WorldWideScience

Sample records for chun che fung

  1. Che Guevara

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2014-01-01

    made Che Guevara a political, religious and cultural icon and an object of consumption, despite his total political and military failure in Bolivia and his violent death. Finally the article contrasts the meanings of his image in the original context with new research that calls into question...... with the achievements and connotations of the Cuban Revolution in the context of the Cold War. The current meanings of the image must be read in the context of the global consumer culture. The article analyzes and explains how a conjunction of factors such as communication strategies and the connotations of his image...

  2. El humanismo del Che Che's Humanism

    OpenAIRE

    Avelino Fernández Espert; Cristina Fernández Rivero

    2004-01-01

    Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che) en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profes...

  3. El humanismo del Che Che's Humanism

    Directory of Open Access Journals (Sweden)

    Avelino Fernández Espert

    2004-08-01

    Full Text Available Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profesional de la medicina. El artículo dedica atención especial a sus conceptos sobre el hombre, su vida e historia y a su proverbial apego a una ética revolucionaria de elevado calibre. El artículo contribuye al enriquecimiento de los conocimientos sobre el desarrollo histórico del humanismo médico cubano, al proyectarlo en la figura de uno de sus más míticos modelosThe authors, studious of the extraordinary influence of Commandant and Dr. Ernesto Guevara de la Serna 's thought in Cuba and America, unveil the humanist perspective of this revolutionary doctor, through the most transcendental historical events in this man's life in different latitudes of the world. Che, young student, medicine doctor with promising gifts that knew how to place the human being and his values above his promissory future as scientific and medicine professional. The article dedicates special attention to his concepts about men, as well as his life and history and to his proverbial attachment to valuable revolutionary ethics. The article contributes to the enrichment of knowledge on the historical development of Cuban medical humanism, by reflecting this in the figure of one of its most mythical models

  4. Notas sobre el che

    Directory of Open Access Journals (Sweden)

    Virginia Bertolotti

    2010-06-01

    Full Text Available In the present work, I review, in the first place, the bibliography that summarizes the discussion surrounding the etymology of the word che. Then, I analyze the uses of this term in the diachrony as in the synchrony of the Río de la Plata Spanish, which allows me to propose a classification of the uses of the word che in this region. In the third part of the article, I discuss the categorial adscrption of the word che. Finally, the categorial analysis of the diachronic and synchronic empirical evidence allows me to conclude that the vocative uses of the term are a loan from the nominal determinant of the guaraní language, and not a phonic change in the Spanish interjection, thus resolving the etymological issues.

  5. Fast, global, and entrepreneurial: supply chain management, Hong Kong style. An interview with Victor Fung. Interview by Joan Magretta.

    Science.gov (United States)

    Fung, V

    1998-01-01

    Li & Fung, Hong Kong's largest export trading company, has been an innovator in supply chain management--a topic of increasing importance to many senior executives. In this interview, chairman Victor Fung explains both the philosophy behind supply chain management and the specific practices that Li & Fung has developed to reduce costs and lead times, allowing its customers to buy "closer to the market." Li & Fung has been a pioneer in "dispersed manufacturing." It performs the higher-value-added tasks such as design and quality control in Hong Kong, and outsources the lower-value-added tasks to the best possible locations around the world. The result is something new: a truly global product. To produce a garment, for example, the company might purchase yarn from Korea that will be woven and dyed in Taiwan, then shipped to Thailand for final assembly, where it will be matched with zippers from a Japanese company. For every order, the goal is to customize the value chain to meet the customer's specific needs. To be run effectively, Victor Fung maintains, trading companies have to be small and entrepreneurial. He describes the organizational approaches that keep the company that way despite its growing size and geographic scope: its organization around small, customer-focused units; its incentives and compensation structure; and its use of venture capital as a vehicle for business development. As Asia's economic crisis continues, chairman Fung sees a new model of companies emerging--companies that are, like Li & Fung, narrowly focused and professionally managed.

  6. Che: His Own Worst Enemy

    Science.gov (United States)

    2015-04-01

    comprised of Green Berets, to go to Bolivia and train a Ranger battalion 40 in counter-insurgency operations. Leading this 16-man team was Maj...York: Routledge & Kegan Ltd., 1987. Sinclair, Andrew. Che Guevara. New York: The Viking Press, 1970. Study of the “Diary of ‘Che’ Guevara in

  7. Cholinesterase (ChE) response and related mortality among birds fed ChE inhibitors

    Science.gov (United States)

    Ludke, J.L.; Hill, E.F.; Dieter, M.P.

