed by hunters in the Tokachi district of Hokkaido Island. No prion protein (PrPSc) associated with CWD was detected in any of the samples. To assess amino acid polymorphisms of the sika deer PrP gene, nucleotide sequencing of the PrP gene was performed. The only amino acid polymorphisms detected were 3 silent mutations at nucleotide positions 63, 225 and 408. These results suggest that sika deer in the Tokachi district are genetically homogeneous, and are not infected with CWD. PMID:15805745

  20. Complete mitochondrial genome sequence of northeastern sika deer (Cervus nippon hortulorum).

    Science.gov (United States)

    Shao, Yuanchen; Zha, Daiming; Xing, Xiumei; Su, Weilin; Liu, Huamiao; Zhang, Ranran

    2016-01-01

    The complete mitochondrial genome of the northeastern sika deer, Cervus nippon hortulorum, was determined by accurate polymerase chain reaction. The entire genome is 16,434 bp in length and contains 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region, all of which are arranged in a typical vertebrate manner. The overall base composition of the northeastern sika deer's mitochondrial genome is 33.3% of A, 24.5% of C, 28.7% of T and 13.5% of G. A termination associated sequence and several conserved central sequence block domains were discovered within the control region. PMID:24660928

  1. Complete mitochondrial genome sequence of tarim red deer (Cervus elaphus yarkandensis).

    Science.gov (United States)

    Shao, Yuanchen; Xing, Xiumei; Zha, Daiming; Yang, Fuhe

    2016-01-01

    The complete mitochondrial genome of the tarim red deer, Cervus elaphus yarkandensis, was determined by accurate polymerase chain reaction. The entire genome was 16,351 bp in length and contained 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region, all of which were arranged in a typical vertebrate manner. The overall base composition of the northeast sika deer's mitochondrial genome was 33.3% of A, 24.4% of C, 28.9% of T and 13.4% of G. A termination-associated sequence and several conserved central sequence block domains were discovered within the control region. PMID:24438284

  2. Isolation and characterization of Babesia pecorum sp. nov. from farmed red deer (Cervus elaphus)

    OpenAIRE

    Jouglin, Maggy; Fernández-de-Mera, Isabel G.; de la Cotte, Nathalie; Ruiz-Fons, Francisco; Gortázar, Christian; Moreau, Emmanuelle; Bastian, Suzanne; de la Fuente, José; Malandrin, Laurence

    2014-01-01

    The diversity of Babesia species infecting cervids in parts of central and southern Spain was analyzed by collecting blood from farmed red deer (Cervus elaphus). Babesia sp. was isolated in vitro from two red deer herds in Cádiz and Ciudad Real. The number of Babesia sp. carriers differed between the two herds: 36/77 in Cádiz and 1/35 in Ciudad Real. Hyalomma lusitanicum was the most prevalent tick species identified on the Cádiz farm vegetation and on sampled animals, and is therefore a cand...

  3. PENDUGAAN DAYA TAMPUNG RUSA LIAR (Cervus timorensis DI PADANG RUMPUT MAR TAMAN NASIONAL WASUR MERAUKE

    Directory of Open Access Journals (Sweden)

    Bambang Tjahyono Hariadi

    2014-06-01

    Full Text Available The objective of this experiment was to know carrying capacity of rusa deer (Cervus timorensisi at Mar, Wasur National Park Merauke district. The data collected were spesies of grasses, production each species and carrying capacity. The results showed species of grasses were Cynadon dactylon, Imperata cylindrica and Phragmites karka. Mar was dominated by Cynadon dactylon. The production of Cynodon dactylon was 2.183 kg/ha. The carryng capacity of rusa deer was 0.5 ha/head/year.

  4. Adrenal response to ACTH stimulation in Rusa deer (Cervus rusa timorensis).

    Science.gov (United States)

    van Mourik, S; Stelmasiak, T

    1984-01-01

    Resting cortisol values in immobilized mature Rusa stags (Cervus rusa timorensis) and the response to synthetic ACTH were investigated. The mean level of cortisol in mature Rusa stags was found to be 3.80 ng/ml (SD = 0.87, N = 18). Over the range 0.37-6.0 i.u. the adrenal response to ACTH challenge was linearly related to the log dose ACTH administered (r = 0.998). More than 6 i.u. of ACTH caused maximal stimulation of the adrenal gland. Rusa deer appear to be much more sensitive to ACTH administration than other species. PMID:6150796

  5. Case 3018. Cervus gouazoubira Fischer, 1814 (currently Mazama gouazoubira; Mammalia, Artiodactyla): proposed conservation as the correct original spelling

    Science.gov (United States)

    Gardner, A.L.

    1999-01-01

    The purpose of this application is to conserve the spelling of the specific name of Cervus gouazoubira Fischer, 1814 for the brown brocket deer of South America (family Cervidae). This spelling, rather than the original gouazoubira, has been in virtually universal usage for almost 50 years.

  6. Seasonal habitat selection of the red deer (Cervus elaphus alxaicus in the Helan Mountains, China

    Directory of Open Access Journals (Sweden)

    Mingming Zhang

    2013-02-01

    Full Text Available We studied the seasonal habitat selection of the red deer, Cervus elaphus alxaicus Bobrinskii & Flerov, 1935, in the Helan Mountains, China, from December 2007 to December 2008. Habitat selection varied widely by season. Seasonal movements between high and low elevations were attributed to changes in forage availability, alpine topography, the arid climate of the Helan Mountains, and potential competition with blue sheep, Pseudois nayaur (Hodgson, 1833. The use of vegetation types varied seasonally according to food availability and ambient temperature. Red deer used montane coniferous forest and alpine shrub and meadow zones distributed above 2,000 m and 3,000 m in summer, alpine shrub and meadows above 3,000 m in autumn, being restricted to lower elevation habitats in spring and winter. The winter habitat of C. elaphus alxaicus was dominated by Ulmus glaucescens Franch. and Juglans regia Linnaeus, deciduous trees, and differed from the habitats selected by other subspecies of red deer. Cervus elaphus alxaicus preferred habitats with abundant vegetation coverage to open habitats in winter, but the reverse pattern was observed in summer and autumn. Red deer preferred gentle slopes (<10° but the use of slope gradient categories varied seasonally. Red deer avoidance of human disturbance in the Helan Mountains varied significantly by season. Information on red deer habitat selection can help understand the factors affecting seasonal movements and also support decision making in the management and conservation of red deer and their habitats.

  7. Prevalence and genetic diversity of Bartonella species in sika deer (Cervus nippon) in Japan.

    Science.gov (United States)

    Sato, Shingo; Kabeya, Hidenori; Yamazaki, Mari; Takeno, Shinako; Suzuki, Kazuo; Kobayashi, Shinichi; Souma, Kousaku; Masuko, Takayoshi; Chomel, Bruno B; Maruyama, Soichi

    2012-12-01

    We report the first description of Bartonella prevalence and genetic diversity in 64 Honshu sika deer (Cervus nippon centralis) and 18 Yezo sika deer (Cervus nippon yesoensis) in Japan. Overall, Bartonella bacteremia prevalence was 41.5% (34/82). The prevalence in wild deer parasitized with ticks and deer keds was 61.8% (34/55), whereas no isolates were detected in captive deer (0/27) free of ectoparasites. The isolates belonged to 11 genogroups based on a combination of the gltA and rpoB gene sequences. Phylogenetic analysis of concatenated sequences of the ftsZ, gltA, ribC, and rpoB genes of 11 representative isolates showed that Japanese sika deer harbor three Bartonella species, including B. capreoli and two novel Bartonella species. All Yezo deer's isolates were identical to B. capreoli B28980 strain isolated from an elk in the USA, based on the sequences of the ftsZ, gltA, and rpoB genes. In contrast, the isolates from Honshu deer showed a higher genetic diversity. PMID:22832020

  8. Asbestos in Colorado Schools.

    Science.gov (United States)

    Baldwin, Cynthia A.

    This study determined, by means of a random sample, how many of Colorado's public schools have asbestos materials and estimated the potential risk of exposure presented by these materials. Forty-one schools were surveyed. Bulk samples of possible asbestos materials were collected and analyzed using the K-squared Asbestos Screening Test to…

  9. Molecular diversity of rumen bacterial communities from tannin-rich and fiber-rich forage fed domestic Sika deer (Cervus nippon) in China

    OpenAIRE

    Li, Zhi Peng; Liu, Han Lu; Li, Guang Yu; Bao, Kun; Wang, Kai Ying; Xu, Chao; Yang, Yi Feng; Yang, Fu He; Wright, André-Denis G.

    2013-01-01

    Background Sika deer (Cervus nippon) have different dietary preferences to other ruminants and are tolerant to tannin-rich plants. Because the rumen bacteria in domestic Sika deer have not been comprehensively studied, it is important to investigate its rumen bacterial population in order to understand its gut health and to improve the productivity of domestic Sika deer. Results The rumen bacterial diversity in domestic Sika deer (Cervus nippon) fed oak leaves- (OL group) and corn stalks-base...

  10. Colorado Geothermal Commercialization Program

    Energy Technology Data Exchange (ETDEWEB)

    Healy, F.C.

    1980-04-01

    Chaffee County, located in central Colorado, has immense potential for geothermal development. This report has been prepared to assist residents and developers in and outside the area to develop the hydrothermal resources of the county. Data has been collected and interpreted from numerous sources in order to introduce a general description of the area, estimate energy requirements, describe the resources and postulate a development plan. Electric power generation and direct heat application potential for the region are described.

  11. Diets of Hangul Deer Cervus elaphus hanglu (Cetartiodactyla: Cervidae in Dachigam National Park, Kashmir, India

    Directory of Open Access Journals (Sweden)

    G.M. Shah

    2009-07-01

    Full Text Available Seasonal variations in the diets of Hangul Deer Cervus elaphus hanglu in Dachigam National Park (DNP were determined by analyzing 95 freshly collected pellet samples. The pellets were collected along well defined transects during a two year study from January 2005 to December 2006. The diets showed marked seasonal variations. The spring diet was constituted by forbs (45.2%, shrubs (24%, grasses (20% and climbers (10.7%. In summer forbs accounted for 42.7% of the diet, trees 38%, grasses 14.3% and shrubs 4.8%. Except the lone representation of forb species (5.6% the autumn diet was mainly represented by shrubs (75% and trees (19.4%. The winter diet was constituted by trees (35.6%, shrubs (28.6%, forbs (21.3%, grasses (8.6% and climbers (5.8%.

  12. Nutritional evaluation of the lipid fraction of Iberian red deer (Cervus elaphus hispanicus) tenderloin.

    Science.gov (United States)

    Quaresma, M A G; Trigo-Rodrigues, I; Alves, S P; Martins, S I V; Barreto, A S; Bessa, R J B

    2012-12-01

    The meat lipid fraction of psoas major muscle from 20 adult (10 males and 10 females) feral Iberian red deer (Cervus elaphus hispanicus) was characterized by quantification of total fat, total cholesterol, vitamin E and fatty acid (FA) composition, including detailed trans octadecenoate isomers and conjugated linoleic acid (CLA) isomeric profile. The total lipid content revealed a very lean meat (0.99 g/100g of meat), with total cholesterol content averaging 55.6 mg/100g of muscle. The FA profile displayed a very high PUFA level for ruminant meat (30.2g/100g FA). The 18:2 cis-9,trans-11 content was fairly low (0.26% of total FA) compared with other ruminant meats. The comparison of stags and hinds showed more similarities than differences. Nevertheless, hinds displayed superior contents of α-tocopherol and trans MUFA and a better n-6/n-3 ratio than stags. PMID:22695295

  13. The complete mitochondrial genome of sika deer Cervus nippon (Cetartiodactyla: Cervinae) South Anhui population.

    Science.gov (United States)

    Pan, Hong-Chun; Fang, Hong-Yan; Jin, Can; Liu, Lei

    2014-04-01

    The complete mitochondrial genome of sika deer (Cervus nippon) South Anhui population is a circular molecule of 16,429 bp in length, containing 13 protein-coding genes, 2 ribosomal RNAs, 22 transfer RNAs and a control region. The A + T content of the overall base composition of H-strand is 62% (T: 28.7%; C: 24.6%; A: 33.3%; G: 13.4%). ND2, ND3 and ND5 genes begin with ATA as start codon, ND4L gene begins with GTG as start codon, while other nine protein-coding genes start with a typical ATG initiation codon. ND1, COI, COII, ATP8, ATP6, ND4L, ND5 and ND6 genes are terminated with TAA as stop codon, ND2 ends with TAG, COIII, ND3 and ND4 ends with T, Cyt b ends with AGA. PMID:23570529

  14. Complete mitochondrial genome of Cervus elaphus songaricus (Cetartiodactyla: Cervinae) and a phylogenetic analysis with related species.

    Science.gov (United States)

    Li, Yiqing; Ba, Hengxing; Yang, Fuhe

    2016-01-01

    Complete mitochondrial genome of Tianshan wapiti, Cervus elaphus songaricus, is 16,419 bp in length and contains 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region. The phylogenetic trees were reconstructed with the concatenated nucleotide sequences of the 13 protein-coding genes using maximum parsimony (MP) and Bayesian inference (BI) methods. MP and BI phylogenetic trees here showed an identical tree topology. The monopoly of red deer, wapiti and sika deer was well supported, and wapiti was found to share a closer relationship with sika deer. Tianshan wapiti shared a closer relationship with xanthopygus than yarkandensis. Rusa unicolor and Rucervus eldi were given a basal phylogenetic position. Our phylogenetic analysis provided a robust phylogenetic resolution spanning the entire evolutionary relationship of the subfamily Cervinae. PMID:24725059

  15. Two potentially zoonotic parasites infecting Philippine brown deer (Cervus mariannus desmarest, 1822 in Leyte Island

    Directory of Open Access Journals (Sweden)

    Harvie Potot Portugaliza

    2015-12-01

    Full Text Available This case report describes the necropsy findings of two potentially zoonotic parasites infecting the Philippine brown deer (Cervus mariannus in Leyte Island, Philippines. A female deer aging approximately 5-year was presented for necropsy to the Diagnostic Laboratory at the College of Veterinary Medicine, Visayas State University. Gross pathology was recorded and the selected organs having lesion were collected for histopathological studies. Results showed severe necrotizing lesions in the nasal and palatal areas, infestation of calliphorid maggots, hepatic fibrosis, cholangitis, cholecystitis, lung atelectasis and duodenitis. Heavy ruminal fluke infection was also observed. Two potentially zoonotic parasites namely Fasciola gigantica and Sarcocystis spp. were identified. The Philippine brown deer appears to have a role in transmission and amplification of zoonotic parasites, and can also be threatened by diseases caused by the parasites.

  16. Malignant catarrhal fever in farmed Rusa deer (Cervus timorensis). 2. Animal transmission and virological studies.

    Science.gov (United States)

    Westbury, H A; Denholm, L J

    1982-03-01

    A disease with clinical signs and histological lesions similar to malignant catarrhal fever in cattle was transmitted from Rusa deer (Cervus timorensis) to rabbits. This was accomplished on 3 separate occasions, and the disease was serially passaged in rabbits up to 11 times. The clinical signs in affected rabbits were pyrexia, depression, anorexia, mucopurulent conjunctivitis, nasal discharge and diarrhoea. These signs were seen in 27 of 38 inoculated rabbits with the mean incubation period being 12 days (range 8 to 20 days). Histologically, affected rabbits exhibited mononuclear perivascular cuffing and vasculitis in the brain, heart, liver and kidney. Lymph nodes and spleen showed destruction and loss of mature lymphocytes and lymphoid follicles and an increased number of large lymphoblastoid cells. These clinical signs and lesions were not detected in control rabbits. The disease was not transmitted to cattle, sheep, guinea pigs or mice, nor was an agent isolated in cattle, deer or rabbit tissue cultures, or in chicken embryos. PMID:7115234

  17. Serum biochemical values of rusa deer (Cervus timorensis russa) in New Caledonia.

    Science.gov (United States)

    Audigé, L

    1992-11-01

    Blood samples were collected from 91 rusa deer (Cervus timorensis russa), immediately after being shot. Serum mean biochemical values from shot deer are presented for blood urea nitrogen, creatinine, creatine kinase, alanine aminotransferase, aspartate aminotransferase, alkaline phosphatase, total bilirubin, total protein, albumin, calcium, and phosphorus. Mean total protein and albumin increased with age. There was an age-associated increase of gamma globulins. Mean creatine kinase activity and creatinine, albumin and phosphorus concentrations were higher in stags than in hinds. Pregnant hinds had lower mean creatine kinase activity and phosphorus and higher mean alanine aminotransferase and total protein than non-pregnant hinds. Mean calcium concentration increased when deer were agitated before bleeding. PMID:1288472

  18. An outbreak of malignant catarrhal fever in young rusa deer (Cervus timorensis).

    Science.gov (United States)

    Tomkins, N W; Jonsson, N N; Young, M P; Gordon, A N; McColl, K A

    1997-10-01

    On the basis of clinical signs and histological findings eight 9-month-old male rusa deer (Cervus timorensis) were diagnosed with sheep associated-malignant catarrhal fever. Following a variable course involving rectal temperatures around 40.5 degrees C, depression, inappetence, diarrhoea, corneal opacity and hypopyon all animals died or were euthanased over a 5-week period. Severe multifocal vasculitis, mainly periglomerular and in the arcuate vessels were consistent histological findings which in the past have been adequate to confirm clinical diagnosis of sheep associated-malignant catarrhal fever. A nested polymerase chain reaction test has been used to detect a sheep associated-malignant catarrhal fever PRC product, 238 base-pairs in size, in DNA extracted from lymphocyte preparations. The result supported the diagnosis of sheep associated-malignant catarrhal fever in these deer. PMID:9406629

  19. Authenticity control of game meat products--a single method to detect and quantify adulteration of fallow deer (Dama dama), red deer (Cervus elaphus) and sika deer (Cervus nippon) by real-time PCR.

    Science.gov (United States)

    Druml, Barbara; Grandits, Stephanie; Mayer, Walter; Hochegger, Rupert; Cichna-Markl, Margit

    2015-03-01

    This contribution presents a single real-time PCR assay allowing the determination of the deer content (the sum of fallow deer (Dama dama), red deer (Cervus elaphus) and sika deer (Cervus nippon)) in meat products to detect food adulteration. The PCR assay does not show cross-reactivity with 20 animal species and 43 botanical species potentially contained in game meat products. The limit of quantification is 0.5% for fallow deer and red deer and 0.1% for sika deer. The deer content in meat products is determined by relating the concentration obtained with the deer PCR assay to that obtained with a reference system which amplifies mammals and poultry DNA. The analysis of binary meat mixtures with pork, a meat mixture containing equal amounts of fallow deer, red deer and sika deer in pork and a model game sausage showed that the quantification approach is very accurate (systematic error generally <25%). PMID:25306377

  20. Observations on the eruption of the permanent incisor teeth of farmed Javan rusa deer (Cervus timorensis russa) in New Caledonia.

    Science.gov (United States)

    Bianchi, M; Hurlin, J C; Lebel, S; Chardonnet, P

    1997-08-01

    The eruption of the permanent incisor teeth of 14 farmed Javan rusa deer (Cervus timorensis russa) of known birth date and their live weights were observed about every 2 weeks from 12 to 30 months of age. The permanent incisor pattern was 11, 14-17 months; 12, 18-23 months; 13, 20-26 months; and 14, 22-27 months. There was no significant relationship between body weight and timing of permanent incisor eruption. PMID:16031978

  1. Spatial Ecology and Population Dynamics of Tule Elk (Cervus elaphus nannodes) at Point Reyes National Seashore, California

    OpenAIRE

    Cobb, McCrea Andrew

    2010-01-01

    The tule elk (Cervus elaphus nannodes) was reintroduced to Point Reyes National Seashore, California in 1978. After exhibiting irruptive growth for 20 years, elk abundances have fluctuated. Three subpopulations of elk currently inhabit Pt. Reyes: a fenced subpopulation at high density; a free-ranging subpopulation in designated wilderness at low density; and a free-ranging subpopulation on active ranchland at low density. Little is known about the spatial ecology and population dynamics of...

  2. Colorado State Capitol Geothermal project

    Energy Technology Data Exchange (ETDEWEB)

    Shepherd, Lance [Colorado Department of Personnel and Adminstration, Denver, CO (United States)

    2016-04-29

    Colorado State Capitol Geothermal Project - Final report is redacted due to space constraints. This project was an innovative large-scale ground-source heat pump (GSHP) project at the Colorado State Capitol in Denver, Colorado. The project employed two large wells on the property. One for pulling water from the aquifer, and another for returning the water to the aquifer, after performing the heat exchange. The two wells can work in either direction. Heat extracted/added to the water via a heat exchanger is used to perform space conditioning in the building.

  3. Colorado wetlands initiative : 1997-2000 : Protecting Colorado's wetlands resource

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Colorado Wetlands Initiative is an endeavor to protect wetlands and wetland-dependent wildlife through the use of voluntary, incentive-based mechanisms. It is a...

  4. Haematological and serum biochemical reference values in free-ranging red deer (Cervus elaphus atlanticus

    Directory of Open Access Journals (Sweden)

    Olav Rosef

    2004-04-01

    Full Text Available Analyses of haematological and biochemical constituents were carried out on the Norwegian subspecies of free-ranging red deer (Cervus elaphus atlanticus. All animals were captured from January to March by using a mixture of xylazine and tiletamin-zolazepam. Immobilisation was performed with plastic projectile syringes fired from a dart gun. Fourteen haematological parameters were analysed. There were no differences in the values between hinds and stags and between adults and calves (P > 0.01. Of the 22 biochemical compounds investigated there was a significant difference (P < 0.01 between calves and adults for lactate dehydrogenase (LD, globulin, beta globulin, gamma globulin, and the minerals Na, K, Mg, Zn, Ca, and P. Differences (P < 0.01 between hinds and stags were found in cholesterol, gamma glutamyl transferase (GGT, alpha-1 globulin, alpha-2 globulin and Cu. The blood values determined in this study can be used as reference values for this red deer subspecies immobilised with a mixture of xylazine-tiletamin-zolazepam for health control and diagnosis of diseases.Abstract in Norwegian /Sammendrag:Hematologiske og biokjemiske parametere er analysert på norsk frittlevende hjort (Cervus elaphus atlanticus. Hjorten ble immobilisert i tidsrommet januar til mars ved hjelp av et spesialgevær ladet med plast kanyler som inneholdt en blanding av xylazin og tiletamin-zolazepam. Det var ingen forskjeller i de14 undersøkte hematologiske verdiene mellom hinder, kalver og bukker (P>0,01. Av de 22 biokjemiske parametrene som ble undersøkt var det en signifikant forskjell mellom kalver og voksne (P<0,01 når det gjelder laktat dehydrogenase, globulin, beta globulin, gamma globulin og mineralene Na, K, Mg, Zn, Ca og P. Det var en signifikant forskjell mellom hinder og bukker (P<0.01 på parametrene kolesterol, gamma glutamyl transferase, alfa-1 globulin, alfa-2 globulin og Cu. Blodverdiene som ble målt i dette studiet kan bli brukt som referanseverdier

  5. Colorados asutati rohelise ehituse toetusprogramm

    Index Scriptorium Estoniae

    2002-01-01

    USA Colorado osariigi rohelised arhitektid ja projekteerijad asutasid koos ehitusfirmadega programmi "Ehita rohelist Coloradot", mille raames pakutakse rohelise maja või korteri ehitamise väljaõpet

  6. Prevalence of Dermatophytes in Red Deer (Cervus elaphus in The Stelvio National Park, Italy

    Directory of Open Access Journals (Sweden)

    Roberta Perego

    2015-10-01

    Full Text Available Dermatophytosis has been described in wildlife, but the literature reporting dermatophyte prevalence in deer is incomplete. To determine the prevalence of dermatophytes and to evaluate the hypothetical role of asymptomatic carriers hair samples were collected from 30 legally hunted wild red deer (Cervus elaphus in the Stelvio National Park, Italy. All deer were visually examined for dermatologic lesions and the coat was brushed using a modified Mackenzie collection method. A small sample of hair was used for direct microscopical examination and subsequently fungal culture was performed on the hair samples. Macroscopic and microscopic examinations were used to identify dermatophytes, saprophytic fungi and yeasts. None of the deer had visible cutaneous lesions. No dermatophyte spores or hyphae were found on direct microscopical examination and, when hair samples were cultured, dermatophytes were not demonstrated in any sample. Only saprophytic fungi were grown, predominantly Alternaria spp., Mucor spp., Cladosporium spp. These results did not reveal the presence of asymptomatic carriers of dermatophytes in the deer sample population of Stelvio National Park and suggest that it is unlikely that, at least in the investigated geographical area, the red deer act a reservoir for transmission of dermatophytes to other wild animals, livestock or people living locally

  7. Do red deer stags (Cervus elaphus use roar fundamental frequency (F0 to assess rivals?

    Directory of Open Access Journals (Sweden)

    Maxime Garcia

    Full Text Available It is well established that in humans, male voices are disproportionately lower pitched than female voices, and recent studies suggest that this dimorphism in fundamental frequency (F0 results from both intrasexual (male competition and intersexual (female mate choice selection for lower pitched voices in men. However, comparative investigations indicate that sexual dimorphism in F0 is not universal in terrestrial mammals. In the highly polygynous and sexually dimorphic Scottish red deer Cervus elaphus scoticus, more successful males give sexually-selected calls (roars with higher minimum F0s, suggesting that high, rather than low F0s advertise quality in this subspecies. While playback experiments demonstrated that oestrous females prefer higher pitched roars, the potential role of roar F0 in male competition remains untested. Here we examined the response of rutting red deer stags to playbacks of re-synthesized male roars with different median F0s. Our results show that stags' responses (latencies and durations of attention, vocal and approach responses were not affected by the F0 of the roar. This suggests that intrasexual selection is unlikely to strongly influence the evolution of roar F0 in Scottish red deer stags, and illustrates how the F0 of terrestrial mammal vocal sexual signals may be subject to different selection pressures across species. Further investigations on species characterized by different F0 profiles are needed to provide a comparative background for evolutionary interpretations of sex differences in mammalian vocalizations.

  8. First description of Onchocerca jakutensis (Nematoda: Filarioidea) in red deer (Cervus elaphus) in Switzerland.

    Science.gov (United States)

    Bosch, Felix; Manzanell, Ralph; Mathis, Alexander

    2016-08-01

    Twenty-seven species of the genus Onchocerca (Nematoda; Filarioidea) can cause a vector-borne parasitic disease called onchocercosis. Most Onchocerca species infect wild and domestic ungulates or the dog, and one species causes river blindness in humans mainly in tropical Africa. The European red deer (Cervus e. elaphus) is host to four species, which are transmitted by blackflies (simuliids) or biting midges (ceratopogonids). Two species, Onchocerca flexuosa and Onchocerca jakutensis, produce subcutaneous nodules, whereas Onchocerca skrjabini and Onchocerca garmsi live free in the hypodermal serous membranes. During the hunting season, September 2013, red deer (n = 25), roe deer (Capreolus c. capreolus, n = 6) and chamois (Rupicapra r. rupicapra, n = 7), all shot in the Grisons Region (Switzerland) were investigated for the presence of subcutaneous nodules which were enzymatically digested, and the contained Onchocerca worms were identified to species by light and scanning electron microscopy as well as by PCR/sequencing. In addition, microfilariae from skin samples were collected and genetically characterized. Neither nodules nor microfilariae were discovered in the roe deer and chamois. Adult worms were found in 24% of red deer, and all of them were identified as O. jakutensis. Two morphologically different microfilariae were obtained from five red deer, and genetic analysis of a skin sample of one red deer indicated the presence of another Onchocerca species. This is the first report of O. jakutensis in Switzerland with a prevalence in red deer similar to that in neighbouring Germany. PMID:27617204

  9. Response of red deer stags ( Cervus elaphus) to playback of harsh versus common roars

    Science.gov (United States)

    Garcia, Maxime; Wyman, Megan T.; Charlton, Benjamin D.; Tecumseh Fitch, W.; Reby, David

    2014-10-01

    Red deer stags ( Cervus elaphus) give two distinct types of roars during the breeding season, the "common roar" and the "harsh roar." Harsh roars are more frequent during contexts of intense competition, and characterized by a set of features that increase their perceptual salience, suggesting that they signal heightened arousal. While common roars have been shown to encode size information and mediate both male competition and female choice, to our knowledge, the specific function of harsh roars during male competition has not yet been studied. Here, we investigate the hypothesis that the specific structure of male harsh roars signals high arousal to competitors. We contrast the behavioral responses of free ranging, harem-holding stags to the playback of harsh roars from an unfamiliar competitor with their response to the playback of common roars from the same animal. We show that males react less strongly to sequences of harsh roars than to sequences of common roars, possibly because they are reluctant to escalate conflicts with highly motivated and threatening unfamiliar males in the absence of visual information. While future work should investigate the response of stags to harsh roars from familiar opponents, our observations remain consistent with the hypothesis that harsh roars may signal motivation during male competition, and illustrate how intrasexual selection can contribute to the diversification of male vocal signals.

  10. Detachment of hard ticks (Acari: Ixodidae) from hunted sika deer (Cervus nippon).

    Science.gov (United States)

    Tsunoda, Takashi

    2014-08-01

    Ixodid ticks were collected from 13 sika deer, Cervus n.nippon, shot in the Boso Peninsula in central Japan from late February to early March 1999. Haemaphysalis megaspinosa was the most abundant species of the adults collected, although Haemaphysalis longicornis, H. flava, H. kitaokai, H. cornigera, Ixodes ovatus, and Amblyomma testudinarium were also collected. Males were more abundant than females for H. longicornis, H. megaspinosa, H. flava, and H. kitaokai. Ticks that had inserted their hypostome into its host skin (designated attached) were distinguished from those that were detached and on the host's surface. A greater fraction of males than females of all four species were detached. Females were classified in three feeding stages (engorged, partially engorged, and unfed). More H. longicornis and H. megaspinosa unfed female ticks than engorged and partially-engorged female ticks were collected detached. Our results indicated that H. megaspinosa, H. longicornis, H. flava, and H. kitaokai male ticks detached sooner than female ticks after their host died. PMID:24659518

  11. Sperm membrane proteome in wild Japanese macaque (Macaca fuscata) and Sika deer (Cervus nippon).

    Science.gov (United States)

    Kawase, Osamu; Cao, Shinuo; Xuan, Xuenan

    2015-01-01

    Whereas recent advances in proteome-related techniques have accumulated a lot of information about sperm proteins in model animals, the information in non-model wildlife species is absolutely deficient, although this knowledge would be valuable to regulate wildlife overabundance. To characterize the repertoires of sperm membrane proteins in Japanese overpopulated wildlife, our study focuses on the following two species: Macaca fuscata and Cervus nippon. We enriched sperm membrane proteins by the phase partitioning with Triton X-114, and then separated them by two-dimensional electrophoresis, and, finally, they were comprehensively identified by peptide mass fingerprinting. Sperm membrane proteins were successfully enriched. They included some proteins with unknown function and fertility-related proteins that work in sperm development, motility, capacitation, transport, protection, acrosome reaction, and fertilization. Additionally, beta-defensin 126 and epithelial chloride channel were strongly detected in M. fuscata but not in C. nippon, whereas lactadherin and NADH-cytochrome b5 reductase 1 were strongly detected in C. nippon alone. This study is an initiative case showing that the sperm of wildlife conserve major fertility-related proteins, but express some proteins in a species-specific manner. In the development of a practical method for fertility control, this aspect may be taken into consideration. PMID:25277530

  12. The complete mitochondrial genome of Sika deer Cervus nippon hortulorum (Artiodactyla: Cervidae) and phylogenetic studies.

    Science.gov (United States)

    Liu, Yan-Hua; Liu, Xin-Xin; Zhang, Ming-Hai

    2016-07-01

    Sika deer (Cervus nippon Temminck 1836) are classified in the order Artiodactyla, family Cervidae, subfamily Cervinae. At present, the phylogenetic studies of C. nippon are problematic. In this study, we first determined and described the complete mitochondrial sequence of the wild C. nippon hortulorum. The complete mitogenome sequence is 16 566 bp in length, including 13 protein-coding genes, two rRNA genes, 22 tRNA genes, a putative control region (CR) and a light-strand replication origin (OL). The overall base composition was 33.4% A, 28.6% T, 24.5% C, 13.5% G, with a 62.0% AT bias. The 13 protein-coding genes encode 3782 amino acids in total. To further validate the new determined sequences and phylogeny of Sika deer, phylogenetic trees involving 15 most closely related species available in GenBank database were constructed. These results are expected to provide useful molecular data for deer species identification and further phylogenetic studies of Artiodactyla. PMID:26258510

  13. Isolation and characterization of peptidoglycan recognition protein 1 from antler base of sika deer (Cervus nippon).

    Science.gov (United States)

    Jiang, Wei; Yin, Yongguang; Zhou, Yajun; He, Guidan; Qi, Yue

    2014-03-01

    Peptidoglycan recognition proteins (PGRPs) are secreted innate immunity pattern recognition molecules. In this study, a new peptidoglycan recognition protein 1 named cnPGRP1 was isolated from an antler base of sika deer Cervus nippon. The antler base antimicrobial proteins (AAP) were subjected to consecutive chromatographic methods connected to Sephadex G-25 gel filtration column (CM) anion-exchange column, and RP-HPLC. The molecular weight of cnPGRP1 was 17.2 kDa under SDS-PAGE, and peptide mass fingerprint analysis by MALDI-TOF-MS as peptidoglycan recognition protein 1 matched to Dasypus novemcinctus. The matched amino acids sequences were RLYEIIQKWPHYRA. Both Gram-positive and Gram-negative bacteria can be killed by cnPGRP1 in the 50-250 μg/mL range through in vitro. Furthermore, cnPGRP1 has been found to bind Gram-positive bacteria, Gram-negative bacteria, and even fungus. PMID:24360898

  14. Effects of supplemental feeding on gastrointestinal parasite infection in Rocky Mountain Elk (Cervus elaphus)

    Science.gov (United States)

    Hines, Alicia M.; Ezenwa, Vanessa O.; Cross, Paul C.; Rogerson, Jared D.

    2007-01-01

    The effects of management practices on the spread and impact of parasites and infectious diseases in wildlife and domestic animals are of increasing concern worldwide, particularly in cases where management of wild species can influence disease spill-over into domestic animals. In the Greater Yellowstone Ecosystem, USA, winter supplemental feeding of Rocky Mountain elk (Cervus elaphus) may enhance parasite and disease transmission by aggregating elk on feedgrounds. In this study, we tested the effect of supplemental feeding on gastrointestinal parasite infection in elk by comparing fecal egg/oocyst counts of fed and unfed elk. We collected fecal samples from fed and unfed elk at feedground and control sites from January to April 2006, and screened all samples for parasites. Six different parasite types were identified, and 48.7% of samples were infected with at least one parasite. Gastrointenstinal (GI) nematodes (Nematoda: Strongylida), Trichuris spp., and coccidia were the most common parasites observed. For all three of these parasites, fecal egg/oocyst counts increased from January to April. Supplementally fed elk had significantly higher GI nematode egg counts than unfed elk in January and February, but significantly lower counts in April. These patterns suggest that supplemental feeding may both increase exposure and decrease susceptibility of elk to GI nematodes, resulting in differences in temporal patterns of egg shedding between fed and unfed elk.

  15. Chemical capture of free-ranging red deer (Cervus elaphus with medetomidine-ketamine

    Directory of Open Access Journals (Sweden)

    J.M. Arnemo

    1994-12-01

    Full Text Available Seventeen free-ranging red deer (Cervus elaphus (12 calves and 5 yearling hinds were immobilized with a combination of medetomidine hydrochloride (MED and ketamine hydrochloride (KET in winter (January-March. Immobilizations were performed with plastic projectile syringes fired from a dart gun. Mean (SD doses of 0.147 (0.024 mg MED/kg and 2.5 (0.4 mg KET/kg induced recumbency in 5.0 (2.0 minutes in the calves and all of them were completely immobilized. The initial doses in the yearling hinds were 0.099 (0.016 mg MED/kg and 1.9 (0.2 mg KET/kg but three of them required addirional dosing for induction of reliable restraint. The distance covered by the animals between darting and recumbency ranged from 40-250 m for calves and 100-300 m for yearling hinds. The animals were translocated to deer farms for breeding purposes and were given 12.5-25.0 mg of atipamezole hydrochloride before transportation. All animals recovered completely. Haematological and serum biochemical comparisons between free-ranging calves immobilized with medetomidine-ketamine (n=3 and captive unmedicated calves (n=4 showed that chemical capture induce very little stress in red deer.

  16. Malignant catarrhal fever in farmed Rusa deer (Cervus timorensis). 1. Clinico-pathological observations.

    Science.gov (United States)

    Denholm, L J; Westbury, H A

    1982-03-01

    A sporadic fatal disease is described in 7 Rusa deer (Cervus timorensis) from 5 deer farms in Victoria. Bilateral ophthalmia and wasting were the most significant signs in a clinical course varying from 4 to 34 days. Bilateral hypopyon, peripheral corneal opacities and interstitial mononuclear cell infiltration of the renal cortex with pronounced mural thickening and dilatation of vessels at the cortico-medullary junction were the only consistent lesions. Haemorrhagic ileitis, colitis and typhlitis were the major lesions in two deer that died 4 and 6 days after onset of clinical disease. Ecchymotic haemorrhages and sub-serosal haematomas on the intestines and mesentery were the main finding in cases with a longer clinical course. Other gross lesions varied between cases. The most significant histological lesion was fibrinoid necrotising vasculitis with adventitial lymphoid cell infiltration characteristic of bovine malignant catarrhal fever. Mucosal erosions seen in protracted cases of this disease were associated with lymphoid cell infiltration into foci of degenerating epithelial cells. In many lymph nodes there was severe follicular necroses. In chronic cases extensive proliferation of lymphoblastoid cells was seen in the parafollicular cortex and medullary sinuses of nodes which also showed discrete follicular necrosis. PMID:6981408

  17. Introgression through rare hybridization: A genetic study of a hybrid zone between red and sika deer (genus Cervus) in Argyll, Scotland.

    OpenAIRE

    Goodman, S. J.; Barton, N. H.; Swanson, G.; Abernethy, K; Pemberton, J M

    1999-01-01

    In this article we describe the structure of a hybrid zone in Argyll, Scotland, between native red deer (Cervus elaphus) and introduced Japanese sika deer (Cervus nippon), on the basis of a genetic analysis using 11 microsatellite markers and mitochondrial DNA. In contrast to the findings of a previous study of the same population, we conclude that the deer fall into two distinct genetic classes, corresponding to either a sika-like or red-like phenotype. Introgression is rare at any one locus...

  18. Identification of single-nucleotide polymorphisms of the prion protein gene in sika deer (Cervus nippon laiouanus)

    OpenAIRE

    Jeong, Hyun-Jeong; Lee, Joong-Bok; Park, Seung-Yong; Song, Chang-Seon; Kim, Bo-Sook; Rho, Jung-Rae; Yoo, Mi-Hyun; Jeong, Byung-Hoon; Kim, Yong-Sun; Choi, In-Soo

    2007-01-01

    Polymorphisms of the prion protein gene (PRNP) have been detected in several cervid species. In order to confirm the genetic variations, this study examined the DNA sequences of the PRNP obtained from 33 captive sika deer (Cervus nippon laiouanus) in Korea. A total of three single-nucleotide polymorphisms (SNPs) at codons 100, 136 and 226 in the PRNP of the sika deer were identified. The polymorphic site located at codon 100 has not been reported. The SNPs detected at codons 100 and 226 induc...

  19. Effects of ovarian storage condition on in vitro maturation of Hokkaido sika deer (Cervus nippon yesoensis) oocytes.

    Science.gov (United States)

    Tulake, Kuerban; Yanagawa, Yojiro; Takahashi, Yoshiyuki; Katagiri, Seiji; Higaki, Shogo; Koyama, Keisuke; Wang, Xuguang; Li, Heping

    2014-11-01

    The effects of different preservation conditions (temperature 20-25 or 10-15 degrees C; duration 12 or 24 h) for ovaries of Cervus nippon yesoensis on in vitro maturation of oocytes were examined. When ovaries were kept for 12 h at 20-25 degrees C, maturation rate of oocytes was highest (71%); however, it declined when the preservation time was extended to 24 h (31%). When the preservation temperature decreased to 10-15 degrees C, the maturation rate after 12 h preservation decreased (51%) but it remained in same level even though preservation time is prolonged to 24 h (55%). PMID:25597189

  20. Survey for bats in Jackson County, Colorado

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report covers a targeted bat survey of Jackson County in north-central Colorado to better understand the abundance and distribution of bats in Colorado. The...

  1. Artificial insemination, hybridization and pregnancy detection in sika deer (Cervus nippon ).

    Science.gov (United States)

    Willard, S T; Hughes, D M; Bringans, M; Sasser, R G; White, D R; Jaques, J T; Godfrey, R W; Welsh, T H; Randel, R D

    1996-10-01

    Artificial insemination (AI) was performed on sika hinds (Cervus nippon ) receiving various dosages of pregnant mare serum gonadotropin (PMSG; Year 1: 0, 50 and 100 IU; Year 2: 100 and 150 IU) and using semen collected from elk and 1 2 elk x 1 2 sika stags. The time from synchronization device removal (CIDR vs norgestomet) to estrus was determined through observations of mounting activity. Methods for pregnancy detection, serum progesterone (P4), estrone sulfate (E1S), pregnancy-specific protein B (PSPB) and ultrasonography, following AI (Year 1: AI, Days 28 and 48 after AI; Year 2: AI, Days 42, 53 and 100 after AI) and a 90-d natural breeding season were investigated. From available production data, body weights were compared among sika and 1 4 elk x 3 4 sika hybrids relative to age. Pregnancy rates tended (P treatment and sire; administration of 0 IU PMSG resulted in fewer hinds becoming pregnant to AI than 50 or 100 IU of PMSG. Hinds receiving 100 IU of PMSG had higher (P 0.10) between the CIDR and norgestomet groups. Pregnancy rates 50 d after a 90-d breeding season were similar (P > 0.10) between ultrasound (70.9%) and PSPB (61.6%). Serum P4 after 90 d in breeding groups and 50 d after stag removal were higher (P 0.10) between ultrasound (49.0%) and PSPB (37.3%). Serum P4 28 and 48 d after AI were higher (P 0.10) between ultrasound and PSPB (66.7%). Serum P4 was higher (P sika males tended (P sika males, while 1 4 elk x 3 4 sika females were heavier (P sika females at all ages. In summary, this study documents the use of AI and methods for pregnancy detection in sika hinds as well as preliminary information regarding the production of elk-x-sika hybrids. PMID:16727942

  2. Susceptibility of European red deer (Cervus elaphus elaphus to alimentary challenge with bovine spongiform encephalopathy.

    Directory of Open Access Journals (Sweden)

    Mark P Dagleish

    Full Text Available European red deer (Cervus elaphus elaphus are susceptible to the agent of bovine spongiform encephalopathy, one of the transmissible spongiform encephalopathies, when challenged intracerebrally but their susceptibility to alimentary challenge, the presumed natural route of transmission, is unknown. To determine this, eighteen deer were challenged via stomach tube with a large dose of the bovine spongiform encephalopathy agent and clinical signs, gross and histological lesions, presence and distribution of abnormal prion protein and the attack rate recorded. Only a single animal developed clinical disease, and this was acute with both neurological and respiratory signs, at 1726 days post challenge although there was significant (27.6% weight loss in the preceding 141 days. The clinically affected animal had histological lesions of vacuolation in the neuronal perikaryon and neuropil, typical of transmissible spongiform encephalopathies. Abnormal prion protein, the diagnostic marker of transmissible encephalopathies, was primarily restricted to the central and peripheral nervous systems although a very small amount was present in tingible body macrophages in the lymphoid patches of the caecum and colon. Serial protein misfolding cyclical amplification, an in vitro ultra-sensitive diagnostic technique, was positive for neurological tissue from the single clinically diseased deer. All other alimentary challenged deer failed to develop clinical disease and were negative for all other investigations. These findings show that transmission of bovine spongiform encephalopathy to European red deer via the alimentary route is possible but the transmission rate is low. Additionally, when deer carcases are subjected to the same regulations that ruminants in Europe with respect to the removal of specified offal from the human food chain, the zoonotic risk of bovine spongiform encephalopathy, the cause of variant Creutzfeldt-Jakob disease, from consumption of

  3. Antlers of Cervus elaphus as biomonitors of {sup 90}Sr in the environment

    Energy Technology Data Exchange (ETDEWEB)

    Baeza, A.; Vallejo, I. [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain); Guillen, J., E-mail: fguillen@unex.e [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain); Salas, A.; Corbacho, J.A. [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain)

    2011-03-15

    Adequate radioprotection of the environment requires the identification of biomonitors sensitive to the variation of its radionuclide content. Due to the chemical similarities between calcium and strontium, calcified tissues of mammals are considered to be good {sup 90}Sr biomonitors. This work considered Cervus elaphus antlers which, being shed annually, can give information about the importance of radiostrontium contamination in an ecosystem in the time period required for the growth of the antler. The samples were collected at various points of W and SW Spain. The mean value of their {sup 90}Sr content was (70 {+-} 43 (S.D.)) Bq/kg d.w., range (16-218) Bq/kg d.w., and the radionuclide was evenly distributed in the different parts of the antler. There was a good correlation between the antlers' {sup 90}Sr content and the {sup 90}Sr deposited in the soil. The antlers' content of {sup 226}Ra (from the natural uranium series) and the contents of some stable elements (Ca, Mg, Sr, and K) were also determined. The values for these stable elements were practically constant in the analyzed samples, and the concentrations measured decreased in the following order: Ca > Mg > K > Sr > {sup 90}Sr > {sup 226}Ra - Research highlights: {yields} There was a good correlation between the antlers' {sup 90}Sr content and the {sup 90}Sr deposited in the soil. {yields} The content of stable elements (Ca, Mg, Sr, K) in the analyzed antlers were practically constant. {yields} The concentrations measured decreased in the following order: Ca > Mg > K > Sr >{sup 90}Sr >{sup 226}Ra.

  4. Colonization of the Scottish islands via long-distance Neolithic transport of red deer (Cervus elaphus).

    Science.gov (United States)

    Stanton, David W G; Mulville, Jacqueline A; Bruford, Michael W

    2016-04-13

    Red deer (Cervus elaphus) have played a key role in human societies throughout history, with important cultural significance and as a source of food and materials. This relationship can be traced back to the earliest human cultures and continues to the present day. Humans are thought to be responsible for the movement of a considerable number of deer throughout history, although the majority of these movements are poorly described or understood. Studying such translocations allows us to better understand ancient human-wildlife interactions, and in the case of island colonizations, informs us about ancient human maritime practices. This study uses DNA sequences to characterise red deer genetic diversity across the Scottish islands (Inner and Outer Hebrides and Orkney) and mainland using ancient deer samples, and attempts to infer historical colonization events. We show that deer from the Outer Hebrides and Orkney are unlikely to have originated from mainland Scotland, implying that humans introduced red deer from a greater distance. Our results are also inconsistent with an origin from Ireland or Norway, suggesting long-distance maritime travel by Neolithic people to the outer Scottish Isles from an unknown source. Common haplotypes and low genetic differentiation between the Outer Hebrides and Orkney imply common ancestry and/or gene flow across these islands. Close genetic proximity between the Inner Hebrides and Ireland, however, corroborates previous studies identifying mainland Britain as a source for red deer introductions into Ireland. This study provides important information on the processes that led to the current distribution of the largest surviving indigenous land mammal in the British Isles. PMID:27053752

  5. An assessment of zoonotic and production limiting pathogens in rusa deer (Cervus timorensis rusa) from Mauritius.

    Science.gov (United States)

    Jori, F; Godfroid, J; Michel, A L; Potts, A D; Jaumally, M R; Sauzier, J; Roger, M

    2014-08-01

    A population of approximately 70,000 rusa deer (Cervus timorensis russa) represents the most important mammal species reared for food on the island of Mauritius, being the main source of red meat for the local population. However, very limited information is available on the circulation of pathogens affecting the productivity and health of this species. To produce baseline data on the circulation of infectious pathogens in rusa deer under production, a serological survey and/or direct pathogen detection for six selected infectious diseases was undertaken in 2007 in a sample of 53% of the herds reared in semi-free-ranging conditions in hunting estates. Seropositive results were recorded for Johne's disease with an indirect ELISA test (1.7%, n = 351), heartwater with an immunofluorescence antibody test (IFAT) (95.5%, n = 178) and leptospirosis with a Microscopic Agglutination Test (MAT) (25.9%, n = 363). Significant associations were found between seroprevalence to some of the leptospiral serogroups detected (Tarassovi, Pomona, Sejroe and Mini) and age of the animals, animal density or location of the estates (being more prevalent in hotter and more humid areas). In addition, Mycobacterium bovis and M. avium subspecies paratuberculosis were confirmed in two deer carcasses by culture and PCR, respectively. No antibodies against Brucella spp. nor Rift Valley Fever virus were detected with the use of respective indirect ELISA's. The results obtained suggest that the population of rusa deer from Mauritius is exposed to a wide range of pathogens which may affect their productivity. In addition, the results highlight the potential public health risks incurred by deer industry workers and consumers. This survey fills an important gap in knowledge regarding the health of tropical deer meat in Mauritius and justifies the need to implement more regular surveys of selected pathogens in the deer population. PMID:24382104

  6. Natural diet and food habitat use of the Tarim red deer, Cervus elaphus yarkandensis

    Institute of Scientific and Technical Information of China (English)

    QIAO Jianfang; YANG Weikang; GAO Xingyi

    2006-01-01

    In order to determine the natural diet and food habitat use of Tarim red deer (Cervus elaphus yarkandensis), a study was carried out in Qiemo, Xinjiang, China from October 2000 to June 2001. Direct observation combined with faecal analysis method was used to determine the natural diet of red deer. 15 different species of plant were identified as food items. Among them, 13 species of plants were identified in winter diet and 9 species in summer. Red deer consumed a wider range of species in winter because of their nutrient requirement as well as the shortage of food and the scarcity of high-quality forage in the study area. Phragmites communis, Glycyrrhiza inflata and populus diversifolia were frequently present in the deer's diet whenever in winter and summer. Among them, Phragmites communis was the most abundant plant in the area and was included in the deer's diet. Observation on food selection frequency of captive Tarim red deer showed that Populus diversifolia was the first preferred species. However, this food was limited in the study area. Five food habitat types were found in the study area according to plant association: (1)Phragmites communis-Tamarix ramosissima association, (2) Tamarix ramosissima-Halostachys caspica association, (3) Tamarix ramosissima-Phragmites communis association, (4) Populus diversifoliaPhragmites communis association, (5) Burned area.Among them, Phragmites communis-Tamarix ramosissima association (reed meadow and reed marsh)was preferred to other types within the study area whenever in summer and winter. Dense reed cover could reduce the chance of detection from predator and obstruct attack from predator. Furthermore, under the cover of the reed, Tarim red deer was protected from direct solar radiation during the hours of www. scichina.com www.springerlink.com hot day in summer. The reed meadow and marsh was preferred, presumably because the red deer could minimize their movements while searching for food, water and cover.