    1975-01-01

    Patterns of mortality and inhibition of brain and plasma ChE in birds treated with ChE inhibitors were studied in an attempt to determine the validity of using ChE activity as a monitoring and diagnostic technique. Analysis of brain ChE activity proved to be reliable for diagnosing and monitoring effects of selected ChE inhibitors in birds. Brain ChE inhibition exceeding 20% indicated exposure, and inhibition greater than 50% was sufficient for diagnosing cause of death. Individuals that died from dietary exposure to parathion or carbofuran had brain ChE activities below 55% of normal; although individuals could survive with brain ChE activity lower than 50%. Problems associated with collection, storage, and analysis of tissues for ChE activity are discussed.

  8. Introduzione. Donne che portano la parrucca

    Directory of Open Access Journals (Sweden)

    Claudia Mattalucci-Yılmaz

    2013-07-01

    Full Text Available Peruk takan kadınlar è l’opera che nel 1999 l’artista e cineasta turco Kutlug Ataman ha presentato alla Biennale di Venezia curata da Harald Szeemann. Quattro schermi giustapposti proiettano le testimonianze di donne che, per un periodo della loro vita, hanno portato una parrucca: un’attivista politica di sinistra che nel 1971, dopo il colpo di stato militare, utilizzava un nome in codice, una divisa delle Turkish Airlines e una parrucca per sfuggire al controllo della polizia; una giornalista, colpita da un tumore al seno, che ha portato una parrucca per mascherare gli effetti della chemioterapia; una studentessa musulmana che indossa una parrucca per frequentare l’università, in un contesto – quello turco – che in nome della laicità dello Stato, interdice l’uso nel foulard nelle scuole, nelle università e nella pubblica amministrazione; e infine un transessuale.

  9. Ultrastructure of spermiogenesis in Vampyroteuthis infernalis Chun — a relict cephalopod mollusc

    Science.gov (United States)

    Healy, John M.

    1990-03-01

    Spermiogenesis in the relict deep-sea cephalopod Vampyroteuthis infernalis Chun is examined using transmission electron microscopy (TEM), and the results compared with available data on other cephalopods. Early spermatids of Vampyroteuthis exhibit an ovoid nucleus (with dense irregular patches), numerous mitochondria and a pair of triplet substructure centrioles (arranged parallel to each other). Subsequently, the following morphological changes take place: (1) nuclear contents condense into a fibrous reticulum, then into thick fibres; (2) the acrosomal vesicle (presumably Golgi-derived) positions itself in a shallow depression at the nuclear apex; (3) the flagellum forms from one of the two centrioles; (4) mitochondria cluster around the flagellum at the base of the nucleus; (5) a dense, fibrous plug forms within the basal invagination of the nucleus. Microtubules surround the acrosome and condensing nucleus of spermatids. The dense plug is of special systematic importance since it also occurs in spermatids and spermatozoa of Octopus spp., but not in any investigated species of the Sepiida, Sepiolida or Teuthida. Late spermatids and mature spermatozoa of Vampyroteuthis strongly resemble developing spermatids of Octopus, suggesting a close phylogenetic relationship between Vampyroteuthis (and the Vampyromorpha) and octopods.

  10. Isolation, Identification and Activities of Natural Antioxidants from Callicarpa kwangtungensis Chun

    Science.gov (United States)

    Cai, Hao; Xie, Zhiyong; Liu, Guanghui; Sun, Xiuman; Peng, Guangtian; Lin, Baoqin; Liao, Qiongfeng

    2014-01-01

    Reactive oxygen species leads to some diseases associated with oxidative stress. Callicarpa kwangtungensis Chun (CK) is a common remedy in traditional Chinese medicine and possesses diverse biological activities involving antioxidant properties; its main compounds phenylethanoid glycosides (PG) and flavonoids are always reported as antioxidants. In order to develop CK as a safe and activated antioxidant, our investigation was performed to validate antioxidant properties and assess which types of compounds (similar polarity or similar structure), even which compounds, played the role of antioxidants. The extracted compounds of CK were analyzed qualitatively and quantitatively by HPLC-DAD-ESI-Trap MS and UV for their contents and antioxidant activities. The correlations between antioxidant activities and known contents were respectively counted and a semi-quantitative experiment was designed to screen antioxidant compounds of CK with HPLC-UV. The n-butanol fraction (BF) showed the highest total phenolic and flavonoid contents (TPC, TFC), and three PG (forsythiaside B, poliumoside and acteoside) contents. BF showed the significantly best (Pantioxidant activities on CCl4-induced acute liver injury Mice and TBHP-reduced HepG2 cells. Nine PG (forsythiaside B, poliumoside, acteoside, alyssonoside, brandioside and their derivatives) and one flavone (rhamnazin) were screened out as antioxidants. BF in CK contained abundant polyphenolic, which reflected some definite antioxidant properties. The antioxidant compounds consisted at the least of nine PG and one flavone. PMID:24667350