  7. Ungulate herbivory on alpine willow in the Sangre de Cristo Mountains of Colorado

    Science.gov (United States)

    Zeigenfuss, L.C.; Schoenecker, K.A.; Amburg, L.K.V.

    2011-01-01

    In many areas of the Rocky Mountains, elk (Cervus elaphus) migrate from low-elevation mountain valleys during spring to high-elevation subalpine and alpine areas for the summer. Research has focused on the impacts of elk herbivory on winter-range plant communities, particularly on woody species such as willow and aspen; however, little information is available on the effects of elk herbivory on alpine willows. In the Sangre de Cristo Mountains of south central Colorado, select alpine areas appear to receive high levels of summer elk herbivory, while other areas are nearly unbrowsed. In 2005 and 2008, we measured willow height, cover, and utilization on sites that appeared to be used heavily by elk, as well as on sites that appeared to be used lightly, to determine differences between these communities over time. We found less willow cover and shorter willows at sites that received higher levels of browsing compared to those that had lower levels of browsing. Human recreational use was greater at lightly browsed sites than at highly browsed sites. From 2005 to 2008, willow utilization declined, and willow cover and height increased at sites with heavy browsing, likely owing to ownership change of adjacent valley land which led to (1) removal of grazing competition from, cattle at valley locations and (2) increased human use in alpine areas, which displaced elk. We discuss the implications of increased human use and climate change on elk use of these alpine habitats. ?? 2011.

  8. Vaccination of elk (Cervus canadensis) with Brucella abortus strain RB51 overexpressing superoxide dismutase and glycosyltransferase genes does not induce adequate protection against experimental brucella abortus challenge

    Science.gov (United States)

    In recent years, elk (Cervus canadensis) have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area (GYA). In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the d...

  9. Gastrointestinal tract development in red deer (Cervus elaphus) calves from 1 to 12 months of age.

    Science.gov (United States)

    Hammond, K J; Hoskin, S O; Jopson, N B; Mackintosh, C G; Hofstra, G; Thompson, B R; Stevens, D R

    2013-11-01

    This study provides a detailed description of the development of the gastrointestinal tract (GIT) of farmed red deer (Cervus elaphus) calves over the first 12 months of age. GIT development was measured using a combination of computerised tomography (CT) scanning and traditional slaughter plus dissection techniques. Red deer calves of a known birth date were randomly assigned to two treatment groups. A group of five animals were repeatedly CT scanned at 31, 63, 92, 135, 207, 275 and 351 days of age to identify GIT organs and determine their volume. From a group of 20 animals, subsets of four individuals were also scanned at corresponding ages (except 135 days of age). They were immediately euthanised and dissected after CT scanning to compare CT-scanned results with actual anatomical measurements. Individual organ weights were compared with their respective organ volumes determined by CT scanning and were found to have a strong, positive relationship. The combined rumen and reticulum (RR) CT-scanned volume was compared with its volume determined by the water-displacement technique and this also showed good correlation between the two techniques (R = 0.92). The allometric growth rates of organs, relative to animal live weight gains, in descending order, were the rumen, omasum, reticulum, abomasum, caecum blind sac, kidneys, spleen and liver. The red deer GIT was continuing to grow and develop when the last measurement was taken at 351 days of age. The greatest growth of the RR, when expressed in terms of empty weight, was between 31 and 92 days of age. Compared with sheep and cattle, it appears that the red deer have a similar or greater rate of RR development up until approximately 60 to 90 days of age; however, the final increments of GIT maturity in deer may take longer to complete, with the empty weight of the RR gaining 7.5 g/day between 275 and 351 days of age. CT scanning was validated in this study as a viable technique to follow GIT development in the same

  10. Experimental transmission of bovine spongiform encephalopathy to European red deer (Cervus elaphus elaphus

    Directory of Open Access Journals (Sweden)

    Reid Hugh W

    2008-05-01

    Full Text Available Abstract Background Bovine spongiform encephalopathy (BSE, a member of the transmissible spongiform encephalopathies (TSE, primarily affects cattle. Transmission is via concentrate feed rations contaminated with infected meat and bone meal (MBM. In addition to cattle, other food animal species are susceptible to BSE and also pose a potential threat to human health as consumption of infected meat products is the cause of variant Creutzfeldt-Jakob disease in humans, which is invariably fatal. In the UK, farmed and free ranging deer were almost certainly exposed to BSE infected MBM in proprietary feeds prior to legislation banning its inclusion. Therefore, although BSE has never been diagnosed in any deer species, a possible risk to human health remains via ingestion of cervine products. Chronic wasting disease (CWD, also a TSE, naturally infects several cervid species in North America and is spreading rapidly in both captive and free-ranging populations. Results Here we show that European red deer (Cervus elaphus elaphus are susceptible to intra-cerebral (i/c challenge with BSE positive cattle brain pool material resulting in clinical neurological disease and weight loss by 794–1290 days and the clinical signs are indistinguishable to those reported in deer with CWD. Spongiform changes typical of TSE infections were present in brain and accumulation of the disease-associated abnormal prion protein (PrPd was present in the central and peripheral nervous systems, but not in lymphoid or other tissues. Western immunoblot analysis of brain material showed a similar glycosylation pattern to that of BSE derived from infected cattle and experimentally infected sheep with respect to protease-resistant PrP isoforms. However, the di-, mono- and unglycosylated bands migrated significantly (p Conclusion This study shows that deer are susceptible to BSE by intra-cerebral inoculation and display clinical signs and vacuolar pathology that are similar to those

  11. Relations between nutritional condition and survival of North American elk Cervus elaphus

    Science.gov (United States)

    Bender, L.C.; Cook, J.G.; Cook, R.C.; Hall, P.B.

    2008-01-01

    We related annual and seasonal survival of four populations of elk Cervus elaphus in the Pacific Northwest, USA, to measures and indices of individual nutritional condition. Among populations, for all mortality (human and non-human causes) sources inclusive, annual survival of adult females was correlated with a rump body condition score (rs = 0.627, P = 0.071), and survival over spring-summer-autumn (SSA) was correlated with mean ingesta-free body fat (IFBF; rs = 0.567, P = 0.088) and rump body condition score (rBCS; rs = 0.615, P = 0.050). For non-human mortality sources only, survival through SSA was correlated with IFBF (rs = 0.567, P = 0.088) and rBCS (rs = 0.615, P = 0.050), and survival over winter was correlated with withers body condition score (rs = 0.677, P = 0.045). For human-caused mortality sources only, survival over SSA was correlated with rBCS (rs = 0.696, P = 0.036) and IFBF (rs = 0.696, P = 0.036). For individuals, logistic analysis found that individual likelihood of dying from all mortality sources inclusive was best predicted (??2 = 8.3, P = 0.004, ?? = -1.24) by longissimus dorsi (loin) muscle thickness, a measure of protein catabolism. For only non-human mortality sources, a model (??2 = 16.1, P = 0.0003) containing both loin muscle thickness (??2 = 5.7, P = 0.017, ??= -1.02) and percent ingesta-free body fat (??2 = 4.9, P = 0.027, ?? = -0.35) best predicted individual susceptibility to mortality. Odds ratios indicated that odds of dying increased approximately 3X for each centimeter of loin muscle catabolized and 1.4X for each percent less body fat. No condition indices at the individual level were related to survival from human-caused mortality sources. Our study populations were characterized by low-marginal condition (i.e. mean ingesta-free body fat levels of 5.9-12.3% for lactating cows in late autumn); this likely increased the prominence of measures of muscle catabolism relative to fat accretion in influencing individual elk survival

  12. Observations on rutting behaviour of Hangul Deer Cervus elaphus hanglu (Cetartiodactyla: Cervidae in Dachigam National Park, Kashmir, India

    Directory of Open Access Journals (Sweden)

    B.A. Bhat

    2009-06-01

    Full Text Available Observations on seasonal rutting behaviour of Hangul Deer Cervus elaphus hanglu were recorded in Dachigam National Park (DNP during the years 2005 to 2007. A total of 24 breeding herds were seen. The size of the herd varied from 2-5, and usually comprised of one large stag and one or more hinds. The rutting season commenced in the main valley of lower Dachigam by late September and extended up to the first week of November. The peak was from October 9 to 20. The stags in rut became intolerant of each other and separated. The most conspicuous feature of the rut was the reverberating resonant roars by stags. The courtship behaviour was observed on six occasions and only mature stags (8-tined and above were involved in courtship. Various anthropogenic activities in the habitat were found to impair the rutting behaviour of deer.

  13. Serological survey for Lyme disease in sika deer (Cervus nippon yesoensis) by enzyme-linked immunosorbent assay (ELISA).

    Science.gov (United States)

    Isogai, E; Isogai, H; Masuzawa, T; Yanagihara, Y; Sato, N; Hayashi, S; Maki, T; Mori, M

    1991-01-01

    Seventy-six wild sika deer (Cervus nippon yesoensis) from areas endemic for Borrelia burgdorferi during 1988 to 1989 had the IgG antibody to the bacteria in enzyme-linked immunosorbent assay. The percentage of seropositive deer was 25.0% to strain HO14 and 22.4% to strain HP3, respectively. Specific IgG antibody titers were high in summer but low in winter. In summer, seropositive deer were 75.0%. Similar results were obtained in serum specimens obtained monthly from 4 farmed deer. It was suggested that the sika deer could be one of the wild reservoirs for B. burgdorferi in Hokkaido, Japan. The transmission risk of B. burgdorferi is considered to be greatest during late spring to early summer. PMID:1808467

  14. Changes in plasma levels of cortisol and corticosterone after acute ACTH stimulation in rusa deer (Cervus rusa timorensis).

    Science.gov (United States)

    van Mourik, S; Stelmasiak, T; Outch, K H

    1985-01-01

    Resting cortisol and corticosterone levels in immobilized mature rusa stags (Cervus rusa timorensis) and the influence of synthetic ACTH on the cortisol/corticosterone ratio (F/B ratio) were investigated. The basal concentration of cortisol was found to be 14.07 nmol/l (SD = 9.3, N = 15) and corticosterone was 3.79 nmol/l (SD = 2.3, N = 15). The cortisol/corticosterone ratio for the basal level was 5.31 (SD = 3.9, N = 15). After ACTH administration the cortisol/corticosterone ratio increased to 11.41 (SD = 5.4, N = 147) regardless of doses of ACTH administered to individual stags. The adrenal response to ACTH administration has a potential application for selection of deer most suitable for deer farming. PMID:2863041

  15. Rusa deer (Cervus timorensis) as a host for the cattle tick (Boophilus microplus) in Papua New Guinea.

    Science.gov (United States)

    Owen, I L

    1977-04-01

    The rusa deer (Cervus timorensis) is more resistant to the cattle tick (Boophlilus microplus) than are Britsh breed cattle in Papua New Guinea. The average yield of replete female ticks from deer was 1.6% (0.3-3.2%) as compared to 11.2% (3.4-23.1%) from calves. Ticks from deer were more slender, lighter in weight and produced fewer eggs (mean 1,800) than did ticks from calves (mean 2,200) but the deer was shown to be an effective host. A cervid population can maintain a tick population in the absence of bovine hosts thus presenting an important factor in eradication programs. Nutritional stress appears to result in a higher seasonal prevalence of infestation amongst males and non-pregnant females. PMID:864854

  16. 78 FR 29321 - Colorado Recreation Resource Advisory Committee Meeting

    Science.gov (United States)

    2013-05-20

    ... Forest Service Colorado Recreation Resource Advisory Committee Meeting AGENCY: Rocky Mountain Region, Forest Service, USDA. ACTION: Notice of meeting. SUMMARY: The Colorado Recreation Resource Advisory... National Forest. Proposals, updates, and other information can be found on the Colorado Recreation...

  17. 2011 Kids Count in Colorado! The Impact of the Great Recession on Colorado's Children

    Science.gov (United States)

    Colorado Children's Campaign, 2011

    2011-01-01

    "Kids Count in Colorado!" is an annual publication of the Colorado Children's Campaign, which provides the best available state- and county-level data to measure and track the education, health and general well-being of the state's children. "Kids Count in Colorado!" informs policy debates and community discussions, serving as a valuable resource…

  18. 78 FR 9629 - Irish Potatoes Grown in Colorado; Reestablishment of Membership on the Colorado Potato...

    Science.gov (United States)

    2013-02-11

    ...; ] DEPARTMENT OF AGRICULTURE Agricultural Marketing Service 7 CFR Part 948 Irish Potatoes Grown in Colorado; Reestablishment of Membership on the Colorado Potato Administrative Committee, Area No. 2 AGENCY: Agricultural... membership on the Colorado Potato Administrative Committee, Area No. 2 (Committee). The Committee...

  19. 77 FR 32980 - Notice of Correction to Filing of Plats, Colorado

    Science.gov (United States)

    2012-06-04

    ... Management (BLM) published a Notice of Filing of Plats by the Colorado State Office, Lakewood, Colorado . The... Surveyor for Colorado, BLM, Colorado State Office, 2850 Youngfield Street, Lakewood, Colorado...

  20. Vaccination of Elk (Cervus canadensis) with Brucella abortus Strain RB51 Overexpressing Superoxide Dismutase and Glycosyltransferase Genes Does Not Induce Adequate Protection against Experimental Brucella abortus Challenge

    OpenAIRE

    Nol, Pauline; Olsen, Steven C.; Rhyan, Jack C.; Sriranganathan, Nammalwar; McCollum, Matthew P.; Hennager, Steven G.; Pavuk, Alana A.; Sprino, Phillip J.; Boyle, Stephen M.; Berrier, Randall J.; Salman, Mo D.

    2016-01-01

    In recent years, elk (Cervus canadensis) have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area. In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the development of effective disease management strategies for wild elk herds is of utmost importance, not only for the prevention of reintroduction of brucellosis to cattle, but also for the overall health o...

  1. Vegetation Recovery in Response to the Exclusion of Grazing by Sika Deer (Cervus nippon) in Seminatural Grassland on Mt. Kushigata, Japan

    OpenAIRE

    Nagaike, Takuo; Ohkubo, Eiji; Hirose, Kazuhiro

    2014-01-01

    We examined the recovery of vegetation in seminatural grassland in central Japan after eliminating grazing by sika deer (Cervus nippon) by fencing. By 2012, after 5 years of fencing for exclusion of sika deer, the species composition of quadrats within the enclosure reverted to the original species composition in 1981, not browsed by sika deer. Conversely, outside the fence was different from the baseline quadrats in 1981. Iris sanguinea, a prominent flower in the area, recovered within the e...

  2. The Association of BDNF Gene Variants with Behaviour Traits in Sika Deer (Cervus nippon)

    OpenAIRE

    Wei Wan-Hong; Guo Jun; Yang Yan; Lv Shen-Jin

    2011-01-01

    It is widely accepted that Brain Derived Neurotrophic Factor (BDNF) is involved in modulating behaviour performance induced by environmental conditions. The aim of this study was to study polymorphisms of the BDNF gene and their relationship with animal behaviour in sika deer (Cervus nippon). About 48 sika deer reared under Ping-Shan-Tang Farm (25 deers) and Zhu-Yu-Wan Park (23 deers), Yangzhou City, Jiangsu province, China were observed and blood samples taken to identify BDNF genotypes. Dat...

  3. Seed contents of sika deer (Cervus nippon) dung and the fate of seeds in a temperate short grassland in an urban park in Japan

    OpenAIRE

    Haruna Ishikawa

    2011-01-01

    Many studies have suggested the positive effects of grazing by large herbivorous mammals on seed dispersal, but little isknown about how herbivores could affect the fate of ingested seeds. This study examined the effects of seed ingestion bysika deer (Cervus nippon) on seed fate in a temperate grassland established in an urban park long resided by high densitiesof sika deer. I compared species composition and seasonal traits of seed abundance and maturity in the grasslandcommunity with those ...

  4. CONTROLLING ANTLER GROWTH IN A CASTRATED INDOCHINESE SIKA DEER CERVUS NIPPON PSEUDAXIS USING A COMMERCIALLY AVAILABLE TRENBOLONE ACETATE AND ESTRADIOL IMPLANT.

    Science.gov (United States)

    Raines, Janis A; Storms, Timothy

    2015-12-01

    A captive Indochinese sika deer (Cervus nippon pseudaxis) was castrated at the age of 5 yr. The resultant abnormal antler growth over the next few years became difficult to manage from both the veterinary and husbandry standpoints. Using a commercially available trenbolone acetate and estradiol implant marketed for domestic cattle heifers, normal mineralization of the abnormal antlers was achieved along with the expected normal casting. The deer was then maintained for 6 yr using an annual implant regimen. PMID:26667563

  5. Predisposition assessment of mountainous forests to bark peeling by red deer (Cervus elaphus L.) as a strategy in preventive forest habitat management

    OpenAIRE

    Friedrich Reimoser; Ursula Nopp-Mayr; Friedrich Voelk

    2011-01-01

    This paper presents a method to assess the predisposition of mountainous forests to bark peeling by red deer (Cervus elaphus), which illustrates options in preventive forest habitat management. We developed an expert system, based on expert interviews and literature analyses. We selected the most important site- and stand-related predisposing factors for bark peeling of red deer, considering the relation of food dependent and food independent settling stimuli. Within the mechanistic expert sy...

  6. 梅花鹿耶尔森氏菌感染的诊断和治疗%THE DIAGNOSIS AND TREATMENT OF CERVUS NIPPON INFECTED WITH YERSINIA

    Institute of Scientific and Technical Information of China (English)

    雷蕾; 张再蓉; 王成东; 余星明; 赵波

    2001-01-01

    Four sika deers (Cervus nippon) (3 males, and 1 female) with depression, loss of appetite, high body temperature and hematochezia were dead in June, 1999 and Yersinia was cultured from their pathological materials. In addition, the susceptibility of Yersinia to antibiotics and the toxicity to mice were detected. All the other sika deers contacted with the died animals were treated with amikacin sulfate and protected from the disease.

  7. Population genetic structure of wild and farmed rusa deer (Cervus timorensis russa) in New-Caledonia inferred from polymorphic microsatellite loci

    OpenAIRE

    Garine-Wichatitsky de, M.; De Meeûs, Thierry; Chevillon, Christine; BERTHIER, D.; Barre, N.; Thevenon, S.; Maillard, J.C.

    2009-01-01

    Historical records indicate that 12 rusa deer (Cervus timorensis russa) were introduced in New-Caledonia during the 1870s. We used eight polymorphic microsatellite DNA loci to assess the genetic differentiation and diversity of farmed and wild deer populations. Past genetic bottlenecks were detected in both sub-populations, although higher genetic diversity was maintained in farmed populations, probably due to the regular introduction of reproducers from wild populations and from other farms....

  8. A Possible Role for Rusa Deer (Cervus timorensis russa) and Wild Pigs in Spread of Trypanosoma evansi from Indonesia to Papua New Guinea

    OpenAIRE

    1999-01-01

    Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa) and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were m...

  9. Genetic diversity and population structure of a Sichuan sika deer (Cervus sichuanicus) population in Tiebu Nature Reserve based on microsatellite variation.

    Science.gov (United States)

    He, Ya; Wang, Zheng-Huan; Wang, Xiao-Ming

    2014-11-18

    Cervus sichuanicus is a species of sika deer (Cervus nippon Group). To date, research has mainly focused on quantity surveying and behavior studies, with genetic information on this species currently deficient. To provide scientific evidence to assist in the protection of this species, we collected Sichuan sika deer fecal samples from the Sichuan Tiebu Nature Reserve (TNR) and extracted DNA from those samples. Microsatellite loci of bovine were used for PCR amplification. After GeneScan, the genotype data were used to analyze the genetic diversity and population structure of the Sichuan sika deer in TNR. Results showed that the average expected heterozygosity of the Sichuan sika deer population in TNR was 0.562, equivalent to the average expected heterozygosity of endangered animals, such as Procapra przewalskii. Furthermore, 8 of 9 microsatellite loci significantly deviated from the Hardy-Weinberg equilibrium and two groups existed within the Sichuan sika deer TNR population. This genetic structure may be caused by a group of Manchurian sika deer (Cervus hortulorum) released in TNR. PMID:25465089

  10. 2013 Kids Count in Colorado! Community Matters

    Science.gov (United States)

    Colorado Children's Campaign, 2013

    2013-01-01

    "Kids Count in Colorado!" is an annual publication of the Children's Campaign, providing state and county level data on child well-being factors including child health, education, and economic status. Since its first release 20 years ago, "Kids Count in Colorado!" has become the most trusted source for data and information on…

  11. Colorado's prospectus on uranium milling

    International Nuclear Information System (INIS)

    The first part of this paper will discuss Colorado's control of uranium mill tailings under Titles I and II of the Uranium Mill Tailings Radiation Control Act of 1978. Colorado has a legacy of nine inactive mill sites requiring reclamation under Title I, and two presently active plus a number of new mill proposals which must be regulated in accordance with Title II. Past failures in siting and control on the part of federal jurisdictions have left the state with a heavy legacy requiring extensive effort to address impacts to the state's environment and population. The second part of this paper will discuss the remedial action programme authorized under Public Law 92-314 for Mesa Country, where lack of federal control led to the dispersal of several hundred thousand tons of uranium mill tailings on thousands of properties, including hundreds of homes, schools and other structures. Successful completion of the State efforts under both programmes will depend on a high level of funding and on the maintenance of adequate regulatory standards. (author)

  12. Energy Smart Colorado, Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Gitchell, John M. [Program Administrator; Palmer, Adam L. [Program Manager

    2014-03-31

    Energy Smart Colorado is an energy efficiency program established in 2011 in the central mountain region of Colorado. The program was funded through a grant of $4.9 million, awarded in August 2010 by the U.S. Department of Energy’s Better Buildings Program. As primary grant recipient, Eagle County coordinated program activities, managed the budget, and reported results. Eagle County staff worked closely with local community education and outreach partner Eagle Valley Alliance for Sustainability (now Walking Mountains Science Center) to engage residents in the program. Sub-recipients Pitkin County and Gunnison County assigned local implementation of the program in their regions to their respective community efficiency organizations, Community Office for Resource Efficiency (CORE) in Pitkin County, and Office for Resource Efficiency (ORE) in Gunnison County. Utility partners contributed $166,600 to support Home Energy Assessments for their customers. Program staff opened Energy Resource Centers, engaged a network of qualified contractors, developed a work-flow, an enrollment website, a loan program, and a data management system to track results.

  13. 7 CFR 948.51 - Colorado Potato Committee.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Colorado Potato Committee. 948.51 Section 948.51... Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN COLORADO Order Regulating Handling Committees § 948.51 Colorado Potato Committee. The Colorado Potato...

  14. 7 CFR 948.151 - Colorado Potato Committee membership.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Colorado Potato Committee membership. 948.151 Section... POTATOES GROWN IN COLORADO Rules and Regulations Modification of Inspection Requirements § 948.151 Colorado Potato Committee membership. The Colorado Potato Committee shall be comprised of six members...

  15. Cervus elaphus Foraging Impacts on Plants and Soils at an Ungrazed Desert Grass/Shrubland in Northwestern New Mexico, USA

    Directory of Open Access Journals (Sweden)

    Louis C. Bender

    2015-01-01

    Full Text Available We evaluated Cervus elaphus herbivory and trampling impacts on plants and soils on Chaco Culture National Historical Park (Chaco, a desert grass/shrubland in northwestern New Mexico, USA, most (63% of which has been protected from grazing by domestic livestock since 1948. We conducted grazing, browse, and water infiltration surveys in areas which received different amounts of C. elaphus use (use and control, 2004–2007. Browse utilization was <32% on monitored species and Odocoileus hemionus use accounted for the majority of browsing. Live plant cover was greater on areas receiving more C. elaphus use, and no grass species were used above recommended levels. Stubble heights of Bouteloua spp. were positively related to relative C. elaphus use on some areas, suggesting possible stimulation of grassland productivity by C. elaphus grazing. Water infiltration rates either did not differ among use or control sites or were faster in use sites, indicating no impacts of C. elaphus use on soil compaction. At current C. elaphus densities (0.2–0.4/km2, negative impacts to plants and soils were not seen on Chaco, and some evidence suggests that light grazing is optimizing desert grasslands of Chaco.

  16. Molecular survey on the presence of zoonotic arthropod-borne pathogens in wild red deer (Cervus elaphus).

    Science.gov (United States)

    Ebani, Valentina Virginia; Rocchigiani, Guido; Bertelloni, Fabrizio; Nardoni, Simona; Leoni, Alessandro; Nicoloso, Sandro; Mancianti, Francesca

    2016-08-01

    To estimate the prevalence of some zoonotic tick-borne pathogens in red deer (Cervus elaphus) living in Italian areas with high risk of arthropod exposure, blood samples from 60 red deer were tested by PCR for A. phagocytophilum, Borrelia burgdorferi s.l., Coxiella burnetii, Francisella tularensis, and piroplasms. Thirty-four (56.67%) animals resulted positive for one or more pathogens. In particular, 24 (40%) red deer were positive for A. phagocytophilum, 16 (26.67%) for Babesia divergens, 6 (10%) for C. burnetii, 2 (3.33%) for B. burgdorferi s.l. No positive reaction was observed for F. tularensis. Thirteen (21.67%) animals resulted co-infected by two or three pathogens. Red deer is confirmed as competent reservoir of A. phagocytophilum and B. divergens, but not of B. burgdorferi. This is the first report of C. burnetii-positive red deer in central Italy. Hunters may be at risk of infection both through infected ticks and during the infected cervids carcasses dressing. PMID:27477510

  17. Genetic diversity among Chinese sika deer (Cervus nippon) populations and relationships between Chinese and Japanese sika deer

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Sika deer (Cervus nippon) is a cervid endemic to mainland and insular Asia and endangered. We analyzed variation in the mitochondrial DNA (mtDNA) control region for four subspecies to understand the genetic diversity, population structure and evolutionary history in China. 335 bp were sequenced and eight haplotypes were identified based on 25 variable sites among the populations. Sika deer in China showed lower genetic diversity, suggesting a small effective population size due to habitat fragmentation, a low number of founder individuals, or the narrow breeding program. AMOVA analysis indicated that there was significant genetic subdivision among the four populations, but no correlation between the genetic and geographic distance. Phylogenetic analyses also revealed that Chinese sika deer may be divided into three genetic clades, but the genetic structure among Chinese populations was inconsistent with subspecies designations and present geographic distribution. Including the sequence data of Japanese sika deer, the results indicated that Chinese populations were more closely related to Southern Japanese populations than to the Northern Japanese one, and the Taiwan population was closer to populations of Northeastern China and Sichuan than to those of Southern China.

  18. Molecular identification of the Cryptosporidium deer genotype in the Hokkaido sika deer (Cervus nippon yesoensis) in Hokkaido, Japan.

    Science.gov (United States)

    Kato, Satomi; Yanagawa, Yojiro; Matsuyama, Ryota; Suzuki, Masatsugu; Sugimoto, Chihiro

    2016-04-01

    The protozoan Cryptosporidium occurs in a wide range of animal species including many Cervidae species. Fecal samples collected from the Hokkaido sika deer (Cervus nippon yesoensis), a native deer of Hokkaido, in the central, western, and eastern areas of Hokkaido were examined by polymerase chain reaction (PCR) to detect infections with Cryptosporidium and for sequence analyses to reveal the molecular characteristics of the amplified DNA. DNA was extracted from 319 fecal samples and examined with PCR using primers for small-subunit ribosomal RNA (SSU-rRNA), actin, and 70-kDa heat shock protein (HSP70) gene loci. PCR-amplified fragments were sequenced and phylogenetic trees were created. In 319 fecal samples, 25 samples (7.8 %) were positive with SSU-rRNA PCR that were identified as the Cryptosporidium deer genotype. Among Cryptosporidium-positive samples, fawns showed higher prevalence (16.1 %) than yearlings (6.4 %) and adults (4.7 %). The result of Fisher's exact test showed a statistical significance in the prevalence of the Cryptosporidium deer genotype between fawn and other age groups. Sequence analyses with actin and HSP70 gene fragments confirmed the SSU-rRNA result, and there were no sequence diversities observed. The Cryptosporidium deer genotype appears to be the prevalent Cryptosporidium species in the wild sika deer in Hokkaido, Japan. PMID:26687968

  19. Bacterial community composition and fermentation patterns in the rumen of sika deer (Cervus nippon) fed three different diets.

    Science.gov (United States)

    Li, Zhipeng; Wright, André-Denis G; Liu, Hanlu; Bao, Kun; Zhang, Tietao; Wang, Kaiying; Cui, Xuezhe; Yang, Fuhe; Zhang, Zhigang; Li, Guangyu

    2015-02-01

    Sika deer (Cervus nippon) rely on microorganisms living in the rumen to convert plant materials into chemical compounds, such as volatile fatty acids (VFAs), but how the rumen bacterial community is affected by different forages and adapt to altered diets remains poorly understood. The present study used 454-pyrosequencing of bacterial 16S ribosomal RNA (rRNA) genes to examine the relationship between rumen bacterial diversity and metabolic phenotypes using three sika deer in a 3 × 3 latin square design. Three sika deer were fed oak leaves (OL), corn stover (CS), or corn silage (CI), respectively. After a 7-day feeding period, when compared to the CS and CI groups, the OL group had a lower proportion of Prevotella spp. and a higher proportion of unclassified bacteria belonging to the families Succinivibrionaceae and Paraprevotellaceae (Psika deer. However, the differences in interplay patterns between rumen bacterial community composition and metabolic phenotypes were altered in the native and domesticated diets indicating the changed fermentation patterns in the rumen of sika deer. PMID:25252928

  20. Movement and Activity Patterns of Translocated Elk (Cervus elaphus Nelsoni on an Active Coal Mine in Kentucky

    Directory of Open Access Journals (Sweden)

    Widén, P.

    2007-06-01

    Full Text Available Monitoring activity and movements of newly translocated wildlife is necessary for identifying factors that may hinder population establishment. We documented movements and activity of 6 radio-collared Rocky Mountain elk (Cervus elaphus nelsoni translocated to Kentucky from the 4th of March 1999 until the 17th of July 1999. Seventy three percent of daily activity occurred during crepuscular hours, a period that accounted for only 33% of the day. Elk tended to be more active at dawn (39% than dusk (32%. Elk spent most of their time feeding (49.4% and resting-ruminating (44.6%, with little time spent walking or standing (6.0%. Elk were disturbed 9 times by humans and once by dogs during 702 hours of monitoring. Eight of these disturbance events occurred in reclaimed grassland. During each disturbance, elk moved farther (892 m than during the same hours when undisturbed (282 m. Disturbances altered elk movement and activity patterns, and fragmented social groups. Wildlife managers should identify sources of disturbance at release sites and implement plans that minimize their impacts on reintroduced animals.

  1. Genetic Structure and Effective Population Sizes in European Red Deer (Cervus elaphus) at a Continental Scale: Insights from Microsatellite DNA.

    Science.gov (United States)

    Zachos, Frank E; Frantz, Alain C; Kuehn, Ralph; Bertouille, Sabine; Colyn, Marc; Niedziałkowska, Magdalena; Pérez-González, Javier; Skog, Anna; Sprĕm, Nikica; Flamand, Marie-Christine

    2016-07-01

    We analyzed more than 600 red deer (Cervus elaphus) from large parts of its European distribution range at 13 microsatellite loci, presenting the first continent-wide study of this species using nuclear markers. Populations were clearly differentiated (overall F ST = 0.166, Jost's D est = 0.385), and the BAPS clustering algorithm yielded mainly geographically limited and adjacent genetic units. When forced into only 3 genetic clusters our data set produced a very similar geographic pattern as previously found in mtDNA phylogeographic studies: a western group from Iberia to central and parts of Eastern Europe, an eastern group from the Balkans to Eastern Europe, and a third group including the threatened relict populations from Sardinia and Mesola in Italy. This result was also confirmed by a multivariate approach to analyzing our data set, a discriminant analysis of principal components. Calculations of genetic diversity and effective population sizes (linkage disequilibrium approach) yielded the lowest results for Italian (Sardinia, Mesola; N e between 2 and 8) and Scandinavian red deer, in line with known bottlenecks in these populations. Our study is the first to present comparative nuclear genetic data in red deer across Europe and may serve as a baseline for future analyses of genetic diversity and structuring in this widespread ungulate. PMID:26912909

  2. 半圈养条件下白唇鹿行为时间分配及活动规律的研究%Time Budget and Behaviour Pattern of Cervus Albirostris in Captivity

    Institute of Scientific and Technical Information of China (English)

    何利军; 丁由中; 王小明; 夏述忠

    2001-01-01

    From March to April,1998,the authors studied the time budget andbehaviour patterns of Cervus albirostris in Shanghai Wild Animal Park.We analyzed the results from 23 days′observation for different sex and weather were analyzed.Cervus albirostris spent about 50% daytime in resting,and 40% daytime in feeding.Resting behaviour was presented from 8∶00 to 17∶00.The female spent more resting time than the male(p<0.05)in fine days.The female spent less standing time than the male in rainy days(p<0.01).Cervus albirostris spent more standing time in fine days than in rainy days(p<0.05 for the male,p<0.01 for the female).

  3. Colorado Plateau Rapid Ecoregion Assessment Data Catalog

    Data.gov (United States)

    Bureau of Land Management, Department of the Interior — Datasets used in the analysis of the Colorado Plateau (COP) Rapid Ecoregion Assessment (REA).They can be downloaded via a layer package (lpk, similar to a zip file...

  4. Notes and comments on Colorado Refuges

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report is a summary of actual management actions, and plant community responses on Colorado refuges during 1992. It is part of the moist-soil expert system...

  5. Seasonal variation in plasma testosterone, luteinizing hormone concentrations and LH-RH responsiveness in mature, male rusa deer (Cervus rusa timorensis).

    Science.gov (United States)

    van Mourik, S; Stelmasiak, T; Outch, K H

    1986-01-01

    Plasma testosterone and luteinizing hormone (LH) concentrations in immobilized or yarded rusa stags (Cervus rusa timorensis) were investigated over a two-year period. Testosterone concentrations showed a minor elevation in autumn (May) and reached maximal levels in late winter-early spring (August) coinciding with the rut. Luteinizing hormone in plasma was only detectable from January to May. Maximal responsiveness of the pituitary-gonadal axis to LH-RH stimulation was recorded in August. The combination of Fentaz (fentanylcitrate and azaperone) and Rompun (xylazine hydrochloride) for immobilizing deer influences hypothalamic function. PMID:2869876

  6. 78 FR 19296 - Notice of Inventory Completion: History Colorado, formerly Colorado Historical Society, Denver, CO

    Science.gov (United States)

    2013-03-29

    ... Society, Denver, CO AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: History Colorado, formerly Colorado Historical Society, has completed an inventory of human remains, in consultation with the... time of the excavation and removal of these human remains, the land from which the remains and...

  7. 78 FR 30737 - Irish Potatoes Grown in Colorado; Reestablishment of Membership on the Colorado Potato...

    Science.gov (United States)

    2013-05-23

    ... action was published in the Federal Register on February 11, 2013 (78 FR 9629). An internet link to the... Service 7 CFR Part 948 Irish Potatoes Grown in Colorado; Reestablishment of Membership on the Colorado Potato Administrative Committee, Area No. 2 AGENCY: Agricultural Marketing Service, USDA. ACTION:...

  8. Characteristics of Antioxidant Systems of Yellow Fraction of Red Deer's (Cervus elaphus L.) Semen During the Rutting Period.

    Science.gov (United States)

    Koziorowska-Gilun, M; Szurnicka, M; Dziekonska, A; Kordan, W; Giżejewski, Z; Filipowicz, K

    2016-04-01

    The objective of this study was to make the preliminary characterization of the antioxidant defence systems of the yellow fraction (YF) of red deer's (Cervus elaphus L.) semen during the rutting period. The semen was collected using artificial vagina (AV). The studies included spectrophotometric determination of antioxidant enzymes activities such as superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPx). We also analysed the contents of low-molecular antioxidants such as L-glutathione (GSH + GSSG), L-ascorbate (ASC) and total antioxidant status (TAS). Additionally, the samples were subjected to PAGE and stained for SOD and GPx activities. It was demonstrated that the yellow fraction exhibited activities of SOD and GPx, with the highest activities in September and October. CAT activity was not detected. Staining for the SOD and GPx activities confirmed three protein bands with SOD activity and one protein band with GPx activity. The content of GSH + GSSG was similar in trials dating from October to December contrary to the content of ASC which was high in samples from September and October. The stable rate of TAS was observed during the whole rutting period. The results of this study showed that the YF of red deer semen is equipped with basic battery of antioxidant enzymes comprising SOD and GPx, with the supporting role of GSH + GSSG and ASC. Moreover, the samples obtained at the peak of the rutting period occurring from September to October had the highest enzymatic activity in comparison with remaining months of the rutting period, which contributed to the high quality of the semen by preventing it from the formation of oxidative stress during the short period of intense sexual activity of male red deer. The better understanding of the mechanisms of antioxidant defence systems in the YF of deer's semen may contribute to the potential use of this fraction in technology of wild ruminant semen preservation. PMID:26854018

  9. Immunohistochemical and biochemical characteristics of BSE and CWD in experimentally infected European red deer (Cervus elaphus elaphus

    Directory of Open Access Journals (Sweden)

    Dagleish Mark P

    2009-07-01

    Full Text Available Abstract Background The cause of the bovine spongiform encephalopathy (BSE epidemic in the United Kingdom (UK was the inclusion of contaminated meat and bone meal in the protein rations fed to cattle. Those rations were not restricted to cattle but were also fed to other livestock including farmed and free living deer. Although there are no reported cases to date of natural BSE in European deer, BSE has been shown to be naturally or experimentally transmissible to a wide range of different ungulate species. Moreover, several species of North America's cervids are highly susceptible to chronic wasting disease (CWD, a transmissible spongiform encephalopathy (TSE that has become endemic. Should BSE infection have been introduced into the UK deer population, the CWD precedent could suggest that there is a danger for spread and maintenance of the disease in both free living and captive UK deer populations. This study compares the immunohistochemical and biochemical characteristics of BSE and CWD in experimentally-infected European red deer (Cervus elpahus elaphus. Results After intracerebral or alimentary challenge, BSE in red deer more closely resembled natural infection in cattle rather than experimental BSE in small ruminants, due to the lack of accumulation of abnormal PrP in lymphoid tissues. In this respect it was different from CWD, and although the neuropathological features of both diseases were similar, BSE could be clearly differentiated from CWD by immunohistochemical and Western blotting methods currently in routine use. Conclusion Red deer are susceptible to both BSE and CWD infection, but the resulting disease phenotypes are distinct and clearly distinguishable.

  10. Mercury and selenium binding biomolecules in terrestrial mammals (Cervus elaphus and Sus scrofa) from a mercury exposed area.

    Science.gov (United States)

    Ropero, M J Patiño; Fariñas, N Rodríguez; Krupp, E; Mateo, R; Nevado, J J Berzas; Martín-Doimeadios, R C Rodríguez

    2016-06-01

    Mercury (Hg) is likely bound to large biomolecules (e.g. proteins) in living organisms, and in order to assess Hg metabolic pathways and possible toxicological effects, it is essential to study these Hg containing biomolecules. However, the exact nature of most metal binding biomolecules is unknown. Such studies are still in their infancy and information on this topic is scarce because the analysis is challenging, mainly due to their lability upon digestion or extraction from the tissue. New analytical methods that allow complex Hg-biomolecules to be analysed intact are needed and only few very recent studies deal with this approach. Therefore, as an initial step towards the characterization of Hg containing biomolecules, an analytical procedure has been optimised using size-exclusion chromatography (SEC) with inductively coupled plasma mass spectrometry (ICP-MS) detection. We applied this technique to elucidate the distribution and elution profile of Hg and Se, and some physiological important elements such as Fe, Ni, Zn and Cu, to assess metal binding profiles in liver and kidney samples of red deer (Cervus elaphus) and wild boar (Sus scrofa) who roam freely within the largest Hg mining district on Earth, Almadén in Spain. Elemental fractionation profiles of the extracts from different tissues were obtained using two different SEC columns (BioSep-SEC-S2000 GL 300-1kDa and Superdex 75 10/300 GL 70-3kDa). Similar profiles of Hg were observed in red deer and wild boar; however, significant differences were evident for liver and kidney. Moreover, the profiles of Se showed a single peak at high-medium molecular weight in all investigated tissues, while co-elution of Hg with Fe, Ni, Zn and Cu was observed. PMID:27093497

  11. ANTIBODY RESPONSE TO EPSILON TOXIN OF CLOSTRIDIUM PERFRINGENS IN CAPTIVE RED DEER (CERVUS ELAPHUS) OVER A 13-MONTH PERIOD.

    Science.gov (United States)

    Scala, Christopher; Duffard, Nicolas; Beauchamp, Guy; Boullier, Séverine; Locatelli, Yann

    2016-03-01

    Deer are sensitive to clostridial diseases, and vaccination with clostridial toxoids is the method of choice to prevent these infections in ruminants. The purpose of this study was to evaluate the serologic responses in red deer (Cervus elaphus) over a 13-mo period after vaccination with a multivalent clostridial vaccine, containing an aluminium hydroxide adjuvant. Antibody production to the Clostridium perfringens type D epsilon toxin component of the vaccine was measured using an indirect enzyme-linked immunosorbent assay. Animals from group 1 (9 mo old; n = 6) were naïve and received an initial vaccination with a booster vaccine 4 wk apart and one annual booster. Animals from group 2 (21 mo old; n = 10) had been previously vaccinated 12 mo prior and received a first annual booster at the beginning of this study and a second annual booster 12 mo later. The multivalent clostridial vaccine induced a high antibody response that peaked after each injection and then slowly decreased with time. In group 1, a booster vaccine was required to obtain an initial high humoral response. The annual booster injection induced a strong, rapid, and consistent anamnestic response in both groups. The serologic responses persisted significantly over the baseline value for 9-12 mo in group 1, but more than 12 mo in group 2. It is unknown whether the measured humoral immune responses would have been protective as no challenge studies were performed. Further investigation is needed to determine the protective antibody titers to challenge and how long this immunity might persist after vaccination. PMID:27010263

  12. Effect of the association of cattle and rusa deer (Cervus timorensis russa) on populations of cattle ticks (Boophilus microplus).

    Science.gov (United States)

    Barre, N; Bianchi, M; De Garine-Wichatitsky, M

    2002-10-01

    The wild population of rusa deer (Cervus timorensis russa) in New Caledonia (South Pacific) is nearly as large as the cattle population. The cattle tick is widespread and occurs all year round. Opinions are divided on the role of deer in the biological cycle of the tick: i) Do they maintain a sustainable tick population that is secondarily available for cattle? ii) Do they decrease the infestation of the environment by collecting larvae on the pasture, but preventing their development to the engorged female stage? or iii) Do they contribute to both situations? An experiment was conducted in three groups of pastures, each seeded with 450 000 larvae/ha and allowed to be grazed only by cattle, only by deer, and by a mixed herd of deer and cattle (deer representing 30% of the biomass), at approximately the same stocking rate (470-510 kg/ha). After 15 months of exposure, the tick burden per weight unit of host was 42 ticks/kg for the steers-only herd and 0.01/kg for the deer-only herd. The steers in the "mixed group" harbored 7 times fewer ticks (6.2/kg) than the cattle-only group, and the deer in the "mixed group," 130 times more (1.3/kg) than the deer-only group. Five emergency acaricide treatments had to be applied in the cattle-only group, but none in the other groups. The long-term sustainability of a viable tick population on deer as well as the potential benefit resulting from the association of deer and susceptible cattle in the tick control of cattle are highlighted. PMID:12381606

  13. 梅花鹿 LHβ基因的克隆及序列分析%The Cloning and Sequence Analysis of Cervus nippon LHβ Gene

    Institute of Scientific and Technical Information of China (English)

    竭航; 陈彬龙; 吴楠; 李地艳; 雷美艳; 张承露; 曾德军

    2015-01-01

    【目的】克隆梅花鹿 LHβ基因 CDS 区并进行序列分析。【方法】采用 PCR 克隆测序的方法获得梅花鹿 LHβ基因 CDS 区全序列,采用 ProtParam tool 等分子生物学工具对梅花鹿 LHβ蛋白的分子量、等电点、二级结构、蛋白功能等进行预测,并采用 MEGA 6.0软件构建进化树以确定其系统发育地位。【结果】梅花鹿 LHβ基因 CDS 区全长462 bp (GenBank 序列号为 KT199365),包含了 ATG 起始密码子和 TAA 终止密码子,共编码141个氨基酸,蛋白质分子量为15.17 kDa,等电点为8.00。梅花鹿 LHβ蛋白均位于膜外,无跨膜结构,平均疏水性(GRAVY)为0.391,蛋白功能预测显示,该蛋白最有可能为激素,这与本研究的目的基因相符。进化树分析结果表明,梅花鹿LHβ基因与山羊、绵羊和牛等反刍动物较近,其中与绵羊最近。【结论】梅花鹿 LHβ基因 CDS 区序列与绵羊 LHβ基因最近。%Objective]The aim of this study is to clone the LHβ gene CDS of Cervus nippon and analyze the structure and features of LHβprotein.[Method]The LHβ gene CDS of Cervus nip-pon was obtained by PCR,cloning and sequencing.Then,the structure and features of LHβpro-tein,including molecular weight,isoelectric point,secondary structure,function were predicted by online molecular biological tool,such as ProtParam tool.Meanwhile,we constructed a phylo-genetic tree by MEGA 6.0 software to further explain the genetic basis for this gene.[Results]The full CDS sequence of Cervus nippon LHβ gene was 462 bp (GenBank Accession No. KT199365),encoding 141 amino acids,which contained ATG start codon,and TGA stop codon, with a calculated molecular weight of 15.17 kDa and an isoelectric point of 8.00.No conserved transmembrane region was detected and all of the amino acids were located outside the membrane. The average of hydrophobicity (GRAVY)was 0.391.Function predicted results showed that the function of

  14. Regional geophysical investigations in central Colorado Plateau

    International Nuclear Information System (INIS)

    Gravity and aeromagnetic surveys covering about 15,000 square miles in the central Colorado Plateau in Utah, Colorado, Arizona, and New Mexico were conducted to assist in determining the regional subsurface geology as it may relate to uranium, oil, and potash exploration. The dominant gravity anomalies are conspicuous gravity lows over the salt anticlines. Both broad regional highs, which occur over the monoclinal uplifts where denser rocks are close to the surface, and regional lows, which occur over the basin and platform areas, are caused by lateral density contrasts related to structural relief. Most of the magnetic anomalies arise from contrasts in magnetization of the Precambrian basement

  15. The instrumental climate history of southwestern Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Doesken, N.J.; McKee, T.B. [Colorado State Univ., Fort Collins, CO (United States)

    1995-09-01

    Instrumental observations of the climate of southwestern Colorado date back to about 1880. Climatic conditions since the late 19th century will be described with emphasis on temperatures, temperature ranges and observed precipitation. Typical seasonal patterns of temperature and precipitation will be shown, and variations and apparent trends over time will be discussed. Drought characteristics will be described based on a standardized precipitation index developed for Colorado. Finally, brief comments on the challenge of collecting accurate and consistent long-term data will be given.

  16. The Colorado Lightning Mapping Array

    Science.gov (United States)

    Rison, W.; Krehbiel, P. R.; Thomas, R. J.; Rodeheffer, D.; Fuchs, B.

    2012-12-01

    A fifteen station Lightning Mapping Array (LMA) was installed in northern Colorado in the spring of 2012. While the driving force for the array was to produce 3-dimensional lightning data to support the Deep Convective Clouds and Chemistry (DC3) Experiment (Barth, this conference), data from the array are being used for several other projects. These include: electrification studies in conjunction with the CSU CHILL radar (Lang et al, this conference); observations of the parent lightning discharges of sprites (Lyons et al, this conference); trying to detect upward discharges triggered by wind turbines, characterizing conditions in which aircraft flying through clouds produce discharges which can be detected by the LMA, and other opportunities, such as observations of lightning in pyrocumulus clouds produced by the High Park Fire west of Fort Collins, CO. All the COLMA stations are solar-powered, and use broadband cellular modems for data communications. This makes the stations completely self-contained and autonomous, allowing a station to be installed anywhere a cellular signal is available. Because most of the stations were installed well away from anthropogenic noise sources, the COLMA is very sensitive. This is evidenced by the numerous plane tracks detected in its the vicinity. The diameter, D, of the COLMA is about 100 km, significantly larger than other LMAs. Because the error in the radial distance r is proportional to (r/D)2, and the error in the altitude z is proportional to (z/D)2, the larger array diameter greatly expands the usable range of the COLMA. The COLMA is able to detect and characterize lighting flashes to a distance of about 350 km from the array center. In addition to a web-based display (lightning.nmt.edu/colma), geo-referenced images are produced and updated at one-minute intervals. These geo-referenced images can be used to overlay the real-time lightning data on Google Earth and other mapping software. These displays were used by the DC3

  17. Hospital Based Paternity Establishment in Colorado.

    Science.gov (United States)

    Pearson, Jessica; Thoennes, Nancy

    1997-01-01

    Describes the impact of the Colorado's Child Support Improvement Project on voluntary paternity acknowledgment rate, which increased almost 24% from 1991 to 1994. Program activities include simplifying voluntary acknowledgment procedures and training hospital personnel on paternity. Voluntary paternity acknowledgment is associated with the…

  18. Besnoitiosis in rodents from Colorado. [Parasitic infestations

    Energy Technology Data Exchange (ETDEWEB)

    Dagle, G E; Winsor, T F; Adee, R R

    1976-01-01

    Parasitic cysts of Besnoitia jellisoni (coccidia) were found in rodents (Peromyscus maniculatus and Spermophilus tridecemlineatus) trapped in Eastern Colorado. The parasite was associated with a granulomatous inflammatory reaction in the lungs of each rodent and was disseminated in several organs from one Peromyscus. The ultrastructural appearance of the merozoites and the cyst wall formed by the host cell were studied.