  11. Je-Chun-Jun induced apoptosis of human cervical carcinoma HeLa cells

    Institute of Scientific and Technical Information of China (English)

    Han-jung CHAE; Kyung-mi PARK; Geun-youn LEE; Gi-seup JEONG; Hyung-rae PARK; Hyung-min KIM; Soo-wan CHAE; Shim-keun YOO; Hyung-ryong KIM

    2004-01-01

    AIM: To study the mechanism of Je-Chun-Jun (JCJ)-inducing the apoptosis of the human cervical carcinoma,HeLa cells. METHODS: The cell viability was assessed using MTT assay. The optical density was measured at 570 nm. The caspase activity was measured using 50 mmol/L of fluorogenic substrate, AC-DEVD-AMC (caspase3), AC-VEID-AMC (caspase-8) or AC-LEHD-AFC (caspase-9). To confirm the expression of proteins, Western blotting was performed. To detect the characteristic of apoptosis chromatin condensation, HeLa cells were stained with Hoechst 33258 in the presence of JCJ. For the cell cycle analysis, HeLa cells were incubated with Propidium iodide (PI) solution. Fluorescence intensity of cell cycle was measured using flow cytometry system. RESULTS:The loss of viability occurred following the exposure of 10 g/L JCJ. Cells treated with 10 g/L JCJ for 3 d exhibited the apoptotic morphology (brightly blue-fluorescent condensed nuclei by Hoechst 33258-staining) and the reduction of cell volume. Cells incubated with JCJ for 48 h were arrested at the G1 phase of cell cycle and their G1 checkpoint related gene products such as cyclin D1 were transiently decreased. We showed that JCJ induced the p38 MAPK activation in HeLa cells. The p38 MAPK inhibitor, SB203580 protected Hela cells from the JCJ-induced death as well as intervened the JCJ-induced accumulation of cells at the G1 phase. In contrast, MEK1 (-ERK upstream) inhibitor, PD98059 had no effect on HeLa cells. CONCLUSION: JCJ induced cell cycle arrest and apoptosis of HeLa cells through p38 MAPK pathway.

  12. Bestimmung der optimalen Array-Apertur für die Ultraschallprüfung von faserverstärkten Kunststoffen

    OpenAIRE

    Kurras, Martin

    2017-01-01

    Für die zerstörungsfreie Prüfung von Kohlenstofffaserverbundwerkstoffen (CFK) wird häufig die Ultraschallprüfung verwendet. Neben dem klassischen Ultraschallverfahren findet dabei auch die Phased Array Technologie Anwendung. Hierbei wird zwischen zwei Verfahren unterschieden: dem handelsüblichen Phased Array oder Conventional Phased Array (CPA) und dem tomographischen Sampling Phased Array (SPA). Der Einsatz von Phased Arrays im Zusammenhang mit Linear-Scan-Technik und das sich daraus ergeben...

  13. Dicty_cDB: CHE636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE636 (Link to dictyBase) - - - Contig-U11696-1 CHE636P (Link... to Original site) CHE636F 174 CHE636Z 123 CHE636P 277 - - Show CHE636 Library CH (Link to library) Clone ID CHE636 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dict...ne RP11-15H22, WORKING DRAFT SEQUENCE, 23 unordered pieces. 40 0.19 3 AC149612 |AC149612.1 Ictalurus punctat... %: cytoskeletal 4.0 %: mitochondrial >> prediction for CHE636 is nuc 5' end seq. ID CHE636F 5' end seq. >CH

  14. Structural Insight inot the low Affinity Between Thermotoga maritima CheA and CheB Compared to their Escherichia coli/Salmonella typhimurium Counterparts

    Energy Technology Data Exchange (ETDEWEB)

    S Park; B Crane

    2011-12-31

    CheA-mediated CheB phosphorylation and the subsequent CheB-mediated demethylation of the chemoreceptors are important steps required for the bacterial chemotactic adaptation response. Although Escherichia coli CheB has been reported to interact with CheA competitively against CheY, we have observed that Thermotoga maritima CheB has no detectable CheA-binding. By determining the CheY-like domain crystal structure of T. maritima CheB, and comparing against the T. maritima CheY and Salmonella typhimurium CheB structures, we propose that the two consecutive glutamates in the {beta}4/{alpha}4 loop of T. maritima CheB that is absent in T. maritima CheY and in E. coli/S. typhimurium CheB may be one factor contributing to the low CheA affinity.