  19. Bats of the Colorado oil shale region

    Energy Technology Data Exchange (ETDEWEB)

    Finley, R.B. Jr.; Caire, W.; Wilhelm, D.E.

    1984-10-31

    New records for Myotis californicus, M. evotis, M. leibii, M. lucifugus, M. thysanodes, M. volans, M. yumanensis, Lasionycteris noctivagans, Pipistrellus hesperus, Eptesicus fuscus, Lasiurus cinereus, Plecotus townsendii, and Antrozous pallidus and their habitat occurrence in northwestern Colorado are reported. Mortality of 27 bats of six species trapped in an oil sludge pit is described. 7 references.

  20. Denver, Colorado: Solar in Action (Brochure)

    Energy Technology Data Exchange (ETDEWEB)

    2011-10-01

    This brochure provides an overview of the challenges and successes of Denver, Colorado, a 2008 Solar America City awardee, on the path toward becoming a solar-powered community. Accomplishments, case studies, key lessons learned, and local resource information are given.

  1. 78 FR 57923 - Colorado Disaster #CO-00065

    Science.gov (United States)

    2013-09-20

    ... ADMINISTRATION Colorado Disaster CO-00065 AGENCY: Small Business Administration. ACTION: Notice. SUMMARY: This is... applications to: U.S. Small Business Administration, Processing and Disbursement Center, 14925 Kingsport Road.... Small Business Administration, 409 3rd Street SW., Suite 6050, Washington, DC 20416....

  2. Air quality management in Denver, Colorado

    International Nuclear Information System (INIS)

    The state of Colorado is addressing a number of air quality problems. In addition to carbon monoxide, ozone, particulates, nitrogen dioxide, sulfur dioxide, and lead, they are also designing programs to deal with visibility, acid deposition, ozone depletion, and global warming. Programs for controlling carbon monoxide, particulates, vehicle emissions, and programs for achieving lifestyle changes are discussed in particular

  3. Colorado Academic Library Master Plan. Revised Edition.

    Science.gov (United States)

    Johns, Claude, Jr., Ed.; Moore, Beverly, Ed.

    This master plan for Colorado academic libraries assesses current strengths and weaknesses of public and private academic libraries in the state and forecasts the role of academic libraries in support of higher education. The plan consists of a series of recommendations divided into six related and overlapping sections: access, collection…

  4. Glycolytic potential and ultimate muscle pH values in red deer (Cervus elaphus and fallow deer (Dama dama

    Directory of Open Access Journals (Sweden)

    Eva Wiklund

    2004-04-01

    Full Text Available The ultimate pH value of meat (measured at approx. 24 hours post slaughter gives information about the technological quality, i.e. shelf life, colour, water-holding properties and tenderness and is a direct consequence of muscle glycogen (energy levels at slaughter. It may therefore also indicate whether or not the animal has been exposed to stressful energy depleting events prior to slaughter. In the present study, 141 animals (130 red deer (Cervus elaphus and 11 fallow deer (Dama dama were included to investigate the relationship between ultimate pH and residual glycogen concentration in red deer and fallow deer M. longissimus. In addition, the muscle glycogen content and ultimate pH values in three red deer muscles (Mm. triceps brachii, longissimus and biceps femoris were studied. M. triceps brachii had higher ultimate pH and lower glycogen content compared with the other two studied muscles. The frequency of intermediate DFD (5.8≤ pH<6.2 was 5.4% in red deer M. longissimus, compared with 9.1% in fallow deer, while the frequency of DFD (pH≥ 6.2 was much lower in red deer (3.8% than in fallow deer (54.5%. A curvilinear relationship between ultimate pH and total glucose concentration (glycogen and glucose 30 min post slaughter in red deer and fallow deer M. longissimus was found. The relationship between muscle pH and lactic acid concentration however, was indicated to be linear. A significant variation in total glucose concentration at ultimate pH below 5.80 was observed, including values in the range from 18 to 123 mmol/kg wet tissue. It was concluded that further studies are needed to further explore the relationship between muscle glycogen content and technological and sensory quality attributes of meat from different deer species.Abstract in Swedish / Sammanfattning:Köttets pH-värde (mätt ca 24 timmar efter slakt har stor betydelse för den teknologiska kvaliteten som t. ex. hållbarhet, färg, vattenhållande förmåga och m

  5. Vaccination of elk (Cervus canadensis with Brucella abortus strain RB51 overexpressing superoxide dismutase and glycosyltransferase genes does not induce adequate protection against experimental Brucella abortus challenge

    Directory of Open Access Journals (Sweden)

    Pauline eNol

    2016-02-01

    Full Text Available In recent years, elk (Cervus canadensis have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area. In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the development of effective disease management strategies for wild elk herds is of utmost importance, not only for the prevention of reintroduction of brucellosis to cattle, but also for the overall health of the Greater Yellowstone Area elk populations. In two studies, we evaluated the efficacy of B. abortus strain RB51 over-expressing superoxide dismutase and glycosytransferase for protecting elk from infection and disease caused by B. abortus after experimental infection with a virulent B. abortus strain. Our data indicate that the recombinant vaccine does not protect elk against brucellosis. Further work is needed for development of an effective brucellosis vaccine for use in elk

  6. Oral vaccination with microencapsuled strain 19 vaccine confers enhanced protection against Brucella abortus strain 2308 challenge in red deer (Cervus elaphus elaphus).

    Science.gov (United States)

    Arenas-Gamboa, Angela M; Ficht, Thomas A; Davis, Donald S; Elzer, Philip H; Kahl-McDonagh, Melissa; Wong-Gonzalez, Alfredo; Rice-Ficht, Allison C

    2009-10-01

    Bison (Bison bison) and elk (Cervus elaphus nelsoni) in the Greater Yellowstone Area (GYA), USA, are infected with Brucella abortus, the causative agent of bovine brucellosis, and they serve as a wildlife reservoir for the disease. Bovine brucellosis recently has been transmitted from infected elk to cattle in Montana, Wyoming, and Idaho and has resulted in their loss of brucellosis-free status. An efficacious Brucella vaccine with a delivery system suitable for wildlife would be a valuable tool in a disease prevention and control program. We evaluated Strain 19 (S19) in a sustained release vehicle consisting of alginate microspheres containing live vaccine. In a challenge study using red deer (Cervus elaphus elaphus) as a model for elk, alginate, a naturally occurring polymer combined with a protein of Fasciola hepatica vitelline protein B was used to microencapsulate S19. Red deer were orally or subcutaneously immunized with 1.5 x 10(10) colony-forming units (CFUs) using microencapsulated S19. Humoral and cellular profiles were analyzed bimonthly throughout the study. The vaccinated red deer and nonvaccinated controls were challenged 1 yr postimmunization conjunctivally with 1 x 10(9) CFUs of B. abortus strain 2308. Red deer vaccinated with oral microencapsulated S19 had a statistically significant lower bacterial tissue load compared with controls. These data indicate for the first time that protection against Brucella-challenge can be achieved by combining a commonly used vaccine with a novel oral delivery system such as alginate-vitelline protein B microencapsulation. This system is a potential improvement for efficacious Brucella-vaccine delivery to wildlife in the GYA. PMID:19901378

  7. Gunnison, Colorado subpile study report. Revision 1

    International Nuclear Information System (INIS)

    To protect human health and the environment, the Uranium Mill Tailings Remedial Action (UMTRA) Project will remediate the uranium mill tailings site at Gunnison Colorado. There are explicit requirements (i.e., 40 CFR Part 192) for the surface remediation of radiologically contaminated soils on UMTRA sites. The removal of subpile sediment to the depth required by 40 CFR Part 192 will leave in place deeper foundation sediment that is contaminated with hazardous constituents other than radium-226 and thorium-230. The Department of Energy and the Colorado Department of Health have questioned whether this contaminated soil could potentially act as a continuing source of ground water contamination even after surface remediation based on 40 CFR Part 192 is complete. To evaluate the subpile sediments as a potential source of ground water contamination, the Gunnison Subpile study was initiated. This report summarizes the results and findings of this study

  8. BENEFITS OF CONTROLLING SALINE WATER IN COLORADO

    OpenAIRE

    Ellingson, Lindsey; Houk, Eric E.; Schuck, Eric C.; Frasier, W. Marshall

    2004-01-01

    The Arkansas River in Colorado is confronted with a salinity issue; the majority of this salinity problem is due to agricultural runoff caused by irrigation. Reducing applications of irrigation water through adoption of more technically efficient irrigation systems is one means of improving water quality in the Arkansas River basin. This research uses positive mathematical programming to model the cropping practices of the farms along the Arkansas River. It examines the affect of acreage and ...

  9. Green pricing: A Colorado case study

    Energy Technology Data Exchange (ETDEWEB)

    Blank, E.; Udall, J.R.

    1996-12-31

    A model program for green pricing targeted primarily at large customers is proposed in this paper. The program would create a partnership between a local community group, a renewables advocacy group, and several Colorado utilities. The first part of the paper summarizes pertinent background issues, including utility experience with green pricing programs. The rest of the paper outlines the program proposal, focusing primarily on organizational structure.

  10. Habitat acoustics of Rocky Mountain elk in Colorado and European Red deer in Denmark

    DEFF Research Database (Denmark)

    Riede, Tobias; Jensen, Kenneth Kragh; Larsen, Ole Næsbye;

      Male vocal displays are rarely so dramatically different in closely related subspecies as in Cervus elaphus. Many studies investigated the evolution of the European Red deer low pitched roaring sounds, but little is known about why the Rocky Mountain elk evolved high pitched bugles. We investig......  Male vocal displays are rarely so dramatically different in closely related subspecies as in Cervus elaphus. Many studies investigated the evolution of the European Red deer low pitched roaring sounds, but little is known about why the Rocky Mountain elk evolved high pitched bugles. We...

  11. Acoustic behaviour of two large terrestrial mammals in relation to resources maintenance and mating systems: wolf(Canis lupus) and red deer (Cervus elaphus) as model species

    OpenAIRE

    Passilongo, Daniela

    2013-01-01

    The high variability of vocalization is due to their function, the habitat where they evolved and the physical constraints of the emitters. The aim of this study were to analyse the acoustic behaviour of two large terrestrial mammals, wolf (Canis lupus) and red deer (Cervus elaphus), in relation to resources maintenance and mating systems. Firstly, I analysed the Italian wolf howl. I found two forms of howl; both types are uttered within the lowest frequencies of the wolf’s vocal range,...

  12. PREVALENCE OF ANTIBIOTIC RESISTANT STRAINS OF ESCHERICHIA COLI AND ENTEROCOCCUS SPP. IN ROE DEER (CAPREOLUS CAPREOLUS) AND RED DEER (CERVUS ELAPHUS) AT THE PARCO NAZIONALE DEI MONTI SIBILLINI, ITALY

    OpenAIRE

    B. Cenci Goga; A. Vizzani; C. Monticelli; I. Nicchiarelli; P. Sechi; I. Pisano

    2009-01-01

    A case control study was performed in the Parco Nazionale dei Monti Sibillini, Italy, to find out whether roe deer (Capreolus capreolus) and red deer (Cervus elaphus) were more likely to harbour antibiotic resistant Escherichia coli in their faeces, compared to Enterococcus spp. Ten areas were selected and samples were collected during a fourmonths (May to August, 2008) sampling period. Samples of water (n=12) and feces (n=59), collected at 10 different sites, were cultured for E. coli and En...

  13. Economic impact study of the Uranium Mill Tailings Remedial Action Project in Colorado: Colorado state fiscal year 1993

    International Nuclear Information System (INIS)

    The Colorado economic impact study summarizes employment and economic benefits to the state from activities associated with the Uranium Mill Tailings Remedial Action (UMTRA) Project during Colorado state fiscal year 1993 (July 1, 1992, through June 30, 1993). To capture employment benefits, a questionnaire was distributed to subcontractor employees at the active UMTRA Project sites of Grand Junction, Rifle, and Gunnison, Colorado. An estimated 52 percent of the employees working on the UMTRA Project responded to this information request. Economic data were requested from each site prime subcontractor, as well as from the Remedial Action Contractor. The most significant benefits associated with the UMTRA Project in Colorado are summarized

  14. Economic impact study of the Uranium Mill Tailings Remedial Action project in Colorado: Colorado state fiscal year 1995

    International Nuclear Information System (INIS)

    This Colorado economic impact study summarizes employment and economic benefits to the state from activities associated with the Uranium Mill Tailings Remedial Action (UMTRA) Project during Colorado state fiscal year (FY) 1995 (1 July 1994 through 30 June 1995). To capture employment information, a questionnaire was distributed to subcontractor employees at the active UMTRA Project sites of Grand Junction, Gunnison, Maybell, Naturita, Rifle, and Slick Rock, Colorado. Economic data were requested from the Remedial Action Contractor (RAC), the Technical Assistance Contractor (TAC) and the US Department of Energy (DOE). The most significant benefits associated with the UMTRA Project in Colorado are summarized

  15. Colorado Fathers' Resource Guide = Guia de Recursos para los Padres en Colorado.

    Science.gov (United States)

    Colorado Foundation for Families and Children, Denver.

    Developed through the Colorado Fatherhood Connection, this guide, in English- and Spanish-language versions, provides suggestions and resources for fathers as well as tips on discipline, communication, and activities fathers can do with their children. Topics addressed in the guide include characteristics of responsible fatherhood, characteristics…

  16. Cancer incidence study in Mesa County, Colorado

    International Nuclear Information System (INIS)

    In November of 1982 the Colorado Department of Health completed an epidemiologic investigation of leukemia, multiple myeloma, and cancers of the lung, stomach, pancreas and colon in Mesa County, Colorado for the years 1970 to 1979. This investigation was performed in response to a concern that the presence of uranium mill tailings in some Mesa County homes presents a potential cancer hazard. The results of the investigation show that the incidence of multiple myeloma, colon, stomach and pancreatic cancer are not above expected rates. The incidence of leukemia is not above expected rates for the entire study period, 1970 to 1979. The incidence of lung cancer appears elevated when compared to the The Third National Cancer Survey data for Colorado but lower than expected when compared to Surveillance, Epidemiology and End Results data. To further examine the leukemia and lung cancer incidence findings, a case/control study was conducted. The controls consisted of colon, stomach and pancreatic cancer cases. The results of the leukemia case/control analysis show no association with the radiation exposure variables: occupational radiation exposure; uranium mining exposure; having ever lived in a type A home (uranium tailings home); and radiation therapy. The lung cancer case/control analysis shows a significant association with only the radiation exposure variable, uranium mining history, indicating cases were more likely to have been uranium miners than were controls. As with leukemia, the study found no association between lung cancer and living in a uranium mill tailings home. The relatively low radiation exposures typical of type A homes and the small number of persons exposed make it very difficult to establish, by epidemiologic methods, that a risk exists

  17. Development of industrial minerals in Colorado

    Science.gov (United States)

    Arbogast, Belinda F.; Knepper, Daniel H.; Langer, William H.; Cappa, James A.; Keller, John W.; Widmann, Beth L.; Ellefsen, Karl J.; Klein, Terry L.; Lucius, Jeffrey E.; Dersch, John S.

    2011-01-01

    Technology and engineering have helped make mining safer and cleaner for both humans and the environment. Inevitably, mineral development entails costs as well as benefits. Developing a mine is an environmental, engineering, and planning challenge that must conform to many Federal, State, and local regulations. Community collaboration, creative design, and best management practices of sustainability and biodiversity can be positive indicators for the mining industry. A better understanding of aesthetics, culture, economics, geology, climate, vegetation and wildlife, topography, historical significance, and regional land planning is important in resolving land-use issues and managing mineral resources wisely. Ultimately, the consuming public makes choices about product use (including water, food, highways, housing, and thousands of other items) that influence operations of the mineral industry. Land planners, resource managers, earth scientists, designers, and public groups have a responsibility to consider sound scientific information, society's needs, and community appeals in making smart decisions concerning resource use and how complex landscapes should change. An effort to provide comprehensive geosciences data for land management agencies in central Colorado was undertaken in 2003 by scientists of the U.S. Geological Survey and the Colorado Geological Survey. This effort, the Central Colorado Assessment Project, addressed a variety of land-use issues: an understanding of the availability of industrial and metallic rocks and minerals, the geochemical and environmental effects of historic mining activity on surface water and groundwater, and the geologic controls on the availability and quality of groundwater. The USDA Forest Service and other land management agencies have the opportunity to contribute to the sustainable management of natural aggregate and other mineral resources through the identification and selective development of mineral resources and the

  18. 77 FR 15093 - Public Service Company of Colorado;

    Science.gov (United States)

    2012-03-14

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Public Service Company of Colorado; Notice of Application Tendered for... Public Service Company of Colorado. e. Name of Project: Cabin Creek Pumped Storage Project. f....

  19. Extensive Green Roof Research Program at Colorado State University

    Science.gov (United States)

    In the high elevation, semi-arid climate of Colorado, green roofs have not been scientifically tested. This research examined alternative plant species, media blends, and plant interactions on an existing modular extensive green roof in Denver, Colorado. Six plant species were ev...

  20. 77 FR 21803 - Notice of Competitive Coal Lease Sale, Colorado

    Science.gov (United States)

    2012-04-11

    ... Bureau of Land Management Notice of Competitive Coal Lease Sale, Colorado AGENCY: Bureau of Land... Creek East Tract described below in Gunnison County, Colorado, will be offered for competitive lease by... lease sale will be held at 10 a.m., May 15, 2012. The sealed bid must be submitted on or before 10...

  1. Parasitism and body condition in humpback chub from the Colorado and Little Colorado Rivers, Grand Canyon, Arizona

    Science.gov (United States)

    Hoffnagle, T.; Choudhury, Anindo; Cole, R.A.

    2006-01-01

    Glen Canyon Dam has greatly altered the Colorado River in Grand Canyon. The Little Colorado River (LCR) provides a small refuge of seasonally warm and turbid water that is thought to be more suitable than the Colorado River for endangered humpback chub Gila cypha. However, the LCR has low productivity and contains nonnative fishes and parasites, which pose a threat to humpback chub. The Colorado River hosts a different suite of nonnative fishes and is cold and clear but more productive. We compared condition factor (K), abdominal fat index (AFI), and presence and number of two introduced pathogenic parasites (Lernaea cyprinacea and Bothriocephalus acheilognathi) between juvenile (parasitism and poorer body condition in humpback chub from the LCR challenge the paradigm that warmer LCR waters are more suitable for humpback chub than the colder Colorado River and indicate the need to consider the importance and benefits of all available habitats, as well as biotic and abiotic factors, when managing endangered species and their environment.

  2. Epidemiologic characterization of Colorado backyard bird flocks.

    Science.gov (United States)

    Smith, Emily I; Reif, John S; Hill, Ashley E; Slota, Katharine E; Miller, Ryan S; Bjork, Kathe E; Pabilonia, Kristy L

    2012-06-01

    Backyard gallinaceous bird flocks may play an important role in the spread of infectious diseases within poultry populations as well as the transmission of zoonotic diseases to humans. An epidemiologic characterization was conducted of Colorado backyard flocks to gather information on general flock characteristics, human movement of birds, human-bird interaction, biosecurity practices, and flock health. Our results suggest that backyard poultry flocks in Colorado are small-sized flocks (68.6% of flocks had production for the family (86.44%) or as pet or hobby birds (42.27%). The backyard flock environment may promote bird-to-bird transmission as well as bird-to-human transmission of infectious disease. Birds are primarily housed with free access to the outside (96.85%), and many are moved from the home premises (46.06% within 1 yr). Human contact with backyard flocks is high, biosecurity practices are minimal, and bird health is negatively impacted by increased movement events. Increased knowledge of backyard bird characteristics and associated management practices can provide guidelines for the development of measures to decrease disease transmission between bird populations, decrease disease transmission from birds to humans, and increase the overall health of backyard birds. PMID:22856180

  3. På vej mod en dansk krondyrforvaltning (Cervus elaphus): Hvad mangler vi at vide, og hvad mangler vi at gøre?

    DEFF Research Database (Denmark)

    Sunde, Peter; Haugaard, Lars

    2014-01-01

    bestanden og jagtudbyttet på, vil være at frede de unge hjorte mod at have fri jagt på dem, som har nået ”høstklar” alder. Ud over at sikre jægerne et bedre udbytte vil en sådan ”mindstemålsmodel” modvirke selektion for tidligere kønsmodenhed og mindre kropstørrelse for hjorte. In Denmark, red deer (Cervus....... We compared the harvest outcome and demographic composition of these theoretical models with two Danish red deer populations with contrasting land owner structure and hunting regimes (Djursland and Oksbøl). Djursland (hunting seasons 2008/9-2012/13) represents a ‘typical’ Danish landscape, comprising...... of maintaining a stable red deer population with a high proportion of mature stags. We demonstrate that the harvest pattern on Djursland (with an annual mortality of 50% of 2-7 year old stags wherefore less than 1 % of male calves survive until 8 years of age) result in far fewer mature stags in the...

  4. A relapsing fever group Borrelia sp. similar to Borrelia lonestari found among wild sika deer (Cervus nippon yesoensis) and Haemaphysalis spp. ticks in Hokkaido, Japan.

    Science.gov (United States)

    Lee, Kyunglee; Takano, Ai; Taylor, Kyle; Sashika, Mariko; Shimozuru, Michito; Konnai, Satoru; Kawabata, Hiroki; Tsubota, Toshio

    2014-10-01

    A relapsing fever Borrelia sp. similar to Borrelia lonestari (herein referred to as B. lonestari-like) was detected from wild sika deer (Cervus nippon yesoensis) and Haemaphysalis ticks in the eastern part of Hokkaido, Japan. The total prevalence of this Borrelia sp. in tested deer blood samples was 10.6% using conventional PCR and real-time PCR. The prevalence was significantly higher in deer fawns compared to adults (21.9% and 9.4%, respectively). Additionally, there was significant regional difference between our two sampling areas, Shiretoko and Shibetsu with 17% and 2.8% prevalence, respectively. Regional differences were also found in tick species collected from field and on deer. In the Shiretoko region, Haemaphysalis spp. were more abundant than Ixodes spp., while in Shibetsu, Ixodes spp. were more abundant. Using real-time PCR analysis, B. lonestari-like was detected from 2 out of 290 adult Haemaphysalis spp. ticks and 4 out of 76 pools of nymphs. This is the first report of a B. lonestari-like organism in Haemaphysalis spp. ticks, and the first phylogenetic analysis of this B. lonestari-like organism in Asia. Based on our results, Haemaphysalis spp. are the most likely candidates to act as a vector for B. lonestari-like; furthermore, regional variation of B. lonestari-like prevalence in sika deer may be dependent on the population distribution of these ticks. PMID:25108784

  5. X- and Y-chromosome specific variants of the amelogenin gene allow sex determination in sheep (Ovis aries and European red deer (Cervus elaphus

    Directory of Open Access Journals (Sweden)

    Brenig B

    2005-03-01

    Full Text Available Abstract Background Simple and precise methods for sex determination in animals are a pre-requisite for a number of applications in animal production and forensics. However, some of the existing methods depend only on the detection of Y-chromosome specific sequences. Therefore, the abscence of a signal does not necessarily mean that the sample is of female origin, because experimental errors can also lead to negative results. Thus, the detection of Y- and X-chromosome specific sequences is advantageous. Results A novel method for sex identification in mammals (sheep, Ovis aries and European red deer, Cervus elaphus is described, using a polymerase chain reaction (PCR and sequencing of a part of the amelogenin gene. A partial sequence of the amelogenin gene of sheep and red deer was obtained, which exists on both X and Y chromosomes with a deletion region on the Y chromosome. With a specific pair of primers a DNA fragment of different length between the male and female mammal was amplified. Conclusion PCR amplification using the amelogenin gene primers is useful in sex identification of samples from sheep and red deer and can be applied to DNA analysis of micro samples with small amounts of DNA such as hair roots as well as bones or embryo biopsies.

  6. Complete mitochondrial genome sequence of a Hungarian red deer (Cervus elaphus hippelaphus) from high-throughput sequencing data and its phylogenetic position within the family Cervidae.

    Science.gov (United States)

    Frank, Krisztián; Barta, Endre; Bana, Nóra Á; Nagy, János; Horn, Péter; Orosz, László; Stéger, Viktor

    2016-06-01

    Recently, there has been considerable interest in genetic differentiation in the Cervidae family. A common tool used to determine genetic variation in different species, breeds and populations is mitochondrial DNA analysis, which can be used to estimate phylogenetic relationships among animal taxa and for molecular phylogenetic evolution analysis. With the development of sequencing technology, more and more mitochondrial sequences have been made available in public databases, including whole mitochondrial DNA sequences. These data have been used for phylogenetic analysis of animal species, and for studies of evolutionary processes. We determined the complete mitochondrial genome of a Central European red deer, Cervus elaphus hippelaphus, from Hungary by a next generation sequencing technology. The mitochondrial genome is 16 354 bp in length and contains 13 protein-coding genes, two rRNA genes, 22 tRNA genes and a control region, all of which are arranged similar as in other vertebrates. We made phylogenetic analyses with the new sequence and 76 available mitochondrial sequences of Cervidae, using Bos taurus mitochondrial sequence as outgroup. We used 'neighbor joining' and 'maximum likelihood' methods on whole mitochondrial genome sequences; the consensus phylogenetic trees supported monophyly of the family Cervidae; it was divided into two subfamilies, Cervinae and Capreolinae, and five tribes, Cervini, Muntiacini, Alceini, Odocoileini, and Capreolini. The evolutionary structure of the family Cervidae can be reconstructed by phylogenetic analysis based on whole mitochondrial genomes; which method could be used broadly in phylogenetic evolutionary analysis of animal taxa. PMID:27165525

  7. A Molecular and Serological Survey of Rickettsiales Bacteria in Wild Sika Deer (Cervus nippon nippon) in Shizuoka Prefecture, Japan: High Prevalence of Anaplasma Species.

    Science.gov (United States)

    Wu, Dongxing; Wuritu; Yoshikawa, Yuko; Gaowa; Kawamori, Fumihiko; Ikegaya, Asaka; Ohtake, Masayoshi; Ohashi, Masataka; Shimada, Masahiko; Takada, Ayumi; Iwai, Katsuki; Ohashi, Norio

    2015-01-01

    We surveyed Rickettsiales bacteria, including Rickettsia, Ehrlichia, Anaplasma, and Neoehrlichia, in wild sika deer (Cervus nippon nippon) from Shizuoka prefecture, Japan. In spleen samples from 187 deer, Anaplasma phagocytophilum (deer type), A. bovis, and A. centrale were successfully detected by PCR assay targeting to 16S rDNA or p44/msp2, and their positive rates were 96.3% (180/187), 53.5% (100/187), and 78.1% (146/187), respectively. Additionally, 2 or 3 Anaplasma species could be detected from a single deer in 165 spleen samples (88.2%), indicating dual or triple infection. In contrast, A. phagocytophilum (human type) 16S rDNA, Rickettsia gltA, Ehrlichia p28/omp-1, and Neoehrlichia 16S rDNA could not be amplified. The serological test of 105 deer serum samples by immunofluorescence assay showed that the detection of antibodies against antigens of A. phagocytophilum HZ (US-human isolate) and Rickettsia japonica YH were 29.5% (31/105) and 75.2% (79/105), respectively. These findings suggest that A. phagocytophilum (deer type), A. centrale, and A. bovis are highly dominant and prevalent in wild sika deer from Shizuoka, a central region of Japan, and that the antibodies against some Rickettsiales bacteria have also been retained in deer blood. PMID:25971318

  8. Mismatch repair mRNA and protein expression in intestinal adenocarcinoma in sika deer (Cervus nippon) resembling heritable non-polyposis colorectal cancer in man.

    Science.gov (United States)

    Jahns, H; Browne, J A

    2015-01-01

    Intestinal adenocarcinomas seen in an inbred herd of farmed sika deer (Cervus nippon) morphologically resembled human hereditary non-polyposis colorectal cancer (HNPCC). Features common to both included multiple de novo sites of tumourigenesis in the proximal colon, sessile and non-polyposis mucosal changes, the frequent finding of mucinous type adenocarcinoma, lymphocyte infiltration into the neoplastic tubules and Crohn's-like lymphoid follicles at the deep margin of the tumour. HNPCC is defined by a germline mutation of mismatch repair (MMR) genes resulting in their inactivation and loss of expression. To test the hypothesis that similar MMR gene inactivation occurs in the deer tumours, the expression of the four most important MMR genes, MSH2, MLH1, MSH6 and PMS2, was examined at the mRNA level by reverse transcriptase polymerase chain reaction (n = 12) and at the protein level by immunohistochemistry (n = 40) in tumour and control tissues. All four genes were expressed equally in normal and neoplastic tissues, so MMR gene inactivation could not be implicated in the carcinogenesis of this tumour in sika deer. PMID:25678423

  9. Effect of the Velvet Antler of Formosan Sambar Deer (Cervus unicolor swinhoei on the Prevention of an Allergic Airway Response in Mice

    Directory of Open Access Journals (Sweden)

    Ching-Yun Kuo

    2012-01-01

    Full Text Available Two mouse models were used to assay the antiallergic effects of the velvet antler (VA of Formosan sambar deer (Cervus unicolor swinhoei in this study. The results using the ovalbumin- (OVA- sensitized mouse model showed that the levels of total IgE and OVA-specific IgE were reduced after VA powder was administrated for 4 weeks. In addition, the ex vivo results indicated that the secretion of T helper cell 1 (Th1, regulatory T (Treg, and Th17 cytokines by splenocytes was significantly increased (P<0.05 when VA powder was administered to the mice. Furthermore, OVA-allergic asthma mice that have been orally administrated with VA powder showed a strong inhibition of Th2 cytokine and proinflammatory cytokine production in bronchoalveolar fluid compared to control mice. An increase in the regulatory T-cell population of splenocytes in the allergic asthma mice after oral administration of VA was also observed. All the features of the asthmatic phenotype, including airway inflammation and the development of airway hyperresponsiveness, were reduced by treatment with VA. These findings support the hypothesis that oral feeding of VA may be an effective way of alleviating asthmatic symptoms in humans.

  10. Predisposition assessment of mountainous forests to bark peeling by red deer (Cervus elaphus L. as a strategy in preventive forest habitat management

    Directory of Open Access Journals (Sweden)

    Friedrich Reimoser

    2011-06-01

    Full Text Available This paper presents a method to assess the predisposition of mountainous forests to bark peeling by red deer (Cervus elaphus, which illustrates options in preventive forest habitat management. We developed an expert system, based on expert interviews and literature analyses. We selected the most important site- and stand-related predisposing factors for bark peeling of red deer, considering the relation of food dependent and food independent settling stimuli. Within the mechanistic expert system, knowledge on predisposing effects of certain site and stand features is represented in the form of an award-penalty point system. In the current paper, we present the predisposition assessment system for bark peeling and the verification of the system with data of the inventory of natural resources of the Limestone Alps National Park (Upper Austria. Three site-related indicators, i.e. terrain features, roughness/smoothness of relief, and local climate, and six stand-related indicator, i.e. tree age, canopy cover, proportion of conifers, cover of herb layer, method of final cutting, and harassment, were included in the system. Both the chosen indicators and the overall assessment clearly reflected the predisposition in terms of relative frequencies of peeled and unpeeled sample plots. A supplemental logistic regression run with the occurrence/absence of bark peeling as response variable and the assessed predisposition scores from the PAS as explanatory variable proved the discriminatory value of the PAS.

  11. Population genetic structure of wild and farmed rusa deer (Cervus timorensis russa) in New-Caledonia inferred from polymorphic microsatellite loci.

    Science.gov (United States)

    de Garine-Wichatitsky, M; de Meeûs, T; Chevillon, C; Berthier, D; Barré, N; Thévenon, S; Maillard, J-C

    2009-12-01

    Historical records indicate that 12 rusa deer (Cervus timorensis russa) were introduced in New-Caledonia during the 1870s. We used eight polymorphic microsatellite DNA loci to assess the genetic differentiation and diversity of farmed and wild deer populations. Past genetic bottlenecks were detected in both sub-populations, although higher genetic diversity was maintained in farmed populations, probably due to the regular introduction of reproducers from wild populations and from other farms. The genetic structure of farmed and wild populations differed significantly. There was a significant isolation by distance for wild populations, whereas farmed populations were significantly differentiated between farms independently from their geographical proximity. Wild rusa deer consisted of small populations (with effective population sizes ranging between 7 and 19 individuals depending on the methods used), with a low parent-offspring dispersion range (0.20-2.02 km). Genetic tools and direct observations provided congruent estimates of dispersion and population sizes. We discuss the relevance of our results for management purposes. PMID:19680748

  12. BUFFALO PEAKS WILDERNESS STUDY AREA, COLORADO.

    Science.gov (United States)

    Hedlund, D.C.; Wood, R.H.

    1984-01-01

    Field investigations were conducted to evaluate the mineral-resource potential of the Buffalo Peaks Wilderness Study Area, Colorado. On the basis of this study there is a probable mineral-resource potential for silver vein and bedding replacement deposits along the Weston Pass fault zone, for hydrothermal vein-type uranium deposits in the vicinity of the Parkdale iron pit, and for gold vein deposits in the parts of the Granite and Four Mile districts that are within the wilderness study area. A probable barite resource potential occurs at Rough and Tumbling Creek and near Spring Creek on the east side of the study area. There is little promise for the occurrence of energy resources.

  13. Ponnequin Wind Energy Project Weld County, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-08-01

    The purpose of this environmental assessment (EA) is to provide the U.S. Department of Energy (DOE) and the public with information on potential environmental impacts associated with the development of the Ponnequin Wind Energy Project in Colorado. This EA and public comments received on it will be used in DOE`s deliberations on whether to release funding for the project. This document provides a detailed description of the proposed project and an assessment of potential impacts associated with its construction and operations. Resources and conditions considered in the analysis include streams; wetlands; floodplains; water quality; soils; vegetation; air quality; socioeconomic conditions; energy resources; noise; transportation; cultural resources; visual and land use resources; public health and safety; wildlife; threatened, endangered, and candidate species; and cumulative impacts. The analysis found that the project would have minimal impacts on these resources and conditions, and would not create impacts that exceed the significance criteria defined in this document. 90 refs., 5 figs.

  14. Environmental geology of the Summitville mine, Colorado

    Science.gov (United States)

    Gray, John E.; Coolbaugh, Mark F.; Plumlee, Geoffrey S.; Atkinson, William W.

    1994-01-01

    Although altered and mineralized rocks at Summitville mine in Colorado contain minimal amount of sulfide minerals, acid mine problems existed primarily because of the pervasive alteration of the surrounding rocks, through hydrothermal process, to highly siliceous and argillized rocks that are incapable of buffering acidic waters during weathering. The problems are compounded by the continued exposure of altered and mineralized rocks in open pit, heap leach pad and waste piles to oxygenated waters. Inadequate subsurface structural control and underground mine workings also greatly affect water quality and the location of acid mine drainage output. It is expected that with these initial results, geological studies on constrained acid-generation from ore and altered rocks will be pursued.

  15. Dike rocks of the Apishapa Quadrangle, Colorado

    Science.gov (United States)

    Cross, Whitman

    1915-01-01

    The Apishapa quadrangle, the geographic relations of which are shown by Plate IV, is situated on the plains south of Arkansas River, in Colorado, about 24 miles east of the mountain front. The geology of the Pueblo, Walsenburg, Spanish Peaks, and Elmoro quadrangles, adjoining it on the northwest, west, southwest, and south, respectively, has been described in folios of the Geologic Atlas. G. K. Gilbert, assisted by F. P. Gulliver and G. W. Stose, took up the survey of the Apishapa area in 1894. The Apishapa folio was completed by Stose and was issued in 1913. The rocks to be described in this paper were collected by Gilbert and his assistants, the present writer never having visited the area. The following description of the occurrence of the has been kindly furnished by Mr. Stose.

  16. Final Critical Habitat for the Colorado pikeminnow (Ptychocheilus lucius)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — To provide the user with a general idea of areas where final critical habitat for Colorado pikeminnow (Ptychocheilus lucius) occur based on the description provided...

  17. Saturated thickness of the High Plains Aquifer, Colorado, 2000

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — These data are in support of report DS 472 (Arnold and others, 2009). This data set represents the saturated thickness of the High Plains aquifer within Colorado....

  18. Final Critical Habitat for the Little Colorado spinedace (Lepidomeda vittata)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — provide the user with a general idea of areas where final critical habitat for Little Colorado spinedace (Lepidomeda vittata) occur based on the description...

  19. Excellence in Veterinary Medicine at Colorado State University

    Science.gov (United States)

    Tietz, William J.

    1977-01-01

    Colorado State University has developed a strong interdisciplinary faculty that provides the entire university with graduate and undergraduate instruction in the basic biomedical sciences--anatomy, physiology, and microbiology--in addition to instruction in the professional curriculum. (LBH)

  20. Corbiculae fluminea as a bioindicator on the Lower Colorado River

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Tissue samples from Asiatic clam (Corbimla fluminea) from the lower Colorado River were analyzed for trace element concentrations. Selenium and arsenic were...

  1. Mean-annual erosion potential for Colorado and New Mexico

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The U.S. Geological Survey Data Series provides raster data representing an estimate of the mean-annual erosion potential of a 30-meter raster cell in Colorado and...

  2. Colorado's hydrothermal resource base: an assessment

    Energy Technology Data Exchange (ETDEWEB)

    Pearl, R.H.

    1981-01-01

    As part of its effort to more accurately describe the nations geothrmal resource potential, the US Department of Energy/Division of Geothermal Energy contracted with the Colorado Geological survey to appraise the hydrothermal (hot water) geothermal resources of Colorado. Part of this effort required that the amount of energy that could possibly be contained in the various hydrothermal systems in Colorado be estimated. The findings of that assessment are presented. To make these estimates the geothermometer reservoir temperatures estimated by Barrett and Pearl (1978) were used. In addition, the possible reservoir size and extent were estimated and used. This assessment shows that the total energy content of the thermal systems in Colorado could range from 4.872 x 10{sup 15} BTU's to 13.2386 x 10{sup 15} BTU's.

  3. The Colorado Plateau coal assessment study area, 2000 (cpstdyg)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This is a coverage of the Colorado Plateau coal assessment study area. The study area outline was drawn on the county lines that most closely outline the...

  4. Photographs of historical mining operations in Colorado and Utah

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — A collection of photographs of mine sites, mining operations, and tailings taken prior to 1980 at a variety of sites throughout Colorado and Utah. A database of...

  5. US Forest Service Roadless Areas: Colorado Roadless Rule

    Data.gov (United States)

    US Forest Service, Department of Agriculture — A map service, available on the www that depicts the boundaries of Roadless Areas designated by the Colorado Roadless Rule of 2012 and managed by the US Forest...

  6. Host plant preference in Colorado potato beetle (Coleoptera: Chrysomelidae)

    Science.gov (United States)

    Field and laboratory-choice tests were conducted to better understand host plant preference by the Colorado potato beetle, Leptinotarsa decemlineata Say (Coleoptera: Chrysomelidae), in Virginia. In laboratory olfactometer studies, L. decemlineata preferred potato over both tomato and eggplant foli...

  7. Colorado's Voucher Law:Examining the Claim of Fiscal Neutrality

    OpenAIRE

    Kevin G. Welner

    2004-01-01

    Colorado's voucher law was declared unconstitutional by the Colorado Supreme Court on June 28, 2004. Voucher supporters have begun drafting revised legislation designed to address the legal problem. This article calls into question the key financial claim of revenue neutrality'a claim that was central to the promotion and passage of the departing voucher law. The author concludes that the voucher law was not revenue neutral, even though it attempts to exclude from eligibility those children a...

  8. Raton basin coalbed methane production picking up in Colorado

    Science.gov (United States)

    Hemborg, H. Thomas

    1996-01-01

    Coalbed methane production in the Raton basin of south-central Colorado and northeast New Mexico has gone over pilot testing and entered the development stage which is expected to last several years. The development work is restricted to roughly a 25 mile by 15 mile wide `fairway' centered about 20 miles west of Trinidad, Colorado. At last count, 85 wells were producing nearly 17.5 MMcfd of coalbed methane from the basin's Raton and Vermejo formation coals.

  9. The Colorado Plateau II : Biophysical, Socioeconomic, and Cultural Research

    OpenAIRE

    Riper, Charles Van; Mattson, David J.

    2005-01-01

    Abstract from GoogleBooks: The publication of The Colorado Plateau: Cultural, Biological, and Physical Research in 2004 marked a timely summation of current research in the Four Corners states. This new volume, derived from the seventh Biennial Conference on the Colorado Plateau in 2003, complements the previous book by again focusing on the integration of science into resource management issues. The 32 chapters range in content from measuring human impacts on cultural resources, through graz...

  10. Colorado River cutthroat habitat resistance and resilience to climate change

    OpenAIRE

    Olsen, Kate

    2013-01-01

    Colorado River cutthroat trout, Oncorhyncus clarki pleuriticus , occupy less than 12% of their historic range. Restoration and conservation of this species are currently under way across the upper Colorado River basin, but guidance to inform management decisions related to the impacts of climate change on cutthroat is lacking. Shifts in the thermal distribution of freshwater fish have been documented, and will continue to occur as cold water habitat is threatened by warming water temperatures...

  11. Update of the Accounting Surface Along the Lower Colorado River

    Science.gov (United States)

    Wiele, Stephen M.; Leake, Stanley A.; Owen-Joyce, Sandra J.; McGuire, Emmet H.

    2008-01-01

    The accounting-surface method was developed in the 1990s by the U.S. Geological Survey, in cooperation with the Bureau of Reclamation, to identify wells outside the flood plain of the lower Colorado River that yield water that will be replaced by water from the river. This method was needed to identify which wells require an entitlement for diversion of water from the Colorado River and need to be included in accounting for consumptive use of Colorado River water as outlined in the Consolidated Decree of the United States Supreme Court in Arizona v. California. The method is based on the concept of a river aquifer and an accounting surface within the river aquifer. The study area includes the valley adjacent to the lower Colorado River and parts of some adjacent valleys in Arizona, California, Nevada, and Utah and extends from the east end of Lake Mead south to the southerly international boundary with Mexico. Contours for the original accounting surface were hand drawn based on the shape of the aquifer, water-surface elevations in the Colorado River and drainage ditches, and hydrologic judgment. This report documents an update of the original accounting surface based on updated water-surface elevations in the Colorado River and drainage ditches and the use of simple, physically based ground-water flow models to calculate the accounting surface in four areas adjacent to the free-flowing river.

  12. A Possible Role for Rusa Deer (Cervus timorensis russa and Wild Pigs in Spread of Trypanosoma evansi from Indonesia to Papua New Guinea

    Directory of Open Access Journals (Sweden)

    SA Reid

    1999-03-01

    Full Text Available Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were monitored each second day for 120 days. Trypanosomes were observed in haematocrit tubes at the plasma-buffy coat interface of jugular blood of deer and pigs on 86% and 37% of sampling occasions respectively. Parasitaemia was at a high level in deer for 35% of the time but for only 11.5% of the time in pigs. Results indicate that both Rusa deer and pigs have a high tolerance for infection with T. evansi. The deer suffered mild anaemia evidenced by a 25% reduction in packed cell volume (PCV 14 days after infection which coincided with the initial peak in parasitaemia. However, PCV had returned to pre infection values by the end of the experiment. The pigs showed no change in PCV. There were no visual indications of disease in either species and appetite was not noticeably affected. It was concluded that both Rusa deer and pigs were capable reservoir hosts for T. evansi but that Rusa deer, with their more persistent higher levels of parasitaemia, have more potential to spread T. evansi into Papua New Guinea from West Irian than pigs.

  13. A field survey on the status of gastrointestinal helminth parasites in hangul (Cervus elaphus hanglu) in Dachigam National Park of Kashmir.

    Science.gov (United States)

    Lone, Bashir A; Chishti, M Z; Ahmad, Fayaz; Tak, Hidayatullah; Bandh, Suhaib A; Khan, Abida

    2016-09-01

    One year crossectional survey was carried out to determine and describe the prevalence and intensity of gastrointestinal parasite infections in hangul (Cervus elaphus hanglu) in Dachigam National Park of Kashmir through faecal examinations. Out of 153 faecal samples examined, 82 (53.59 %) were found infected with GIT helminthes. In present study seven helminth species were found, including five nematode [Haemonchus contortus (55.39 %), Trichuris ovis (39.75 %), Dictyocaulus viviparus (28.4.00 %), Oesophogostomum circumcincta (13.7 %) and Chabertia ovina (4.02 %)] one trematode [Fasciola hepatica (17.3 %)] and one cestode species [Moneizia expansa (6.05 %)]. Based on the severity of infection 81.7 % of hangul positive samples were severely infected (epg > 1,500), 8.3 % heavily infected (epg = 1,100-1,500), 3.8 % moderately infected (epg = 800-1,000) and 7.2 % mildly infected (epg = 500). Season, sex and age were the factors that influenced the epidemiological prevalence of GIT helminths in hangul in the present study. The maximum helminth infection was observed in summer season and lowest in winter (P = 0.003). Lower age groups were more infected than adult animals (P > 0.05). Prevalence was higher in males than females (P > 0.05). The present study will initially be of great significance to add to existing knowledge of the epidemiology of GIT helminth of hangul which is the pioneering study on this animal in the valley and the findings will be quite helpful to devise the appropriate control and prophylactic strategies for GIT helminthiasis of hangul in the Dachigam national park. PMID:27605778

  14. Pragmatic perspective on conservation genetics and demographic history of the last surviving population of Kashmir red deer (Cervus elaphus hanglu in India.

    Directory of Open Access Journals (Sweden)

    Mukesh

    Full Text Available The hangul (Cervus elaphus hanglu is of great conservation concern because it represents the easternmost and only hope for an Asiatic survivor of the red deer species in the Indian subcontinent. Despite the rigorous conservation efforts of the Department of Wildlife Protection in Jammu & Kashmir, the hangul population has experienced a severe decline in numbers and range contraction in the past few decades. The hangul population once abundant in the past has largely become confined to the Dachigam landscape, with a recent population estimate of 218 individuals. We investigated the genetic variability and demographic history of the hangul population and found that it has shown a relatively low diversity estimates when compared to other red deer populations of the world. Neutrality tests, which are used to evaluate demographic effects, did not support population expansion, and the multimodal pattern of mismatch distribution indicated that the hangul population is under demographic equilibrium. Furthermore, the hangul population did not exhibit any signature of bottleneck footprints in the past, and Coalescent Bayesian Skyline plot analysis revealed that the population had not experienced any dramatic changes in the effective population size over the last several thousand years. We observed a strong evidence of sub-structuring in the population, wherein the majority of individuals were assigned to different clusters in Bayesian cluster analysis. Population viability analysis demonstrated insignificant changes in the mean population size, with a positive growth rate projected for the next hundred years. We discuss the phylogenetic status of hangul for the first time among the other red deer subspecies of the world and strongly recommend to upgrade hangul conservation status under IUCN that should be discrete from the other red deer subspecies of the world to draw more conservation attention from national and international bodies.

  15. Prevalence of Liver Fluke (Fasciola hepatica) in Wild Red Deer (Cervus elaphus): Coproantigen ELISA Is a Practicable Alternative to Faecal Egg Counting for Surveillance in Remote Populations.

    Science.gov (United States)

    French, Andrew S; Zadoks, Ruth N; Skuce, Philip J; Mitchell, Gillian; Gordon-Gibbs, Danielle K; Craine, Alexandra; Shaw, David; Gibb, Stuart W; Taggart, Mark A

    2016-01-01

    Red deer (Cervus elaphus) are hosts of liver fluke (Fasciola hepatica); yet, prevalence is rarely quantified in wild populations. Testing fresh samples from remote regions by faecal examination (FE) can be logistically challenging; hence, we appraise frozen storage and the use of a coproantigen ELISA (cELISA) for F. hepatica surveillance. We also present cELISA surveillance data for red deer from the Highlands of Scotland. Diagnoses in faecal samples (207 frozen, 146 fresh) were compared using a cELISA and by FE. For each storage method (frozen or fresh), agreement between the two diagnostics was estimated at individual and population levels, where population prevalence was stratified into cohorts (e.g., by sampling location). To approximate sensitivity and specificity, 65 post-slaughter whole liver examinations were used as a reference. At the individual level, FE and cELISA diagnoses agreed moderately (κfrozen = 0.46; κfresh = 0.51), a likely reflection of their underlying principles. At the population level, FE and cELISA cohort prevalence correlated strongly (Pearson's R = 0.89, p advantages of cELISA over FE: i) the ability to store samples long term (frozen) without apparent loss in diagnostic power; and ii) reduced labour and the ability to process large batches. Further evaluation of cELISA sensitivity in red deer, where a range of fluke burdens can be obtained, is desirable. In the interim, the cELISA is a practicable diagnostic for F. hepatica surveillance in red deer, and its application here has revealed considerable geographic, temporal, sex and age related differences in F. hepatica prevalence in wild Scottish Highland red deer. PMID:27598003

  16. A possible role for rusa deer (Cervus timorensis russa) and wild pigs in spread of Trypanosoma evansi from Indonesia to Papua New Guinea.

    Science.gov (United States)

    Reid, S; Husein, A; Hutchinson, G; Copeman, D

    1999-01-01

    Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa) and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were monitored each second day for 120 days. Trypanosomes were observed in haematocrit tubes at the plasma-buffy coat interface of jugular blood of deer and pigs on 86% and 37% of sampling occasions respectively. Parasitaemia was at a high level in deer for 35% of the time but for only 11.5% of the time in pigs. Results indicate that both Rusa deer and pigs have a high tolerance for infection with T. evansi. The deer suffered mild anaemia evidenced by a 25% reduction in packed cell volume (PCV) 14 days after infection which coincided with the initial peak in parasitaemia. However, PCV had returned to pre infection values by the end of the experiment. The pigs showed no change in PCV. There were no visual indications of disease in either species and appetite was not noticeably affected. It was concluded that both Rusa deer and pigs were capable reservoir hosts for T. evansi but that Rusa deer, with their more persistent higher levels of parasitaemia, have more potential to spread T. evansi into Papua New Guinea from West Irian than pigs. PMID:10224527

  17. Economic impact study of the Uranium Mill Tailings Remedial Action Project in Colorado: Colorado State fiscal year 1994. Revision 1

    International Nuclear Information System (INIS)

    The Colorado economic impact study summarizes employment and economic benefits to the state from activities associated with the Uranium Mill Tailings Remedial Action (UMTRA) Project during Colorado state fiscal year 1994 (1 July 1993 through 30 June 1994). To capture employment information, a questionnaire was distributed to subcontractor employees at the active UMTRA Project sites of Grand Junction, Naturita, Gunnison, and Rifle, Colorado. Economic data were requested from each site prime subcontractor, as well as from the Remedial Action Contractor. Information on wages, taxes, and subcontract expenditures in combination with estimates and economic multipliers is used to estimate the dollar economic benefits to Colorado during the state fiscal year. Finally, the fiscal year 1994 estimates are compared to fiscal year 1993 employment and economic information

  18. Economic impact study of the Uranium Mill Tailings Remedial Action Project in Colorado: Colorado State fiscal year 1994. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1994-12-01

    The Colorado economic impact study summarizes employment and economic benefits to the state from activities associated with the Uranium Mill Tailings Remedial Action (UMTRA) Project during Colorado state fiscal year 1994 (1 July 1993 through 30 June 1994). To capture employment information, a questionnaire was distributed to subcontractor employees at the active UMTRA Project sites of Grand Junction, Naturita, Gunnison, and Rifle, Colorado. Economic data were requested from each site prime subcontractor, as well as from the Remedial Action Contractor. Information on wages, taxes, and subcontract expenditures in combination with estimates and economic multipliers is used to estimate the dollar economic benefits to Colorado during the state fiscal year. Finally, the fiscal year 1994 estimates are compared to fiscal year 1993 employment and economic information.

  19. Colorado River Wildlife Management Area (Colorado and Gunnison River Easements) [Land Status Map: Sheet 2 of 2

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This map was produced by the Division of Realty to depict landownership at Colorado River Wildlife Management Area. It was generated from rectified aerial...

  20. Colorado Better Buildings Project Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Strife, Susie; Yancey, Lea

    2013-12-30

    The Colorado Better Buildings project intended to bring new and existing energy efficiency model programs to market with regional collaboration and funding partnerships. The goals for Boulder County and its program partners were to advance energy efficiency investments, stimulate economic growth in Colorado and advance the state’s energy independence. Collectively, three counties set out to complete 9,025 energy efficiency upgrades in 2.5 years and they succeeded in doing so. Energy efficiency upgrades have been completed in more than 11,000 homes and businesses in these communities. Boulder County and its partners received a $25 million BetterBuildings grant from the U.S. Department of Energy under the American Recovery and Reinvestment Act in the summer of 2010. This was also known as the Energy Efficiency and Conservation Block Grants program. With this funding, Boulder County, the City and County of Denver, and Garfield County set out to design programs for the residential and commercial sectors to overcome key barriers in the energy upgrade process. Since January 2011, these communities have paired homeowners and business owners with an Energy Advisor – an expert to help move from assessment to upgrade with minimal hassle. Pairing this step-by-step assistance with financing incentives has effectively addressed many key barriers, resulting in energy efficiency improvements and happy customers. An expert energy advisor guides the building owner through every step of the process, coordinating the energy assessment, interpreting results for a customized action plan, providing a list of contractors, and finding and applying for all available rebates and low-interest loans. In addition to the expert advising and financial incentives, the programs also included elements of social marketing, technical assistance, workforce development and contractor trainings, project monitoring and verification, and a cloud-based customer data system to coordinate among field

  1. Puente Río Colorado - Costa Rica

    Directory of Open Access Journals (Sweden)

    Kulka, F.

    1973-03-01

    Full Text Available The Colorado River bridge is located in a 95 m deep canyon, with a 122 m span. To choose the type of bridge, it has been endeavoured to use the largest possible number of national building materials which, together with the difficulty of reaching the site, meant that a series of classical solutions had to be rejected. That of an arch bridge was adopted, with a reversed support on prestressed cables, on which the road passes. The system is based on the hanging bridge principle, but with the rolling track resting on the cables, instead of hanging from them. There is a first cover, made up of prefabricated components, on the cables, which strengthens the bridge's stability. This cover supports three portal-columns, the pillars of the final roadway. The cables were prestressed from the heads of the two sloping pillars. The two side spans were designed with prefabricated T girders.El puente Río Colorado está situado en un cañón de 95 m de profundidad, salvando una luz de 122 m. Para la elección del tipo de puente se ha procurado emplear el mayor número posible de materiales de construcción nacionales, lo que, unido a la dificultad de acceso a la obra, hizo que se rechazaran una serie de soluciones clásicas. Se adoptó la de un puente-arco con un soporte invertido sobre cables pretensados, encima del cual descansa la calzada. El sistema está basado en los principios del puente colgante, pero apoyando el camino de rodadura en los cables, en lugar de colgarlo de ellos. Sobre los cables existe una primera cubierta, integrada por elementos prefabricados, que refuerza la estabilidad del puente. Esta cubierta soporta tres pórticos-columna, pilares de la calzada definitiva. El pretensado de los cables se realizó desde las cabezas de dos pilares inclinados. Los dos vanos laterales se proyectaron con vigas en T prefabricadas.

  2. Approaches to local climate action in Colorado

    Science.gov (United States)

    Huang, Y. D.

    2011-12-01

    Though climate change is a global problem, the impacts are felt on the local scale; it follows that the solutions must come at the local level. Fortunately, many cities and municipalities are implementing climate mitigation (or climate action) policies and programs. However, they face many procedural and institutional barriers to their efforts, such of lack of expertise or data, limited human and financial resources, and lack of community engagement (Krause 2011). To address the first obstacle, thirteen in-depth case studies were done of successful model practices ("best practices") of climate action programs carried out by various cities, counties, and organizations in Colorado, and one outside Colorado, and developed into "how-to guides" for other municipalities to use. Research was conducted by reading documents (e.g. annual reports, community guides, city websites), email correspondence with program managers and city officials, and via phone interviews. The information gathered was then compiled into a series of reports containing a narrative description of the initiative; an overview of the plan elements (target audience and goals); implementation strategies and any indicators of success to date (e.g. GHG emissions reductions, cost savings); and the adoption or approval process, as well as community engagement efforts and marketing or messaging strategies. The types of programs covered were energy action plans, energy efficiency programs, renewable energy programs, and transportation and land use programs. Between the thirteen case studies, there was a range of approaches to implementing local climate action programs, examined along two dimensions: focus on climate change (whether it was direct/explicit or indirect/implicit) and extent of government authority. This benchmarking exercise affirmed the conventional wisdom propounded by Pitt (2010), that peer pressure (that is, the presence of neighboring jurisdictions with climate initiatives), the level of

  3. Elementary particle physics and high energy phenomena. [Dept. of Physics, Univ. of Colorado, Boulder, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Barker, A.R.; Cumalat, J.P.; De Alwis, S.P.; DeGrand, T.A.; Ford, W.T.; Mahanthappa, K.T.; Nauenberg, U.; Rankin, P.; Smith, J.G.

    1992-06-01

    Experimental and theoretical high-energy physics programs at the University of Colorado are reported. Areas of concentration include the following: study of the properties of the Z[sup 0] with the SLD detector; fixed-target K-decay experiments; the R D program for the muon system: the SDC detector; high-energy photoproduction of states containing heavy quarks; electron--positron physics with the CLEO II detector at CESR; lattice QCD; and spin models and dynamically triangulated random surfaces. 24 figs., 2 tabs., 117 refs.

  4. 75 FR 66786 - Notice of Invitation To Participate; Exploration for Coal in Colorado License Application COC-74447

    Science.gov (United States)

    2010-10-29

    ... State Office, 2850 Youngfield Street, Lakewood, Colorado 80215, and the BLM, Little Snake Field Office... Director, in writing, at the BLM Colorado State Office, 2850 Youngfield Street, Lakewood, Colorado...

  5. 75 FR 44983 - Notice of Invitation To Participate; Exploration for Coal in Colorado; License Application COC-74235

    Science.gov (United States)

    2010-07-30

    ... Office, 2850 Youngfield Street, Lakewood, Colorado 80215 and the BLM, Uncompahgre Field Office, 2505 S..., in writing, at the BLM Colorado State Office, 2850 Youngfield Street, Lakewood, Colorado 80215...

  6. Dendroclimatic reconstructions for the southern Colorado plateau

    Energy Technology Data Exchange (ETDEWEB)

    Dean, J.S.; Funkhouser, G.S. [Univ. of Arizona, Tucson, AZ (United States)

    1995-09-01

    A geographical network of climate sensitive tree-ring chronologies consisting of 25 archaeological sequences and two bristlecone pine series provides the basis for high resolution reconstructions of low and high frequency climatic variability on the southern Colorado Plateau over the last 1,500 years. Qualitative and quantitative dendroclimatic analyses of these data produce annual retrodictions of yearly and seasonal precipitation and summer Palmer Drought Severity Indices for each station and reconstructions of regional scale patterns in climatic variability. These reconstructions provide detailed information on climatic fluctuations that affected biotic and human populations as well as long-term baseline data for evaluating present-day climate and estimating future climatic trends. When integrated with other measures of past environmental variability, these reconstructions specify periods of favorable and unfavorable environmental conditions that would have affected past human populations of the region. The severest degradation, which occurred between A.D. 1250 and 1450, probably was causally related to numerous cultural changes that occurred at the end of the l3th century including the Anasazi abandonment of the Four Comers area. Projecting environmental patterns that characterized the last two millennia into the future indicates potential hazards to long term uranium mill waste disposal and containment and the potential and limitations of environmental restoration.

  7. Preliminary Site Characterization Report, Rulsion Site, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-08-01

    This report is a summary of environmental information gathered during a review of the documents pertaining to Project Rulison and interviews with personnel who worked on the project. Project Rulison was part of Operation Plowshare (a program designed to explore peaceful uses for nuclear devices). The project consisted of detonating a 43-kiloton nuclear device on September 10, 1969, in western Colorado to stimulate natural gas production. Following the detonation, a reentry well was drilled and several gas production tests were conducted. The reentry well was shut-in after the last gas production test and was held in standby condition until the general cleanup was undertaken in 1972. A final cleanup was conducted after the emplacement and testing wells were plugged in 1976. However, some surface radiologic contamination resulted from decontamination of the drilling equipment and fallout from the gas flaring during drilling operations. With the exception of the drilling effluent pond, all surface contamination at the Rulison Site was removed during the cleanup operations. All mudpits and other excavations were backfilled, and both upper and lower drilling pads were leveled and dressed. This report provides information regarding known or suspected areas of contamination, previous cleanup activities, analytical results, a review of the regulatory status, the site`s physical environment, and future recommendations for Project Ruhson. Based on this research, several potential areas of contamination have been identified. These include the drilling effluent pond and mudpits used during drilling operations. In addition, contamination could migrate in the gas horizon.

  8. Colorado longitudinal twin study of reading disability.

    Science.gov (United States)

    Wadsworth, Sally J; DeFries, John C; Olson, Richard K; Willcutt, Erik G

    2007-12-01

    The primary objectives of the present study are to introduce the Colorado Longitudinal Twin Study of Reading Disability, the first longitudinal twin study in which subjects have been specifically selected for having a history of reading difficulties, and to present some initial assessments of the stability of reading performance and cognitive abilities in this sample. Preliminary examination of the test scores of 124 twins with a history of reading difficulties and 154 twins with no history of reading difficulties indicates that over the 5- to 6-year interval between assessments, cognitive and reading performance are highly stable. As a group, those subjects with a history of reading difficulties had substantial deficits relative to control subjects on all measures at initial assessment, and significant deficits remained at follow-up. The stability noted for all cognitive and achievement measures was highest for a composite measure of reading, whose average stability correlation across groups was 0.80. Results of preliminary behavior genetic analyses for this measure indicated that shared genetic influences accounted for 86% and 49% of the phenotypic correlations between the two assessments for twin pairs with and without reading difficulties, respectively. In addition, genetic correlations reached unity for both groups, suggesting that the same genetic influences are manifested at both time points. PMID:18060583

  9. 75 FR 38768 - Ashley National Forest, UT, High Uintas Wilderness-Colorado River Cutthroat Trout Habitat...

    Science.gov (United States)

    2010-07-06

    ... Forest Service Ashley National Forest, UT, High Uintas Wilderness--Colorado River Cutthroat Trout Habitat...) proposes to restore genetically pure Colorado River cutthroat trout (CRCT; Onchorhynchus clarki pleuriticus... District. Nonnative fish species to be removed are primarily brook trout (Salvelinus...

  10. SRTM Anaglyph: Pinon Canyon region, Colorado

    Science.gov (United States)

    2001-01-01

    Erosional features are prominent in this view of southern Colorado taken by the Shuttle Radar Topography Mission (SRTM). The area covers about 20,000square kilometers and is located about 50 kilometers south of Pueblo, Colorado. The prominent mountains near the left edge of the image are the Spanish Peaks, remnants of a 20 million year old volcano. Rising 2,100 meters (7,000 feet) above the plains to the east, these igneous rock formations with intrusions of eroded sedimentary rock historically served as guiding landmarks for travelers on the Mountain Branch of the Santa Fe Trail.Near the center of the image is the Pinon Canyon Maneuver Site, a training area for soldiers of the U.S. Army from nearby Fort Carson. The site supports a diverse ecosystem with large numbers of big and small game, fisheries, non-game wildlife, forest, range land and mineral resources. It is bounded on the east by the dramatic topography of the Purgatoire River Canyon, a 100 meter (328 feet) deep scenic red canyon with flowing streams, sandstone formations and exposed geologic processes.This anaglyph was produced by first shading a preliminary SRTM elevation model. The stereoscopic effect was then created by generating two differing perspectives, one for each eye. When viewed through special glasses, the result is a vertically exaggerated view of the Earth's surface in its full three dimensions. Anaglyph glasses cover the left eye with a red filter and cover the right eye with a blue filter.Elevation data used in this image was acquired by the Shuttle Radar Topography Mission (SRTM) aboard the Space Shuttle Endeavour, launched on Feb. 11, 2000. SRTM used the same radar instrument that comprised the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR)that flew twice on the Space Shuttle Endeavour in 1994. SRTM was designed to collect three-dimensional measurements of the Earth's surface. To collect the 3-D data, engineers added a 60-meter-long (200-foot) mast, installed

  11. Denitrification in marine shales in northeastern Colorado

    Science.gov (United States)

    McMahon, P.B.; Böhlke, J.K.; Bruce, B.W.

    1999-01-01

    Parts of the South Platte River alluvial aquifer in northeastern Colorado are underlain by the Pierre Shale, a marine deposit of Late Cretaceous age that is denitrification in the forms of organic carbon and sulfide minerals. Nested piezometers were sampled, pore water was squeezed from cores of shale, and an injection test was conducted to determine if denitrification in the shale was a sink for alluvial NO3/- and to measure denitrification rates in the shale. Measured values of NO3/-, N2, NH4/+, ??15[NO3/-], ??15N[N2], and ??15N[NH4/+] in the alluvial and shale pore water indicated that denitrification in the shale was a sink for alluvial NO3/-. Chemical gradients, reaction rate constants, and hydraulic head data indicated that denitrification in the shale was limited by the slow rate of NO3/- transport (possibly by diffusion) into the shale. The apparent in situ first-order rate constant for denitrification in the shale based on diffusion calculations was of the order of 0.04-0.4 yr-1, whereas the potential rate constant in the shale based on injection tests was of the order of 60 yr-1. Chemical data and mass balance calculations indicate that organic carbon was the primary electron donor for denitrification in the shale during the injection test, and ferrous iron was a minor electron donor in the process. Flux calculations for the conditions encountered at the site indicate that denitrification in the shale could remove only a small fraction of the annual agricultural NO3/- input to the alluvial aquifer. However, the relatively large potential first-order rate constant for denitrification in the shale indicated that the percentage of NO3/- uptake by the shale could be considerably larger in areas where NO3/- is transported more rapidly into the shale by advection.

  12. Uranium deposits: northern Denver Julesburg basin, Colorado

    International Nuclear Information System (INIS)

    The Fox Hills Sandstone and the Laramie Formation (Upper Cretaceous) are the host rocks for uranium deposits in Weld County, northern Denver Julesburg basin, Colorado. The uranium deposits discovered in the Grover and Sand Creek areas occur in well-defined north--south trending channel sandstones of the Laramie Formation whereas the sandstone channel in the upper part of the Fox Hills Sandstone trends east--west. Mineralization was localized where the lithology was favorable for uranium accumulation. Exploration was guided by log interpretation methods similar to those proposed by Bruce Rubin for the Powder River basin, Wyoming, because alteration could not be readily identified in drilling samples. The uranium host rocks consist of medium- to fine-grained carbonaceous, feldspathic fluvial channel sandstones. The uranium deposits consist of simple to stacked roll fronts. Reserve estimates for the deposits are: (1) Grover 1,007,000 lbs with an average grade of 0.14 percent eU3O8,2) Sand Creek 154,000 lbs with an average grade of 0.08 percent eU3O8, and 3) The Pawnee deposit 1,060,000 lbs with an average grade of 0.07 percent eU3O8. The configuration of the geochemical cells in the Grover and Sand Creek sandstones indicate that uraniferous fluids moved northward whereas in the Pawnee sandstone of the Fox Hills uraniferous fluids moved southward. Precipitation of uranium in the frontal zone probably was caused by downdip migration of oxygcnated groundwater high in uranium content moving through a favorable highly carbonaceous and pyritic host sandstone

  13. Environmental assessment, expanded Ponnequin wind energy project, Weld County, Colorado

    International Nuclear Information System (INIS)

    The US Department of Energy (DOE) has considered a proposal from the State of Colorado, Office of Energy Conservation (OEC), for funding construction of the Expanded Ponnequin Wind Project in Weld County, Colorado. OEC plans to enter into a contracting arrangement with Public Service Company of Colorado (PSCo) for the completion of these activities. PSCo, along with its subcontractors and business partners, are jointly developing the Expanded Ponnequin Wind Project. The purpose of this Final Environmental Assessment (EA) is to provide DOE and the public with information on potential environmental impacts associated with the Expanded Ponnequin Wind Energy Project. This EA, and public comments received on it, were used in DOE's deliberations on whether to release funding for the expanded project under the Commercialization Ventures Program

  14. Environmental assessment, expanded Ponnequin wind energy project, Weld County, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-02-01

    The US Department of Energy (DOE) has considered a proposal from the State of Colorado, Office of Energy Conservation (OEC), for funding construction of the Expanded Ponnequin Wind Project in Weld County, Colorado. OEC plans to enter into a contracting arrangement with Public Service Company of Colorado (PSCo) for the completion of these activities. PSCo, along with its subcontractors and business partners, are jointly developing the Expanded Ponnequin Wind Project. The purpose of this Final Environmental Assessment (EA) is to provide DOE and the public with information on potential environmental impacts associated with the Expanded Ponnequin Wind Energy Project. This EA, and public comments received on it, were used in DOE`s deliberations on whether to release funding for the expanded project under the Commercialization Ventures Program.

  15. 78 FR 69985 - Irish Potatoes Grown in Colorado; Decreased Assessment Rate for Area No. 2

    Science.gov (United States)

    2013-11-22

    ... approved, an assessment rate for Colorado Area No. 2 that would continue in effect from fiscal period to..., 2013, an assessment rate of $0.0033 per hundredweight is established for Colorado Area No. 2 potatoes... Agricultural Marketing Service 7 CFR Part 948 Irish Potatoes Grown in Colorado; Decreased Assessment Rate...

  16. 40 CFR 52.331 - Committal SIP for the Colorado Group II PM10 areas.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Committal SIP for the Colorado Group II... SIP for the Colorado Group II PM10 areas. On April 14, 1989, the Governor submitted a Committal SIP for the Colorado Group II PM10 areas. The SIP commits the State to continue to monitor for...

  17. 76 FR 77549 - Colorado River Indian Tribes-Amendment to Health & Safety Code, Article 2. Liquor

    Science.gov (United States)

    2011-12-13

    ... Bureau of Indian Affairs Colorado River Indian Tribes--Amendment to Health & Safety Code, Article 2... amendment to the Colorado River Tribal Health and Safety Code, Article 2. Liquor, Section 2-403(12). The... Indian Tribal Council adopted this amendment to the Colorado River Tribal Health and Safety Code,...

  18. 78 FR 72706 - Notice of Inventory Completion: Colorado State University, Fort Collins, CO

    Science.gov (United States)

    2013-12-03

    ... National Park Service Notice of Inventory Completion: Colorado State University, Fort Collins, CO AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: Colorado State University (CSU) has completed an... in this notice by January 2, 2014. ADDRESSES: Christopher Green, Colorado State University,...

  19. 75 FR 45657 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2010-08-03

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY... of human remains in the control of the University of Colorado Museum, Boulder, CO. The human remains... this notice. A detailed assessment of the human remains was made by the University of Colorado...

  20. 75 FR 28647 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2010-05-21

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY... of human remains in the possession of the University of Colorado Museum, Boulder, CO. The human... this notice. A detailed assessment of the human remains was made by University of Colorado...

  1. 76 FR 62839 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2011-10-11

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The University of Colorado Museum has completed... contact the University of Colorado Museum. Disposition of the human remains to the Indian tribes...

  2. 75 FR 26988 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2010-05-13

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY... of human remains in the possession of the University of Colorado Museum, Boulder, CO. The human... this notice. A detailed assessment of the human remains was made by University of Colorado...

  3. 75 FR 42771 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2010-07-22

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY... of human remains and associated funerary objects in the control of the University of Colorado Museum... assessment of the human remains was made by the University of Colorado Museum professional staff...

  4. 75 FR 77898 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2010-12-14

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY... of human remains in the possession of the ] University of Colorado Museum, Boulder, CO. The human... made by University of Colorado Museum professional staff in consultation with representatives of...

  5. 78 FR 59960 - Notice of Inventory Completion: Colorado State University, Fort Collins, CO

    Science.gov (United States)

    2013-09-30

    ... National Park Service Notice of Inventory Completion: Colorado State University, Fort Collins, CO AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: Colorado State University has completed an... remains should submit a written request to Colorado State University, Department of Anthropology. If...

  6. 78 FR 50103 - Notice of Inventory Completion: Colorado State University, Fort Collins, CO

    Science.gov (United States)

    2013-08-16

    ... National Park Service Notice of Inventory Completion: Colorado State University, Fort Collins, CO AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: Colorado State University has completed an... remains should submit a written request to Colorado State University, Department of Anthropology. If...

  7. 75 FR 45655 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2010-08-03

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY... of human remains in the control of the University of Colorado Museum, Boulder, CO. The human remains.... A detailed assessment of the human remains was made by the University of Colorado...

  8. 75 FR 57290 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2010-09-20

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY... of human remains and associated funerary objects in the control of the University of Colorado Museum... assessment of the human remains was made by the University of Colorado Museum professional staff...

  9. 76 FR 62833 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2011-10-11

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The University of Colorado Museum has completed... contact the University of Colorado Museum. Disposition of the human remains and associated funerary...

  10. 2010 Kids Count in Colorado! Far from Average: Growing Gaps in Child Well-Being

    Science.gov (United States)

    Colorado Children's Campaign, 2010

    2010-01-01

    "Kids Count in Colorado!" is an annual publication of the Colorado Children's Campaign, which provides the best available state- and county-level data to measure and track the education, health and general well-being of the state's children. "Kids Count in Colorado!" informs policy debates and community discussions, serving as a valuable resource…

  11. Small Wind Turbine Applications: Current Practice in Colorado

    International Nuclear Information System (INIS)

    Numerous small wind turbines are being used by homeowners in Colorado. Some of these installations are quite recent while others date back to the federal tax-credit era of the early 1980s. Through visits with small wind turbine owners in Colorado, I have developed case studies of six small wind energy applications focusing on the wind turbine technology, wind turbine siting, the power systems and electric loads, regulatory issues, and motivations about wind energy. These case studies offer a glimpse into the current state-of-the-art of small-scale wind energy and provide some insight into issues affecting development of a wider market

  12. Assessment of surface-water quantity and quality, Eagle River watershed, Colorado, 1947-2007

    Science.gov (United States)

    Williams, Cory A.; Moore, Jennifer L.; Richards, Rodney J.

    2011-01-01

    From the early mining days to the current tourism-based economy, the Eagle River watershed (ERW) in central Colorado has undergone a sequence of land-use changes that has affected the hydrology, habitat, and water quality of the area. In 2000, the USGS, in cooperation with the Colorado River Water Conservation District, Eagle County, Eagle River Water and Sanitation District, Upper Eagle Regional Water Authority, Colorado Department of Transportation, City of Aurora, Town of Eagle, Town of Gypsum, Town of Minturn, Town of Vail, Vail Resorts, City of Colorado Springs, Colorado Springs Utilities, and Denver Water, initiated a retrospective analysis of surface-water quantity and quality in the ERW.

  13. Promoting Equalization and Local Control in Financing Colorado's Schools.

    Science.gov (United States)

    Mathers, Judith K.; King, Richard A.

    1997-01-01

    Per-pupil property valuation extremes among Colorado school districts are as varied as the landscape. A foundation plan levels funding disparities for school operations, but financing of major capital outlay projects still depends on local property taxation. Funds are needed to finance classroom technologies and Internet connections. (MLH)

  14. Colorado Model Content Standards for Music: Suggested Grade Level Expectations.

    Science.gov (United States)

    Colorado State Dept. of Education, Denver.

    The state of Colorado has set forth five content standards for music education in its public schools: (1) students sing or play on instruments a varied repertoire of music, alone or with others; (2) students will read and notate music; (3) students will create music; (4) students will listen to, analyze, evaluate, and describe music; and (5)…

  15. Problem Based Learning at the University of Colorado at Denver.

    Science.gov (United States)

    Duffield, Judith A.; Grabinger, R. Scott

    This paper provides a brief overview of Problem-Based Learning (PBL) as an instructional methodology. A description of a graduate program for practicing teachers at the University of Colorado at Denver (UCD) is also included. Problem-based learning is a student-centered instructional methodology that teaches content and skills within a knowledge…

  16. Looking Forward: Colorado's Fiscal Prospects Amid a Financial Crisis

    Science.gov (United States)

    Buchanan, Wade, Ed.; Jones, Rich, Ed.; Watt, Joe, Ed

    2009-01-01

    This report projects the amount Colorado would need to spend to maintain state services at 2007 levels through fiscal year 2012-13 and the amount of revenues that will be generated to pay for them. The costs of services were estimated based on factors that drive the budget, such as the number of students in college, inflation rates and the number…

  17. 78 FR 62001 - Colorado Disaster Number CO-00066

    Science.gov (United States)

    2013-10-10

    ... ADMINISTRATION Colorado Disaster Number CO-00066 AGENCY: U.S. Small Business Administration. ACTION: Amendment 1...: 06/24/2014. ADDRESSES: Submit completed loan applications to: U.S. Small Business Administration... CONTACT: A. Escobar, Office of Disaster Assistance, U.S. Small Business Administration, 409 3rd Street...

  18. 78 FR 62001 - Colorado Disaster Number CO-00065

    Science.gov (United States)

    2013-10-10

    ... ADMINISTRATION Colorado Disaster Number CO-00065 AGENCY: U.S. Small Business Administration. ACTION: Amendment 3... loan applications to: U.S. Small Business Administration, Processing and Disbursement Center, 14925... Assistance, U.S. Small Business Administration, 409 3rd Street SW., Suite 6050, Washington, DC...

  19. From Colorado to Guam: Infant Diagnostic Audiological Evaluations by Telepractice

    Science.gov (United States)

    Hayes, Deborah; Eclavea, Elaine; Dreith, Susan; Habte, Bereket

    2012-01-01

    This manuscript describes a pilot project in which infants in Guam who refer on newborn hearing screening receive diagnostic audiological evaluation conducted by audiologists in Colorado over the Internet (telepractice). The evaluation is completed in real time using commercially-available software and personal computers to control the diagnostic…

  20. The Colorado Gambling Boom: An Experiment in Rural Community Development.

    Science.gov (United States)

    Stokowski, Patricia A.

    1992-01-01

    Three small Colorado towns that faced a declining economy as the mining resource ran out used gambling-based tourism as a strategy for community development. Although economic benefits to the towns have far exceeded expectations, negative social, environmental, and political changes, such as crime alcoholism, traffic problems, and conflicts…

  1. 78 FR 60008 - Colorado Disaster Number CO-00065

    Science.gov (United States)

    2013-09-30

    ... ADMINISTRATION Colorado Disaster Number CO-00065 AGENCY: U.S. Small Business Administration. ACTION: Amendment 2... applications to: U.S. Small Business Administration, Processing And Disbursement Center, 14925 Kingsport Road.... Small Business Administration, 409 3rd Street SW., Suite 6050, Washington, DC 20416....

  2. The Colorado Plateau IV: shaping conservation through science and management

    Science.gov (United States)

    Wakeling, Brian F.; Sisk, Thomas D.

    2010-01-01

    Roughly centered on the Four Corners region of the southwestern United States, the Colorado Plateau covers some 130,000 square miles of sparsely vegetated plateaus, mesas, canyons, arches, and cliffs in Arizona, Utah, Colorado, and New Mexico. With elevations ranging from 3,000 to 14,000 feet, the natural systems found within the plateau are dramatically varied, from desert to alpine conditions. This book focuses on the integration of science and resource management issues in this unique and highly varied environment. Broken into three subsections, this volume addresses conservation biology, biophysical resources, and inventory and monitoring concerns. The chapters range in content, addressing conservation issues–past, present, and future–on the Colorado Plateau, measurement of human impacts on resources, grazing and wildland-urban interfaces, and tools and methods for monitoring habitats and species. An informative read for people interested in the conservation and natural history of the region, the book will also serve as a valuable reference for those people engaged in the management of cultural and biological resources of the Colorado Plateau, as well as scientists interested in methods and tools for land and resource management throughout the West.

  3. Telehealth: Families Finding Ways to Connect in Rural Colorado

    Science.gov (United States)

    Kaiser, Kristen

    2011-01-01

    JFK Partners, at the University of Colorado Denver, School of Medicine, is currently implementing a study on the use of telehealth (receiving treatment or services using videoconferencing technology, such as Skype) and youth with autism spectrum disorder (ASD) and anxiety. The study is an exploratory grant from Health Resources and Services…

  4. Small-Scale Spatial Variability of Ozone in Boulder, Colorado

    Science.gov (United States)

    Deanes, L. N.; Sadighi, K.; Casey, J. G.; Collier, A. M.; Hannigan, M.

    2015-12-01

    Surface ozone (O3) can pose several health risks to humans, such as an increased number of and intensity of asthma attacks. Considering this, it is important that ozone levels are monitored. While municipal air quality monitors are present in cities like Boulder, Colorado, these monitors often only consider regional analysis, neglecting the variability of compounds, such as ozone or carbon monoxide, over smaller distances. Small-scale (approximately 1 kilometer) spatial variability in ozone is important because humans experience these small scales on a daily basis. Using low-cost, next-generation air quality monitors ("pods") developed at the University of Colorado-Boulder, we assessed small-scale spatial variability of surface ozone in Boulder, Colorado. This was done by placing clusters of 4-5 pods within approximately 1 kilometer of each other at specific sites in the city of Boulder. We collected data at two sites: one on the University of Colorado-Boulder campus (i.e., an urban site) and one outside of the city (i.e., a rural site). Pods were left in their positions for one to two weeks allowing for observation of ozone trends. As expected the typical diurnal trend was observed; however, further analysis revealed differences between these daily trends. Data collected by the pods allows for better understanding of small-scale spatial variability of surface ozone and how this may be driven by nearby sources.

  5. Colorado Plateau magmatism and uplift by warming of heterogeneous lithosphere.

    Science.gov (United States)

    Roy, Mousumi; Jordan, Thomas H; Pederson, Joel

    2009-06-18

    The forces that drove rock uplift of the low-relief, high-elevation, tectonically stable Colorado Plateau are the subject of long-standing debate. While the adjacent Basin and Range province and Rio Grande rift province underwent Cenozoic shortening followed by extension, the plateau experienced approximately 2 km of rock uplift without significant internal deformation. Here we propose that warming of the thicker, more iron-depleted Colorado Plateau lithosphere over 35-40 Myr following mid-Cenozoic removal of the Farallon plate from beneath North America is the primary mechanism driving rock uplift. In our model, conductive re-equilibration not only explains the rock uplift of the plateau, but also provides a robust geodynamic interpretation of observed contrasts between the Colorado Plateau margins and the plateau interior. In particular, the model matches the encroachment of Cenozoic magmatism from the margins towards the plateau interior at rates of 3-6 km Myr(-1) and is consistent with lower seismic velocities and more negative Bouguer gravity at the margins than in the plateau interior. We suggest that warming of heterogeneous lithosphere is a powerful mechanism for driving epeirogenic rock uplift of the Colorado Plateau and may be of general importance in plate-interior settings. PMID:19536263

  6. 'Pot Tourists' Linked to Surge in Colorado ER Visits

    Science.gov (United States)

    ... pot is so well-known, Hill said, that tourism boards have taken out billboards that say, "Don't let a candy bar ruin your vacation. With edibles, start low and go slow." The Colorado Legislature also has pumped more ...

  7. 77 FR 40630 - Notice of Competitive Coal Lease Sale, Colorado

    Science.gov (United States)

    2012-07-10

    ... Bureau of Land Management Notice of Competitive Coal Lease Sale, Colorado AGENCY: Bureau of Land Management, Interior. ACTION: Notice of competitive coal lease sale. SUMMARY: Notice is hereby given that... competitive lease by sealed bid in accordance with the provisions of the Mineral Leasing Act of 1920,...

  8. Induction of Sperm Acrosome Reaction wti h Calcium Ionophore A23187 in Wapiti (Cervus elaphus)%钙离子载体诱发马鹿精子顶体反应效果1)

    Institute of Scientific and Technical Information of China (English)

    李和平; 邹琦; 商兰; 刘伟石

    2014-01-01

    Wapiti (Cervus elaphus) sperm was capacitated in vitro by swimming-up and the acrosome reaction (AR) was in-duced by Calcium ionophore A23187 to choose an optimal A23187 system during AR.A23187 of 0.01-100 μmol/L can enhance the ratio of AR on the capacitated sperm and 0.1μmol/L A23187 can obtain the highest ratio of AR (74.00%± 2.62%) for 5-min treatment time.AR of capacitated sperm can, but the uncapacitated sperm cannot, be induced by A23187 in wapiti.%以马鹿( Cervus elaphus)为试验动物,采用上浮法诱导马鹿精子体外获能,以钙离子载体( A23187)诱导马鹿精子顶体反应,进而摸索钙离子载体( A23187)诱发其顶体反应的适宜体系。结果表明:0.01~100.00μmol/L的A23187可提高获能马鹿精子的顶体反应率;其中适宜的A23187浓度为0.10μmol/L,反应的时间为5 min,顶体反应率为(74.00±2.62)%。 A23187能促进获能马鹿精子的顶体反应,但不能显著(P>0.05)促进未获能马鹿精子的顶体反应。

  9. Colorado River Basin Water Supply and Demand Study

    Science.gov (United States)

    Prairie, J. R.; Jerla, C.

    2012-12-01

    The Colorado River Basin Water Supply & Demand Study (Study), part of the Basin Study Program under the Department of the Interior's WaterSMART Program, is being conducted by the Bureau of Reclamation and agencies representing the seven Colorado River Basin States. The purpose of the Study is to assess future water supply and demand imbalances in the Colorado River Basin over the next 50 years and develop and evaluate options and strategies to resolve those imbalances. The Study is being conducted over the period from January 2010 to September 2012 and contains four major phases: Water Supply Assessment, Water Demand Assessment, System Reliability Analysis, and Development and Evaluation of Opportunities for balancing supply and demand. To address the considerable amount of uncertainty in projecting the future state of the Colorado River system, the Study has adopted a scenario planning approach that has resulted in four water supply scenarios and up to six water demand scenarios. The water supply scenarios consider hydrologic futures derived from the observed historical and paleo-reconstructed records as well as downscaled global climate model (GCM) projections. The water demand scenarios contain differing projections of parameters such as population growth, water use efficiency, irrigated acreage, and water use for energy that result in varying projections of future demand. Demand for outdoor municipal uses as well as agricultural uses were adjusted based on changing rates of evapotranspiration derived from downscaled GCM projections. Water supply and demand scenarios are combined through Reclamation's long-term planning model to project the effects of future supply and demand imbalances on Colorado River Basin resources. These projections lend to an assessment of the effectiveness of a broad range of options and strategies to address future imbalances.

  10. Economic impact study of the Uranium Mill Tailings Remedial Action Project in Colorado: Colorado state fiscal year 1994

    Energy Technology Data Exchange (ETDEWEB)

    1994-11-01

    The Colorado economic impact study summarizes employment and economic benefits to the state from activities associated with the Uranium Mill Tailings Remedial Action (UMTRA) Project during Colorado state fiscal year 1994. To capture employment information, a questionnaire was distributed to subcontractor employees at the active UMTRA Project sites of Grand Junction, Naturita, Gunnison, and Rifle, Colorado. Economic data were requested from each site prime subcontractor, as well as from the Remedial Action Contractor. The most significant benefits associated with the UMTRA Project in Colorado are summarized. This study assesses benefits associated with the Grand Junction, Gunnison, Naturita, and Rifle UMTRA Projects sites for the 1-year period under study. Work at the Naturita site was initiated in April 1994 and involved demolition of buildings at the processing site. Actual start-up of remediation of Naturita is planned to begin in the spring of 1995. Work at the Slick Rock and Maybell sites is expected to begin in 1995. The only current economic benefits associated with these sites are related to UMTRA Project support work.

  11. Economic impact study of the Uranium Mill Tailings Remedial Action Project in Colorado: Colorado state fiscal year 1994

    International Nuclear Information System (INIS)

    The Colorado economic impact study summarizes employment and economic benefits to the state from activities associated with the Uranium Mill Tailings Remedial Action (UMTRA) Project during Colorado state fiscal year 1994. To capture employment information, a questionnaire was distributed to subcontractor employees at the active UMTRA Project sites of Grand Junction, Naturita, Gunnison, and Rifle, Colorado. Economic data were requested from each site prime subcontractor, as well as from the Remedial Action Contractor. The most significant benefits associated with the UMTRA Project in Colorado are summarized. This study assesses benefits associated with the Grand Junction, Gunnison, Naturita, and Rifle UMTRA Projects sites for the 1-year period under study. Work at the Naturita site was initiated in April 1994 and involved demolition of buildings at the processing site. Actual start-up of remediation of Naturita is planned to begin in the spring of 1995. Work at the Slick Rock and Maybell sites is expected to begin in 1995. The only current economic benefits associated with these sites are related to UMTRA Project support work

  12. Assessing Vulnerability under Uncertainty in the Colorado River Basin: The Colorado River Basin Water Supply and Demand Study

    Science.gov (United States)

    Jerla, C.; Adams, P.; Butler, A.; Nowak, K.; Prairie, J. R.

    2013-12-01

    Spanning parts of the seven states, of Arizona, California, Colorado, New Mexico, Nevada, Utah, and Wyoming, the Colorado River is one of the most critical sources of water in the western United States. Colorado River allocations exceed the long-term supply and since the 1950s, there have been a number of years when the annual water use in the Colorado River Basin exceeded the yield. The Basin is entering its second decade of drought conditions which brings challenges that will only be compounded if projections of climate change are realized. It was against this backdrop that the Colorado River Basin Water Supply and Demand Study was conducted. The Study's objectives are to define current and future imbalances in the Basin over the next 50 years and to develop and analyze adaptation and mitigation strategies to resolve those imbalances. Long-term planning in the Basin involves the integration of uncertainty with respect to a changing climate and other uncertainties such as future demand and how policies may be modified to adapt to changing reliability. The Study adopted a scenario planning approach to address this uncertainty in which thousands of scenarios were developed to encompass a wide range of plausible future water supply and demand conditions. Using Reclamation's long-term planning model, the Colorado River Simulation System, the reliability of the system to meet Basin resource needs under these future conditions was projected both with and without additional future adaptation strategies in place. System reliability metrics were developed in order to define system vulnerabilities, the conditions that lead to those vulnerabilities, and sign posts to indicate if the system is approaching a vulnerable state. Options and strategies that reduce these vulnerabilities and improve system reliability were explored through the development of portfolios. Four portfolios, each with different management strategies, were analyzed to assess their effectiveness at

  13. Colorado's Voucher Law:Examining the Claim of Fiscal Neutrality

    Directory of Open Access Journals (Sweden)

    Kevin G. Welner

    2004-07-01

    Full Text Available Colorado's voucher law was declared unconstitutional by the Colorado Supreme Court on June 28, 2004. Voucher supporters have begun drafting revised legislation designed to address the legal problem. This article calls into question the key financial claim of revenue neutrality'a claim that was central to the promotion and passage of the departing voucher law. The author concludes that the voucher law was not revenue neutral, even though it attempts to exclude from eligibility those children already enrolled in private schools. In fact, this law, as well as any revised law with similar eligibility provisions, would actually cost taxpayers an additional $10 million per year once fully implemented because the eligibility provision provides little more than a short-term damper on the law's long-term fiscal impact.

  14. Zia Taqueria: Building a Local Supply Chain in Southwestern Colorado

    OpenAIRE

    Sullins, Martha

    2014-01-01

    Zia Taqueria is a full-service restaurant in Durango, Colorado whose owners have steadily increased the proportion of local vegetables, grains and meats they source and serve to their customers. They created new supply chains that add value to heritage products grown in the Four Corners area, invested in building capacity in local farming operations, and created a restaurant brand known for its commitment to serving high-quality, reasonably priced meals. In addition to operating a profitable ...

  15. From Compassion Fatigue to Resilience: Children's Hospital Colorado

    OpenAIRE

    Johnson, Kelly; Griffin, Chris

    2014-01-01

    Background: Healthcare is a stressful profession. The executives at Children's Hospital Colorado are well aware of the affects that caring for sick children and the pressure associated with it have on our entire staff. Understanding what compassion fatigue looks like as well as the importance of stress management and its role in overall wellness for each of our employees led to the interest and support of HeartMath/Caritas workshops. Methods: HeartMath/Caritas training transformed into a prog...

  16. Breeding densities and migration periods of common snipe in Colorado

    Science.gov (United States)

    Johnson, B.R.; Ryder, R.A.

    1977-01-01

    Breeding densities and migration periods of Common Snipe in Colorado were investigated in 1974-75. Sites studied were near Fort Collins and in North Park, both in north central Colorado; in the Yampa Valley in northwestern Colorado; and in the San Luis Valley in south central Colorado....Estimated densities of breeding snipe based on censuses conducted during May 1974 and 1975 were, by region: 1.3-1.7 snipe/ha near Fort Collins; 0.6 snipe/ha in North Park; 0.5-0.7 snipe/ha in the Yampa Valley; and 0.5 snipe/ha in the San Luis Valley. Overall mean densities were 06 and 0.7 snipe/ha in 1974 and 1975 respectively. On individual study sites, densities of snipe ranged from 0.2 to 2.1 snipe/ha. Areas with shallow, stable, discontinuous water levels, sparse, short vegetation, and soft organic soils had the highest densities.....Twenty-eight nests were located having a mean clutch size of 3.9 eggs. Estimated onset of incubation ranged from 2 May through 4 July. Most nests were initiated in May.....Spring migration extended from late March through early May. Highest densities of snipe were recorded in all regions during l&23 April. Fall migration was underway by early September and was completed by mid-October with highest densities occurring about the third week in September. High numbers of snipe noted in early August may have been early migrants or locally produced juveniles concentrating on favorable feeding areas.

  17. The historical distribution of Gunnison Sage-Grouse in Colorado

    Science.gov (United States)

    Braun, Clait E.; Oyler-McCance, Sara J.; Nehring, Jennifer A.; Commons, Michelle L.; Young, Jessica R.; Potter, Kim M.

    2014-01-01

    The historical distribution of Gunnison Sage-Grouse (Centrocercus minimus) in Colorado is described based on published literature, observations, museum specimens, and the known distribution of sagebrush (Artemisia spp.). Historically, Gunnison Sage-Grouse were widely but patchily distributed in up to 22 counties in south-central and southwestern Colorado. The historical distribution of this species was south of the Colorado-Eagle river drainages primarily west of the Continental Divide. Potential contact areas with Greater Sage-Grouse (C. urophasianus) were along the Colorado-Eagle river system in Mesa, Garfield, and Eagle counties, west of the Continental Divide. Gunnison Sage-Grouse historically occupied habitats that were naturally highly fragmented by forested mountains and plateaus/mesas, intermountain basins without robust species of sagebrush, and river systems. This species adapted to use areas with more deciduous shrubs (i.e., Quercus spp., Amelanchier spp., Prunus spp.) in conjunction with sagebrush. Most areas historically occupied were small, linear, and patchily distributed within the overall landscape matrix. The exception was the large intermountain basin in Gunnison, Hinsdale, and Saguache counties. The documented distribution east of the Continental Divide within the large expanse of the San Luis Valley (Alamosa, Conejos, Costilla, and Rio Grande counties) was minimal and mostly on the eastern, northern, and southern fringes. Many formerly occupied habitat patches were vacant by the mid 1940s with extirpations continuing to the late 1990s. Counties from which populations were recently extirpated include Archuleta and Pitkin (1960s), and Eagle, Garfield, Montezuma, and Ouray (1990s).

  18. Damming Grand Canyon: The 1923 USGS Colorado River Expedition

    OpenAIRE

    Boyer, Diane E.; Webb, Robert H.

    2007-01-01

    In 1923, America paid close attention, via special radio broadcasts, newspaper headlines, and cover stories in popular magazines, as a government party descended the Colorado to survey Grand Canyon. Fifty years after John Wesley Powell's journey, the canyon still had an aura of mystery and extreme danger. At one point, the party was thought lost in a flood. Something important besides adventure was going on. Led by Claude Birdseye and including colorful characters such as early river-runner E...

  19. Infant feeding practices of migrant farmlaborers in Northern Colorado

    OpenAIRE

    O'Malley, Beth

    1989-01-01

    The infant feeding practices and associated environment of 49 infants (6-23 months) of migrant farm laborers in Northern Colorado were investigated during the summer of 1987. Information was collected on 1) breastfeeding practices, 2) introduction of foods and liquids, 3) nutrition and health practices and inadequacies, 4) home living environment, 5) health history, and 6) demographics. Data on the sources of food and nutrition information was collected regarding the 1) u...

  20. Deep mantle forces and the uplift of the Colorado Plateau

    Energy Technology Data Exchange (ETDEWEB)

    Moucha, R; Forte, A M; Rowley, D B; Mitrovica, J X; Simmons, N A; Grand, S P

    2009-06-23

    Since the advent of plate tectonics, it has been speculated that the northern extension of the East Pacific Rise, specifically its mantle source, has been over-ridden by the North American Plate in the last 30 Myrs. Consequently, it has also been postulated that the opening of the Gulf of California, the extension in the Basin and Range province, and the uplift of the Colorado Plateau are the resulting continental expressions of the over-ridden mantle source of the East Pacific Rise. However, only qualitative models based solely on surface observations and heuristic, simplified conceptions of mantle convection have been used in support or against this hypothesis. We introduce a quantitative model of mantle convection that reconstructs the detailed motion of a warm mantle upwelling over the last 30 Myrs and its relative advance towards the interior of the southwestern USA. The onset and evolution of the crustal uplift in the central Basin and Range province and the Colorado Plateau is determined by tracking the topographic swell due to this mantle upwelling through time. We show that (1) the extension and magmatism in the central Basin and Range province between 25 and 10 Ma coincides with the reconstructed past position of this focused upwelling, and (2) the southwestern portion of the Colorado Plateau experienced significant uplift between 10 Ma and 5 Ma that progressed towards the northeastern portion of the plateau. These uplift estimates are consistent with a young, ca. 6 Ma, Grand Canyon model and the recent commencement of mafic magmatism.

  1. Cost effectiveness of the 1993 Model Energy Code in Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Lucas, R.G.

    1995-06-01

    This report documents an analysis of the cost effectiveness of the Council of American Building Officials` 1993 Model Energy Code (MEC) building thermal-envelope requirements for single-family homes in Colorado. The goal of this analysis was to compare the cost effectiveness of the 1993 MEC to current construction practice in Colorado based on an objective methodology that determined the total life-cycle cost associated with complying with the 1993 MEC. This analysis was performed for the range of Colorado climates. The costs and benefits of complying with the 1993 NIEC were estimated from the consumer`s perspective. The time when the homeowner realizes net cash savings (net positive cash flow) for homes built in accordance with the 1993 MEC was estimated to vary from 0.9 year in Steamboat Springs to 2.4 years in Denver. Compliance with the 1993 MEC was estimated to increase first costs by $1190 to $2274, resulting in an incremental down payment increase of $119 to $227 (at 10% down). The net present value of all costs and benefits to the home buyer, accounting for the mortgage and taxes, varied from a savings of $1772 in Springfield to a savings of $6614 in Steamboat Springs. The ratio of benefits to costs ranged from 2.3 in Denver to 3.8 in Steamboat Springs.