  15. Crèche and School

    CERN Multimedia

    EVE et École

    2018-01-01

    IMPORTANT DATES Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesd...

  16. Writing Gardens - Gardening Drawings: Fung, Brunier and Garening as a model of Landscape Architectural Practice

    Directory of Open Access Journals (Sweden)

    Julian Raxworthy

    2004-06-01

    Full Text Available Landscape architecture is different from other design discourses, notably architecture, because of its utilisation of' dynamic' construction media such as plant materials, soils and water, compared with the 'static' materials of architecture, colloquially described as bricks and mortar. This dynamism refers to the fact that landscape materials not only change, but get better over time. While this is a material difference, its implications extend to practice, which has been modelled, from architecture, to favour a static mode of representation: the drawing. While the drawing is important for the propositional nature of landscape architecture, it may be valuable to look at other disciplines, allied to landscape architecture, which might be seen as better able to engage with change. In this essay, the garden provides just such an example. In the writings of Stanislaus Fung on the Chinese garden text the Yuan vi, an argument is made about writing being a fundamental act in the endeavour of gardening that may offer a bridge across the 'ontological disparity' that exists between representation and the subject, the landscape. To speak of writing in this context suggests that writing about gardens is actually a type of gardening in itself. This argument is extended in the current essay quickly to see if it is also appropriate to consider drawings in this way. This essay also attempts to legitimate theoretically the real possibility of modifying landscape architectural practices to engage with change, by suggesting what might be learned from gardening. In further research by this author, this argument will be used as the theoretical basis for critiquing gardens in such a way that lessons learnt from garden designers can be valuably incorporated back into the discourse of landscape architecture.

  17. Che cos’è l’antiziganismo?

    Directory of Open Access Journals (Sweden)

    Leonardo Piasere

    2012-01-01

    Full Text Available Abstract – IT Chi è zingaro? Colui che chiamo zingaro, che assegno a questa identità e che costituisco come "altro" dal resto della società. In questo senso, la storia degli zingari si confonde con quella dell'"antiziganismo", un neologismo che denota una pratica antica. Ma si può dire che la comparsa della nuova parola è legata agliodierni intrecci tra politiche multiculturali da un lato e politiche neoliberiste dall’altro?Abstract – FRQui est Tsigane? Celui que je nomme Tsigane, que j'assigne à cette identité et que je constitue en "autre" du reste de la société. Dans ce sens, l'histoire des Tsiganes se confond avec celle de l'"antitsiganisme", un néologisme qui recouvre une pratique ancienne. Mais peut-on dire que l'apparition de ce nouveau mot estliée aux croisements actuels entre les politiques multiculturelles d'une part, et les politiques néolibéralesde l'autre? Abstract – EN Who is Gypsy? The person I call Gypsy, to whom I assign this identity, is that I establish as "other" than the rest of society. In this sense, the history of Gypsies merges with that of "antigypsism", a neologism that denotes an ancient practice. But can it be said that the appearance ofthis new word is linked to the current entanglement between multi-cultural politics on one side and neo-liberalist politics on the other?

  18. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  19. Che legend elab ka 40 aastat hiljem / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. okt. lk. 10. Argentinas sündinud ja 1967. aastal hukatud revolutsionääri Ernesto Che Guevara poliitikukarjäärist, tema panusest Kuuba revolutsiooni ja poliitikasse. Ernesto Che Guevara mälestamisest Ladina-Ameeerika riikides. Lisa: Kuuba revolutsioon; Che Guevara elu

  20. l'italiano che cambia: apocalisse o palingenesi? alcune riflessioni ...

    African Journals Online (AJOL)

    User

    idea that a real linguistic apocalypse is to be found on one hand, in what. Calvino ... nell'italiano contemporaneo da una prospettiva che, audacemente, definiamo ...... 'terrore semantico', cioè la fuga di fronte a ogni vocabolo che abbia di.