  2. The 2014 Greeley, Colorado Earthquakes: Science, Industry, Regulation, and Media

    Science.gov (United States)

    Yeck, W. L.; Sheehan, A. F.; Weingarten, M.; Nakai, J.; Ge, S.

    2014-12-01

    On June 1, 2014 (UTC) a magnitude 3.2 earthquake occurred east of the town of Greeley, Colorado. The earthquake was widely felt, with reports from Boulder and Golden, over 60 miles away from the epicenter. The location of the earthquake in a region long considered aseismic but now the locus of active oil and gas production prompted the question of whether this was a natural or induced earthquake. Several classic induced seismicity cases hail from Colorado, including the Rocky Mountain Arsenal earthquakes in the 1960s and the Paradox Valley earthquakes in western Colorado. In both cases the earthquakes were linked to wastewater injection. The Greeley earthquake epicenter was close to a Class II well that had been injecting waste fluid into the deepest sedimentary formation of the Denver Basin at rates as high as 350,000 barrels/month for less than a year. The closest seismometers to the June 1 event were more than 100 km away, necessitating deployment of a local seismic network for detailed study. IRIS provided six seismometers to the University of Colorado which were deployed starting within 3 days of the mainshock. Telemetry at one site allowed for real time monitoring of the ongoing seismic sequence. Local media interest was extremely high with speculation that the earthquake was linked to the oil and gas industry. The timetable of media demand for information provided some challenges given the time needed for data collection and analysis. We adopted a policy of open data and open communication with all interested parties, and made proactive attempts to provide information to industry and regulators. After 3 weeks of data collection and analysis, the proximity and timing of the mainshock and aftershocks to the C4A injection well, along with a sharp increase in seismicity culminating in an M 2.6 aftershock, led to a decision by the Colorado Oil and Gas Corporation Commission (COGCC) to recommend a temporary halt to injection at the C4A injection well. This was the

  3. Economic impact study of the Uranium Mill Tailings Remedial Action project in Colorado: Colorado state fiscal year 1995. Revision 1

    International Nuclear Information System (INIS)

    As required by the Romer-Twining Agreement of 1990, the US Department of Energy (DOE) has prepared this annual economic impact study for the state of Colorado. This report assesses the economic impacts related to the DOE Uranium Mill Tailings Remedial Action (UMTRA) Project in Colorado during the state fiscal year (FY) between 1 July 1994 and 30 June 1995. To estimate net economic benefit, employment, salaries and wages, and other related economic benefits are discussed, quantified, and then compared to the state's 10 percent share of the remedial action costs. Actual data obtained from sites currently undergoing remedial action were used as the basis for analyses. If data were not available, estimates were used to derive economic indicators. This study describes the types of employment associated with the UMTRA Project and estimates of the numbers of people employed by UMTRA Project subcontractors in Colorado during state FY 1995. Employment totals are reported in estimated average annual jobs; however, the actual number of workers at the site fluctuates depending on weather and on the status of remedial action activities. In addition, the actual number of people employed on the Project during the year may be higher than the average annual employment reported due to the temporary nature of some of the jobs

  4. Analysis of Nutritional Components and Active Components in Cervus elaphus kansuensis Meat%甘肃马鹿肉营养成分及活性物质分析

    Institute of Scientific and Technical Information of China (English)

    张爱萍; 谢宗平; 李君兰; 郭兆斌; 余群力

    2013-01-01

    以甘肃马鹿肉为实验材料,检测分析了甘肃马鹿肉的营养成分及活性物质.结果表明:甘肃马鹿水分含量为72.88g/100g,蛋白质27.49g/100g,脂肪2.13g/100g,灰分1.09g/100g;铁14.96mg/100g,锌0.84mg/100g,铜0.199mg/100g,硒1.22μg/100g,磷15.72mg/100g;总氨基酸含量为81.08g/100g,必需氨基酸占总氨基酸的38.87%;过氧化物歧化酶63.42U/mg,雌二醇157.88pg/mL,睾酮0.78ng/mL.生长激素0.76ng/mL.甘肃马鹿肉具有高蛋白、低脂肪、丰富的矿物质、氨基酸含量全面等特点,并含有一定量的活性物质,对人体有较高的营养和滋补价值,是优质的动物性食品资源.%Healthy,adult,pasture-raised Cervus elaphus kansuensis ere slaughtered and Longissimus dorsi samples were taken for the measurement of nutritional components and active components by routine methods.The results showed that the Longissimus dorsi of Cervus elaphus kansuensis contained 72.88 g of water,27.49 g of protein,2.13 g of fat,1.09 g of ash,14.96 mg of Fe,0.84 mg of Zn,0.199 mg of Cu,1.22 μg of Se,and 15.72 mg of P per 100 g.The total amino acid content was 81.08% with the essential amino acids together accounting for 38.87% of the total amino acids.Additionally,the levels of SOD,estradiol,testosterone and growth hormone were detected to be 63.42 U/mg,157.88 pg/mL,0.78 ng/mL and 0.76 ng/mL,respectively.These data demonstrate that the meat of Cervus elaphus kansuensis has good quality characteristics such as high protein,low fat,abundant minerals and a full range of amino acids in large quantities,and also contain some active substances,indicating high nutritional and nourishing value for the human body as an excellent source of animal-derived food.

  5. DOE responses to CDH October 1993 comments on the Remedical Action Plan for the Naturita, Colorado, Umtra Site

    International Nuclear Information System (INIS)

    This document includes the October 1993 comments provided by the Colorado Department of Health (CDH) on the Department of Energy (DOE) Preliminary Final Remedial Action Plan for the Naturita, Colorado, UMTRA Site. DOE's responses are included after each CDH comment

  6. Colorado Basin Structure and Rifting, Argentine passive margin

    Science.gov (United States)

    Autin, Julia; Scheck-Wenderoth, Magdalena; Loegering, Markus; Anka, Zahie; Vallejo, Eduardo; Rodriguez, Jorge; Marchal, Denis; Reichert, Christian; di Primio, Rolando

    2010-05-01

    The Argentine margin presents a strong segmentation with considerable strike-slip movements along the fracture zones. We focus on the volcanic segment (between the Salado and Colorado transfer zones), which is characterized by seaward dipping reflectors (SDR) all along the ocean-continent transition [e.g. Franke et al., 2006; Gladczenko et al., 1997; Hinz et al., 1999]. The segment is structured by E-W trending basins, which differs from the South African margin basins and cannot be explained by classical models of rifting. Thus the study of the relationship between the basins and the Argentine margin itself will allow the understanding of their contemporary development. Moreover the comparison of the conjugate margins suggests a particular evolution of rifting and break-up. We firstly focus on the Colorado Basin, which is thought to be the conjugate of the well studied Orange Basin [Hirsch et al., 2009] at the South African margin [e.g. Franke et al., 2006]. This work presents results of a combined approach using seismic interpretation and structural, isostatic and thermal modelling highlighting the structure of the crust. The seismic interpretation shows two rift-related discordances: one intra syn-rift and the break-up unconformity. The overlying sediments of the sag phase are less deformed (no sedimentary wedges) and accumulated before the generation of oceanic crust. The axis of the Colorado Basin trends E-W in the western part, where the deepest pre-rift series are preserved. In contrast, the basin axis turns to a NW-SE direction in its eastern part, where mainly post-rift sediments accumulated. The most distal part reaches the margin slope and opens into the oceanic basin. The general basin direction is almost orthogonal to the present-day margin trend. The most frequent hypothesis explaining this geometry is that the Colorado Basin is an aborted rift resulting from a previous RRR triple junction [e.g. Franke et al., 2002]. The structural interpretation

  7. 75 FR 4373 - Colorado Interstate Gas Company; Notice of Availability of the Environmental Assessment for the...

    Science.gov (United States)

    2010-01-27

    ... Energy Regulatory Commission Colorado Interstate Gas Company; Notice of Availability of the Environmental... Expansion Project proposed by Colorado Interstate Gas Company (CIG) in the above-referenced docket. CIG... the same manner as you would if filing on paper, and then saving the file on your computer's...

  8. Guia del Proceso del IFSP de Colorado: Conexiones para la Ninez Temprana, Iniciativa Infantil de Colorado Parte C del Acta de Educacion para Individuos con Desabilidades (Colorado Guidelines for the IFSP Process: Early Childhood Connections, Colorado's Infant/Toddler Initiative for Part C of the Individuals with Disabilities Education Act).

    Science.gov (United States)

    Miller, Jerri; Petersen, Sandy

    This booklet for Spanish-speaking parents of young children with disabilities describes Colorado's Individualized Family Service Plan (IFSP) process. It explains guidelines, shares family stories and reflections for families and care providers, and the describes the values that drive the IFSP process in Colorado. Information is provided on…

  9. Carnations and the Floriculture Industry: Documenting the Cultivation and Marketing of Flowers in Colorado

    Science.gov (United States)

    Liu, Shu; Meyer, Linda M.

    2008-01-01

    The Records of the Colorado Flower Growers Association (CFGA) is an archival collection documenting the association prior to its 1979 name change. The CFGA was founded in 1928 to support the production and marketing of greenhouse flowers grown commercially in the state. In 1979, the organization changed its name to the Colorado Greenhouse Growers…

  10. 76 FR 14063 - Notice of Inventory Completion: University of Colorado Museum, Boulder, CO

    Science.gov (United States)

    2011-03-15

    ... National Park Service Notice of Inventory Completion: University of Colorado Museum, Boulder, CO AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The University of Colorado Museum has completed... affiliated with the human remains and associated funerary objects may contact the University of...

  11. Casa de la Esperanza: A Case Study of Service Coordination at Work in Colorado.

    Science.gov (United States)

    Franquiz, Maria E.; Hernandez, Carlota Loya

    This chapter describes how a federally funded farmworker housing facility in northern Colorado--Casa de la Esperanza--has changed the lives of migrant students and their families. The history of migrant workers in Colorado is described, as well as the struggle to construct a permanent farmworker housing facility. Casa was built in Boulder County,…

  12. Application of a hybrid model to reduce bias and improve precision in population estimates for elk (Cervus elaphus inhabiting a cold desert ecosystem

    Directory of Open Access Journals (Sweden)

    Kathryn A. Schoenecker

    2016-07-01

    Full Text Available Accurately estimating the size of wildlife populations is critical to wildlife management and conservation of species. Raw counts or “minimum counts” are still used as a basis for wildlife management decisions. Uncorrected raw counts are not only negatively biased due to failure to account for undetected animals, but also provide no estimate of precision on which to judge the utility of counts. We applied a hybrid population estimation technique that combined sightability modeling, radio collar-based mark-resight, and simultaneous double count (double-observer modeling to estimate the population size of elk in a high elevation desert ecosystem. Combining several models maximizes the strengths of each individual model while minimizing their singular weaknesses. We collected data with aerial helicopter surveys of the elk population in the San Luis Valley and adjacent mountains in Colorado State, USA in 2005 and 2007. We present estimates from 7 alternative analyses: 3 based on different methods for obtaining a raw count and 4 based on different statistical models to correct for sighting probability bias. The most reliable of these approaches is a hybrid double-observer sightability model (model MH, which uses detection patterns of 2 independent observers in a helicopter plus telemetry-based detections of radio collared elk groups. Data were fit to customized mark-resight models with individual sighting covariates. Error estimates were obtained by a bootstrapping procedure. The hybrid method was an improvement over commonly used alternatives, with improved precision compared to sightability modeling and reduced bias compared to double-observer modeling. The resulting population estimate corrected for multiple sources of undercount bias that, if left uncorrected, would have underestimated the true population size by as much as 22.9%. Our comparison of these alternative methods demonstrates how various components of our method contribute to

  13. Solar energy system economic evaluation for Colt Pueblo, Pueblo, Colorado

    Science.gov (United States)

    1980-01-01

    The Solar Energy System is not economically beneficial under the assumed economic conditions at Pueblo, Colorado; Yosemite, California; Albuquerque, New Mexico; Fort Worth, Texas; and Washington, D.C. Economic benefits from this system depend on decreasing the initial investment and the continued increase in the cost of conventional energy. Decreasing the cost depends on favorable tax treatment and continuing development of solar energy technology. Fuel cost would have to increase drastically while the cost of the system would have to remain constant or decrease for the system to become economically feasible.

  14. Chemical loading rates from precipitation in the Colorado Rockies

    OpenAIRE

    Grant, Michael C.; LEWIS Jr., WILLIAM M.

    2011-01-01

    Chemical composition of bulk (= wet + dry) precipitation was measured at two stations in the Colorado Rocky Mountains for each of 150 consecutive weeks. The stations were located at 3000 m elevation approximately 6 km east of the Continental Divide and 40 km north of Denver. Chemical species routinely measured included particulate C, N, P and H; dissolved organic C, P and N; conductance and total alkalinity; SO4=, CI-, NO3--N, NO2--N, NH4+-N, Ca++, Mg++, Na+, K+, H2PO4-–P and H+. Particulates...

  15. Environmental Assessment Expanded Ponnequin Wind Energy Project Weld County, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    1999-03-02

    The U.S.Department of Energy (DOE) has considered a proposal from the State of Colorado, Office of Energy Conservation (OEC), for funding construction of the Expanded Ponnequin Wind Project in Weld County, Colorado. OEC plans to enter into a contracting arrangement with Public Service Company of Colorado (PSCO) for the completion of these activities. PSCo, along with its subcontractors and business partners, are jointly developing the Expanded Ponnequin Wind Project. DOE completed an environmental assessment of the original proposed project in August 1997. Since then, the geographic scope and the design of the project changed, necessitating additional review of the project under the National Environmental Policy Act. The project now calls for the possible construction of up to 48 wind turbines on State and private lands. PSCo and its partners have initiated construction of the project on private land in Weld County, Colorado. A substation, access road and some wind turbines have been installed. However, to date, DOE has not provided any funding for these activities. DOE, through its Commercialization Ventures Program, has solicited applications for financial assistance from state energy offices, in a teaming arrangement with private-sector organizations, for projects that will accelerate the commercialization of emerging renewable energy technologies. The Commercialization Ventures Program was established by the Renewable Energy and Energy Efficiency Technology Competitiveness Act of 1989 (P.L. 101-218) as amended by the Energy Policy Act of 1992 (P.L. 102-486). The Program seeks to assist entry into the marketplace of newly emerging renewable energy technologies, or of innovative applications of existing technologies. In short, an emerging renewable energy technology is one which has already proven viable but which has had little or no operational experience. The Program is managed by the Department of Energy, Office of Energy Efficiency and Renewable Energy. The

  16. Locations and attributes of wind turbines in Colorado, 2011

    Science.gov (United States)

    Carr, Natasha B.; Diffendorfer, James E.; Fancher, Tammy; Hawkins, Sarah J.; Latysh, Natalie; Leib, Kenneth J.; Matherne, Anne Marie

    2013-01-01

    This dataset represents an update to U.S. Geological Survey Data Series 597. Locations and attributes of wind turbines in Colorado, 2009 (available at http://pubs.usgs.gov/ds/597/). This updated Colorado wind turbine Data Series provides geospatial data for all 1,204 wind turbines established within the State of Colorado as of September 2011, an increase of 297 wind turbines from 2009. Attributes specific to each turbine include: turbine location, manufacturer and model, rotor diameter, hub height, rotor height, potential megawatt output, land ownership, county, and development status of the wind turbine. Wind energy facility data for each turbine include: facility name, facility power capacity, number of turbines associated with each facility to date, facility developer, facility ownership, and year the facility went online. The locations of turbines are derived from 1-meter true-color aerial photographs produced by the National Agriculture Imagery Program (NAIP); the photographs have a positional accuracy of about ±5 meters. Locations of turbines constructed during or prior to August 2009 are based on August 2009 NAIP imagery and turbine locations constructed after August 2009 were based on September 2011 NAIP imagery. The location of turbines under construction during September 2011 likely will be less accurate than the location of existing turbines. This data series contributes to an Online Interactive Energy Atlas developed by the U.S. Geological Survey (http://my.usgs.gov/eerma/). The Energy Atlas synthesizes data on existing and potential energy development in Colorado and New Mexico and includes additional natural resource data layers. This information may be used by decisionmakers to evaluate and compare the potential benefits and tradeoffs associated with different energy development strategies or scenarios. Interactive maps, downloadable data layers, comprehensive metadata, and decision-support tools also are included in the Energy Atlas. The format of

  17. 78 FR 46552 - Approval and Promulgation of Air Quality Implementation Plans; State of Colorado; Second Ten-Year...

    Science.gov (United States)

    2013-08-01

    ... Colorado Springs area for the carbon monoxide (CO) National Ambient Air Quality Standard (NAAQS). This... AGENCY 40 CFR Part 52 Approval and Promulgation of Air Quality Implementation Plans; State of Colorado; Second Ten-Year Carbon Monoxide Maintenance Plan for Colorado Springs AGENCY: Environmental...

  18. 2014 Kids Count in Colorado! The Big Picture: Taking the Whole Child Approach to Child Well-Being

    Science.gov (United States)

    Colorado Children's Campaign, 2014

    2014-01-01

    "Kids Count in Colorado!" is an annual publication of the Colorado Children's Campaign, which provides the best available state- and county-level data to measure and track the education, health and general well-being of the state's children. "Kids Count in Colorado!" informs policy debates and community discussions, serving as…

  19. Time Budget and Behavior Pattern of Semi-free Cervus nippon in spring%散放条件下春季梅花鹿行为时间分配的研究

    Institute of Scientific and Technical Information of China (English)

    刘振生; 吴建平; 滕丽微

    2002-01-01

    From April to May in 1998, time budget and behavior patterns of semi-free Cervus nippon were studied in Pingshan Wildlife Experimental Farm. The results showed that grazing behavior accounts the most for activity time in spring, next for ruminating and bedding behaviors, and the least for alerting and moving behaviors. In a day, there are three grazing peaks (namely, 7:00~10:00, 12:00~14:00 and 16:00~17:00). The female spend more moving time than the male do. The male spend more alert and bedding time than the female. C. nippong spend more grazing time in cloudy days than in fine and rainy days, whileC. nippon spends less alert and moving time in cloudy days. Sex and weather influence activity time budget of C. nippon. More significant differences exist between male and female's moving behaviors (F = 10.09,P < 0.01 ), while significant differences exist between bedding ( F = 5.96, P < 0.05) and alert ( F = 4.52, P < 0.05) be haviors. More significant differences exist between grazing ( F = 8.39, P < 0.01) and alert ( F = 6.11, P < 0.01 ) behav iors due to weather factor, while significant differences exist between bedding ( F = 4.27, P < 0.05) and moving ( F =5.32, P<0.05) behaviors.

  20. The temporal and spatial relationship between NDVI and climatological parameters in Colorado

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    This paper describes the spatial and temporal relationship between AVHRR/NDVI (Normalized Difference Vegetation Index) and climatological parameters (temperature and precipitation), which, in some sense, is influenced by topographical factors and land-cover types in Colorado. The correlation coefficients and partial correlation coefficients have been computed pixel by pixel over Colorado in order to analyze the relationship. The temporal variation and correlation of AVHRR/NDVI, temperature and precipitation were analyzed with a sampling method. The study reveals that there exists a close correspondence between monthly NDVI and temperature, which has strong impact from temperature on the changes of NDVI in Colorado. The spatial changes of NDVI are not influenced obviously by the precipitation since these two variables are different from each other in time series in Colorado. The study clearly revealed the spatial variation and its distribution patterns of relationship between NDVI and climatic parameters (temperature and precipitation) in Colorado.

  1. An experiment to control nonnative fish in the Colorado River, Grand Canyon, Arizona

    Science.gov (United States)

    Coggins,, Lewis G., Jr.; Yard, Michael D.

    2011-01-01

    The humpback chub (Gila cypha) is an endangered native fish found only in the Colorado River Basin. In Grand Canyon, most humpback chub are found in the Little Colorado River and its confluence with the Colorado River. For decades, however, nonnative rainbow trout (Oncorhynchus mykiss) and brown trout (Salmo trutta), which prey on and compete with native fish, have dominated the Grand Canyon fish community. Between 2003 and 2006, scientists with the U.S. Geological Survey and Arizona Game and Fish Department experimentally removed 23,266 nonnative fish from a 9.4-mile-long reach of the Colorado River near where it joins the Little Colorado River. During the experiment, rainbow trout were reduced by as much as 90% and native fish abundance apparently increased in the reach. Concurrent environmental changes and a decrease in rainbow trout throughout the river make it difficult to determine if the apparent increase in native fish was the result of the experiment.

  2. An Analysis of The Early Development and Protection of the Colorado River

    Institute of Scientific and Technical Information of China (English)

    Zhao Qian

    2009-01-01

    This thesis attempts an environmental analysis of the Colorado River in Southwest America.and examines the early issues of economic development and environmental protection on the Colorado River Basin from a historical perspective.The thesis first provides a brief description of the geography of the Colorado River,paying special attention to the early exploration of the Colorado River by Native Americans and later European colonizers as well as their different attitudes toward nature.Then the thesis looks at the forces of economic development and nature preservation in the progressive era against the arid setting of the Southwest.In the conclusion,the author demonstrates the importance and necessity of the environmental protection of the Colorado River in the beginning period of the America West.

  3. Dating of Pliocene Colorado River sediments: implications for cosmogenic burial dating and the evolution of the lower Colorado River

    Science.gov (United States)

    Matmon, Ari; Stock, Greg M.; Granger, Darryl E.; Howard, Keith A.

    2011-01-01

    We applied cosmogenic 26Al/10Be burial dating to sedimentary deposits of the ancestral Colorado River. We compared cosmogenic burial ages of sediments to the age of an independently well-dated overlying basalt flow at one site, and also applied cosmogenic burial dating to sediments with less precise independent age constraints. All dated gravels yielded old ages that suggest several episodes of sediment burial over the past ∼5.3 m.y. Comparison of burial ages to the overlying 4.4 Ma basalt yielded good agreement and suggests that under the most favorable conditions, cosmogenic burial dating can extend back 4–5 m.y. In contrast, results from other sites with more broadly independent age constraints highlight the complexities inherent in burial dating; these complexities arise from unknown and complicated burial histories, insufficient shielding, postburial production of cosmogenic isotopes by muons, and unknown initial 26Al/10Be ratios. Nevertheless, and in spite of the large range of burial ages and large uncertainties, we identify samples that provide reasonable burial age constraints on the depositional history of sediment along the lower ancestral Colorado River. These samples suggest possible sediment deposition and burial at ca. 5.3, 4.7, and 3.6 Ma. Our calculated basinwide erosion rate for sediment transported by the modern Colorado River (∼187 mm k.y.−1) is higher than the modern erosion rates inferred from the historic sediment load (80–100 mm k.y.−1). In contrast, basinwide paleo-erosion rates calculated from Pliocene sediments are all under 40 mm k.y.−1 The comparatively lower denudation rates calculated for the Pliocene sediment samples are surprising given that the sampled time intervals include significant Pliocene aggradation and may include much incision of the Grand Canyon and its tributaries. This conflict may arise from extensive storage of sediment along the route of the Colorado River, slower paleobedrock erosion, or the inclusion

  4. Annual monitoring report for the Gunnison, Colorado, wetlands mitigation plan

    International Nuclear Information System (INIS)

    The US Department of Energy (DOE) administers the Uranium Mill Tailings Remedial Action (UMTRA) Project to clean up uranium mill tailings and other surface contamination at 24 abandoned uranium mill sites in 10 states. One of these abandoned mill sites is near the town of Gunnison, Colorado; surface remediation and the environmental impacts of remedial action are described in the Gunnison environmental assessment (EA) (DOE, 1992). Remedial action resulted in the elimination of 4.3 acres (ac) 1.7 hectares (ha) of wetlands and mitigation of this loss of wetlands is being accomplished through the enhance of 18.4 ac (7.5 ha) of riparian plant communities in six spring feed areas on Bureau of Land Management (BLM) land. The description of the impacted and mitigation wetlands is provided in the Mitigation and Monitoring Plan for Impacted Wetlands at the Gunnison UMTRA Project Site, Gunnison, Colorado (DOE, 1994), which is attached to the US Army corps of Engineers (USACE) Section 404 Permit. As part of the wetlands mitigation plan, the six mitigation wetlands were fenced in the fall of 1993 to exclude livestock grazing. Baseline of grazed conditions of the wetlands vegetation was determined during the summer of 1993 (DOE, 1994). A 5-year monitoring program of these six sites has been implemented to document the response of vegetation and wildlife to the exclusion of livestock. This annual monitoring report provides the results of the first year of the 5-year monitoring period

  5. Wildfire risk transmission in the Colorado Front Range, USA.

    Science.gov (United States)

    Haas, Jessica R; Calkin, David E; Thompson, Matthew P

    2015-02-01

    Wildfires are a global phenomenon that in some circumstances can result in human casualties, economic loss, and ecosystem service degradation. In this article we spatially identify wildfire risk transmission pathways and locate the areas of highest exposure of human populations to wildland fires under severe, but not uncommon, weather events. We quantify varying levels of exposure in terms of population potentially affected and tie the exposure back to the spatial source of the risk for the Front Range of Colorado, USA. We use probabilistic fire simulation modeling to address where fire ignitions are most likely to cause the highest impact to human communities, and to explore the role that various landowners play in that transmission of risk. Our results indicated that, given an ignition and the right fire weather conditions, large areas along the Front Range in Colorado could be exposed to wildfires with high potential to impact human populations, and that overall private ignitions have the potential to impact more people than federal ignitions. These results can be used to identify high-priority areas for wildfire risk mitigation using various mitigation tools. PMID:25156542

  6. Annual monitoring report for the Gunnison, Colorado, wetlands mitigation plan

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The US Department of Energy (DOE) administers the Uranium Mill Tailings Remedial Action (UMTRA) Project to clean up uranium mill tailings and other surface contamination at 24 abandoned uranium mill sites in 10 states. One of these abandoned mill sites is near the town of Gunnison, Colorado; surface remediation and the environmental impacts of remedial action are described in the Gunnison environmental assessment (EA) (DOE, 1992). Remedial action resulted in the elimination of 4.3 acres (ac) 1.7 hectares (ha) of wetlands and mitigation of this loss of wetlands is being accomplished through the enhance of 18.4 ac (7.5 ha) of riparian plant communities in six spring feed areas on Bureau of Land Management (BLM) land. The description of the impacted and mitigation wetlands is provided in the Mitigation and Monitoring Plan for Impacted Wetlands at the Gunnison UMTRA Project Site, Gunnison, Colorado (DOE, 1994), which is attached to the US Army corps of Engineers (USACE) Section 404 Permit. As part of the wetlands mitigation plan, the six mitigation wetlands were fenced in the fall of 1993 to exclude livestock grazing. Baseline of grazed conditions of the wetlands vegetation was determined during the summer of 1993 (DOE, 1994). A 5-year monitoring program of these six sites has been implemented to document the response of vegetation and wildlife to the exclusion of livestock. This annual monitoring report provides the results of the first year of the 5-year monitoring period.

  7. The rural utility response to Colorado's electricity mandates

    International Nuclear Information System (INIS)

    When Colorado voters passed Amendment 37 in 2004, it became the first state to pass a renewable portfolio standard at the ballet box, suggesting broad appeal to harness and pay for renewable energy. While large urban utilities are prepared to make this transition, smaller cities and rural areas, for various financial and scale issues are severely disadvantaged in trying to incorporate more renewable energy sources into their electricity mix. This was evident by the state's support for Amendment 37, which was passed due to strong support in the Denver metro area-representing nearly half of the state's population. Support for the bill was poor in the rest of the state. Nevertheless, in 2007, the state expanded up Amendment 37 by forcing the utilities in rural communities to diversify their electricity mix. This study surveyed the managers at the state's various rural electric cooperatives and municipal utilities in an effort to gage their attitudes concerning: carbon legislation, conservation and efficiency programs, and their plans for making the transition away from fossil fuel generation. - Highlights: → Communities served by rural utilities opposed Colorado's state-wide RPS, but were forced to adhere anyway. → Most rural utilities are very concerned about the economic impacts of trying to diversify their energy portfolios. → Many of these unregulated utilities were already pushing DSM programs to promote conservation and improve efficiency.

  8. Locations and attributes of wind turbines in Colorado, 2009

    Science.gov (United States)

    Carr, Natasha B.; Diffendorfer, Jay E.; Fancher, Tammy S.; Latysh, Natalie E.; Leib, Kenneth J.; Matherne, Anne-Marie; Turner, Christine

    2011-01-01

    The Colorado wind-turbine data series provides geospatial data for all wind turbines established within the State as of August 2009. Attributes specific to each turbine include: turbine location, manufacturer and model, rotor diameter, hub height, rotor height, potential megawatt output, land ownership, and county. Wind energy facility data for each turbine include: facility name, facility power capacity, number of turbines associated with each facility to date, facility developer, facility ownership, year the facility went online, and development status of wind facility. Turbine locations were derived from August 2009 1-meter true-color aerial photographs produced by the National Agriculture Imagery Program; the photographs have a positional accuracy of about + or - 5 meters. The location of turbines under construction during August 2009 likely will be less accurate than the location of existing turbines. This data series contributes to an Online Interactive Energy Atlas currently (2011) in development by the U.S. Geological Survey. The Energy Atlas will synthesize data on existing and potential energy development in Colorado and New Mexico and will include additional natural resource data layers. This information may be used by decisionmakers to evaluate and compare the potential benefits and tradeoffs associated with different energy development strategies or scenarios. Interactive maps, downloadable data layers, comprehensive metadata, and decision-support tools will be included in the Energy Atlas. The format of the Energy Atlas will facilitate the integration of information about energy with key terrestrial and aquatic resources for evaluating resource values and minimizing risks from energy development.

  9. 1992 Colorado Economic Impact Study for the US Department of Energy and Colorado Department of Health Uranium Mill Tailings Remedial Action (UMTRA) Project

    International Nuclear Information System (INIS)

    The findings of the 1992 Colorado Economic Impact Study (CEIS) for the Uranium Mill Tailings Remedial Action (UMTRA) Project are outlined below. All dollar amounts used in the study are in year-of-expenditure dollars. The total funding requirement for the State of Colorado for the UMTRA Project is estimated to be $66.8 million, or 10 percent of the remedial action costs for the UMTRA Project in Colorado. The UMTRA Project will generate $487.5 million in gross labor income in Colorado between 1983 and 1996. This includes $54.4 million in state and local tax revenues and $41.2 million in federal individual income tax revenues. The net economic benefit of the UMTRA Project to Colorado is $355.1 million. For every dollar the State of Colorado invests in the UMTRA Project, it will realize $5.32 in gross labor income. The employment impact to the Western Slope region is significant. The UMTRA Project will create a total employment impact of 13,749 fulltime equivalents (FTES) spread over. a period of 13 years in seven site areas. Nearly 100 percent of the labor will be drawn from the local communities. The State of Colorado's Western Slope is anticipated to be minimally impacted by the phaseout of the UMTRA Project. Unlike industries that shut down operations without warning, the UMTRA Project workers, local government, and businesses know the schedule for completion and can consider and prepare for the impact of UMTRA Project conclusion. Further, because the majority of the work force is local, there has not been a significant investment in each community's infrastructure. Any small increases in the infrastructure will not be abandoned at the end of the UMTRA Project due to a marked increase in migration out of the local community

  10. Lightning in Colorado forest fire smoke plumes during summer 2012

    Science.gov (United States)

    Lang, T. J.; Krehbiel, P. R.; Dolan, B.; Lindsey, D.; Rutledge, S. A.; Rison, W.

    2012-12-01

    May and June 2012 were unusually hot and dry in Colorado, which was suffering from a strong drought. A major consequence of this climatic regime was one of the most destructive forest fire seasons in state history, with hundreds of thousands of acres of forest and grassland consumed by flames, hundreds of homes burned, and several lives lost. Many of these fires occurred within range of the newly installed Colorado Lightning Mapping Array (COLMA), which provides high-resolution observations of discharges over a large portion of the state. The COLMA was installed in advance of the Deep Convective Clouds and Chemistry (DC3) project. High-altitude lightning was observed to occur sporadically in the smoke plumes over three major fires that occurred during early summer: Hewlett Gulch, High Park, and Waldo Canyon. Additionally, the Colorado State University CHILL (CSU-CHILL) and Pawnee radars observed the Hewlett Gulch plume electrify with detailed polarimetric and dual-Doppler measurements, and also provided these same measurements for the High Park plume when it was not producing lightning. Meanwhile, local Next Generation Radars (NEXRADs) provided observations of the electrified High Park and Waldo Canyon plumes. All of these plumes also were observed by geostationary meteorological satellites. These observations provide an unprecedented dataset with which to study smoke plume and pyrocumulus electrification. The polarimetric data - low reflectivity, high differential reflectivity, low correlation coefficient, and noisy differential phase - were consistent with the smoke plumes and associated pyrocumulus being filled primarily with irregularly shaped ash particles. Lightning was not observed in the plumes until they reached over 10 km above mean sea level, which was an uncommon occurrence requiring explosive fire growth combined with increased meteorological instability and reduced wind shear. Plume updraft intensification and echo-top growth led the occurrence of

  11. Colorado's Prospects for Interstate Commerce in Renewable Power

    Energy Technology Data Exchange (ETDEWEB)

    Hurlbut, D. J.

    2009-12-01

    Colorado has more renewable energy potential than it is ever likely to need for its own in-state electricity consumption. Such abundance may suggest an opportunity for the state to sell renewable power elsewhere, but Colorado faces considerable competition from other western states that may have better resources and easier access to key markets on the West Coast. This report examines factors that will be important to the development of interstate commerce for electricity generated from renewable resources. It examines market fundamentals in a regional context, and then looks at the implications for Colorado.

  12. 1996 monitoring report for the Gunnison, Colorado, wetlands mitigation plan

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    The US Department of Energy (DOE) administers the Uranium Mill Tailings Remedial Action (UMTRA) Project to clean up uranium mill tailings and other surface contamination at 24 abandoned uranium mill sites in 10 states. One of these abandoned mill sites was near the town of Gunnison, Colorado. Surface remediation was completed at the Gunnison site in December 1995. Remedial action resulted in the elimination of 4.3 acres of wetlands and mitigation of this loss is through the enhancement of 17.8 acres of riparian plant communities in six spring-fed areas on US Bureau of Land Management mitigation sites. A five-year monitoring program was then implemented to document the response of vegetation and wildlife to the exclusion of livestock. This report provides the results of the third year of the monitoring program.

  13. 1996 monitoring report for the Gunnison, Colorado, wetlands mitigation plan

    International Nuclear Information System (INIS)

    The US Department of Energy (DOE) administers the Uranium Mill Tailings Remedial Action (UMTRA) Project to clean up uranium mill tailings and other surface contamination at 24 abandoned uranium mill sites in 10 states. One of these abandoned mill sites was near the town of Gunnison, Colorado. Surface remediation was completed at the Gunnison site in December 1995. Remedial action resulted in the elimination of 4.3 acres of wetlands and mitigation of this loss is through the enhancement of 17.8 acres of riparian plant communities in six spring-fed areas on US Bureau of Land Management mitigation sites. A five-year monitoring program was then implemented to document the response of vegetation and wildlife to the exclusion of livestock. This report provides the results of the third year of the monitoring program

  14. UMTRA project water sampling and analysis plan, Maybell, Colorado

    International Nuclear Information System (INIS)

    This water sampling and analysis plan (WSAP) describes planned water sampling activities and provides the regulatory and technical basis for ground water sampling in 1994 at the US Department of Energy's (DOE) Uranium Mill Tailings Remedial Action (UMTRA) Project site in Maybell, Colorado. The WSAP identifies and justifies sampling locations, analytical parameters, and sampling frequencies at the site. The ground water data will be used for site characterization and risk assessment. The regulatory basis for the ground water and surface water monitoring activities is derived from the EPA regulations in 40 CFR Part 192 (1993) and the proposed EPA standards of 1987 (52 FR 36000). Sampling procedures are guided by the UMTRA Project standard operating procedures (SOP) (JEG, n.d.), the Technical Approach Document (TAD) (DOE, 1989), and the most effective technical approach for the site. This WSAP also includes a summary and the results of water sampling activities from 1989 through 1992 (no sampling was performed in 1993)

  15. Geology of the lower Yellow Creek Area, Northwestern Colorado

    International Nuclear Information System (INIS)

    The lower Yellow Creek area is located in Rio Blanco and Moffat Counties of northwestern Colorado, about midway between the towns of Rangely and Meeker. The study area is in the northwestern part of the Piceance Creek basin, a very deep structural and sedimentary basin that formed during the Laramide orogeny. Potentially important resources in the area are oil shale and related minerals, oil and gas, coal, and uranium. Topics discussed in the report include: Stratigraphy (Subsurface rocks, Cretaceous rocks, Tertiary rocks, and Quaternary deposits); Structure (Midland anticline, graben at Pinyon Ridge, and Crooked Wash syncline, Folds and faults in the vicinity of the White River, Red Wash syncline and central graben zone, Yellow Creek anticlinal nose); Economic geology (Oil shale and associated minerals, Coal, Oil and gas, Uranium, Gravel)

  16. Fluid evolution of Cerro Colorado Porphyry Copper Mine

    Science.gov (United States)

    Tsang, Debbie Pui Wai; Wallis, Simon

    2014-05-01

    The Cerro Colorado porphyry copper deposit is the northernmost currently active copper mine in Chile, producing 90.5kt copper per year. It belongs to one of the Paleocene to early Eocene porphyry copper deposits that are distributed along the western slope of the main Andean Cordillera in Northern Chile (Bouzari & Clark, 2002). Active commercial production began in 1994, and the estimated reserves within the supergene blanket can sustain further 12 years of copper mining. Field studies of the well-exposed geology around the mine site and the access to drilled cores that penetrate into the hypogene zone provide a good opportunity to study the temporal relationship between magmatism, hypogene and supergene ore formation of the region. The geological evolution of Cerro Colorado area can be generalized as follows. The Cretaceous Cerro Empexa Formation, consisting of a sequence of volcanic rocks, mainly andesitic lava and breccia, lahars, some ignimbrite intercalations and dacitic tuff (Charrier, Pinto & Rodrigues, 2007), was intruded by tonalitic to dioritic magma in Middle-Eocene. Magmatic activities generated brecciated rocks accompanying with different alteration zones radiate outward from the intrusion. The mineralized hypogene protore later interacted with ground water, creating the supergene blanket, which is now the principal mining target of Cerro Colorado. Several plutonic lithologies with slight but distinct compositional differences were exposed in the valleys around the mine site. The presence of these several phases of small-scale intrusions suggests the ore genesis may be related to multiple pulses of heating and associated fluid flow. Complementarily, on-site geologists have reported occurrences of early stage biotites vein cutting into phyllitic alteration zone, or across terminal stage quartz-pyrite veins in the drilled cores. These observations are direct evidences of at least two major distinct phases of fluid flow, and imply the ore mineralization

  17. Groundwater availability of the Denver Basin aquifer system, Colorado

    Science.gov (United States)

    Paschke, Suzanne S., (Edited By)

    2011-01-01

    The Denver Basin aquifer system is a critical water resource for growing municipal, industrial, and domestic uses along the semiarid Front Range urban corridor of Colorado. The confined bedrock aquifer system is located along the eastern edge of the Rocky Mountain Front Range where the mountains meet the Great Plains physiographic province. Continued population growth and the resulting need for additional water supplies in the Denver Basin and throughout the western United States emphasize the need to continually monitor and reassess the availability of groundwater resources. In 2004, the U.S. Geological Survey initiated large-scale regional studies to provide updated groundwater-availability assessments of important principal aquifers across the United States, including the Denver Basin. This study of the Denver Basin aquifer system evaluates the hydrologic effects of continued pumping and documents an updated groundwater flow model useful for appraisal of hydrologic conditions.

  18. Butane Hash Oil Burns Associated with Marijuana Liberalization in Colorado.

    Science.gov (United States)

    Bell, Cameron; Slim, Jessica; Flaten, Hanna K; Lindberg, Gordon; Arek, Wiktor; Monte, Andrew A

    2015-12-01

    Butane hash oil (BHO), also known as "amber," "dab," "glass," "honey," "shatter," or "wax," is a potent marijuana concentrate, containing up to 90 % tetrahydrocannabinol (THC). BHO is easily manufactured using highly volatile butane as a solvent. Our objective was to characterize hydrocarbon burns associated with BHO manufacture in Colorado. This was a cross-sectional study utilizing the National Burn Repository to capture all hydrocarbon burns reported to the local burn center from January 1st, 2008, through August 31st, 2014. We abstracted demographic and clinical variables from medical records for patients admitted for hydrocarbon burns associated with butane hash oil extraction. Twenty-nine cases of BHO burns were admitted to the local burn center during the study period. Zero cases presented prior to medical liberalization, 19 (61.3 %) during medical liberalization (Oct 2009-Dec 2013), and 12 (38.7 %) in 2014 since legalization. The majority of cases were Caucasian (72.4 %) males (89.7 %). Median age was 26 (range 15-58). The median total-body-surface-area (TBSA) burn size was 10 % (TBSA range 1-90 %). Median length of hospital admission was 10 days. Six required intubation for airway protection (21 %). Nineteen required skin grafting, eight wound care only, one required surgical fracture repair, and one required surgical debridement. Hydrocarbon burns associated with hash oil production have increased since the liberalization of marijuana policy in Colorado. A combination of public health messaging, standardization of manufacturing processes, and worker safety regulations are needed to decrease the risks associated with BHO production. PMID:26289652

  19. Study on the Changes in Enzyme and Insulin-like Growth Factor-1 Concentrations in Blood Serum and Growth Characteristics of Velvet Antler during the Antler Growth Period in Sika Deer (Cervus nippon).

    Science.gov (United States)

    Park, Jaehyun; Jeon, Byongtae; Kang, Sungki; Oh, Mirae; Kim, Myonghwa; Jang, Seyoung; Park, Pyojam; Kim, Sangwoo; Moon, Sangho

    2015-09-01

    This study was conducted to investigate changes in blood enzyme parameters and to evaluate the relationship between insulin-like growth factor-1 (IGF-1), antler growth and body weight during the antler growth of sika deer (Cervus nippon). Serum enzyme activity and IGF-1 concentrations were measured in blood samples collected from the jugular and femoral veins at regular intervals during the antler growth period. Blood samples were taken in the morning from fasted stags (n = 12) which were healthy and showed no clinical signs of disease. Alfalfa was available ad libitum and concentrates were given at 1% of body weight to all stags. The experimental diet was provided at 9 am with water available at all times. There were no significant differences in alkaline phosphatase, aspartate aminotransferase, and alanine aminotransferase during antler growth, but alkaline phosphatase concentrations increased with antler growth progression, and the highest alkaline phosphatase concentration was obtained 55 days after antler casting. Serum IGF-1 concentrations measured from blood samples taken from the jugular vein during antler growth, determined that levels of IGF-1 was associated with body weight and antler growth patterns. Serum IGF-1 concentrations were higher at the antler cutting date than other sampling dates. Antler length increased significantly during antler growth (p<0.001), and there was a similar trend to between right and left beams. Body weight increased with antler growth but was not significant. Consequently it appeared that serum alkaline phosphatase concentration was related to antler growth and both antler growth and body weight were associated positively with IGF-1 concentrations during antler growth. PMID:26194228

  20. PREVALENCE OF ANTIBIOTIC RESISTANT STRAINS OF ESCHERICHIA COLI AND ENTEROCOCCUS SPP. IN ROE DEER (CAPREOLUS CAPREOLUS AND RED DEER (CERVUS ELAPHUS AT THE PARCO NAZIONALE DEI MONTI SIBILLINI, ITALY

    Directory of Open Access Journals (Sweden)

    B. Cenci Goga

    2009-09-01

    Full Text Available A case control study was performed in the Parco Nazionale dei Monti Sibillini, Italy, to find out whether roe deer (Capreolus capreolus and red deer (Cervus elaphus were more likely to harbour antibiotic resistant Escherichia coli in their faeces, compared to Enterococcus spp. Ten areas were selected and samples were collected during a fourmonths (May to August, 2008 sampling period. Samples of water (n=12 and feces (n=59, collected at 10 different sites, were cultured for E. coli and Enterococcus spp. The resulting colonies were screened for tetracycline, ampicillin and kanamycin resistance using the Lederberg Replica Plating method (breakpoint 4 μg/ml. All resistant isolates were then selected, and subjected to the CLSI antimicrobial plate susceptibility test (7. Among the water specimens contaminated by E. coli, 80% were found to be resistant to ampicillin, 80% to tetracycline and 40% to kanamycin. Among the water specimens contaminated by Enterococcus spp., 14.29% were found to be resistant to ampicillin, 14.29% to tetracycline and 71.3% to kanamycin. Among the 39 strains of E. coli isolated from red deer feces, 12 were resistant to ampicillin (30.77%, 5 to tetracycline (12,82% and 3 to kanamycin (7.69%. Among the 19 strains of Enterococcus spp. isolated from red deer feces, 0 were resistant to ampicillin (0%, 1 to tetracycline (5.26% and 19 to kanamycin (100. These are significant findings, indicating that antibiotic resistance can be found in naïve animal populations and that red deer and fallow deer could act as sentinels for antimicrobial resistance. Key words Antibiotic-resistance, red deer, fallow deer, Escherichia

  1. Development and Adoption of a Watershed Approach to Compensatory Mitigation: Experiences in Colorado and California

    Science.gov (United States)

    In this article, we examine the adoption of the watershed approach and its technical methods into regulatory programs in Colorado and California. Specific steps and motives for the adoption are explained. Through close collaboration, regulators have systematically been made aware...

  2. Colorado River Wildlife Management Area (Green River Easements) [Land Status Map: Sheet 1 of 2

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This map was produced by the Division of Realty to depict landownership at Colorado River Wildlife Management Area. It was generated from rectified aerial...

  3. Final Critical Habitat for the Preble's Meadow Jumping Mouse (Zapus hudsonius preblei) - Colorado Population

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These data identify, in general, the areas where final critical habitat for the Preble's Meadow Jumping Mouse (Zapus hudsonius preblei) occur for the Colorado...

  4. Colorado State Briefing Book for low-level radioactive-waste management

    International Nuclear Information System (INIS)

    The Colorado State Briefing Book is one of a series of state briefing books on low-level radioactive waste management practices. It has been prepared to assist state and federal agency officials in planning for safe low-level radioactive waste disposal. The report contains a profile of low-level radioactive waste generators in Colorado. The profile is the result of a survey of NRC licensees in Colorado. The briefing book also contains a comprehensive assessment of low-level radioactive waste management issues and concerns as defined by all major interested parties including industry, government, the media, and interest groups. The assessment was developed through personal communications with representatives of interested parties, and through a review of media sources. Lastly, the briefing book provides demographic and socioeconomic data and a discussion of relevant government agencies and activities, all of which may impact waste management practices in Colorado

  5. Bedrock Geology of the turkey Creek Drainage Basin, Jefferson County, Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This geospatial data set describes bedrock geology of the Turkey Creek drainage basin in Jefferson County, Colorado. It was digitized from maps of fault locations...

  6. Digital geospatial datasets in support of hydrologic investigations of the Colorado Front Range Infrastructure Resources Project

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The U.S. Geological Survey developed this dataset as part of the Colorado Front Range Infrastructure Resources Project (FRIRP). One goal of the FRIRP was to provide...

  7. Mahogany Ledge Digital Structure Contour Lines of the Piceance Basin, Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The Mahogany ledge structure contour lines were needed to perform overburden calculations in the Piceance Basin, Colorado as part of a 2009 National Oil Shale...

  8. Raster Dataset Model of Overburden Above the Mahogany Zone in the Piceance Basin, Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — An ESRI GRID raster data model of the overburden material above the Mahogany Zone was needed to perform calculations in the Piceance Basin, Colorado as part of a...

  9. Unioned layer of coal resource calculation in the Danforth Hills coal field, Colorado (dan*fing)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Final unioned polygon coverages and shapefiles used to calculate coal resources of the A through G coal zones, Danforth Hills coal field, northwestern Colorado....

  10. Contaminants in Waterbirds, Grackles, and Swallows Nesting on the Lower Colorado River, Arizona, 2000-2001

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Levels and potential effects of organochlorine compounds and metals were assessed in 106 eggs representing nine avian species nesting at four lower Colorado River...

  11. Business Metrics for High-Performance Homes: A Colorado Springs Case Study

    Energy Technology Data Exchange (ETDEWEB)

    Beach, R. [IBACOS, Inc, Pittsburgh, PA (United States); Jones, A. [IBACOS, Inc, Pittsburgh, PA (United States)

    2016-04-26

    This report explores the correlation between energy efficiency and the business success of home builders by examining a data set of builders and homes in the Colorado Springs, Colorado, market between 2006 and 2014. During this time, the Great Recession of 2007 to 2009 occurred, and new-home sales plummeted both nationally and in Colorado Springs. What is evident from an analysis of builders and homes in Colorado Springs is that builders who had Home Energy Rating System (HERS) ratings performed on some or all of their homes during the Recession remained in business during this challenging economic period. Many builders who did not have HERS ratings performed on their homes at that time went out of business or left the area. From the analysis presented in this report, it is evident that a correlation exists between energy efficiency and the business success of home builders, although the reasons for this correlation remain largely anecdotal and not yet clearly understood.

  12. Geospatial Dataset of Agricultural Lands in the Upper Colorado River Basin, 2007 - 10

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset represents the extent and spatial distribution of irrigated agricultural lands in the Upper Colorado River Basin for 2007-10. The boundaries in this...

  13. Depth to water in the High Plains Aquifer in Colorado, 2000.

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — These data are in support of report DS 456 (Arnold and others, 2009). This grid represents the depth to groundwater in the High Plains Aquifer in Colorado in 2000....

  14. Field Plot and Observation Points for Colorado National Monument Vegetation Mapping Project

    Data.gov (United States)

    National Park Service, Department of the Interior — This point file displays the 525 field plot and observation locations visited in 2003 and 2004 as part of the vegetation mapping project for Colorado National...

  15. Boundary for Black Canyon of the Gunnison National Park (BLCA), Colorado (2002)

    Data.gov (United States)

    National Park Service, Department of the Interior — This administrative boundary for Black Canyon of the Gunnison National Park (BLCA), Colorado contains 6 polygons showing National Park Service (NPS) lands, and...

  16. Quality characterization of Cretaceous coal from the Colorado Plateau coal assessment study area, 2000 (cpchmg)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This is a shapefile and ARC/INFO point coverage of coal geochemistry in the Colorado Plateau. This GIS layer was created from the U.S. Geological Survey's USCHEM...

  17. Final unioned files for Yampa coal field resource calculations, northwestern Colorado (yam*fing)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — These are shapefiles and final unioned polygon coverages used to calculate coal resources of the A through D coal zones, Yampa coal field, northwestern Colorado....

  18. Reporting Polygons to Summarize Overburden Material Above the Mahogany Zone in the Piceance Basin, Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Reporting polygons were created to display and quantify overburden material above the Mahogany Zone, by PLSS section, in the Piceance Basin, Colorado as part of a...

  19. Cored Cottonwood Tree Sample Cluster Polygons at Sand Creek Massacre National Historic Site, Colorado

    Data.gov (United States)

    National Park Service, Department of the Interior — A vector polygon dataset representing the location of sample clusters of cored trees at Sand Creek Massacre NHS as part of a University of Colorado research study.

  20. Tree Transect Starting Locations (Points) at Sand Creek Massacre National Historic Site, Colorado

    Data.gov (United States)

    National Park Service, Department of the Interior — A vector point dataset representing the starting location of tree transects at Sand Creek Massacre NHS as part of a University of Colorado research study.

  1. TIN Dataset Model of Overburden Above the Mahogany Zone in the Piceance Basin, Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — An ESRI TIN data model of the overburden material above the Mahogany Zone was needed to perform calculations in the Piceance Basin, Colorado as part of a 2009...

  2. Raster Dataset Model of Nahcolite Resources in the Piceance Basin, Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — ESRI GRID raster datasets were created to display and quantify nahcolite resources for eight oil shale zones in the Piceance Basin, Colorado as part of a 2009...

  3. TIN Dataset Model of Overburden Above the Mahogany Bed in the Uinta Basin, Utah and Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — An ESRI TIN data model of the overburden material above the Mahogany bed was needed to perform calculations in the Uinta Basin, Utah and Colorado as part of a 2009...

  4. TIN Dataset Model of the Mahogany Bed Structure in the Uinta Basin, Utah and Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — An ESRI TIN data model of the Mahogany bed structure was needed to perform overburden calculations in the Uinta Basin, Utah and Colorado as part of a 2009 National...

  5. Oil Shale Core Holes Containing Nahcolite in the State of Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This file contains points that describe locations of oil shale core holes that contain nahcolite in the state of Colorado and is available as an ESRI shapefile,...

  6. Raster Dataset Model of the Mahogany Bed Structure in the Uinta Basin, Utah and Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — An ESRI GRID raster data model of the Mahogany bed structure was needed to perform overburden calculations in the Uinta Basin, Utah and Colorado as part of a 2009...

  7. Raster Dataset Model of the Mahogany Zone Structure in the Piceance Basin, Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — An ESRI GRID raster data model of the Mahogany Zone structure was needed to perform overburden calculations in the Piceance Basin, Colorado as part of a 2009...

  8. Raster Dataset Model of Overburden Above the Mahogany Bed in the Uinta Basin, Utah and Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — An ESRI GRID raster data model of the overburden material above the Mahogany bed was needed to perform calculations in the Uinta Basin, Utah and Colorado as part of...

  9. TIN Dataset Model of the Mahogany Zone Structure in the Piceance Basin, Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — An ESRI TIN data model of the Mahogany Zone structure was needed to perform overburden calculations in the Piceance Basin, Colorado as part of a 2009 National Oil...

  10. Background Contaminants Evaluation of the Republican River Drainage- Colorado, Kansas, and Nebraska

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Republican River Basin is a very large watershed in west-central Kansas, eastern Colorado, Wyoming and southern Nebraska. This study was conducted to determine...

  11. Oil Shale Core Hole and Rotary Hole Locations in the State of Colorado

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This file contains points that describe locations of oil shale core holes and rotary holes in the state of Colorado and is available as an ESRI shapefile, Google...

  12. [Draft] Environmental Impact Statement : San Luis Valley Project : Colorado Closed Basin Division

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Closed Basin Division, San Luis Valley Project, Alamosa and Saguache Counties, Colorado, is a multipurpose water resource plan designated to salvage and deliver...

  13. Colorado geothermal commercialization planning. Semi-annual progress report, January 1, 1979-June 30, 1979

    Energy Technology Data Exchange (ETDEWEB)

    Coe, B.A.

    1979-01-01

    The potential for developing the geothermal resources of Colorado is detailed. Constraints that are limiting geothermal energy development are described. Area development plans, an institutional analysis, and the outreach program are presented. (MHR)

  14. Colorado geothermal commercialization program. Geothermal energy opportunities at four Colorado towns: Durango, Glenwood Springs, Idaho Springs, Ouray

    Energy Technology Data Exchange (ETDEWEB)

    Coe, B.A.; Zimmerman, J.

    1981-01-01

    The potential of four prospective geothermal development sites in Colorado was analyzed and hypothetical plans prepared for their development. Several broad areas were investigated for each site. The first area of investigation was the site itself: its geographic, population, economic, energy demand characteristics and the attitudes of its residents relative to geothermal development potential. Secondly, the resource potential was described, to the extent it was known, along with information concerning any exploration or development that has been conducted. The third item investigated was the process required for development. There are financial, institutional, environmental, technological and economic criteria for development that must be known in order to realistically gauge the possible development. Using that information, the next concern, the geothermal energy potential, was then addressed. Planned, proposed and potential development are all described, along with a possible schedule for that development. An assessment of the development opportunities and constraints are included. Technical methodologies are described in the Appendix. (MHR)

  15. Assessment of Human-Coyote Conflicts: City and County of Broomfield, Colorado

    OpenAIRE

    Grant, Stan; Young, Julie; Riley, Seth

    2011-01-01

    In the summer of 2011, the Anthem Highlands neighborhood of the City and County of Broomfield (Broomfield), Colorado experienced multiple serious incidents between humans and coyotes. Broomfield has a detailed policy about coexisting with wildlife in general, and coyotes in particular, that includes extensive public education and outreach. Because of the serious nature of the incidents, the Colorado Division of Parks and Wildlife, with assistance from USDA-Wildlife Services and in collaborati...

  16. Record of Decision Colorado River Interim Surplus Guidelines Final Environmental Impact Statement

    OpenAIRE

    Secretary of the Department of the Interior

    2001-01-01

    This document constitutes the Record of Decision (ROD) of the Department of the Interior, regarding the preferred alternative for Colorado River Interim Surplus Guidelines (Guidelines). The Secretary of the Interior (Secretary) is vested with the responsibility of managing the mainstream waters of the lower Colorado River pursuant to federal law. This responsibility is carried out consistent with applicable federal law. Reclamation, as the agency that is designated to act on the Secretary’s b...

  17. Development of streamflow projections under changing climate conditions over Colorado River basin headwaters

    OpenAIRE

    W. P. Miller; T. C. Piechota; Gangopadhyay, S; T. Pruitt

    2011-01-01

    The current drought over the Colorado River Basin has raised concerns that the US Department of the Interior, Bureau of Reclamation (Reclamation) may impose water shortages over the lower portion of the basin for the first time in history. The guidelines that determine levels of shortage are affected by relatively short-term (3 to 7 month) forecasts determined by the Colorado Basin River Forecast Center (CBRFC) using the National Weather Service (NWS) River Forecasting System (RFS) hydrologic...

  18. Development of streamflow projections under changing climate conditions over Colorado River Basin headwaters

    OpenAIRE

    W. P. Miller; T. C. Piechota; Gangopadhyay, S; T. Pruitt

    2010-01-01

    The current drought over the Colorado River Basin has raised concerns that the US Department of the Interior, Bureau of Reclamation (Reclamation) may impose water shortages over the lower portion of the basin for the first time in history. The guidelines that determine levels of shortage are affected by forecasts determined by the Colorado Basin River Forecast Center (CBRFC). While these forecasts by the CBRFC are useful, water managers within the basin are interested in long-term proj...

  19. Development of streamflow projections under changing climate conditions over Colorado River basin headwaters

    OpenAIRE

    W. P. Miller; T. C. Piechota; Gangopadhyay, S; T. Pruitt

    2011-01-01

    The current drought over the Colorado River Basin has raised concerns that the US Department of the Interior, Bureau of Reclamation (Reclamation) may impose water shortages over the lower portion of the basin for the first time in history. The guidelines that determine levels of shortage are affected by relatively short-term (3 to 7 month) forecasts determined by the Colorado Basin River Forecast Center (CBRFC) using the National Weather Service (NWS) River Forecasting Syste...

  20. Small business lending by commercial banks in Colorado : 1994 to 1996

    OpenAIRE

    Richard J. Sullivan; Johnson, Richard D.; Ronnie J. Phillips; Kenneth R. Spong

    1998-01-01

    The structure of Colorado's banking industry has recently undergone significant change and, therefore, provides a good case study with which to gauge the impact of consolidation on sources of loans and access to credit for small business. We find that between 1994 and 1996, lending to small businesses in Colorado by small to medium size banking organizations grew much faster than lending by large organizations. This lending pattern was similar across in-state and out-of-state banking organiza...

  1. Comparative analysis of Colorado potato beetle (Leptinotarsa decemlineata Say) resistance monitoring methods

    OpenAIRE

    Stanković Slađan; Zabel Anton; Kostić Miodrag; Šestović Milorad

    2003-01-01

    Insecticide efficacy for Colorado potato beetle (Leptinotarsa decemlineata Say) control rapidly decreases due to development of resistance. Resistance causes harmful impact to both, economy and ecology. Resistance monitoring has one of the most important roles in avoiding these problems. Early detection and resistance monitoring could prolong use of insecticides. Standard laboratory methods (impregnated filter papers, insect dipping glass surface spraying and topical application) for Colorado...

  2. Feeding activity and spawning time of striped bass in the Colorado River Inlet, Lake Powell, Utah

    Science.gov (United States)

    Persons, William R.; Bulkly, R.V.

    1982-01-01

    Striped bass, Morone saxatilis, from Lake Powell, Utah spawned in or near the mixing zone of the reservoir and the Colorado River in 1980 and 1981. The fish did not move through Cataract Canyon rapids just above the reservoir in either year. Of 321 adult striped bass stomachs examined, 30% contained food and 28% contained threadfin shad, Dorosoma petenense. No stomachs contained native threatened or endangered Colorado River fishes.

  3. Economic Development from New Generation and Transmission in Wyoming and Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Keyser, D.; Lantz, E.

    2013-03-01

    This report analyzes the potential economic impacts in Colorado and Wyoming of a 225 MW natural gas fired electricity generation facility and a 900 MW wind farm constructed in Wyoming as well as a 180 mile, 345 kV transmission line that runs from Wyoming to Colorado. This report and analysis is not a forecast, but rather an estimate of economic activity associated with a hypothetical scenario.

  4. Economic Development from New Generation and Transmission in Wyoming and Colorado (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2013-03-01

    This report analyzes the potential economic impacts in Colorado and Wyoming of a 225 MW natural gas fired electricity generation facility and a 900 MW wind farm constructed in Wyoming as well as a 180 mile, 345 kV transmission line that runs from Wyoming to Colorado. This report and analysis is not a forecast, but rather an estimate of economic activity associated with a hypothetical scenario.

  5. Holocene valley-floor deposition and incision in a small drainage basin in western Colorado, USA

    OpenAIRE

    Jones, Lawrence S.; Rosenburg, Margaret; del Mar Figueroa, Maria; McKee, Kathleen; Haravitch, Ben; Hunter, Jenna

    2010-01-01

    The valley floor of a 33.9 km^2 watershed in western Colorado experienced gradual sedimentation from before ~ 6765 to ~ 500 cal yr BP followed by deep incision, renewed aggradation, and secondary incision. In contrast, at least four terraces and widespread cut-and-fill architecture in the valley floor downstream indicate multiple episodes of incision and deposition occurred during the same time interval. The upper valley fill history is atypical compared to other drainages in the Colorado Pla...

  6. Costs and Savings Associated With Community Water Fluoridation Programs in Colorado

    Directory of Open Access Journals (Sweden)

    Joan M. O’Connell, PhD

    2005-11-01

    Full Text Available Introduction Local, state, and national health policy makers require information on the economic burden of oral disease and the cost-effectiveness of oral health programs to set policies and allocate resources. In this study, we estimate the cost savings associated with community water fluoridation programs (CWFPs in Colorado and potential cost savings if Colorado communities without fluoridation programs or naturally high fluoride levels were to implement CWFPs. Methods We developed an economic model to compare the costs associated with CWFPs with treatment savings achieved through averted tooth decay. Treatment savings included those associated with direct medical costs and indirect nonmedical costs (i.e., patient time spent on dental visit. We estimated program costs and treatment savings for each water system in Colorado in 2003 dollars. We obtained parameter estimates from published studies, national surveys, and other sources. We calculated net costs for Colorado water systems with existing CWFPs and potential net costs for systems without CWFPs. The analysis includes data for 172 public water systems in Colorado that serve populations of 1000 individuals or more. We used second-order Monte Carlo simulations to evaluate the inherent uncertainty of the model assumptions on the results and report the 95% credible range from the simulation model. Results We estimated that Colorado CWFPs were associated with annual savings of $148.9 million (credible range, $115.1 million to $187.2 million in 2003, or an average of $60.78 per person (credible range, $46.97 to $76.41. We estimated that Colorado would save an additional $46.6 million (credible range, $36.0 to $58.6 million annually if CWFPs were implemented in the 52 water systems without such programs and for which fluoridation is recommended. Conclusion Colorado realizes significant annual savings from CWFPs; additional savings and reductions in morbidity could be achieved if fluoridation

  7. CRevolution 2—Origin and evolution of the Colorado River system, workshop abstracts

    Science.gov (United States)

    : Beard, L. Sue, (Edited By); Karlstrom, Karl E.; Young, Richard A.; Billingsley, George H.

    2011-01-01

    A 2010 Colorado River symposium, held in Flagstaff, Arizona, involved 70 participants who engaged in intense debate about the origin and evolution of the Colorado River system. This symposium, built upon two previous decadal scientific meetings, focused on forging scientific consensus, where possible, while articulating continued controversies regarding the Cenozoic evolution of the Colorado River System and the landscapes of the Colorado Plateau-Rocky Mountain region that it drains. New developments involved hypotheses that Neogene mantle flow is driving plateau tilting and differential uplift and new and controversial hypotheses for the pre-6 Ma presence and evolution of ancestral rivers that may be important in the history and birth of the present Colorado River. There is a consensus that plateau tilt and uplift models must be tested with multidisciplinary studies involving differential incision studies and additional geochronology and thermochronology to determine the relative importance of tectonic and geomorphic forces that shape the spectacular landscapes of the Colorado Plateau, Arizona and region. In addition to the scientific goals, the meeting participants emphasized the iconic status of Grand Canyon for geosciences and the importance of good communication between the research community, the geoscience education/interpretation community, the public, and the media. Building on a century-long tradition, this region still provides a globally important natural laboratory for studies of the interactions of erosion and tectonism in shaping the landscape of elevated plateaus.

  8. Documentation of input datasets for the soil-water balance groundwater recharge model of the Upper Colorado River Basin

    Science.gov (United States)

    Tillman, Fred D

    2015-01-01

    The Colorado River and its tributaries supply water to more than 35 million people in the United States and 3 million people in Mexico, irrigating more than 4.5 million acres of farmland, and generating about 12 billion kilowatt hours of hydroelectric power annually. The Upper Colorado River Basin, encompassing more than 110,000 square miles (mi2), contains the headwaters of the Colorado River (also known as the River) and is an important source of snowmelt runoff to the River. Groundwater discharge also is an important source of water in the River and its tributaries, with estimates ranging from 21 to 58 percent of streamflow in the upper basin. Planning for the sustainable management of the Colorado River in future climates requires an understanding of the Upper Colorado River Basin groundwater system. This report documents input datasets for a Soil-Water Balance groundwater recharge model that was developed for the Upper Colorado River Basin.

  9. A Dreissena Risk Assessment for the Colorado River Ecosystem

    Science.gov (United States)

    Kennedy, Theodore A.

    2007-01-01

    Executive Summary Nonnative zebra and quagga mussels (Dreissena polymorpha and Dreissena bugensis, respectively; see photo above) were accidentally introduced to the Great Lakes in the 1980s and subsequently spread to watersheds of the Eastern United States (Strayer and others, 1999). The introduction of Dreissena mussels has been economically costly and has had large and far-reaching ecological impacts on these systems. Quagga mussels were found in Lakes Mead and Havasu in January 2007. Given the likelihood that quagga mussels and, eventually, zebra mussels will be introduced to Lake Powell and the Colorado River at Lees Ferry, it is important to assess the risks that introduction of Dreissena mussels pose to the Colorado River ecosystem (here defined as the segment of river from just below Glen Canyon Dam to Diamond Creek; hereafter CRE). In this report, I assess three different types of risks associated with Dreissena and the CRE: (1) the risk that Dreissena will establish at high densities in the CRE, (2) the risk of ecological impacts should Dreissena establish at high densities in the CRE or in Lake Powell, and (3) the risk that Dreissena will be introduced to tributaries of the CRE. The risk of Dreissena establishing within the CRE is low, except for the Lees Ferry tailwater reach where the risk appears high. Dreissena are unlikely to establish at high densities within the CRE or its tributaries because of high suspended sediment, high ratios of suspended inorganic:organic material, and high water velocities, all of which interfere with the ability of Dreissena to effectively filter feed. The rapids of Grand Canyon may represent a large source of mortality to larval Dreissena, which would limit their ability to disperse and colonize downstream reaches of the CRE. In contrast, conditions within the Lees Ferry tailwater generally appear suitable for Dreissena establishment, with the exception of high average water velocity. If Dreissena establish within the

  10. Changing landscapes and the cosmopolitism of the eastern Colorado avifauna

    Science.gov (United States)

    Knopf, Fritz L.

    1986-01-01

    of a population are difficult to detect locally. Contemporary issues in the conservation of native species demand regional and continental perspectives (Samson and Knopf 1982). Thus, management activities at specific sites are often viewed as short-sighted by planners and conservation critics. This paper illustrates how these contemporary theories can influence a local conservation perspective. That perspective is developed around historical processes that have led to cosmopolitism of the local avifauna on the Colorado Division of Wildlife's South Platte Wildlife Management Area (SPWMA) near Crook, Colorado.

  11. Allen's big-eared bat (Idionycteris phyllotis) documented in colorado based on recordings of its distinctive echolocation call

    Science.gov (United States)

    Hayes, M.A.; Navo, K.W.; Bonewell, L.; Mosch, C.J.; Adams, R.A.

    2009-01-01

    Allen's big-eared bat (Idionycteris phyllotis) inhabits much of the southwestern USA, but has not been documented in Colorado. We recorded echolocation calls consistent with I. phyllotis near La Sal Creek, Montrose County, Colorado. Based on characteristics of echolocation calls and flight behavior, we conclude that the echolocation calls described here were emitted by I. phyllotis and that they represent the first documentation of this species in Colorado.

  12. USING DEGREE-DAY MODELS TO REDUCE OR OPTIMIZE INSECTICIDE USE ON SUNFLOWER IN NORTHEASTERN COLORADO, PESTICIDE SPECIAL STUDY, COLORADO STATE UNIVERSITY

    Science.gov (United States)

    Specific objectives of this project are: - Develop a degree-day model for the potimum scouting window for the sunflower stem weevil (SSW) and the banded sunflower moth (BSM) in northeastern Colorado. - Develop a degree-day model for the optimum treatment window for the sunflo...

  13. Higher Education in Colorado: The Citizens' Viewpoint. The Results of a State-Wide Survey of Colorado Residents on Higher Education in the State.

    Science.gov (United States)

    Brouillette, John R.; Rogers, David L.

    The views of Colorado citizens on a wide variety of issues about higher education in the state were surveyed. A questionnaire was mailed to 3,939 persons 18 years of age or older who were chosen from driver's license lists. From the 1,816 usable responses, information was obtained on respondent background characteristics and the following nine…

  14. The Colorado Plateau III: integrating research and resources management for effective conservation

    Science.gov (United States)

    Sogge, Mark K.

    2008-01-01

    Roughly centered on the Four Corners region of the southwestern United States, the Colorado Plateau covers an area of 130,000 square miles. The relatively high semi-arid province boasts nine national parks, sixteen national monuments, many state parks, and dozens of wilderness areas. With the highest concentration of parklands in North America and unique geological and ecological features, the area is of particular interest to researchers. Derived from the Eighth Biennial Conference of Research on the Colorado Plateau, this third volume in a series of research on the Colorado Plateau expands upon the previous two books. This volume focuses on the integration of science into resource management issues, summarizes what criteria make a successful collaborative effort, outlines land management concerns about drought, provides summaries of current biological, sociological, and archaeological research, and highlights current environmental issues in the Four Corner States of Arizona, New Mexico, Colorado, and Utah. With broad coverage that touches on topics as diverse as historical aspects of pronghorn antelope movement patterns through calculating watershed prescriptions to the role of wind-blown sand in preserving archaeological sites on the Colorado River, this volume stands as a compendium of cuttingedge management-oriented research on the Colorado Plateau. The book also introduces, for the first time, tools that can be used to assist with collaboration efforts among landowners and managers who wish to work together toward preserving resources on the Colorado Plateau and offers a wealth of insights into land management questions for many readers, especially people interested in the natural history, biology, anthropology, wildlife, and cultural management issues of the region.

  15. Seismicity of the Paradox Basin and the Colorado Plateau interior

    International Nuclear Information System (INIS)

    National Waste Terminal Storage Program site qualification criteria require that a nuclear waste repository be located so that ground motion associated with the maximum credible and maximum probable earthquakes or other earthquake-associated effects will not have an unacceptable adverse impact on system performance. To determine whether a potential repository site located in the Paradox salt formation in the Paradox Basin of southeastern Utah satisfies these criteria, seismological studies were undertaken by Woodward-Clyde Consultants (WCC) in March 1978. These studies included: (1) analysis of historical seismicity; (2) analysis of contemporary seismicity and tectonics of both the Paradox Basin and surrounding Colorado Plateau, including an extensive program of microearthquake monitoring; (3) evaluation of the Paradox Basin crustal structure; (4) evaluation of mining-induced seismicity; and (5) characterization of design-related earthquake-induced ground motions pertinent to a potential repository site through studies of attentation and subsurface ground motions. A detailed discussion of the results of the seismological studies performed through December 1980 is contained in WCC (1982). The purpose of this topical report is to update and summarize the studies on the local, regional, and mining-induced seismicity conducted through December 1982. The limitations of any interpretations are also discussed and additional information that remains to be acquired is identified. 56 references, 45 figures, 4 tables

  16. Paper 5944 Changing Climates @ Colorado State: It's Everybody's Business

    Science.gov (United States)

    Campbell, S.; Calderazzo, J.; Denning, S.; Betsill, M.; Klein, J. A.; Fiege, M.

    2014-12-01

    With the help of faculty from all eight colleges, twenty-seven departments, and numerous other entities on and off the Colorado State University campus, this education and outreach initiative is based on the premises that climate change is everybody's business and that everyone has something to offer in meeting its challenges. Beginning in 2007, CC@CSU has organized some 120 talks to audiences totaling some 6,000, helping inform the student body and community and catalyzing relationships among faculty and researchers across campus. It has offered communication coaching to scientists (and others) who want to translate their expertise for the public. And it has developed a multidisciplinary website (http://changingclimates.colostate.edu) with over 450 annotated entries, all college-level content, primer-level clarity, on topics that include climate science and ecology, economics and emotions, ethics and policy, communication and activism, paleoclimate and human history, and much more. This presentation will address the basic questions of why, who, how, what, for whom, and so what, concluding with some of the key lessons learned about communicating across disciplinary boundaries on this important subject.

  17. Map of mixed prairie grassland vegetation, Rocky Flats, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Clark, S J.V.; Webber, P J; Komarkova, V; Weber, W A

    1980-01-01

    A color vegetation map at the scale of 1:12,000 of the area surrounding the Rocky Flats, Rockwell International Plant near Boulder, Colorado, provides a permanent record of baseline data which can be used to monitor changes in both vegetation and environment and thus to contribute to future land management and land-use policies. Sixteen mapping units based on species composition were identified, and characterized by two 10-m/sup 2/ vegetation stands each. These were grouped into prairie, pasture, and valley side on the basis of their species composition. Both the mapping units and these major groups were later confirmed by agglomerative clustering analysis of the 32 vegetation stands on the basis of species composition. A modified Bray and Curtis ordination was used to determine the environmental factor complexes controlling the distribution of vegetation at Rocky flats. Recommendations are made for future policies of environmental management and predictions of the response to environmental change of the present vegetation at the Rocky Flats site.

  18. Wildlife mitigation and monitoring report Gunnison, Colorado, site

    International Nuclear Information System (INIS)

    The Uranium Mill Tailings Remedial Action (UMTRA) Project is administered by the U.S. Department of Energy (DOE); its purpose is to cleanup uranium mill tailings and other contaminated material at 24 UMTRA Project sites in 10 states. This report summarizes the wildlife mitigation and monitoring program under way at the Gunnison UMTRA Project, Gunnison, Colorado. Remedial action at the Gunnison site was completed in December 1995 and is described in detail in the Gunnison completion report. The impacts of this activity were analyzed in the Gunnison environmental assessment (EA). These impacts included two important game species: the pronghorn antelope (Antilocapra americans) and sage grouse (Wentrocerus urophasianus). Haul truck traffic was predicted to limit antelope access to water sources north of the Tenderfoot Mountain haul road and that truck traffic along this and other haul roads could result in antelope road kills. Clearing land at the disposal cell, haul road and borrow site activities, and the associated human activities also were predicted to negatively impact (directly and indirectly) sage grouse breeding, nesting, loafing, and wintering habitat. As a result, an extensive mitigation and monitoring plan began in 1992. Most of the monitoring studies are complete and the results of these studies, written by different authors, appear in numerous reports. This report will: (1) Analyze existing impacts and compare them to predicted impacts. (2) Summarize mitigation measures. (3) Summarize all existing monitoring data in one report. (4) Analyze the effectiveness of the mitigation measures

  19. Wildlife mitigation and monitoring report Gunnison, Colorado, site

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-04-01

    The Uranium Mill Tailings Remedial Action (UMTRA) Project is administered by the U.S. Department of Energy (DOE); its purpose is to cleanup uranium mill tailings and other contaminated material at 24 UMTRA Project sites in 10 states. This report summarizes the wildlife mitigation and monitoring program under way at the Gunnison UMTRA Project, Gunnison, Colorado. Remedial action at the Gunnison site was completed in December 1995 and is described in detail in the Gunnison completion report. The impacts of this activity were analyzed in the Gunnison environmental assessment (EA). These impacts included two important game species: the pronghorn antelope (Antilocapra americans) and sage grouse (Wentrocerus urophasianus). Haul truck traffic was predicted to limit antelope access to water sources north of the Tenderfoot Mountain haul road and that truck traffic along this and other haul roads could result in antelope road kills. Clearing land at the disposal cell, haul road and borrow site activities, and the associated human activities also were predicted to negatively impact (directly and indirectly) sage grouse breeding, nesting, loafing, and wintering habitat. As a result, an extensive mitigation and monitoring plan began in 1992. Most of the monitoring studies are complete and the results of these studies, written by different authors, appear in numerous reports. This report will: (1) Analyze existing impacts and compare them to predicted impacts. (2) Summarize mitigation measures. (3) Summarize all existing monitoring data in one report. (4) Analyze the effectiveness of the mitigation measures.

  20. Hydrology of coal-lease areas near Durango, Colorado

    Science.gov (United States)

    Brooks, Tom

    1985-01-01

    The U.S. Bureau of Land Management leases Federal lands and minerals for coal mining near Durango, Colorado. This report addresses the hydrologic suitability of those lands for coal leasing; the report describes the general hydrology of the Durango area and, more specifically, the hydrology of the Stollsteimer Creek study area 32 miles east of the Durango and the Hay Gulch study area, 12 miles southwest of Durango. The most productive aquifers in the Durango study area are Quaternary alluvium and the tertiary Animas Formation. Water wells completed in alluvium typically yield 5 to 20 gallons/min; wells completed is the Animas Formation yield as much as 50 gallons/min. Water quality in these aquifers is variable, but it generally is suitable for domestic use. The coal-bearing Cretaceous Fruitland and Menefee Formations are mined by surface methods at the Chimney Rock Mine in the Stollsteimer Creek study area and by underground methods at the National King Coal Mine in the Hay Gulch study area. Effects of surface mining in the Stollsteimer Creek area are: (1) Dewatering of an alluvial aquifer; and (2) Local degradation of alluvium water quality by spoil-pile effluent. Effects of underground mining in the Hay Gulch area are: (1) Introduction of water with greater dissolved-solids concentrations into the upper Hay Gulch alluvium from mine runoff; (2) Subsidence fracturing which could dewater streams and the alluvial aquifer. (USGS)

  1. 海南坡鹿栖息地的外来植物调查%Field Survey of Alien Plants in Habitats of Hainan Eld's Deer ( Cervus eldi hainanus )

    Institute of Scientific and Technical Information of China (English)

    符明利; 吴琳琳; 侯荣; 林思亮

    2012-01-01

    Hainan Eld's deer ( Cervus eldi hainanus ) is a national - level protected species and endemic to China. The stability and development of Eld's deer habitats play a significant role in population growth. Alien invasive plants can affect habitats ir- reversibly over long time periods. We surveyed the alien plants in Hainan Datian National Nature Reserve, where Hainan Eld's deer occur, using line transects and quadrats from 2009 to 2011. We recorded 115 alien plant species of 40 families and 95 genera. Among these, 80 herbs accounted for 70% and most are tropical species, 50% were introduced from the Americas and were mainly distributed in grasslands. The widely distributed alien plants impact the abundance and distribution of native spe- cies and may have a negative effect on Eld's deer food resource in future. We make several recommendations for effective man- agement and conservation. Our survey results can provide a basis for maintaining the stability of Hainan Eld's deer habitat.%海南坡鹿是中国特有的国家Ⅰ级重点保护野生动物,其栖息地的稳定和发展对该物种种群有重要意义。潜在的外来入侵植物会对栖息地产生长期不可恢复的影响。因此,我们于2009—2011年采用样方调查和线路调查相结合的方法对海南坡鹿的栖息地海南大田国家级自然保护区内的外来植物进行了调查,共记录外来植物40科95属115种。其中,草本植物80种,占总物种数的69.6%;不论从科区系还是属区系上看,外来植物的区系分布都具有热带性;50.4%的外来植物产自美洲,在草地中分布最多。保护区内分布广泛的外来植物已对乡土物种产生一定的影响,也将可能对坡鹿的食物资源产生不利影响。根据调查结果,我们提出了一些保护管理建议。

  2. Sensitivity of the Colorado Plateau to change: Climate, ecosystems, and society

    Science.gov (United States)

    Schwinning, S.; Belnap, J.; Bowling, David R.; Ehleringer, J.R.

    2008-01-01

    The Colorado Plateau is located in the interior, dry end of two moisture trajectories coming from opposite directions, which have made this region a target for unusual climate fluctuations. A multidecadal drought event some 850 years ago may have eliminated maize cultivation by the first human settlers of the Colorado Plateau, the Fremont and Anasazi people, and contributed to the abandonment of their settlements. Even today, ranching and farming are vulnerable to drought and struggle to persist. The recent use of the Colorado Plateau primarily as rangeland has made this region less tolerant to drought due to unprecedented levels of surface disturbances that destroy biological crusts, reduce soil carbon and nitrogen stocks, and increase rates of soil erosion. The most recent drought of 2002 demonstrated the vulnerability of the Colorado Plateau in its currently depleted state and the associated costs to the local economies. New climate predictions for the southwestern United States include the possibility of a long-term shift to warmer, more arid conditions, punctuated by megadroughts not seen since medieval times. It remains to be seen whether the present-day extractive industries, aided by external subsidies, can persist in a climate regime that apparently exceeded the adaptive capacities of the Colorado Plateau's prehistoric agriculturalists.

  3. Debris Flow Occurrence and Sediment Persistence, Upper Colorado River Valley, CO

    Science.gov (United States)

    Grimsley, K. J.; Rathburn, S. L.; Friedman, J. M.; Mangano, J. F.

    2016-07-01

    Debris flow magnitudes and frequencies are compared across the Upper Colorado River valley to assess influences on debris flow occurrence and to evaluate valley geometry effects on sediment persistence. Dendrochronology, field mapping, and aerial photographic analysis are used to evaluate whether a 19th century earthen, water-conveyance ditch has altered the regime of debris flow occurrence in the Colorado River headwaters. Identifying any shifts in disturbance processes or changes in magnitudes and frequencies of occurrence is fundamental to establishing the historical range of variability (HRV) at the site. We found no substantial difference in frequency of debris flows cataloged at eleven sites of deposition between the east (8) and west (11) sides of the Colorado River valley over the last century, but four of the five largest debris flows originated on the west side of the valley in association with the earthen ditch, while the fifth is on a steep hillslope of hydrothermally altered rock on the east side. These results suggest that the ditch has altered the regime of debris flow activity in the Colorado River headwaters as compared to HRV by increasing the frequency of debris flows large enough to reach the Colorado River valley. Valley confinement is a dominant control on response to debris flows, influencing volumes of aggradation and persistence of debris flow deposits. Large, frequent debris flows, exceeding HRV, create persistent effects due to valley geometry and geomorphic setting conducive to sediment storage that are easily delineated by valley confinement ratios which are useful to land managers.

  4. Climate change and changes in sediment transport capacity in the Colorado Plateau, USA

    Science.gov (United States)

    Milhous, R.T.

    2005-01-01

    Information is presented on changes in the sediment transport capacity of streams of the Colorado Plateau region of the United States. The changes in transport capacity may be due to changes in climate. Changes in the ability of three rivers in the Colorado Plateau to transport sediment were investigated (Paria River at Lees Ferry, Arizona; Sevier River at Hatch, Utah; and Little Colorado at Woodruff, Arizona) using an index to sediment transport potential (or capacity) of the rivers. The index is called a Sediment Transport Capacity Index (STCI). The parameters in the index are calibrated to measured sediment concentrations. Other investigators have postulated that there have been three climate regimes in the Colorado Plateau during the 20th century: 1905-1941, 1942-1977 and 1978-1998. Time series analyses of the STCI showed reasonably clearly that there was a change in the climate about 1941 and a high probability of a change about 1923-1929. The STCI time series for the Sevier River had the expected pattern because the STCI increased in the years following 1997 nearly to the pre-1942 values from lower 1942-1977 values. The Little Colorado River showed a similar pattern, but not nearly to the magnitude suggested by the change in precipitation. The STCI for the Paria River essentially did not change. Changes in sediment transport also are investigated in the lower San Juan River where alterations in the sediment balance of the river may be due to variations in the character of summer precipitation.

  5. A class III archaeological survey of twelve region wide fencing upgrade locations in Eagle, Grand, Gunnison, Jackson, Moffat, Pitkin, and Routt counties, Colorado

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Colorado Department of Transportation proposes to upgrade existing right-of-way fencing along roadways at twelve separate locations in northwestern Colorado. To...

  6. Remedial action plan for the inactive uranium processing site at Naturita, Colorado. DOE responses to comments from U.S. Nuclear Regulatory Commission and Colorado Department of Public Health and Environment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-11-16

    This report contains responses by the US Department of Energy to comments from the US Nuclear Regulatory Commission and the Colorado Department of Public Health and Environment on the Naturita remedial action plan. This was done in an attempt to clarify information. The site is an inactive uranium processing site at Naturita, Colorado.

  7. Remedial action plan for the inactive uranium processing site at Naturita, Colorado. DOE responses to comments from U.S. Nuclear Regulatory Commission and Colorado Department of Public Health and Environment

    International Nuclear Information System (INIS)

    This report contains responses by the US Department of Energy to comments from the US Nuclear Regulatory Commission and the Colorado Department of Public Health and Environment on the Naturita remedial action plan. This was done in an attempt to clarify information. The site is an inactive uranium processing site at Naturita, Colorado

  8. SRTM Colored Height and Shaded Relief: Pinon Canyon region, Colorado

    Science.gov (United States)

    2001-01-01

    Erosional features are prominent in this view of southern Colorado taken by the Shuttle Radar Topography Mission (SRTM). The area covers about 20,000 square kilometers and is located about 50 kilometers south of Pueblo, Colorado. The prominent mountains near the left edge of the image are the Spanish Peaks, remnants of a 20 million year old volcano. Rising 2,100 meters (7,000 ft) above the plains to the east, these igneous rock formations with intrusions of eroded sedimentary rock historically served as guiding landmarks for travelers on the Mountain Branch of the Santa Fe Trail.Near the center of the image is the Pinon Canyon Maneuver Site, a training area for soldiers of the U.S. Army from nearby Fort Carson. The site supports a diverse ecosystem with large numbers of big and small game, fisheries, non-game wildlife, forest, range land and mineral resources. It is bounded on the east by the dramatic topography of the Purgatoire River Canyon, a 100 meter (328 foot) deep scenic red canyon with flowing streams, sandstone formations, and exposed geologic processes.Two visualization methods were combined to produce this image: shading and color coding of topographic height. The shade image was derived by computing topographic slope in the northwest-southeast direction. Southern slopes appear bright and northern slopes appear dark. Color coding is directly related to topographic height, with blue and green at the lower elevations, rising through yellow and brown to white at the highest elevations.Elevation data used in this image was acquired by the Shuttle Radar Topography Mission (SRTM) aboard the Space Shuttle Endeavour, launched on February 11, 2000. SRTM used the same radar instrument that comprised the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR)that flew twice on the Space Shuttle Endeavour in 1994. SRTM was designed to collect three-dimensional measurements of the Earth's surface. To collect the 3-D data, engineers added a 60-meter

  9. Indoor air quality in Latino homes in Boulder, Colorado

    Science.gov (United States)

    Escobedo, Luis E.; Champion, Wyatt M.; Li, Ning; Montoya, Lupita D.

    2014-08-01

    Indoor concentrations of airborne pollutants can be several times higher than those found outdoors, often due to poor ventilation, overcrowding, and the contribution of indoor sources within a home. Americans spend most of their time indoors where exposure to poor indoor air quality (IAQ) can result in diminished respiratory and cardiovascular health. This study measured the indoor air quality in 30 homes of a low-income Latino community in Boulder, Colorado during the summer of 2012. Participants were administered a survey, which included questions on their health conditions and indoor air pollution sources like cigarette smoke, heating fuel, and building materials. Twenty-four hour samples of fine particulate matter (PM2.5) from the indoor air were collected in each home; ambient PM2.5 samples were collected each day as well. Concurrent air samples were collected onto 47 mm Teflo and Tissuquartz filter at each location. Teflo filters were analyzed gravimetrically to measure PM2.5 and their extracts were used to determine levels of proteins and endotoxins in the fine fraction. The Tissuquartz filters were analyzed for elemental and organic carbon content (EC/OC). Results indicated that the indoor air contained higher concentrations of PM2.5 than the ambient air, and that the levels of OC were much higher than EC in both indoor and outdoor samples. This community showed no smoking in their homes and kept furry pets indoors at very low rates; therefore, cooking is likely the primary source of indoor PM. For responders with significant exposure to PM, it appeared to be primarily from occupational environments or childhood exposure abroad. Our findings indicate that for immigrant communities such as this, it is important to consider not only their housing conditions but also the relevant prior exposures when conducting health assessments.

  10. Mercury dynamics in the Rocky Mountain, Colorado, snowpack

    Science.gov (United States)

    Faïn, X.; Helmig, D.; Hueber, J.; Obrist, D.; Williams, M. W.

    2013-06-01

    Gaseous elemental mercury (GEM) was monitored at the Niwot Ridge (NWT) Long-Term Ecological Research (LTER) site (Colorado, USA, 40° N) from interstitial air extracted from the snowpack at depths ranging from the snow surface to 10 cm above the soil. A highly dynamic cycling of mercury (Hg) in this mid-latitude snowpack was observed. Patterns were driven by both GEM production in surface snow and GEM destruction in the deeper snowpack layers. Thorough mixing and vertical transport processes were observed through the snowpack. GEM was photochemically produced near the snow-air interface throughout the entire winter, leading to enhanced GEM levels in interstitial air of surface snow of up to 8 ng m-3. During low-wind periods, GEM in surface snow layers remained significantly above ambient air levels at night as well, which may indicate a potential weak GEM production overnight. Analyses of vertical GEM gradients in the snowpack show that surface GEM enhancements efficiently propagated down the snowpack, with a temporal lag in peak GEM levels observed with increasing depth. Downward diffusion was responsible for much of these patterns, although vertical advection also contributed to vertical redistribution. Destruction of GEM in the lower snowpack layers was attributed to dark oxidation of GEM. Analysis of vertical GEM / CO2 flux ratios indicated that this GEM destruction occurred in the snow and not in the underlying soil. The strong, diurnal patterns of photochemical GEM production at the surface ultimately lead to re-emission losses of deposited Hg back to the atmosphere. The NWT data show that highest GEM surface production and re-emissions occur shortly after fresh snowfall, which possibly resupplies photoreducible Hg to the snowpack, and that photochemical GEM reduction is not radiation-limited as it is strong even on cloudy days.

  11. Mercury dynamics in the Rocky Mountain, Colorado, snowpack

    Directory of Open Access Journals (Sweden)

    X. Faïn

    2013-06-01

    Full Text Available Gaseous elemental mercury (GEM was monitored at the Niwot Ridge (NWT Long-Term Ecological Research (LTER site (Colorado, USA, 40° N from interstitial air extracted from the snowpack at depths ranging from the snow surface to 10 cm above the soil. A highly dynamic cycling of mercury (Hg in this mid-latitude snowpack was observed. Patterns were driven by both GEM production in surface snow and GEM destruction in the deeper snowpack layers. Thorough mixing and vertical transport processes were observed through the snowpack. GEM was photochemically produced near the snow-air interface throughout the entire winter, leading to enhanced GEM levels in interstitial air of surface snow of up to 8 ng m−3. During low-wind periods, GEM in surface snow layers remained significantly above ambient air levels at night as well, which may indicate a potential weak GEM production overnight. Analyses of vertical GEM gradients in the snowpack show that surface GEM enhancements efficiently propagated down the snowpack, with a temporal lag in peak GEM levels observed with increasing depth. Downward diffusion was responsible for much of these patterns, although vertical advection also contributed to vertical redistribution. Destruction of GEM in the lower snowpack layers was attributed to dark oxidation of GEM. Analysis of vertical GEM / CO2 flux ratios indicated that this GEM destruction occurred in the snow and not in the underlying soil. The strong, diurnal patterns of photochemical GEM production at the surface ultimately lead to re-emission losses of deposited Hg back to the atmosphere. The NWT data show that highest GEM surface production and re-emissions occur shortly after fresh snowfall, which possibly resupplies photoreducible Hg to the snowpack, and that photochemical GEM reduction is not radiation-limited as it is strong even on cloudy days.

  12. Measurements of Fluorescent Bioaerosol Particles in the Colorado Front Range

    Science.gov (United States)

    Perring, A. E.; Emerson, J. B.; Fierer, N.; Schwarz, J. P.; Fahey, D. W.

    2013-12-01

    Bioaerosols are of atmospheric interest due to their potential importance as cloud condensation and heterogeneous ice nuclei and because they represent a sizeable fraction of coarse mode aerosol in some locations. Relatively little data exists, however, regarding diurnal, seasonal and annual cycles of bioaerosols and the meteorological processes that control them. Newly developed real-time instrumentation allows for sensitive, high time resolution detection of fluorescent bioaerosols and is uniquely suited to address key uncertainties in the sources, distributions and behavior of these particles in the atmosphere. Here we present observations of ambient fluorescent biological aerosol made on the Front Range of Colorado using a custom-modified Wideband Integrated Bioaerosol Sensor (WIBS) during the summer and fall of 2013. The summertime measurements were made from the roof of the NOAA ESRL David Skaggs Research Center in Boulder and the fall measurements were made both at the surface and aloft at the Boulder Atmospheric Observatory Tall Tower. We examine diurnal variations in loading and size distribution of fluorescent bioaerosol at the two locations. We also investigate the relationship between meteorological events and fluorescent bioaerosol. For example, we observe higher concentrations and markedly different number distributions associated with precipitation events. Simultaneous filter samples were collected for DNA sequencing and flow cytometry. To our knowledge this represents the first such comparison for the WIBS under ambient conditions and the microbial identification accomplished with the filters adds significantly to the analysis. This data set will provide useful insight into the sources, loadings and properties of fluorescent bioaerosol and the local and regional processes that drive them.

  13. Reclamation studies on oil shale lands in northwestern Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Cook, C.W.; Redente, E.F.

    1980-02-01

    The overall objective of this project is to study the effects of various reclamation practices on above- and belowground ecosystem development associated with disturbed oil shale lands in northwestern Colorado. Plant growth media that are being used in field test plots include retorted shale, soil over retorted shale, subsoil materials, and surface disturbed topsoils. Some of the more significant results are: (1) a soil cover of at least 61 cm in conjunction with a capiallary barrier provided the best combination of treatments for the establishment of vegetation and a functional microbial community, (2) aboveground production values for native and introduced species mixtures are comparable after three growing seasons, (3) cover values for native species mixtures are generally greater than for introduced species, (4) native seed mixtures, in general, allow greater invasion to occur, (5) sewage sludge at relatively low rates appears to provide the most beneficial overall effect on plant growth, (6) cultural practices, such as irrigated and mulching have significant effects on both above- and belowground ecosystem development, (7) topsoil storage after 1.5 years does not appear to significantly affect general microbial activities but does reduce the mycorrhizal infection potential of the soil at shallow depths, (8) populations of mycorrhizal fungi are decreased on severely disturbed soils if a cover of vegetation is not established, (9) significant biological differences among ecotypes of important shrub species have been identified, (10) a vegetation model is outlined which upon completion will enable the reclamation specialist to predict the plant species combinations best adapted to specific reclamation sites, and (11) synthetic strains of two important grass species are close to development which will provide superior plant materials for reclamation in the West.

  14. Hydrogeochemistry and simulated solute transport, Piceance Basin, northwestern Colorado

    Science.gov (United States)

    Robson, Stanley G.; Saulnier, George J.

    1980-01-01

    Oil-shale mining activities in Piceance basin in northwestern Colorado could adversely affect the ground- and surface-water quality in the basin. This study of the hydrology and geochemistry of the area used groundwater solute-transport-modeling techniques to investigate the possible impact of the mines on water quality. Maps of the extent and structure of the aquifer were prepared and show that a saturated thickness of 2,000 feet occurs in the northeast part of the basin. Ground-water recharge in the upland areas in the east, south, and west parts of the basin moves down into deeper zones in the aquifer and laterally to the discharge areas along Piceance and Yellow Creeks. The saline zone and the unsaturated zone provide the majority of the dissolved solids found in the ground water. Precipitation, ion-exchange, and oxidation-reduction reactions are also occurring in the aquifer. Model simulations of groundwater pumpage in tracts C-a and C-b indicate that the altered direction of groundwater movement near the pumped mines will cause an improvement in groundwater quality near the mines and a degradation of water quality downgradient from the tracts. Model simulations of mine leaching in tract C-a and C-b indicate that equal rates of mine leaching in the tracts will produce much different effects on the water quality in the basin. Tract C-a, by virtue of its remote location from perennial streams, will primarily degrade the groundwater quality over a large area to the northeast of the tract. Tract C-b, by contrast, will primarily degrade the surface-water quality in Piceance Creek, with only localized effects on the groundwater quality. (USGS)

  15. 1997 Monitoring report for the Gunnison, Colorado Wetlands Mitigation Plan

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-11-01

    Under the Uranium Mill Tailings Remedial Action (UMTRA) Project, the U.S. Department of Energy (DOE) cleaned up uranium mill tailings and other surface contamination near the town of Gunnison, Colorado. Remedial action resulted in the elimination of 4.3 acres (ac) (1.7 hectares [ha]) of wetlands. This loss is mitigated by the enhancement of six spring-fed areas on Bureau of Land Management (BLM) land (mitigation sites). Approximately 254 ac (1 03.3 ha) were fenced at the six sites to exclude grazing livestock. Of the 254 ac (103.3 ha), 17.8 ac (7.2 ha) are riparian plant communities; the rest are sagebrush communities. Baseline grazed conditions of the riparian plant communities at the mitigation sites were measured prior to fencing. This report discusses results of the fourth year of a monitoring program implemented to document the response of vegetation and wildlife to the exclusion of livestock. Three criteria for determining success of the mitigation were established: plant height, vegetation density (bare ground), and vegetation diversity. By 1996, Prospector Spring, Upper Long`s Gulch, and Camp Kettle met the criteria. The DOE requested transfer of these sites to BLM for long-term oversight. The 1997 evaluation of the three remaining sites, discussed in this report, showed two sites (Houston Gulch and Lower Long`s Gulch) meet the criteria. The DOE will request the transfer of these two sites to the BLM for long-term oversight. The last remaining site, Sage Hen Spring, has met only two of the criteria (percent bare ground and plant height). The third criterion, vegetation diversity, was not met. The vegetation appears to be changing from predominantly wet species to drier upland species, although the reason for this change is uncertain. It may be due to below-normal precipitation in recent years, diversion of water from the spring to the stock tank, or manipulation of the hydrology farther up gradient.

  16. Molybdenite in the Montezuma District of central Colorado

    Science.gov (United States)

    Neuerburg, George J.; Botinelly, Theodore; Watterson, John R.

    1974-01-01

    The Montezuma mining district, in the Colorado mineral belt, is defined by an assemblage of porphyry, ore, and altered rocks that originated in the venting of a Tertiary batholith through weak structures in Precambrian rocks. The ore consists of silver-lead-zinc veins clustered on the propylitic fringe of a geometrically complex system of altered rocks, which is centered on the intersection of the Oligocene Montezuma stock with the Montezuma shear zone of Precambrian ancestry. Alteration chemistry conforms to the standard porphyry-metal model but is developed around several small intrusives strung out along the shear zone and is expressed as a mottled pattern, rather than as the usual thick concentric zones centered on one large plug. The distribution of trace amounts of molybdenite is consistent with the postulate of molybdenite deposits in the district, but the mottled alteration pattern may signify small and scattered, possibly very deep, deposits. Disseminated molybdenite is essentially coextensive with altered rock and increases slightly in quantity toward the inner alteration zones. Two groups of molybdenite veins, associated with phyllic and potassic alteration, represent possible diffuse halos of molybdenite deposits. One group of veins resembles the Climax and Henderson deposits but was seen only in a small and isolated area of outcrops. The second group of molybdenite veins is in a bismuth-rich part of the Montezuma stock and underlies an area of bismuth veins; this group records the passage of contact metasomatic ore fluids. Another bismuth-rich area is in the southeast corner of the stock in a region of bismuth veins and may indicate a third group of molybdenite veins.

  17. 1997 Monitoring report for the Gunnison, Colorado Wetlands Mitigation Plan

    International Nuclear Information System (INIS)

    Under the Uranium Mill Tailings Remedial Action (UMTRA) Project, the U.S. Department of Energy (DOE) cleaned up uranium mill tailings and other surface contamination near the town of Gunnison, Colorado. Remedial action resulted in the elimination of 4.3 acres (ac) (1.7 hectares [ha]) of wetlands. This loss is mitigated by the enhancement of six spring-fed areas on Bureau of Land Management (BLM) land (mitigation sites). Approximately 254 ac (1 03.3 ha) were fenced at the six sites to exclude grazing livestock. Of the 254 ac (103.3 ha), 17.8 ac (7.2 ha) are riparian plant communities; the rest are sagebrush communities. Baseline grazed conditions of the riparian plant communities at the mitigation sites were measured prior to fencing. This report discusses results of the fourth year of a monitoring program implemented to document the response of vegetation and wildlife to the exclusion of livestock. Three criteria for determining success of the mitigation were established: plant height, vegetation density (bare ground), and vegetation diversity. By 1996, Prospector Spring, Upper Long's Gulch, and Camp Kettle met the criteria. The DOE requested transfer of these sites to BLM for long-term oversight. The 1997 evaluation of the three remaining sites, discussed in this report, showed two sites (Houston Gulch and Lower Long's Gulch) meet the criteria. The DOE will request the transfer of these two sites to the BLM for long-term oversight. The last remaining site, Sage Hen Spring, has met only two of the criteria (percent bare ground and plant height). The third criterion, vegetation diversity, was not met. The vegetation appears to be changing from predominantly wet species to drier upland species, although the reason for this change is uncertain. It may be due to below-normal precipitation in recent years, diversion of water from the spring to the stock tank, or manipulation of the hydrology farther up gradient

  18. Remedial action selection report Maybell, Colorado, site. Final report

    International Nuclear Information System (INIS)

    The Maybell uranium mill tailings site is 25 miles (mi) (40 kilometers [km]) west of the town of Craig, Colorado, in Moffat County, in the northwestern part of the state. The unincorporated town of Maybell is 5 road mi (8 km) southwest of the site. The site is 2.5 mi (4 km) northeast of the Yampa River on relatively flat terrain broken by low, flat-topped mesas. U.S. Highway 40 runs east-west 2 mi (3.2 km) south of the site. The designated site covers approximately 110 acres (ac) (45 hectares [ha]) and consists of a concave-shaped tailings pile and rubble from the demolition of the mill buildings buried in the former mill area. The site is situated between Johnson Wash to the east and Rob Pit Mine to the west. Numerous reclaimed and unreclaimed mines are in the immediate vicinity. Aerial photographs (included at the end of this executive summary) show evidence of mining activity around the Maybell site. Contaminated materials at the Maybell processing site include the tailings pile, which has an average depth of 20 feet (ft) (6 meters [ml]) and contains 2.8 million cubic yards (yd3) (2.1 million cubic meters [m3]) of tailings. The former mill processing area is on the north side of the site and contains 20,000 yd 3 (15,000 m3) of contaminated demolition debris. Off-pile contamination is present and includes areas adjacent to the tailings pile, as well as contamination dispersed by wind and surface water flow. The volume of off-pile contamination to be placed in the disposal cell is 550,000 yd3(420,000 m3). The total volume of contaminated materials to be disposed of as part of the remedial action is estimated to be 3.37 million yd3 (2.58 million m3)

  19. Municipal geothermal heat utilization plan for Glenwood Springs, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    1980-12-31

    A study has been made of the engineering and economic feasibility of utilizing the geothermal resource underlying Glenwood Springs Colorado, to heat a group of public buildings. The results have shown that the use of geothermal heat is indeed feasible when compared to the cost of natural gas. The proposed system is composed of a wellhead plate heat exchanger which feeds a closed distribution loop of treated water circulated to the buildings which form the load. The base case system was designed to supply twice the demand created by the seven public buildings in order to take advantage of some economies of scale. To increase the utilization factor of the available geothermal energy, a peaking boiler which burns natural gas is recommended. Disposal of the cooled brine would be via underground injection. Considerable study was done to examine the impact of reduced operating temperature on the existing heating systems. Several options to minimize this problem were identified. Economic analyses were completed to determine the present values of heat from the geothermal system and from the present natural gas over a 30 year projected system life. For the base case savings of over $1 million were shown. Sensitivities of the economics to capital cost, operating cost, system size and other parameters were calculated. For all reasonable assumptions, the geothermal system was cheaper. Financing alternatives were also examined. An extensive survey of all existing data on the geology of the study has led to the prediction of resource parameters. The wellhead temperature of produced fluid is suspected to lie between 140 and 180/sup 0/F (60 and 82/sup 0/C). Flowrates may be as high as 1000 gpm (3800 liters per minute) from a reservoir formation that is 300 ft (90 m) thick beginning about 500 ft (150 m) below the suggested drill site in the proposed Two Rivers Park.

  20. National Uranium Resource Evaluation: Cortez quadrangle, Colorado and Utah

    International Nuclear Information System (INIS)

    Six stratigraphic units are recognized as favorable for the occurrence of uranium deposits that meet the minimum size and grade requirements of the U.S. Department of Energy in the Cortez 10 x 20 Quadrangle, Utah and Colorado. These units include the Jurassic Salt Wash, Recapture, and Brushy Basin Members of the Morrison Formation and the Entrada Sandstone, the Late Triassic Chinle Formation, and the Permian Cutler Formation. Four areas are judged favorable for the Morrison members which include the Slick Rock, Montezuma Canyon, Cottonwood Wash and Hatch districts. The criteria used to determine favorability include the presence of the following (1) fluvial sandstone beds deposited by low-energy streams; (2) actively moving major and minor structures such as the Paradox Basin and the many folds within it; (3) paleostream transport directions approximately perpendicular to the trend of many of the paleofolds; (4) presence of favorable gray lacustrine mudstone beds; and (5) known uranium occurrences associated with the favorable gray mudstones. Two areas of favorability are recognized for the Chinle Formation. These areas include the Abajo Mountain and Aneth-Ute Mountain areas. The criteria used to determine favorability include the sandstone-to-mudstone ratio for the Chinle Formation and the geographic distribution of the Petrified Forest Member of the Chinle Formation. Two favorable areas are recognized for the Cutler Formation. Both of these areas are along the northern border of the quadrangle between the Abajo Mountains and the Dolores River Canyon area. Two areas are judged favorable for the Entrada Sandstone. One area is in the northeast corner of the quadrangle in the Placerville district and the second is along the eastern border of the quadrangle on the southeast flank of the La Plata Mountains

  1. "Actionable" Climate Scenarios for Natural Resource Managers in Southwestern Colorado

    Science.gov (United States)

    Rangwala, I.; Rondeau, R.; Wyborn, C.

    2014-12-01

    Locally relevant projections of climate change provide critical insights for natural resource managers seeking to adapt their management activities to climate change. To provide such information, we developed narrative scenarios of future climate change and its impacts on different ecosystems in southwestern Colorado. This multi-institution and trans-disciplinary project seeks to provide useful and useable knowledge to facilitate climate change adaptation in the context of uncertainty. The narratives are intended to provide detailed insights into the range of changes that natural resource managers may face in the future. These scenarios were developed in an iterative process through interactions between ecologists, social and climate scientists. In our scenario development process, climate uncertainty is acknowledged by having multiple scenarios, where each scenario is regarded as a storyline with equal probability as another scenario. Rather than a qualitative narration of the general direction of change and range in responses, we quantified changes in several decision relevant climate and ecological responses based on our best available understanding and provided a tight storyline for each scenario to facilitate (a) a more augmented use of scientific information in a decision-making process, (b) differential responses from stakeholders across the different scenarios, and (c) identification of strategies that could work across these multiple scenarios. This presentation will discuss the process of selecting the scenarios, quantifying climate and ecological responses, and the criteria for building the narrative for each scenario. We will also cover the process by which these scenarios get used, and how the user feedbacks are integrated in further developing the tools and processes.

  2. Quantifying atmospheric nitrogen outflow from the Front Range of Colorado

    Science.gov (United States)

    Neuman, J. A.; Eilerman, S. J.; Brock, C. A.; Brown, S. S.; Dube, W. P.; Herndon, S. C.; Holloway, J. S.; Nowak, J. B.; Roscioli, J. R.; Ryerson, T. B.; Sjostedt, S. J.; Thompson, C. R.; Trainer, M.; Veres, P. R.; Wild, R. J.

    2015-12-01

    Reactive nitrogen emitted to the atmosphere from urban, industrial, and agricultural sources can be transported and deposited far from the source regions, affecting vegetation, soils, and water of sensitive ecosystems. Mitigation of atmospheric nitrogen deposition requires emissions characterization and quantification. Ammonia (NH3), a full suite of gas-phase oxidized nitrogen compounds, and particulate matter were measured from an aircraft that flew downwind from concentrated animal feeding operations, oil and gas extraction facilities, and urban areas along the Colorado Front Range in March and April 2015, as part of the Shale Oil and Natural Gas Nexus (SONGNEX) field study. Additionally, NH3 measurements from a fully instrumented aircraft that flew over the same region in July and August 2014 as part of the Front Range Air Pollution and Photochemistry Experiment (FRAPPE) are used to examine atmospheric nitrogen emission and transport. Cross-wind plume transects and altitude profiles were performed over the source regions and 60-240 km downwind. Plumes were transported in the boundary layer with large NH3 mixing ratios (typically 20-100 ppbv) and were tens of km wide. The NH3 in these plumes provided an atmospheric nitrogen burden greater than 0.2 kg N/ha. Nitrogen oxides and their oxidation products and particulate matter were also enhanced in the plumes, but with concentrations substantially less than NH3. With efficient transport followed by wet deposition, these plumes have the potential to provide a large nitrogen input to the neighboring Rocky Mountain National Park, where nitrogen deposition currently exceeds the ecological critical load of 1.5 kg N/ha/yr.

  3. 77 FR 35669 - AltaGas Renewable Energy Colorado LLC; Supplemental Notice That Initial Market-Based Rate Filing...

    Science.gov (United States)

    2012-06-14

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AltaGas Renewable Energy Colorado LLC; Supplemental Notice That Initial... notice in the above-referenced proceeding of AltaGas Renewable Energy Colorado LLC application for...

  4. 78 FR 46521 - Approval and Promulgation of Air Quality Implementation Plans; State of Colorado; Second 10-Year...

    Science.gov (United States)

    2013-08-01

    ... for the Colorado Springs area for the carbon monoxide (CO) National Ambient Air Quality Standard... Subjects in 40 CFR Part 52 Environmental protection, Air pollution control, Carbon monoxide, Incorporation...; Second 10-Year Carbon Monoxide Maintenance Plan for Colorado Springs AGENCY: Environmental...

  5. Childhood Obesity in Colorado: A Growing Problem--The Impact of the Epidemic and Recommendations for Solutions

    Science.gov (United States)

    Trujillo, Tara

    2007-01-01

    Colorado traditionally has ranked as one of the healthiest states in the nation, a claim that reinforces a culture of activity, community and well-being. Though Colorado is ahead of the curve in this area, Coloradans aren't immune to the growing trends that threaten the health of people across the nation. One of the most concerning elements of…

  6. The Effects of Increased Academic Requirements for Graduation on Secondary Vocational Enrollments in Colorado. Research Report. Executive Summary.

    Science.gov (United States)

    Anderson, B. Harold; Brouillette, Mary DeMaio

    A study examined the effects of increased academic requirements for graduation on secondary vocational enrollments in Colorado. After identifying 111 of the school districts in Colorado that have recently increased their graduation requirements (representing 61 percent of the 180 school districts in the State), researchers randomly selected five…

  7. FY 1978-79 Zero-Base Budget Review. The Colorado State System of Community and Junior Colleges: A Summary.

    Science.gov (United States)

    Tollefson, Terrence A.

    Two reports are presented in this document prepared for the Colorado State Legislature. The first, a zero-base budget review, presents a summary of the characteristics of the student population served by Colorado's 11 junior colleges. The summary includes statistics on age range, state of residence, gender, ethnic background, types of financial…

  8. Vegetation and substrate on aeolian landscapes in the Colorado River corridor, Cataract Canyon, Utah

    Science.gov (United States)

    Draut, Amy E.; Gillette, Elizabeth R.

    2010-01-01

    Vegetation and substrate data presented in this report characterize ground cover on aeolian landscapes of the Colorado River corridor through Cataract Canyon, Utah, in Canyonlands National Park. The 27-km-long Cataract Canyon reach has undergone less anthropogenic alteration than other reaches of the mainstem Colorado River. Characterizing ecosystem parameters there provides a basis against which to evaluate future changes, such as those that could result from the further spread of nonnative plant species or increased visitor use. Upstream dams have less effect on the hydrology and sediment supply in Cataract Canyon compared with downstream reaches in Grand Canyon National Park. For this reason, comparison of these vegetation and substrate measurements with similar data from aeolian landscapes of Grand Canyon will help to resolve the effects of Glen Canyon Dam operations on the Colorado River corridor ecosystem.

  9. Business Metrics for High-Performance Homes: A Colorado Springs Case Study

    Energy Technology Data Exchange (ETDEWEB)

    Beach, R. [IBACOS, Inc., Pittsburgh, PA (United States); Jones, A. [IBACOS, Inc., Pittsburgh, PA (United States)

    2016-04-26

    The building industry needs to understand how energy ratings can impact homebuilders. Of interest is how energy efficiency may or may not have a positive impact on homebuilders’ business success. Focusing on Colorado Springs, Colorado, as a case study, the U.S. Department of Energy’s Building America research team IBACOS suggests a win–win between a builder’s investment in energy efficiency and that builder’s ability to sell homes. Although this research did not ultimately determine why a correlation may exist, a builder’s investment in voluntary energy-efficiency programs correlated with that builder’s ability to survive the Great Recession of 2007 to 2009. This report explores the relationship between energy-efficiency ratings and the market performance of several builders in Colorado Springs.

  10. Natural cultural, and environmental resource values influencing Colorado River Basin management

    International Nuclear Information System (INIS)

    The Colorado River Basin supplies water to the seven western states of Wyoming, Colorado, Utah, Arizona, New Mexico, Nevada, and California, and to Mexico. Originally the Colorado River was developed to help settle the semiarid lands in the west by means of irrigation. Other uses soon evolved for power generation, flood control, domestic and industrial supply, recreation, and fish and wildlife protection. Several large dams and reservoirs can store four times the natural flow of 18.5 GM3 per year. The Federal Government owns over half the lands within the Basin. Management agencies include the National Park, and Fish and Wildlife Services, and the Bureaus of Indian Affairs, Land Management, and Reclamation. Since 1991, agencies are cooperating to understand and manage multiple purposes that include protection of natural, cultural, recreational, and environmental resources, and endangered species for the enjoyment and use by future generations

  11. Forecasting the Colorado River Discharge Using an Artificial Neural Network (ANN) Approach

    CERN Document Server

    Mehrkesh, Amirhossein

    2014-01-01

    Artificial Neural Network (ANN) based model is a computational approach commonly used for modeling the complex relationships between input and output parameters. Prediction of the flow rate of a river is a requisite for any successful water resource management and river basin planning. In the current survey, the effectiveness of an Artificial Neural Network was examined to predict the Colorado River discharge. In this modeling process, an ANN model was used to relate the discharge of the Colorado River to such parameters as the amount of precipitation, ambient temperature and snowpack level at a specific time of the year. The model was able to precisely study the impact of climatic parameters on the flow rate of the Colorado River.

  12. Sidney-North Yuma 230-kV Transmission Line Project, Colorado and Nebraska

    Energy Technology Data Exchange (ETDEWEB)

    1991-06-01

    This report describes the need for a 230-kV overhead transmission line to supply power from Sidney, Nebraska to eastern Colorado. The alternative scenario compared to construction of the line is No Action. Rejected alternatives include underground lines and different routing paths, with a possible extension to the Sterling area. Both scenarios are evaluated for environmental effects, cost, and consequences for the eastern Colorado region. The proposed route is determined to be the environmentally preferred choice. 120 refs., 6 figs., 13 tabs. (MHB)

  13. DOE Zero Energy Ready Home Case Study: Boulder ZED Design Build - Boulder, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2014-11-01

    This case study describes a DOE Zero Energy Ready Home in Boulder, Colorado, that scored HERS 38 without PV and 0 with PV. This 2,504 ft2 custom home has advanced framed walls, superior insulation a ground-source heat pump, ERV, and triple-pane windows.

  14. Students' Epistemologies about Experimental Physics: Validating the Colorado Learning Attitudes about Science Survey for Experimental Physics

    Science.gov (United States)

    Wilcox, Bethany R.; Lewandowski, H. J.

    2016-01-01

    Student learning in instructional physics labs represents a growing area of research that includes investigations of students' beliefs and expectations about the nature of experimental physics. To directly probe students' epistemologies about experimental physics and support broader lab transformation efforts at the University of Colorado Boulder…

  15. Shallow subsurface temperatures and some estimates of heat flow from the Colorado Plateau of northeastern Arizona

    Energy Technology Data Exchange (ETDEWEB)

    Sass, J.H.; Stone, C.; Bills, D.J.

    1982-01-01

    Temperature data to depths of a few hundred meters were obtained from 29 wells in northeastern Arizona; 12 in the region surrounding the San Francisco Volcanic Field, 8 in the Black Mesa area, and 9 in the south-central Colorado Plateau which includes the White Mountains. Although there was evidence for local hydrologic disturbances in many temperature profiles, most wells provided an estimate of the conductive thermal gradient at the site. A few thermal conductivities were measured and were combined with published regional averages for the north-central part of the Colorado Plateau to produce crude estimates of regional heat flux. None of the wells was accessible below the regional aquifers. To these depths, heat flow in the area of the San Francisco Volcanic Field appears to be controlled primarily by regional lateral water movement having a significant downward vertical component of velocity. The mean heat flow of 27 +- 5 mWm/sup -2/ is only a third to a quarter of what we would expect in this tectonic setting. The heat that is being carried laterally and downward probably is being discharged at low enthalpy and low elevation in springs and streams of the Colorado Plateau and Mogollon Rim. In the vicinity of Black Mesa, heat-flow averages about 60 mWm/sup -2/, characteristics of the coal interior of the Colorado Plateau. North of the White Mountain Volcanic Field, the average heat flow is about 95 mWm/sup -2/.

  16. Enhanced Atrazine Degradation: A Survey of Crop Fields in North-Eastern Colorado.

    Science.gov (United States)

    When it comes to weed management, logically, farmers have a very low tolerance for weed infestations since it can cause significant damage to their crop yields. However, over application of pesticides for any infestation has a serious consequence. Recently, farmers in the north-eastern Colorado repo...

  17. Investigation of the enzyme system of detoxification of insecticides in the Colorado beetle

    International Nuclear Information System (INIS)

    The activity of three enzymes systems of xenobiotic metabolism - cytochrome P-450-dependent monooxygenases, nonspecific esterases, and glutathione S-transferases - was investigated at various stages of the development of the Colorado beetle Leptinotarsa decemlineata. Substantial sex and ontogenetic differences in the content of cytochrome P-450, the position of the maxima of the CO-differential spectra of its reduced form, and the substrate specificity of cytochrome P-450 were demonstrated. An increase in the activity of nonspecific esterases with increasing age of Colorado beetle larvae was observed. The insecticide 1-naphtholenol methylcarbamate, which is metabolized by the system of cytochrome P-450-dependent monooxygenases, is more toxic at the larval stage of development in comparison with the imaginal stage, which is in good agreement with the activity of this system at different stages of development. The inhibitor of microsomal monooxygenases piperonyl butoxide more than doubles the toxicity of the insecticide in the Colorado beetle imago. The data presented are evidence of a different contribution of the systems of detoxification to the sensitivity of the Colorado beetle to insecticides at different stages of metamorphosis

  18. 78 FR 49318 - Colorado Disaster # CO-00055 Declaration of Economic Injury

    Science.gov (United States)

    2013-08-13

    ... ADMINISTRATION Colorado Disaster CO-00055 Declaration of Economic Injury AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Economic Injury Disaster Loan (EIDL) declaration...'s EIDL declaration, applications for economic injury disaster loans may be filed at the...

  19. 78 FR 44186 - Colorado Disaster # CO-00058 Declaration of Economic Injury

    Science.gov (United States)

    2013-07-23

    ... ADMINISTRATION Colorado Disaster CO-00058 Declaration of Economic Injury AGENCY: U.S. Small Business Administration. ACTION: Notice SUMMARY: This is a notice of an Economic Injury Disaster Loan (EIDL) declaration...'s EIDL declaration, applications for economic injury disaster loans may be filed at the...

  20. Equity in Excellence for Colorado's Future: "A Policy Audit and Analysis"

    Science.gov (United States)

    Michelau, Demarée K.

    2014-01-01

    Equity in Excellence is a two-year project launched in 2013 to support the implementation of Colorado's higher education reform agenda. With a focus on the metropolitan Denver area, the project intends to align the state's higher education policies with concrete, equity-focused actions at its public community colleges and four-year institutions.…

  1. 75 FR 37749 - White River National Forest, Colorado, Oil and Gas Leasing Environmental Impact Statement

    Science.gov (United States)

    2010-06-30

    ... Forest Service White River National Forest, Colorado, Oil and Gas Leasing Environmental Impact Statement... Oil and Gas Leasing and Final EIS and Record of Decision. The proposed revision includes the following: Changing what lands will be available for oil and gas leasing; changing or adding stipulations to...

  2. Release and uptake of volatile inorganic and organic gases through the snowpack at Niwot Ridge, Colorado

    NARCIS (Netherlands)

    Helmig, D.; Apel, E.; Blake, D.; Ganzeveld, L.N.; Lefer, B.L.; Meinardi, S.; Swanson, A.L.

    2009-01-01

    Whole air drawn from four heights within the high elevation (3,340 m asl), deep, winter snowpack at Niwot Ridge, Colorado, were sampled into stainless steel canisters, and subsequently analyzed by gas chromatography for 51 volatile inorganic and organic gases. Two adjacent plots with similar snow co

  3. Colorado Community College System Financial Aid Services: Cost Analyses and Cost Efficiency Study

    Science.gov (United States)

    Beckmann, Dale

    2004-01-01

    This study was conducted in two phases. One, the Cost Analysis, reports on inventory and analysis of actual estimated costs for delivering financial aid services to students and potential students in thirteen Colorado Community College System (CCCS) community colleges in Fiscal Year 2003. Additionally, an assessment of services and functions is…

  4. Equity, Adequacy, and Categorical Funding in Colorado School Finance: A Focus on English Language Learners

    Science.gov (United States)

    Ramirez, Al; Siegrist, Michael; Krumholz, Patrick; Rainey, Tracie

    2013-01-01

    This study investigates the interrelationship of categorical funding mechanisms within the Colorado school finance system for English language learners (ELLs) in an effort to test overall equity of the system in light of an underfunded categorical program. Using several analytical techniques, the study set out to determine the degree to which…

  5. 76 FR 70170 - Proposed Alternative Soils Standards for the Uravan, Colorado Uranium Mill

    Science.gov (United States)

    2011-11-10

    ... COMMISSION Proposed Alternative Soils Standards for the Uravan, Colorado Uranium Mill AGENCY: Nuclear Regulatory Commission. ACTION: Uranium milling alternative standards. SUMMARY: By letter dated October 10... Agreement States to specifically amend their Agreements to regulate uranium mill tailings (11e.(2)...

  6. Bureau of Reclamation-Lower Colorado River Management Plan for the Yuma Clapper Rail

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Presently there are just over 4,200 acres of cattail/bulrush along the lower Colorado River (LCR) in the United States, most of which is managed by the U.S. Fish...

  7. 78 FR 57923 - Colorado Disaster #CO-00058 Declaration of Economic Injury

    Science.gov (United States)

    2013-09-20

    ... ADMINISTRATION Colorado Disaster CO-00058 Declaration of Economic Injury AGENCY: Small Business Administration.../2014. ADDRESSES: Submit completed loan applications to: U.S. Small Business Administration, Processing...: A. Escobar, Office of Disaster Assistance, U.S. Small Business Administration, 409 3rd Street...

  8. Reinventing Systems;: Collaborations To Support Families. California, Colorado, New Mexico, West Virginia.

    Science.gov (United States)

    MacDonald, Mia

    The decline in Federal funding for state-provided social services during the 1980s triggered a transformation in the states' roles in family policymaking. This booklet documents four state initiatives designed to bring about systems change: (1) Healthy Start (California); (2) the Governor's Families and Children Initiative (Colorado); (3) the…

  9. Extensive Green Roof Species and Soilless Media Evaluations in Semi-arid Colorado

    Science.gov (United States)

    In the high elevation, semi-arid climate of Colorado, green roofs have not been scientifically tested. This research examined alternative plant species, soilless media blends and plant interactions on an existing, modular-extensive (shallow, 10 cm deep) green roof in Denver, Colo...

  10. 76 FR 70109 - Agenda and Notice of Public Meeting of the Colorado Advisory Committee

    Science.gov (United States)

    2011-11-10

    ... From the Federal Register Online via the Government Publishing Office COMMISSION ON CIVIL RIGHTS Agenda and Notice of Public Meeting of the Colorado Advisory Committee Notice is hereby given, pursuant... dialing Dial 711 for relay services and enter 1-(800) 516-9896, followed by Conference ID: 8334. To...

  11. Use of the Colorado SURGE System for Continuing Education for Civil Engineers.

    Science.gov (United States)

    Fead, J. W. N.

    The Colorado State University Resources in Graduate Education (SURGE) program is described in this report. Since it is expected that not all the participants in a graduate engineering program will be able to attend university-based lectures, presentations are video-taped and transported to industrial plants, engineering offices, and other…

  12. Renewable Energy Deployment in Colorado and the West: A Modeling Sensitivity and GIS Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Barrows, Clayton [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mai, Trieu [National Renewable Energy Lab. (NREL), Golden, CO (United States); Haase, Scott [National Renewable Energy Lab. (NREL), Golden, CO (United States); Melius, Jennifer [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mooney, Meghan [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-03-01

    The Resource Planning Model is a capacity expansion model designed for a regional power system, such as a utility service territory, state, or balancing authority. We apply a geospatial analysis to Resource Planning Model renewable energy capacity expansion results to understand the likelihood of renewable development on various lands within Colorado.

  13. 77 FR 2466 - Approval, Disapproval and Promulgation of Air Quality Implementation Plans; Colorado: Smoke...

    Science.gov (United States)

    2012-01-18

    ... Register on August 10, 2011 (76 FR 49391). EPA has determined that the approved revisions in Colorado's... revisions (76 FR 49391), we said that the State had submitted a revision to Section II.A.1 requiring sources... revisions (76 FR 49391), that the State had submitted a revision to Section VI.B.4.i that addressed...

  14. The Impact of the Recession on Public Library Use in Colorado: A Closer Look

    Science.gov (United States)

    Lance, Keith Curry; Hofschire, Linda; Daisey, Jamie

    2011-01-01

    This report shares the statistical trends for public library use in Colorado before and since the onset of the latest recession. It also includes the voices of librarians from around the state, offering their observations and stories of how public libraries are helping in these difficult times. To determine the impact of the Great Recession on use…

  15. 78 FR 63486 - Colorado; Amendment No. 5 to Notice of a Major Disaster Declaration

    Science.gov (United States)

    2013-10-24

    ..., Disaster Unemployment Assistance (DUA); 97.046, Fire Management Assistance Grant; 97.048, Disaster Housing... Declared Disaster Assistance--Disaster Housing Operations for Individuals and Households; 97.050... SECURITY Federal Emergency Management Agency Colorado; Amendment No. 5 to Notice of a Major...

  16. 77 FR 44649 - Colorado; Amendment No. 1 to Notice of a Major Disaster Declaration

    Science.gov (United States)

    2012-07-30

    ... Unemployment Assistance (DUA); 97.046, Fire Management Assistance Grant; 97.048, Disaster Housing Assistance to... Assistance--Disaster Housing Operations for Individuals and Households; 97.050, Presidentially Declared... SECURITY Federal Emergency Management Agency Colorado; Amendment No. 1 to Notice of a Major...

  17. Guidelines for School Property Accounting in Colorado, Part II--General Fixed Asset Accounts.

    Science.gov (United States)

    Stiverson, Clare L.

    The second publication of a series of three issued by the Colorado Department of Education is designed as a guide for local school districts in the development of a property accounting system. It defines and classifies groups of accounts whereby financial information, taken from inventory records, may be transcribed into debit and credit entries…

  18. 2011 Residential Energy Efficiency Technical Update Meeting Summary Report: Denver, Colorado - August 9-11, 2011

    Energy Technology Data Exchange (ETDEWEB)

    2011-11-01

    This report provides an overview of the U.S. Department of Energy Building America program's Summer 2011 Residential Energy Efficiency Technical Update Meeting. This meeting was held on August 9-11, 2011, in Denver, Colorado, and brought together more than 290 professionals representing organizations with a vested interest in energy efficiency improvements in residential buildings.

  19. Evaluation of Student Engagement Assessment in Colorado State University's Warner College of Natural Resources

    Science.gov (United States)

    Holman, Debra Kaye

    2013-01-01

    The purpose of this mixed methods study was to conduct a participatory program evaluation of student engagement assessment in Colorado State University's (CSU) Warner College of Natural Resources (WCNR). The college requested the evaluation after completing two pilot studies of undergraduate engagement which led them to consider establishing the…

  20. Final audit report of remedial action construction at the UMTRA project site Rifle, Colorado. Rev. 1

    International Nuclear Information System (INIS)

    This final audit report summarizes the assessments performed by the U.S. Department of Energy (DOE) Environmental Restoration Division (ERD) and its Technical Assistance Contractor (TAC) of remedial action compliance with approved plans, specifications, standards, and 40 CFR Part 192 at the Rifle, Colorado, Uranium Mill Tailings Remedial Action (UMTRA) Project site. Remedial action construction was directed by the Remedial Action Contractor (RAC)

  1. Sugar Beets, Segregation, and Schools: Mexican Americans in a Northern Colorado Community, 1920-1960.

    Science.gov (United States)

    Donato, Ruben

    2003-01-01

    What was unique about the Mexican American experience in Fort Collins (Colorado) was the extent to which the Great Western Sugar Company colonized Mexican workers. They lived in Mexican colonies, separate neighborhoods, or remote locations on sugar beet farms. In public schools, Mexican Americans were perceived as intellectually inferior and were…

  2. Design and Installation of a Groundwater Monitoring-Well Network in the High Plains Aquifer, Colorado

    Science.gov (United States)

    Arnold, L.R.; Flynn, J.L.; Paschke, S.S.

    2009-01-01

    The High Plains aquifer is an important water source for irrigated agriculture and domestic supplies in northeastern Colorado. To address the needs of Colorado's Groundwater Protection Program, the U.S. Geological Survey designed and installed a groundwater monitoring-well network in cooperation with the Colorado Department of Agriculture in 2008 to characterize water quality in the High Plains aquifer underlying areas of irrigated agriculture in eastern Colorado. A 30-well network was designed to provide for statistical representation of water-quality conditions by using a computerized technique to generate randomly distributed potential groundwater sampling sites based on aquifer extent, extent of irrigated agricultural land, depth to water from land surface, and saturated thickness. Twenty of the 30 sites were selected for well installation, and wells were drilled and installed during the period June-September 2008. Lithologic logs and well-construction reports were prepared for each well, and wells were developed after drilling to remove mud and foreign material to provide for good hydraulic connection between the well and aquifer. Documentation of the well-network design, site selection, lithologic logs, well-construction diagrams, and well-development records is presented in this report.

  3. Nutrition. Healthy Moms, Healthy Kids: A Series on Maternal and Child Health in Colorado

    Science.gov (United States)

    Colorado Children's Campaign, 2011

    2011-01-01

    Adequate consumption of nutritious, wholesome foods is essential to the healthy development of young children. Unfortunately, many households throughout the U.S. and Colorado struggle to put sufficient food on the table. According to the United States Department of Agriculture, the percentage of American families who reported experiencing…

  4. Uranium Geologic Drilling Project, Sand Wash Basin, Moffat and Routt Counties, Colorado:

    International Nuclear Information System (INIS)

    This environmental assessment of drill holes in Moffat and Routt Counties, Colorado considered the current environment; potential impacts from site preparation, drilling operations, and site restoration; coordination among local, state and federal plans; and consideration of alternative actions for this uranium drilling project

  5. 75 FR 78950 - Availability of Additional Information for the Proposed Rulemaking for Colorado's Attainment...

    Science.gov (United States)

    2010-12-17

    ... Federal Register (July 21, 2010; 75 FR 42346). On October 7, 2010, Colorado submitted revised... proposed rulemaking that was published in the Federal Register on July 21, 2010 (75 FR 42346), the comments... views as clearly as possible, avoiding the use of profanity or personal threats. Make sure to...

  6. Estimated Yield of Some Alternative Crops Under Varying Irrigation in Northeast Colorado

    Science.gov (United States)

    Much of the irrigated acres in northeastern Colorado are devoted to corn grain production. Diversifying irrigated agricultural production in this region could result in water savings if alternative crops were grown that have lower water requirements than corn. Making such crop choice decisions initi...

  7. 15 CFR 265.5 - Laws of Maryland and Colorado applicable.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Laws of Maryland and Colorado applicable. 265.5 Section 265.5 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade... States. The applicability of State laws shall not, however, affect or abrogate any other Federal law...

  8. The butterflies of Barro Colorado Island: Local extinction rates since the 1930's

    Science.gov (United States)

    Few data are available about the regional or local extinction of tropical butterfly species. When confirmed, local extinction was often due to the loss of host-plant species. We used published lists and recent monitoring programs to evaluate changes in butterfly composition on Barro Colorado Island ...

  9. POLLUTION PREVENTION OPPORTUNITY ASSESSMENT HISTOLOGY LABORATORY XYLENE USE - FORT CARSON, COLORADO

    Science.gov (United States)

    Under the WREAFS program, RREL has performed a waste minimization opportunity assessment (WMOA) at the Evans Community Hospital Histopathology Laboratory on the Ft. Carson Army Base, Colorado, in the area of waste xylene and ethyl alcohol contaminated with human tissue. The waste...

  10. Changes in Colorado Subalpine Fen Peat Stratigraphy and Humification During the Holocene

    Science.gov (United States)

    Sullivan, D. G.

    2013-12-01

    This project focuses on the record of peat stratigraphy and decomposition preserved in cores taken from minerotrophic peatlands in Colorado. Subalpine peatlands in the Colorado Rocky Mountains and in the Colorado Plateau cover only about 2% of the state's land area, yet these wetlands provide important wildlife habitat and ecosystem services. The peatlands in Colorado are fens, and, while summer precipitation contributes to the local hydrology, the fens are only found in locations where winter snowpack persists long enough into the summers to maintain sufficiently high water tables to preserve the peat. We hypothesized that changes in summer precipitation and winter snowpack through the Holocene would be evident in the degree of peat humification and stratigraphy. We were interested in determining how warmer summer conditions early in the Holocene influenced precipitation, particularly summer monsoons, and thus, groundwater. In addition, our research using lake sediment cores in the region indicates that sediment organic content may fluctuate with paleotemperature. We sought to determine whether fens likewise preserve evidence of relatively low magnitude temperature changes, including those associated with the Medieval Climate Anomaly (MCA) and the Little Ice Age (LIA). Since fens persist in the region only under marginal conditions, they are very sensitive to fluctuations in climate and consequent hydrological responses. Nine fens were sampled in the study. Fen stratigraphy was studied at all of the sites. Humification analysis and bulk density and organic content determinations were conducted at one-centimeter intervals on cores from four of the fens. Core chronology was established using radiocarbon dating. Our results suggest that warmer summers in the early Holocene led to earlier snowmelt at lower elevations. Fens located near the lower margins of the subalpine zone (<3100 m elevation) ceased to accumulate peat during this period, changing to alluvial

  11. Effect of Drought on Streamflow and Stream-Water Quality in Colorado, July through September 2002

    Science.gov (United States)

    Chafin, Daniel T.; Druliner, A. Douglas

    2007-01-01

    During 2002, Colorado experienced the State's worst drought since 1977. In 2003, the U.S. Geological Survey entered into cooperative agreement with the Colorado Department of Public Health and Environment to evaluate the general effects of drought on the water quality of streams in Colorado during summer 2002 by analyzing a water-quality data set obtained during summer 2002 in cooperation with a variety of State and local governments. Water samples were collected at 148 stream sites in Colorado and were measured or analyzed for field properties, major ions, nutrients, organic carbon, bacteria, and dissolved and total recoverable metals. Mean annual streamflow was analyzed at 134 sites in Colorado, and mean summer (July-September) streamflow for 2002 was determined for 146 sites for water years 1978-2002. Mean annual streamflow for 2002 had an average percentile of 29.4 and mean summer streamflow for 2002 had an average percentile of 7.6 relative to 1978-2002. These results indicate that streamflow in Colorado was substantially less than median streamflow for the period and that the effect of drought on streamflow was greater during summer 2002 than during water year 2002 (October 1, 2001, through September 30, 2002). Few measured constituent concentrations or values were elevated or depressed on a widespread basis during summer 2002. Specific conductance was elevated (in the upper quartile relative to historical data) in five of the seven basins that had sufficient data for characterization, indicating that specific conductance likely was affected by drought in those basins. Chloride concentrations were elevated in three of five basins with sufficient data and indicate that chloride concentration generally was affected by drought in those basins. Sulfate concentration was elevated in four of six basins with sufficient data. The widespread elevation of specific conductance and concentrations of chloride and sulfate indicates that salinity generally was affected by

  12. Geology of uranium deposits in the southern part of the Rocky Mountain province of Colorado

    International Nuclear Information System (INIS)

    This report summarizes the geology of uranium deposits in the southern part of the Rocky Mountains of Colorado, an area of about 20,000 square miles. In January 1966, combined ore reserves and ore production at 28 uranium deposits were about 685,000 tons of ore averaging 0.24 percent U3O8 (3.32 million pounds U3O8). About half of these deposits each contain <1,000 tons of ore. The two largest deposits, the Pitch in the Marshall Pass locality southwest of Salida and the T-1 in the Cochetopa locality southeast of Gunnison, account for about 90 percent of all production and available reserves. The probability in excellent for major expansion of reserves in Marshall Pass and is favorable at a few other vein localities. There are six types of uranium deposits, and there were at least four ages of emplacement of these deposits in the southern part of the Colorado Rockies. There are eight types of host rocks of eight different ages. Veins and stratiform deposits each account for about 40 percent of the total number of deposits, but the veins of early and middle Tertiary age account for nearly all of the total reserves plus production. The remaining 20 percent of the deposits include uraniferous pegmatites, irregular disseminations in porphyry, and other less important types. The wall rocks at the large Tertiary vein deposits in the southern part of the Rocky Mountains of Colorado are Paleozoic and Mesozoic sedimentary rocks, whereas Precambrian metamorphic wall rocks predominate at the large veins in the Front Range of the northern Colorado Rockies. Metallogenetic considerations and tectonic influences affecting the distribution of uranium in Colorado and in adjacent portions of the western United States are analyzed

  13. Value and Resilience in the Case of 'Invasive' Tamarix in the Colorado River Riparian Corridor

    Science.gov (United States)

    Loring, P. A.; Gerlach, S.; Zamora, F.

    2009-12-01

    A common premise of science for conservation and sustainability is an assumption that despite any human definitions of value, there are ecological first principles, e.g., resilience, which must be understood if sustainability is to be possible. As I show here, however, pursuits such as restoration, conservation, and sustainability remain tangled in (and sometimes at odds with one another regarding) many value-laden decisions regarding the equity, justice, and morality of human-environment interactions. These include such important decisions as: what should be restored or sustained and for whom, how and by whom, and at what cost. This paper uses examples from the lower Colorado River Riparian Corridor, in particular the issue of the so-called ‘invasive’ saltcedar (Tamarix spp.), to illustrate some of the implicit value judgments common to the practice of managing ecosystems. There are many possible perspectives to be taken on a matter like Tamarix, each implicitly or explicitly representing different worldviews and agendas for the ecosystems in question. Resilience theory provides one such perspective, but as I show here, it proves incapable of producing recommendations for managing the corridor that are free of subjective valuations. I end with a case study of habitat and Tamarix management practices in the Mexican portion of the Colorado River Delta, highlighting the proven potential when up-front values are explicitly coupled to the practice of sustainability science, rather than left as details for 'good governance,' a realm presently imagined as separate from science, to sort out. Map of the Colorado River Delta. The Sonoran Institute manages projects in the Mexican portion of the Colorado River Delta region, along the Rio Hardy, the mainstem of the Colorado River in Baja California, MX and in the Cienega de Santa Clara wetlands, Sonora, MX. Map courtesy of Water Education Foundation. www.watereducation.org

  14. Satellite Observations of Drought and Falling Water Storage in the Colorado River Basin and Lake Mead

    Science.gov (United States)

    Castle, S.; Famiglietti, J. S.; Reager, J. T.; Thomas, B.

    2012-12-01

    Over the past decade the Western US has experienced extreme drought conditions, which have affected both agricultural and urban areas. An example of water infrastructure being impacted by these droughts is Lake Mead, the largest reservoir in the United States at its full capacity that provides water and energy for several states in the Western US. Once Lake Mead falls below the critical elevation of 1050 feet above sea level, the Hoover Dam, the structure that created Lake Mead by damming flow within the Colorado River, will stop producing energy for Las Vegas. The Gravity Recovery and Climate Experiment (GRACE) satellites, launched in 2002, have proven successful for monitoring changes in water storage over large areas, and give hydrologists a first-ever picture of how total water storage is changing spatially and temporally within large regions. Given the importance of the Colorado River to meet water demands to several neighboring regions, including Southern California, it is vital to understand how water is transported and managed throughout the basin. In this research, we use hydrologic remote sensing to characterize the human and natural water balance of the Colorado River basin and Lake Mead. The research will include quantifying the amount of Colorado River water delivered to Southern California, coupling the GRACE Total Water Storage signal of the Upper and Lower Colorado River with Landsat-TM satellite imagery and areal extent of Lake Mead water storage, and combining these data together to determine the current status of water availability in the Western US. We consider water management and policy changes necessary for sustainable water practices including human water use, hydropower, and ecosystem services in arid regions throughout the Western US.

  15. Cold and transition season cloud condensation nuclei measurements in western Colorado

    Directory of Open Access Journals (Sweden)

    D. S. Ward

    2011-05-01

    Full Text Available Recent studies have shown that orographic precipitation and the water resources that depend on it in the Colorado Rocky Mountains are sensitive to the variability of the region's aerosols, whether emitted locally or from distant sources. However, observations of cloud droplet nucleating aerosols in western Colorado, climatologically upwind of the Colorado Rocky Mountains, have been limited to a few studies at a single, northern site. To address this knowledge gap, atmospheric aerosols were sampled at a ground site in southwestern Colorado and in low-level north to south transects of the Colorado Western Slope as part of the Inhibition of Snowfall by Pollution Aerosols (ISPA-III field campaign. Total particle and cloud condensation nuclei (CCN number concentrations were measured for a 24-day period in Mesa Verde National Park, in September and October 2009. Regression analysis showed a positive relationship between mid-troposphere atmospheric pressure to the west of the site and the total particle count at the ground site, but no similar statistically significant relationship was found for the observed CCN. These data were supplemented with particle and CCN number concentration, as well as particle size distribution measurements collected aboard the King Air platform during December 2009. A CCN closure attempt was performed and suggested that the sampled aerosol may have had a low hygroscopicity that changed little with the large-scale wind direction. Together, the sampled aerosols from these field programs were characteristic of a rural continental environment with CCN number concentrations that varied slowly in time, and little in space along the Western Slope.

  16. Cold and transition season cloud condensation nuclei measurements in western Colorado

    Directory of Open Access Journals (Sweden)

    D. S. Ward

    2010-11-01

    Full Text Available Recent research has shown that orographic precipitation and the water resources that depend on it in the Colorado Rocky Mountains are sensitive to the variability of the region's aerosols, whether emitted locally or from distant sources. However, observations of cloud-active aerosols in western Colorado, climatologically upwind of the Colorado Rocky Mountains, have been limited to a few studies at a single, northern site. To address this knowledge gap, atmospheric aerosols were sampled at a ground site in southwestern Colorado and in low-level north to south transects of the Colorado Western Slope as part of the Inhibition of Snowfall by Pollution Aerosols (ISPA-III field campaign. Total particle and cloud condensation nuclei (CCN number concentration were measured for a 24-day period in Mesa Verde National Park, climatologically upwind of the San Juan Mountains, in Sept. and Oct. 2009. Regression analysis showed a positive relationship between mid-troposphere atmospheric pressure to the west of the site and the total particle count at the ground site, but no similar statistically significant relationship for the observed CCN. These data were supplemented with particle and CCN number concentration, as well as particle size distribution measurements aboard the KingAir platform during December 2009. A CCN closure attempt was performed using the size distribution information and suggested that the sampled aerosol in general had low hygroscopicity that changed slightly with the large-scale wind direction. Together, the sampled aerosols from these field programs were characteristic of a rural continental environment with a cloud active portion that varied slowly in time, and little in space along the Western Slope.

  17. Mercury and selenium in fish of Fountain Creek, Colorado (USA): possible sources and implications.

    Science.gov (United States)

    Nimmo, D R; Herrmann, S J; Carsella, J S; McGarvy, C M; Foutz, H P; Herrmann-Hoesing, L M; Gregorich, J M; Turner, J A; Vanden Heuvel, B D

    2016-01-01

    Fountain Creek in Colorado USA is a major tributary that confluences with the Arkansas River at Pueblo, Colorado, the result being the tributary's influence on Arkansas River water quality affecting down-stream users. In a previous study, we found that bryophytes (aquatic plants) accumulated selenium in Fountain Creek watershed and this finding prompted us to investigate the extent of the metalloid in the whole-body tissues of fish. One hundred 11 fish (six species) were collected and analyzed for Se by inductively-coupled plasma emission mass spectrometry. Analysis of all analytical data also showed mercury in all of the fish whole bodies and selected tissues. There was a general increase in selenium but a decrease in mercury in fish with downstream travel-distance. The highest whole-body selenium was in Pueblo, Colorado (3393 µg/kg, dry weight; 906 µg/kg, wet weight); the highest mercury in fish was in the Monument Creek tributary north of Colorado Springs, Colorado (71 µg/kg, dry weight; 19 µg/kg, wet weight). In four tissues of 11 female fish captured, selenium was highest in the livers at eight sites but highest in the ovaries at three sites. Mercury was highest in the epaxial muscle at all sites. Selenium availability could be due to the watershed lithology and land uses; however, mercury could be carried by atmospheric deposition from coal-fired power plants and historic mining activities. Selenium in fish tissues and water samples were compared to U.S. national water quality criteria. PMID:27104125

  18. Continuing Colorado plateau uplift by delamination-style convective lithospheric downwelling.

    Science.gov (United States)

    Levander, A; Schmandt, B; Miller, M S; Liu, K; Karlstrom, K E; Crow, R S; Lee, C-T A; Humphreys, E D

    2011-04-28

    The Colorado plateau is a large, tectonically intact, physiographic province in the southwestern North American Cordillera that stands at ∼1,800-2,000 m elevation and has long been thought to be in isostatic equilibrium. The origin of these high elevations is unclear because unlike the surrounding provinces, which have undergone significant Cretaceous-Palaeogene compressional deformation followed by Neogene extensional deformation, the Colorado plateau is largely internally undeformed. Here we combine new seismic tomography and receiver function images to resolve a vertical high-seismic-velocity anomaly beneath the west-central plateau that extends more than 200 km in depth. The upper surface of this anomaly is seismically defined by a dipping interface extending from the lower crust to depths of 70-90 km. The base of the continental crust above the anomaly has a similar shape, with an elevated Moho. We interpret these seismic structures as a continuing regional, delamination-style foundering of lower crust and continental lithosphere. This implies that Pliocene (2.6-5.3 Myr ago) uplift of the plateau and the magmatism on its margins are intimately tied to continuing deep lithospheric processes. Petrologic and geochemical observations indicate that late Cretaceous-Palaeogene (∼90-40 Myr ago) low-angle subduction hydrated and probably weakened much of the Proterozoic tectospheric mantle beneath the Colorado plateau. We suggest that mid-Cenozoic (∼35-25 Myr ago) to Recent magmatic infiltration subsequently imparted negative compositional buoyancy to the base and sides of the Colorado plateau upper mantle, triggering downwelling. The patterns of magmatic activity suggest that previous such events have progressively removed the Colorado plateau lithosphere inward from its margins, and have driven uplift. Using Grand Canyon incision rates and Pliocene basaltic volcanism patterns, we suggest that this particular event has been active over the past ∼6

  19. Reconnaissance-level application of physical habitat simulation in the evaluation of physical habitat limits in the Animas Basin, Colorado

    Science.gov (United States)

    Milhous, Robert T.

    2003-01-01

    The Animas River is in southwestern Colorado and flows mostly to the south to join the San Juan River at Farmington, New Mexico (Figure 1). The Upper Animas River watershed is in San Juan County, Colorado and is located in the San Juan Mountains. The lower river is in the Colorado Plateau country. The winters are cold with considerable snowfall and little snowmelt in the mountains in the upper part of the basin. The lower basin has less snow but the winters are still cold. The streamflows during the winter are low and reasonably stable.

  20. Public involvement in the dose reconstruction study: the colorado story

    International Nuclear Information System (INIS)

    Public involvement was a critical component for building awareness, trust, and credibility for the dose reconstruction study for the Rocky Flats Nuclear Weapons Facility in Colorado. The research team developed a process to inform, involve, and encourage public participation over the nine-year study period. Key affected and interested groups with a legitimate stake in the study were identified and invited to identify concerns and offer suggestions for the study. In many cases, the public actually provided direction for the research. Many issues were studied more in-depth as result of public concern. Proactive community outreach was undertaken; quarterly public meetings and workshops were held to inform the public about the study's progress and to hear their comments. Quarterly newsletters were mailed to stake holders. A speaker's bureau was established and more than 50 presentations were made to 1,500 community members in various civic, business, neighborhood, and technical groups. Fact sheets, citizen summaries of technical reports, technical topic papers, and a video were developed to provide a complete overview of the studies and the findings at the conclusion of the project. The video was provided to local cable television stations, and publications were taken to local libraries. A web site was developed to allow the public to readily access information and to order technical reports. Public comments on draft technical reports were solicited; questions and concerns were addressed and investigated. The staff answered citizen calls, and the research team responded in writing to more than 200 issues raised by very concerned citizens. In addition, a citizen's group was formed in 1992 to conduct an independent study of plutonium levels found in soil samples collected around Rocky Flats. Made up of homeowners, public interest groups, local health departments, interested citizens, and Health Advisory Panel members, the committee arranged for sampling and analysis of

  1. Changing Climates @ Colorado State: 100 (Multidisciplinary) Views of Climate Change

    Science.gov (United States)

    Campbell, S.; Calderazzo, J.; Changing Climates, Cmmap Education; Diversity Team

    2011-12-01

    We would like to talk about a multidisciplinary education and outreach program we co-direct at Colorado State University, with support from an NSF-funded STC, CMMAP, the Center for Multiscale Modeling of Atmospheric Processes. We are working to raise public literacy about climate change by providing information that is high quality, up to date, thoroughly multidisciplinary, and easy for non-specialists to understand. Our primary audiences are college-level students, their teachers, and the general public. Our motto is Climate Change is Everybody's Business. To encourage and help our faculty infuse climate-change content into their courses, we have organized some 115 talks given by as many different speakers-speakers drawn from 28 academic departments, all 8 colleges at CSU, and numerous other entities from campus, the community, and farther afield. We began with a faculty-teaching-faculty series and then broadened our attentions to the whole campus and surrounding community. Some talks have been for narrowly focused audiences such as extension agents who work on energy, but most are for more eclectic groups of students, staff, faculty, and citizens. We count heads at most events, and our current total is roughly 6,000. We have created a website (http://changingclimates.colostate.edu) that includes videotapes of many of these talks, short videos we have created, and annotated sources that we judge to be accurate, interesting, clearly written, and aimed at non-specialists, including books, articles and essays, websites, and a few items specifically for college teachers (such as syllabi). Pages of the website focus on such topics as how the climate works / how it changes; what's happening / what might happen; natural ecosystems; agriculture; impacts on people; responses from ethics, art, literature; communication; daily life; policy; energy; and-pulling all the pieces together-the big picture. We have begun working on a new series of very short videos that can be

  2. The Colorado Center for Lunar Dust and Atmospheric Studies

    Science.gov (United States)

    Collette, A.; Gruen, E.; Horanyi, M.; Munsat, T.; Poppe, A. R.; Robertson, S. H.; Srama, R.; Shu, A. J.; Sternovsky, Z.; Wang, X.; Ccldas Team

    2010-12-01

    The Colorado Center for Lunar Dust and Atmospheric Studies (CCLDAS) is a member of the NASA Lunar Science Institute, focused on experimental and theoretical investigations of the lunar surface, including dusty plasma and impact processes, the origins of the lunar atmosphere, and the development of new instrument concepts, with a complementary program of education and community development. The tenuous lunar atmosphere is a surface-bound exosphere (SBE) similar to that found throughout the solar system, for example on Mercury, various icy satellites, over the rings of Saturn, on large asteroids, and on Kuiper Belt objects. Its time-dependent constituents arise from a dynamic balance between sources that may be sporadic (solar wind, sputtering, micrometeoroid impacts, outgassing) and loss mechanisms (escape, ionization), creating a natural dusty plasma laboratory. CCLDAS supports a diverse experimental program, performed in conjunction with theory and simulation, to investigate the near-surface lunar plasma environment, dust charging and mobilization, and the effects of micrometeoroids. The flagship device at CCLDAS is a dust accelerator, currently under construction, which will allow simulation of micrometeoroid impacts at speeds relevant to the lunar environment. The accelerator will be available for direct science investigation as well as instrument calibration; in addition to our own research program, the experimental facilities are open to the lunar and space physics community. One use will be to support the calibration of the Lunar Dust EXperiment (LDEX) instrument, scheduled for launch in 2013 onboard the Lunar Atmosphere and Dust Environment Explorer (LADEE) spacecraft. LDEX will measure the density and temporal variation of micron and submicron sized dust particles released from the lunar surface and elevated to > 30 km altitude by micrometeoroid bombardment and/or electrostatic forces. The new Lunar Environment and Impact Laboratory (LEIL) at CCLDAS

  3. A site-specific assessment of the risk of ammonia to endangered Colorado Pikeminnow and Razorback Sucker populations in the upper Colorado River adjacent to the Atlas Mill Tailings Pile, Moab, Utah

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Atlas Mill Tailings Pile is located adjacent to the Upper Colorado River near Moab, Utah. Milling of ore ceased in 1984 and the Atlas Corporation subsequently...

  4. Characterization of selected biological, chemical, and physical conditions at fixed sites in the Upper Colorado River basin, Colorado, 1995-98

    Science.gov (United States)

    Deacon, Jeffrey R.; Mize, Scott V.; Spahr, Norman E.

    1999-01-01

    Biological community samples were collected at 15 sites in the Upper Colorado River Basin (UCOL) in Colorado as part of the National Water-Quality Assessment (NAWQA) Program. Sites sampled in two physiographic provinces, the Southern Rocky Mountains and the Colorado Plateau, represented agriculture, mining, urban and recreation, and mixed land uses and background conditions. Nine measures of water quality, which include information on nutrients, specific conductance (a surrogate for salinity), trace elements in streambed sediment, pesticides in fish tissue, fish communities, and macroinvertebrate richness and composition and stream habitat were used for comparisons among sites within the two physiographic provinces. Sampling sites from three other NAWQA study units?the Rio Grande Valley, the South Platte River Basin, and the Upper Snake River Basin study units?were categorized on the basis of land use and stream size in order to develop a larger data set for comparison to sites in the UCOL. Three categories of land use?forested (includes mining, urban and recreation, and background), agriculture, and mixed?were used for comparison to the UCOL fixed sites. Results indicated that all sites other than the Colorado River below Baker Gulch (a background site) showed some water-quality characteristics to be significantly affected. Results indicated that the concentrations of cadmium and zinc in streambed sediment at mining land-use sites in the Southern Rocky Mountains physiographic province generally were orders of magnitude higher than streambed-sediment concentrations at the background site. Streambed-sediment concentrations at mining land-use sites in the UCOL were greater than the 75th percentile of concentrations from sites in the three other NAWQA study units. Fish communities and habitat conditions were degraded at mining land-use sites compared to the background site. Ephemeroptera, Plecoptera, and Trichoptera (EPT) richness and the percentage of EPT were lower

  5. Coal fields and outlines of coal-bearing strata in the Colorado Plateau coal assessment study area (cpcf*g)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — These are shapefiles and ARC/INFO coverages of coal fields and coal-bearing formations in the Colorado Plateau. These GIS layers were created by combining numerous...

  6. Available Water Capacity for the Upper Colorado River Basin in Daymet Climate Data resolution (awc_UCRB_Daymet_resolution.txt)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — awc_UCRB_Daymet_resolution.txt is an Esri ASCII grid representing the available water capacity (AWC) for the Upper Colorado River Basin. AWC (available water...

  7. Comment and response document for the long-term surveillance plan for the Bodo Canyon Disposal Site, Durango. Colorado

    International Nuclear Information System (INIS)

    This document contains comments made by the US Nuclear Regulatory Commission upon their review of the Long-Term Surveillance Plan for the Bodo Canyon Disposal Site, Durango, Colorado. Responses to the comments are also included in the document

  8. Results of the Aquatic Monitoring Program in streams at the Rocky Flats Site : Golden, Colorado 2001-2002

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — An aquatic monitoring program was initiated in the summer 200 I at the Rocky Flats EnvironmentalTechnology Site (Rocky Flats) in Golden, Colorado, and was conducted...

  9. Coal-mine production history from 1984 through 1995 in the Colorado Plateau coal assessment study area (cpmphg)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This is a point coverage containing 12 years (1984 through 1995) of coal mining history in the Colorado Plateau coal assessment study area. This layer was derived...

  10. Backwater manipulations for endangered fishes: Management implications of selenium on National Wildlife Refuges of the Lower Colorado River

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Many studies have evaluated selenium in the lower Colorado River, but none have reviewed selenium levels after river water has been directed into previously...

  11. Input Digital Datasets for the Soil-Water Balance Groundwater Recharge Model of the Upper Colorado River Basin

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The Colorado River and its tributaries supply water to more than 35 million people in the United States and 3 million people in Mexico, irrigating more than 4.5...

  12. Land Cover Information for the Upper Colorado River Basin in Daymet Climate Data resolution (nlcd_UCRB_daymet_resolution.txt)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — nlcd_UCRB_daymet_resolution.txt is an Esri ASCII grid representing land cover information for the Upper Colorado River Basin. The 2011 National Land Cover Database...

  13. Hydrologic Soil Group for the Upper Colorado River Basin in Daymet Climate Data resolution (hsg_UCRB_Daymet_resolution.txt)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — hsg_UCRB_Daymet_resolution.txt is an Esri ASCII grid representing the hydrologic soil group (HSG) for the Upper Colorado River Basin. The HSG for an area is...

  14. Can the Gila River reduce risk in the Colorado River Basin?

    Science.gov (United States)

    Wade, L. C.; Rajagopalan, B.; Lukas, J.; Kanzer, D.

    2012-12-01

    The Colorado River is the most important source of water in the southwest United States and Northern Mexico, providing water to approximately 35 million people and 4-5 million acres of irrigated lands. To manage the water resources of the basin, estimated to be about 17 million acre-feet (MAF) of undepleted supplies per year, managers use reservoir facilities that can store more than 60 MAF. As the demands on the water resources of the basin approach or exceed the average annual supply, and with average flow projected to decrease due to climate change, smart water management is vital for its sustainability. To quantify the future risk of depleting reservoir storage, Rajagopalan et al. (2009) developed a water-balance model and ran it under scenarios based on historical, paleo-reconstructed and future projections of flows, and different management alternatives. That study did not consider the impact of the Gila River, which enters the Colorado River below all major reservoirs and U.S. diversions. Due to intensive use in Central Arizona, the Gila only has significant inflows to the Colorado in wet years. However, these irregular inflows could beneficially influence system reliability in the US by helping to meet a portion of the 1.5 MAF delivery obligations to Mexico. To help quantify the potential system reliability benefit of the Gila River, we modify the Rajagopalan et al (2009) model to incorporate simulated Gila River inflows. These new data inputs to the water balance model are based on historical flows and tree-ring reconstructions of flow in the Upper Colorado River Basin (at Lee's Ferry), the Lower Colorado River Basin (tributary inflows), and the intermittent flows from the Gila River which are generated using extreme value analysis methods. Incorporating Gila River inflows, although they are highly variable and intermittent, reduces the modeled cumulative risk of reservoir depletion by 4 to 11% by 2057, depending on the demand schedule, reservoir operation

  15. Aerial gamma ray and magnetic survey: Uncompahgre Uplift Project, Salina, Utah; Moab, Utah and Colorado, Montrose and Leadville, Colorado Quadrangle. Final report

    International Nuclear Information System (INIS)

    In the fall of 1978, an airborne reconnaissance radiometric and magnetic survey was flown by geoMetrics in western Colorado and eastern Utah as part of the Department of Energy's National Uranium Resource Evaluation program. A total of 13,390 line miles were flown in the four 10 x 20 topographic maps - Salina, Moab, Montrose and Leadville - encompassed by the survey area. The survey area includes portions of the Colorado Plateau and Southern Rocky Mountains Physiographic Provinces. A series of uplift and basin structures are distributed throughout both provinces. Thick sequences of relatively flat-lying, Phanerozoic age, sedimentary and some volcanic materials overlie crystalline basement rocks in most of the Colorado Plateau, but are relatively thin in most of the Southern Rocky Mountains. Precambrian crystalline basement rocks are exposed over some of the uplifted areas. Radioactive mineral deposits of many different types are reported. The literature consulted included information on about 1,300 occurrences of radioactive minerals and/or anomalous radioactivity within the project area. About 1,048 of these occurrences are mines which have produced or are now producing uranium. About 917 of the productive deposits are in the Moab Quadrangle, about 115 in the Salina Quadrangle and eight each in the Montrose and Leadville Quadrangles. A total of 582 grouped statistical values in the uranium window meeting the criteria established for valid anomalies are displayed and discussed in the interpretation section: 181 in Salina; 88 in Moab; 220 in Montrose; and 93 in Leadville. Some anomalies are associated with known uranium occurrences and mines such as the Uravan Belt, but most are not and are scattered across the entire range of Proterozoic and Phanerozoic rocks exposed in the survey area. Residual magnetic data generally delineate the major geologic structures present as well as providing more detailed information concerning specific rock units

  16. The Colorado river delta (Mexico: ecological importance and management = O delta do rio Colorado (Mexico: importância ecológica e gerenciamento

    Directory of Open Access Journals (Sweden)

    José Luis Fermán Almada

    2008-10-01

    Full Text Available The Colorado river delta is a unique coastal system in the world, as it combines two important systems: the Colorado river and the Gulf of California. Consequently, the delta is dominated by bilateral interests, and influenced by administrative, political and natural processes, which involve the countries of the United States and Mexico. Located in the northern part of the Gulf of California, under a condition of natural isolation, a series of environmental attributeshave been developed (biotic and abiotic that are only observed in is region. In this work, the development of the bilateral political relations and the most important ecological characteristicsare presented, as well as the management instruments that have been developed for over 80 years. From these issues, the possible scenario for the region is defined, and the development of methodologies for monitoring the effects of these possible tendencies on the natural components of the delta is proposed.O delta do rio Colorado é uma zona costeira única em todo o mundo, porassociar dois importantes sistemas: o próprio rio Colorado e o Golfo da Califórnia. Conseqüentemente, o delta é dominado por interesses bi-nacionais e influenciado por processos administrativos, políticos e naturais, envolvendo os Estados Unidos e o México. Localizado no norte do Golfo da Califórnia, sob uma condição de isolamento natural,desenvolveu-se uma série de atributos ambientais (bióticos e abióticos que só podem ser vistos nessa região. Neste trabalho, são apresentados o desenvolvimento das relações políticas bilaterais e as características ecológicas mais importantes, bem como osmecanismos de gerenciamento que vêm sido desenvolvidos por mais de 80 anos. A partir dessas questões, é definido um cenário tendencial possível para a região, e o desenvolvimento de metodologias para o acompanhamento dos efeitos dessas possíveis tendências sobre os componentes naturais do delta é proposto.

  17. CHEMICAL AND MECHANICAL CONTROL OF COLORADO POTATO BEETLE (Leptinotarsa decemlineata Say) ON POTATO IN ĐAKOVO AREA

    OpenAIRE

    Kristijan Rack; Marija Ivezić; Emilija Raspudić; Mirjana Brmež

    2001-01-01

    The aim of this investigation was to determine the efficacy in controlling Colorado potato beetles (Leptinotarsa decemlineata Say) by using chemical and mechanical methods of control. The field trials were carried out in 1999 and 2000 in the area of Đakovo. The aim was also to determine the differences between chemical and mechanical way of control, and on the base of the obtained results, give the recommendations for acceptable and profitable way in controlling Colorado potato beetle. This t...

  18. Comparing Host Plant Resistance, Engineered Resistance, and Insecticide Treatment for Control of Colorado Potato Beetle and Potato Leafhopper in Potatoes

    OpenAIRE

    Coombs, Joseph J.; Felcher, Kimberly J.; Douches, David S; Ghidiu, Gerald M.

    2011-01-01

    The Colorado potato beetle, Leptinotarsa decemlineata (Say) Order Coleoptera and the potato leafhopper, Empoasca fabae (Harris) Order Homoptera, are the major insect pests of potato in eastern North America. In two years of field trials, we compared the effectiveness of three pest management options for the control of Colorado potato beetle and potato leafhopper: natural host plant resistance (glandular trichomes), engineered resistance (Bacillus thuringiensis [Bt] Berliner cry3A gene) and a ...

  19. Assessing Climate Change Impacts on Water Resources and Colorado Agriculture Using an Equilibrium Displacement Mathematical Programming Model

    OpenAIRE

    Eihab Fathelrahman; Amalia Davies; Stephen Davies; James Pritchett

    2014-01-01

    This research models selected impacts of climate change on Colorado agriculture several decades in the future, using an Economic Displacement Mathematical Programming model. The agricultural economy in Colorado is dominated by livestock, which accounts for 67% of total receipts. Crops, including feed grains and forages, account for the remainder. Most agriculture is based on irrigated production, which depends on both groundwater, especially from the Ogallala aquifer, and surface water that c...

  20. Work plan for ground water elevation data recorder/monitor well installation at the New Rifle Site, Rifle, Colorado

    International Nuclear Information System (INIS)

    The purpose of this document is to describe the work that will be performed and the procedures that will be followed during installation of ground water monitor wells and ground water elevation data recorders (data loggers) at the New Rifle Uranium Mill Tailings Remedial Action (UMTRA) Project site, Rifle, Colorado. The monitor wells and data loggers will be used to gather required time-dependent data to investigate the interaction between the shallow aquifer and the Colorado River

  1. Changes in groundwater recharge under projected climate in the upper Colorado River basin

    Science.gov (United States)

    Tillman, Fred; Gangopadhyay, Subhrendu; Pruitt, Tom

    2016-01-01

    Understanding groundwater-budget components, particularly groundwater recharge, is important to sustainably manage both groundwater and surface water supplies in the Colorado River basin now and in the future. This study quantifies projected changes in upper Colorado River basin (UCRB) groundwater recharge from recent historical (1950–2015) through future (2016–2099) time periods, using a distributed-parameter groundwater recharge model with downscaled climate data from 97 Coupled Model Intercomparison Project Phase 5 climate projections. Simulated future groundwater recharge in the UCRB is generally expected to be greater than the historical average in most decades. Increases in groundwater recharge in the UCRB are a consequence of projected increases in precipitation, offsetting reductions in recharge that would result from projected increased temperatures.

  2. Analysis of stream sediment reconnaissance data for mineral resources from the Montrose NTMS Quadrangle, Colorado

    International Nuclear Information System (INIS)

    Multivariate statistical analysis to support the National Uranium Resource Evaluation and to evaluate strategic and other commercially important mineral resources was carried out on Hydrogeochemical and Stream Sediment Reconnaissance data from the Montrose quadrangle, Colorado. The analysis suggests that: (1) the southern Colorado Mineral Belt is an area favorable for uranium mineral occurrences; (2) carnotite-type occurrences are likely in the nose of the Gunnison Uplift; (3) uranium mineral occurrences may be present along the western and northern margins of the West Elk crater; (4) a base-metal mineralized area is associated with the Uncompahgre Uplift; and (5) uranium and base metals are associated in some areas, and both are often controlled by faults trending west-northwest and north

  3. High flow and riparian vegetation along the San Miguel River, Colorado

    Science.gov (United States)

    Friedman, J.M.; Auble, G.T.

    2000-01-01

    Riparian ecosystems are characterized by abundance of water and frequent flow related disturbance. River regulation typically decreases peak flows, reducing the amount of disturbance and altering the vegetation. The San Miguel River is one of the last relatively unregulated rivers remaining in the Colorado River Watershed. One goal of major landowners along the San Miguel including the Bureau of Land Management and The Nature Conservancy is to maintain their lands in a natural condition. Conservation of an entire river corridor requires an integrated understanding of the variability in ecosystems and external influences along the river. Therefore, the Bureau of Land Management and others have fostered a series of studies designed to catalogue that variability, and to characterize the processes that maintain the river as a whole. In addition to providing information useful to managers, these studies present a rare opportunity to investigate how a Colorado river operates in the absence of regulation.

  4. Studio Physics at the Colorado School of Mines: A model for iterative development and assessment

    Science.gov (United States)

    Kohl, Patrick; Kuo, Vincent

    2009-05-01

    The Colorado School of Mines (CSM) has taught its first-semester introductory physics course using a hybrid lecture/Studio Physics format for several years. Based on this previous success, over the past 18 months we have converted the second semester of our traditional calculus-based introductory physics course (Physics II) to a Studio Physics format. In this talk, we describe the recent history of the Physics II course and of Studio at Mines, discuss the PER-based improvements that we are implementing, and characterize our progress via several metrics, including pre/post Conceptual Survey of Electricity and Magnetism (CSEM) scores, Colorado Learning About Science Survey scores (CLASS), failure rates, and exam scores. We also report on recent attempts to involve students in the department's Senior Design program with our course. Our ultimate goal is to construct one possible model for a practical and successful transition from a lecture course to a Studio (or Studio-like) course.

  5. Pigs on the plains: Institutional analysis of a Colorado water quality initiative

    Science.gov (United States)

    King, D.; Burkardt, N.; Lee, Lamb B.

    2006-01-01

    We used the Legal-Institutional Analysis Model (LIAM) and Advocacy Coalition Framework (ACF) to analyze the campaign over passage of the Colorado Hogs Rule, an initiative passed by the voters in 1998 to require regulation of swine production facilities in Colorado. Used in tandem, LIAM and ACF provided an opportunity to develop a robust understanding of the obstacles and opportunities that face water quality managers in a state-centered multi-organizational decision process. We found that combining the LIAM with the ACF enhanced the understanding that could be achieved by using either model in isolation. The predictive capacity of the LIAM would have been reduced without information from the ACF, and the ACF by itself would have missed the importance of a single-case study.

  6. Revealing Differences Between Curricula Using the Colorado Upper-Division Electrostatics Diagnostic

    CERN Document Server

    Zwolak, Justyna P

    2014-01-01

    The Colorado Upper-Division Electrostatics (CUE) Diagnostic is an exam developed as part of the curriculum reform at the University of Colorado, Boulder (CU). It was designed to assess conceptual learning within upper-division electricity and magnetism (E&M). Using the CUE, we have been documenting students' understanding of E&M at Oregon State University (OSU) over a period of 5 years. Our analysis indicates that the CUE identifies concepts that are generally difficult for students, regardless of the curriculum. The overall pattern of OSU students' scores reproduces the pattern reported by Chasteen et al. at CU. There are, however, some important differences that we will address. In particular, our students struggle with the CUE problems involving separation of variables and boundary conditions. We will discuss the possible causes for this, as well as steps that may rectify the situation.

  7. Validation study of the Colorado Learning Attitudes about Science Survey at a Hispanic-serving institution

    Directory of Open Access Journals (Sweden)

    Vashti Sawtelle

    2009-08-01

    Full Text Available The Colorado Learning Attitudes about Science Survey (CLASS has been widely acknowledged as a useful measure of student cognitive attitudes about science and learning. The initial University of Colorado validation study included only 20% non-Caucasian student populations. In this Brief Report we extend their validation to include a predominately under-represented minority population. We validated the CLASS instrument at Florida International University, a Hispanic-serving institution, by interviewing students in introductory physics classes using a semistructured protocol, examining students’ responses on the CLASS item statements, and comparing them to the items’ intended meaning. We find that in our predominately Hispanic population, 94% of the students’ interview responses indicate that the students interpret the CLASS items correctly, and thus the CLASS is a valid instrument. We also identify one potentially problematic item in the instrument which one third of the students interviewed consistently misinterpreted.

  8. Beyond annual streamflow reconstructions for the Upper Colorado River Basin: A paleo-water-balance approach

    Science.gov (United States)

    Gangopadhyay, Subhrendu; McCabe, Gregory J.; Woodhouse, Connie A.

    2015-12-01

    In this paper, we present a methodology to use annual tree-ring chronologies and a monthly water balance model to generate annual reconstructions of water balance variables (e.g., potential evapotranspiration (PET), actual evapotranspiration (AET), snow water equivalent (SWE), soil moisture storage (SMS), and runoff (R)). The method involves resampling monthly temperature and precipitation from the instrumental record directed by variability indicated by the paleoclimate record. The generated time series of monthly temperature and precipitation are subsequently used as inputs to a monthly water balance model. The methodology is applied to the Upper Colorado River Basin, and results indicate that the methodology reliably simulates water-year runoff, maximum snow water equivalent, and seasonal soil moisture storage for the instrumental period. As a final application, the methodology is used to produce time series of PET, AET, SWE, SMS, and R for the 1404-1905 period for the Upper Colorado River Basin.

  9. Analysis of stream sediment reconnaissance data for mineral resources from the Montrose NTMS Quadrangle, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Beyth, M.; Broxton, D.; McInteer, C.; Averett, W.R.; Stablein, N.K.

    1980-06-01

    Multivariate statistical analysis to support the National Uranium Resource Evaluation and to evaluate strategic and other commercially important mineral resources was carried out on Hydrogeochemical and Stream Sediment Reconnaissance data from the Montrose quadrangle, Colorado. The analysis suggests that: (1) the southern Colorado Mineral Belt is an area favorable for uranium mineral occurrences; (2) carnotite-type occurrences are likely in the nose of the Gunnison Uplift; (3) uranium mineral occurrences may be present along the western and northern margins of the West Elk crater; (4) a base-metal mineralized area is associated with the Uncompahgre Uplift; and (5) uranium and base metals are associated in some areas, and both are often controlled by faults trending west-northwest and north.

  10. Changes in groundwater recharge under projected climate in the upper Colorado River basin

    Science.gov (United States)

    Tillman, Fred D.; Gangopadhyay, Subhrendu; Pruitt, Tom

    2016-07-01

    Understanding groundwater-budget components, particularly groundwater recharge, is important to sustainably manage both groundwater and surface water supplies in the Colorado River basin now and in the future. This study quantifies projected changes in upper Colorado River basin (UCRB) groundwater recharge from recent historical (1950-2015) through future (2016-2099) time periods, using a distributed-parameter groundwater recharge model with downscaled climate data from 97 Coupled Model Intercomparison Project Phase 5 climate projections. Simulated future groundwater recharge in the UCRB is generally expected to be greater than the historical average in most decades. Increases in groundwater recharge in the UCRB are a consequence of projected increases in precipitation, offsetting reductions in recharge that would result from projected increased temperatures.

  11. Students' epistemologies about experimental physics: Validating the Colorado Learning Attitudes about Science Survey for Experimental Physics

    CERN Document Server

    Wilcox, Bethany R

    2015-01-01

    Student learning in instructional physics labs represents a growing area of research that includes investigations of students' beliefs and expectations about the nature of experimental physics. To directly probe students' epistemologies about experimental physics and support broader lab transformation efforts at the University of Colorado Boulder (CU) and elsewhere, we developed the Colorado Learning Attitudes about Science Survey for Experimental Physics (E-CLASS). Previous work with this assessment has included establishing the accuracy and clarity of the instrument through student interviews and preliminary testing. Several years of data collection at multiple institutions has resulted in a growing national data set of student responses. Here, we report on results of the analysis of these data to investigate the statistical validity and reliability of the E-CLASS as a measure of students' epistemologies for a broad student population. We find that the E-CLASS demonstrates an acceptable level of both validi...

  12. Radiological, health, and safety, and occurrence reporting system audit report, Rifle, Colorado

    International Nuclear Information System (INIS)

    This paper describes an audit dated September 14--16, 1993. The performance of the contractors and subcontractors responsible for remedial action work at the former uranium ore processing site at Rifle, Colorado, and the uranium tailings disposal cell at Estes Gulch (Colorado) was reviewed during an audit conducted September 14 through 16, 1993. MK-Ferguson Company (MK-F) is the Remedial Action Contractor (RAC) responsible for engineering and construction management of the Rifle operations. The audit focused on radiological issues, occupational safety and health (OS ampersand H) issues, and the Occurrence Reporting and Processing System (ORPS). The close-out meeting was held on September 16, 1993, which was attended by representatives of MK-F, the US Department of Energy (DOE), and the Technical Assistance Contractor (TAC)

  13. Commercial production of ethanol in the San Luis Valley, Colorado. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Hewlett, E.M.; Erickson, M.V.; Ferguson, C.D.; Sherwood, P.B.; Boswell, B.S.; Walter, K.M.; Hart, M.L.

    1983-07-01

    The purpose of this study is to assess the commercial feasibility of producing between 76 and 189 million liters (20 and 50 million gallons) of ethanol annually in the San Luis Valley, Colorado using geothermal energy as the primary heat source. The San Luis Valley is located in south-central Colorado. The valley is a high basin situated approximately 2316 meters (7600 feet) above sea level which contains numerous warm water wells and springs. A known geothermal resource area (KGRA) is located in the east-central area of the valley. The main industry in the valley is agriculture, while the main industry in the surrounding mountains is lumber. Both of these industries can provide feedstock for the production of ethanol.

  14. Commercial production of ethanol in the San Luis Valley, Colorado. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Hewlett, E.M.; Erickson, M.V.; Ferguson, C.D.; Boswell, B.S.; Walter, K.M.; Hart, M.L.; Sherwood, P.B.

    1983-07-01

    The commercial feasibility of producing between 76 and 189 million liters (20 to 50 million gallons) of ethanol annually in the San Luis Valley, Colorado using geothermal energy as the primary heat source was assessed. The San Luis Valley is located in south-central Colorado. The valley is a high basin situated approximately 2316 meters (7600 feet) above sea level which contains numerous warm water wells and springs. A known geothermal resource area (IGRA) is located in the east-central area of the valley. The main industry in the valley is agriculture, while the main industry in the surrounding mountains is lumber. Both of these industries can provide feedstocks for the production of ethanol.

  15. Validation study of the Colorado Learning Attitudes about Science Survey at a Hispanic-serving institution

    Science.gov (United States)

    Sawtelle, Vashti; Brewe, Eric; Kramer, Laird

    2009-12-01

    The Colorado Learning Attitudes about Science Survey (CLASS) has been widely acknowledged as a useful measure of student cognitive attitudes about science and learning. The initial University of Colorado validation study included only 20% non-Caucasian student populations. In this Brief Report we extend their validation to include a predominately under-represented minority population. We validated the CLASS instrument at Florida International University, a Hispanic-serving institution, by interviewing students in introductory physics classes using a semistructured protocol, examining students’ responses on the CLASS item statements, and comparing them to the items’ intended meaning. We find that in our predominately Hispanic population, 94% of the students’ interview responses indicate that the students interpret the CLASS items correctly, and thus the CLASS is a valid instrument. We also identify one potentially problematic item in the instrument which one third of the students interviewed consistently misinterpreted.

  16. Results from utility wind resource assessment programs in Nebraska, Colorado, and Arizona

    Energy Technology Data Exchange (ETDEWEB)

    Drapeau, C.L. [Global Energy Concepts, Inc., Bothell, WA (United States)

    1997-12-31

    Global Energy Concepts (GEC) has been retained by utilities in Colorado, Nebraska, and Arizona to site, install, and operate 21 wind monitoring stations as part of the Utility Wind Resource Assessment Program (U*WRAP). Preliminary results indicate wind speed averages at 40 meters (132 ft) of 6.5 - 7.4 m/s (14.5-16.5 mph) in Nebraska and 7.6 - 8.9 m/s (17.0-19.9 mph) in Colorado. The Arizona stations are not yet operational. This paper presents the history and current status of the 21 monitoring stations as well as preliminary data results. Information on wind speeds, wind direction, turbulence intensity, wind shear, frequency distribution, and data recovery rates are provided.

  17. National uranium resource evaluation. Raton Quadrangle New Mexico and Colorado. Final report

    International Nuclear Information System (INIS)

    Using National Uranium Resource Evaluation criteria, the Raton Quadrangle (New Mexico and Colorado) contains one environment favorable for uranium deposits, the permeable arkosic sandstone members of the Pennsylvanian-Permian Sangre de Cristo Formation for either peneconcordant or roll-type deposits. The favorable parts of the Sangre de Cristo lie mostly in the subsurface in the Raton and Las Vegas Basins in the eastern part of the quadrangle. An area in the Costilla Peak Massif was investigated for uranium by determining geochemical anomalies in stream sediments and spring waters. Further work will be required to determine plutonic environment type. Environments unfavorable for uranium deposits include the Ogallala, Raton, and Vermejo Formations, the Trinidad Sandstone, the Pierre Shale, the Colorado Group, the Dakota Sandstone, the Morrison Formation, the Entrada and Glorieta Sandstones, Mississippian and Pennsylvanian rocks, quartz-pebble conglomerates, pegmatities, and Tertiary granitic stocks

  18. A Defense of the Late Nineteenth Century White Suffrage Activists of Australia, New Zealand and Colorado

    OpenAIRE

    Theodora-Eliza Vacarescu

    2003-01-01

    This paper addresses the history of late nineteenth century women’s suffrage and the history of the women involved in the struggle for female enfranchisement of Australia, New Zealand, and Colorado, which have recently been the target of fervent postcolonial criticism. The paper will attempt to defend the efforts of white suffragists by deconstructing the groundlessness and, occasion- ally, the falseness of postcolonial criticism.

  19. Agricultural Production with Change and Uncertainty: A Temporal Case Study Simulation of Colorado Potato Beetle

    OpenAIRE

    Heikkila, Jaakko; Peltola, Jukka

    2005-01-01

    Changes in climatic and policy environments combined with uncertainty related to stochastic environmental fluctuations make design of invasive pest policy challenging. These external changes are often exacerbated by changes in the species characteristics. We discuss facing local change and uncertainty when deciding ex ante on a specific policy strategy. Our empirical case deals with an invasive agricultural pest, Colorado potato beetle, and agricultural production in Finland. Invasions are mo...

  20. Colorado potato beetle manipulates plant defenses in local and systemic leaves

    OpenAIRE

    Chung, Seung Ho; Rosa, Cristina; Hoover, Kelli; Luthe, Dawn S; Felton, Gary W.

    2013-01-01

    Herbivore microbial associates can affect diverse interactions between plants and insect herbivores. Some insect symbionts enable herbivores to expand host plant range or to facilitate host plant use by modifying plant physiology. However, little attention has been paid to the role of herbivore-associated microbes in manipulating plant defenses. We have recently shown that Colorado potato beetle secrete the symbiotic bacteria to suppress plant defenses. The bacteria in oral secretions from th...

  1. Efficacy of biological insecticides to control the Colorado potato beetle (Leptinotasara decemlineata) in organic farming

    OpenAIRE

    Kühne, Stefan; Reelfs, Torben; Ellmer, Frank; Moll, Eckard; Kleinhenz, Benno; Gemmer, Christine

    2008-01-01

    The Colorado potato beetle (Leptinotasara decemlineata Say) is one of the most important pests on potatoes (Solanum tuberosum). In the present study, we compared the efficacy of three biological insecticides – Neem (NeemAzal-T/S), pyrethrum/rapeseed oil (Spruzit Neu) and Bacillus thuringiensis var. tenebrionis (Novodor FC) – against this pest in field trials conducted from 2005 to 2007. The combined and temporarily shifted application of neem and B.t.t. reduced significantly the number of bee...

  2. The importance of base flow in sustaining surface water flow in the Upper Colorado River Basin

    Science.gov (United States)

    Miller, Matthew P.; Buto, Susan G.; Susong, David D.; Rumsey, Christine A.

    2016-05-01

    The Colorado River has been identified as the most overallocated river in the world. Considering predicted future imbalances between water supply and demand and the growing recognition that base flow (a proxy for groundwater discharge to streams) is critical for sustaining flow in streams and rivers, there is a need to develop methods to better quantify present-day base flow across large regions. We adapted and applied the spatially referenced regression on watershed attributes (SPARROW) water quality model to assess the spatial distribution of base flow, the fraction of streamflow supported by base flow, and estimates of and potential processes contributing to the amount of base flow that is lost during in-stream transport in the Upper Colorado River Basin (UCRB). On average, 56% of the streamflow in the UCRB originated as base flow, and precipitation was identified as the dominant driver of spatial variability in base flow at the scale of the UCRB, with the majority of base flow discharge to streams occurring in upper elevation watersheds. The model estimates an average of 1.8 × 1010 m3/yr of base flow in the UCRB; greater than 80% of which is lost during in-stream transport to the Lower Colorado River Basin via processes including evapotranspiration and water diversion for irrigation. Our results indicate that surface waters in the Colorado River Basin are dependent on base flow, and that management approaches that consider groundwater and surface water as a joint resource will be needed to effectively manage current and future water resources in the Basin.

  3. Economic Impacts of Water Conservation Measures in Agriculture and Energy Within the Upper Colorado River Basin

    OpenAIRE

    Franklin, Douglas R.

    1982-01-01

    The demand for water is increasing in the western United States. Coupled with growing emphasis on development of the western resources, the limited supply of water will create an expanding competitive market for water by agricultural, energy, industrial and municipal users. The Upper Colorado River Basin is faced with a question of what water conservation measures in the agricultural and energy sectors can be instigated without reducing agricultural output. If the decision is made to adopt wa...

  4. On the contribution of groundwater storage to interannual streamflow anomalies in the Colorado River basin

    OpenAIRE

    E. A. Rosenberg; Clark, E A; Steinemann, A. C.; Lettenmaier, D. P.

    2013-01-01

    We assess the significance of groundwater storage for seasonal streamflow forecasts by evaluating its contribution to interannual streamflow anomalies in the 29 tributary sub-basins of the Colorado River. Monthly and annual changes in total basin storage are simulated by two implementations of the Variable Infiltration Capacity (VIC) macroscale hydrology model – the standard release of the model, and an alternate version that has been modified to include the SIMple Groundwat...

  5. Isotopes of helium, hydrogen, and carbon as groundwater tracers in aquifers along the Colorado River

    OpenAIRE

    Haber, Samuel Ainsworth

    2009-01-01

    Isotopes of hydrogen, carbon, helium, and neon in groundwater from 20 wells in the Lower Colorado River Valley (LCRV) are presented, with the aim of determining the age and mixing characteristics of the groundwater. Groundwaters from thirteen wells have measurable tritium and young ¹⁴C ages, suggesting mixing with at least a portion of recently-recharged (post-1952) groundwater. Groundwaters from the other seven wells are characterized as many thousands of years old and lack discernible triti...

  6. Multimodal Stimulation of Colorado Potato Beetle Reveals Modulation of Pheromone Response by Yellow Light

    OpenAIRE

    Fernando Otálora-Luna; Joseph C. Dickens

    2011-01-01

    Orientation of insects to host plants and conspecifics is the result of detection and integration of chemical and physical cues present in the environment. Sensory organs have evolved to be sensitive to important signals, providing neural input for higher order multimodal processing and behavioral output. Here we report experiments to determine decisions made by Colorado potato beetle (CPB), Leptinotarsa decemlineata, in response to isolated stimuli and multimodal combinations of signals on a...

  7. The Colorado Learning Attitudes about Science Survey (CLASS) for Use in Biology

    OpenAIRE

    Semsar, Katharine; Knight, Jennifer K.; Birol, Gülnur; Michelle K. Smith

    2011-01-01

    This paper describes a newly adapted instrument for measuring novice-to-expert-like perceptions about biology: the Colorado Learning Attitudes about Science Survey for Biology (CLASS-Bio). Consisting of 31 Likert-scale statements, CLASS-Bio probes a range of perceptions that vary between experts and novices, including enjoyment of the discipline, propensity to make connections to the real world, recognition of conceptual connections underlying knowledge, and problem-solving strategies. CLASS-...

  8. Inventory of forest and rangeland resources, including forest stress. [Black Hills, Manitou, Colorado, and Atlanta, Georgia

    Science.gov (United States)

    Aldrich, R. C.; Weber, F. P.; Driscoll, R. S. (Principal Investigator)

    1974-01-01

    The author has identified the following significant results. Road systems being developed within the Manitou, Colorado area for human habitation are readily discernible on the S192 normal-color photographs. These are dirt roads, some of which are about 20 feet wide. These data should provide the District Ranger of the Pike National Forest required information on the size and extent of these developing areas, information which he does not now have but is required for total management of the District.

  9. The Dust Accelerator Facility of the Colorado Center for Lunar Dust and Atmospheric Studies

    International Nuclear Information System (INIS)

    The NASA Lunar Institute's Colorado Center for Lunar Dust and Atmospheric Studies has recently completed the construction of a new experimental facility to study hypervelocity dust impacts. The installation includes a 3 MV Pelletron, accelerating small particles in the size range of 0.1 to few microns to velocities in the range of 1 to 100 km/s. Here we report the capabilities of our facility, and the results of our first experiments.

  10. Evaluation of a Multifamily Retrofit in Climate Zone 5, Boulder, Colorado (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2013-11-01

    In 2009, a 37-unit apartment complex located in Boulder, Colorado, underwent an energy retrofit to comply with Boulder SmartRegs Ordinance, a mandate that requires all rental properties to meet certain energy efficiency standards by 2018. The Consortium of Advanced Residential Buildings (CARB), a U.S. Department of Energy Building America team, worked with city planners and building owners to evaluate this program and recently completed a case study evaluating the effectiveness of a collection of retrofit measures.

  11. Snow water equivalent interpolation for the Colorado River Basin from snow telemetry (SNOTEL) data

    OpenAIRE

    Fassnacht, SR; Dressler, KA; Bales, RC

    2003-01-01

    Inverse weighted distance and regression nonexact techniques were evaluated for interpolating methods snow water equivalent (SWE) across the entire Colorado River Basin of the western United States. A 1-km spacing was used for the gridding of snow telemetry (SNOTEL) measurements for the years 1993, 1998, and 1999, which on average, represented higher than average, average, and lower than average snow years. Because of the terrain effects, the regression techniques (hypsometric elevation and m...

  12. Laboratory Evaluation of Five Chitin Synthesis Inhibitors Against the Colorado Potato Beetle, Leptinotarsa decemlineata

    OpenAIRE

    Karimzadeh, R.; Hejazi, M. J.; Rahimzadeh Khoei, F.; Moghaddam, M.

    2007-01-01

    Results of laboratory experiments are reported that tested the effects of five chitin synthesis inhibitors, diflubenzuron, cyromazine, lufenuron, hexaflumuron and triflumuron. on second instars of the Colorado potato beetle, Leptinotarsa decemlineata (Say) (Coleoptera: Crysomelidae), originally collected from potato fields of Bostanabaad, a town 66 km southeast of Tabriz, Iran. In bioassays, the larvae were fed potato leaves dipped in aqueous solutions containing chitin synthesis inhibitors. ...

  13. A Review of Aeromagnetic Anomalies in the Sawatch Range, Central Colorado

    Science.gov (United States)

    Bankey, Viki

    2010-01-01

    This report contains digital data and image files of aeromagnetic anomalies in the Sawatch Range of central Colorado. The primary product is a data layer of polygons with linked data records that summarize previous interpretations of aeromagnetic anomalies in this region. None of these data files and images are new; rather, they are presented in updated formats that are intended to be used as input to geographic information systems, standard graphics software, or map-plotting packages.

  14. Environmental assessment of remedial action at the Maybell Uranium Mill Tailings Site near Maybell, Colorado

    International Nuclear Information System (INIS)

    The purpose of this environmental assessment (EA) is to evaluate the environmental impacts resulting from remedial action at the Maybell uranium mill tailings site near Maybell, Colorado. A biological assessment (Attachment 1) and a floodplain/wetlands attachments describe the proposed action, affected environment, and environmental impacts associated with the proposed remedial action, including impacts to threatened and endangered species listed or proposed for listing by the US Fish and Wildlife Service (FWS)

  15. Joint state of Colorado-US Department of Energy WIPP Shipment Exercise Program: TRANSAX '90

    International Nuclear Information System (INIS)

    In July 1990, the United States Secretary of Energy requested the DOE conduct a transportation emergency exercise before the end of CY 1990. The tasking was subsequently directed to the Director of DOE's Office of Environmental Restoration and Waste Management (EM) to plan and conduct an exercise, based on a Waste Isolation Pilot Plant (WIPP) shipment scenario. The state of Colorado was asked to participate. Colorado, in turn, invited the DOE to integrate the exercise into its own series of WIPP-related tabletop and field exercises for which the state had already begun planning. The result was a joint USDOE/Colorado full-scale (orientation) exercise called Transportation Accident Exercise 1990 (TRANSAX '90). The state of Colorado's exercise program was a follow-on to previously conducted classroom training. The program would serve to identify and resolve outstanding issues concerning inspections of the WIPP shipment transporter as it entered and passed through the state on the designated Interstate 25 transportation corridor; criteria for movement under various adverse weather and road conditions; and emergency response to accidents occurring in an urban or rural environment. The USDOE designed its participation in the exercise program to test selected aspects of the DOE Emergency Management System relating to response to and management of DOE off-site transportation emergencies involving assistance to state and local emergency response personnel. While a number of issues remain under study for ultimate resolution, others have been resolved and will become the basis for emergency operations plans, SOPs, mutual aid agreements, and checklist upgrades. Concurrently, the concentrated efforts at local, state, and federal levels in dealing with WIPP- related activities during this exercise program development have given renewed impetus to all parties as the beginning of actual shipments draws nearer. Three tabletop scenarios are discussed in this report

  16. What predicts the mobility of elementary schoolleaders? An analysis of longitudinal data in Colorado

    OpenAIRE

    Motoko Akiba; Robert Reichardt

    2004-01-01

    While many studies have reported the predictors of teacher attrition, we know little about what predicts the attrition of school leaders. Using the Colorado state data on elementary school principals’ and assistant principals’ career paths from 1999 to 2001 and school achievement-level data, we addressed two research questions: 1) How do the age-specific attrition rates differ by gender and race? and 2) What other conditional factors are associated with the attrition of school leaders? We fou...

  17. Water and Energy Balance of a Riparian and Agricultural Ecosystem along the Lower Colorado River

    OpenAIRE

    Taghvaeian, Saleh

    2011-01-01

    Spatially-distributed water consumption was modeled over a segment of the Lower Colorado River, which contains irrigated agricultural and Tamarisk-dominated riparian ecosystems. For the irrigation scheme, distributed evapotranspiration data were analyzed in conjunction with point measurements of precipitation and surface flow in order to close daily and annual water balance. The annual closure error was less than 1% of the total water diversion to the area. In addition, it was found that t...

  18. Characterization of Mesa Verde Black-on-white ceramics from southwestern Colorado using NAA

    International Nuclear Information System (INIS)

    Sixty Mesa Verde variety Black-on-white bowls from Castle Rock Pueblo (5MT 1825) and Sand Canyon Pueblo (5MT765) in southwestern Colorado were chemically characterized using neutron activation analysis. Eleven clay sources local to the sites in the McElmo Drainage area were also analyzed. The results revealed two distinct compositional groups containing relative frequencies that imply local production. The occurrence of trade between the two sites was also identified. (author). 20 refs., 5 figs., 2 tabs

  19. Comparability among four invertebrate sampling methods, Fountain Creek Basin, Colorado, 2010-2012

    Science.gov (United States)

    Zuellig, Robert E.; Bruce, James F.; Stogner, Robert W.; Brown, Krystal D.

    2014-01-01

    The U.S. Geological Survey, in cooperation with Colorado Springs City Engineering and Colorado Springs Utilities, designed a study to determine if sampling method and sample timing resulted in comparable samples and assessments of biological condition. To accomplish this task, annual invertebrate samples were collected concurrently using four sampling methods at 15 U.S. Geological Survey streamflow gages in the Fountain Creek basin from 2010 to 2012. Collectively, the four methods are used by local (U.S. Geological Survey cooperative monitoring program) and State monitoring programs (Colorado Department of Public Health and Environment) in the Fountain Creek basin to produce two distinct sample types for each program that target single-and multiple-habitats. This study found distinguishable differences between single-and multi-habitat sample types using both community similarities and multi-metric index values, while methods from each program within sample type were comparable. This indicates that the Colorado Department of Public Health and Environment methods were compatible with the cooperative monitoring program methods within multi-and single-habitat sample types. Comparisons between September and October samples found distinguishable differences based on community similarities for both sample types, whereas only differences were found for single-habitat samples when multi-metric index values were considered. At one site, differences between September and October index values from single-habitat samples resulted in opposing assessments of biological condition. Direct application of the results to inform the revision of the existing Fountain Creek basin U.S. Geological Survey cooperative monitoring program are discussed.

  20. University of Colorado, Nuclear Physics Laboratory technical progress report, November 1, 1978-October 31, 1979. Report NPL-845. [Nuclear Physics Lab. , Univ. of Colorado

    Energy Technology Data Exchange (ETDEWEB)

    1979-11-01

    This report summarizes work carried out at the Nuclear Physics Laboratory of the University of Colorado from November 1, 1978 to October 31, 1979, under contract EY-76-C-02-0535.A003 between the University of Colorado and the United States Department of Energy. Experimental studies of light ion-induced reactions were performed with the AVF cyclotron, which continues each year to produce beams of yet higher quality. Charged-particle studies continued to emphasize use of the high-resolution spectrometer system, but some return to broad-range spectroscopic studies using solid state detectors also occurred. Neutron time-of-flight experiments used 9-meter and 30-meter flight paths. Neutron-gamma ray coincidence studies developed into a new and promising field. The new PDP 11/34 data acquisition system was of great value in allowing such multiparameter experiments. Smaller programs in nuclear astrophysics, plasma diagnostic development, and medical physics were also undertaken. Research activities based at other accelerators grew. Studies of future directions for light-ion accelerators, including work on intense pulsed ion sources, orbit dynamics, and storage rings, were greatly enlarged. 19 of the articles in this report were abstracted and indexed individually. Lists of publications and personnel conclude this report. (RWR)