  1. Natural gas prices in Italy. Tariffs geographical distribution; Metano. Paese che vai, prezzo che trovi

    Energy Technology Data Exchange (ETDEWEB)

    Marrocchelli, A. [ENEA, Rome (Italy). Centro Ricerche Casaccia

    2000-11-01

    The annual report on services and activity carries at some evaluations of data concerned the natural gas market: total consumption, costs and prices in Italy and comparative evaluations with other european countries. [Italian] La relazione annuale sullo stato dei servizi e sull'attivita' svolta, presentata dal Presidente dell'Autorita' per l'energia elettrica e il gas, porta ad alcune considerazioni sui dati che riguardano il mercato del gas naturale: i consumi totali, i costi e i prezzi in Italia, il confronto con i costi e i prezzi praticati negli altri paesi europei.

  2. Validierung der Wirksamkeitsprüfung für Clostridium tetani Impfstoffe ad usum veterinarium durch den direkten Nachweis von Tetanus-Antitoxin im Zieltier mittels ELISA

    OpenAIRE

    Roßkopf, Ute

    2007-01-01

    Die dargelegten Ergebnisse zur Validierung einer neuen Wirksamkeitsprüfung von Tetanus-Impfstoffen resultieren aus umfangreichen Feldstudien, durchgeführt mit neun unterschiedlichen Impfstoffen für das Pferd sowie acht Impfstoffen für das Schaf. Insgesamt wurden 102 Pferde und 82 Schafe entsprechend den Angaben in der Gebrauchsinformation immunisiert. Blutentnahmen fanden nach einem vorgegebenen Schema von bis zu zwei Jahren nach der ersten Impfung statt. Die Impfstoffe waren entweder monoval...

  3. Pflicht zur Prüfung der Existenz des Internen Kontrollsystems: Bestandesaufnahme zur Steuerung und Kontrolle mittelgrosser Unternehmen in der Schweiz

    OpenAIRE

    Ruud, T F; Isufi, S; Friebe, P

    2008-01-01

    Die Pflicht zur Prüfung der Existenz des internen Kontrollsystems betrifft auch etliche mittelgrosse Unternehmen. Im Rahmen einer Umfrage haben das Institut für Rechnungswesen und Controlling der Universität Zürich und PricewaterhouseCoopers bei diesen Unternehmen eine Bestandesaufnahme zu Kontroll- und Prüfungsaktivitäten durchgeführt. Nachstehend werden die Ergebnisse der Umfrage zum internen Kontrollsystem präsentiert.

  4. Full-scale measurements and system identification on Sutong cable-stayed bridge during Typhoon Fung-Wong.

    Science.gov (United States)

    Wang, Hao; Tao, Tianyou; Guo, Tong; Li, Jian; Li, Aiqun

    2014-01-01

    The structural health monitoring system (SHMS) provides an effective tool to conduct full-scale measurements on existing bridges for essential research on bridge wind engineering. In July 2008, Typhoon Fung-Wong lashed China and hit Sutong cable-stayed bridge (SCB) in China. During typhoon period, full-scale measurements were conducted to record the wind data and the structural vibration responses were collected by the SHMS installed on SCB. Based on the statistical method and the spectral analysis technique, the measured data are analyzed to obtain the typical parameters and characteristics. Furthermore, this paper analyzed the measured structural vibration responses and indicated the vibration characteristics of the stay cable and the deck, the relationship between structural vibrations and wind speed, the comparison of upstream and downstream cable vibrations, the effectiveness of cable dampers, and so forth. Considering the significance of damping ratio in vibration mitigation, the modal damping ratios of the SCB are identified based on the Hilbert-Huang transform (HHT) combined with the random decrement technique (RDT). The analysis results can be used to validate the current dynamic characteristic analysis methods, buffeting calculation methods, and wind tunnel test results of the long-span cable-stayed bridges.

  5. Full-Scale Measurements and System Identification on Sutong Cable-Stayed Bridge during Typhoon Fung-Wong

    Directory of Open Access Journals (Sweden)

    Hao Wang

    2014-01-01

    Full Text Available The structural health monitoring system (SHMS provides an effective tool to conduct full-scale measurements on existing bridges for essential research on bridge wind engineering. In July 2008, Typhoon Fung-Wong lashed China and hit Sutong cable-stayed bridge (SCB in China. During typhoon period, full-scale measurements were conducted to record the wind data and the structural vibration responses were collected by the SHMS installed on SCB. Based on the statistical method and the spectral analysis technique, the measured data are analyzed to obtain the typical parameters and characteristics. Furthermore, this paper analyzed the measured structural vibration responses and indicated the vibration characteristics of the stay cable and the deck, the relationship between structural vibrations and wind speed, the comparison of upstream and downstream cable vibrations, the effectiveness of cable dampers, and so forth. Considering the significance of damping ratio in vibration mitigation, the modal damping ratios of the SCB are identified based on the Hilbert-Huang transform (HHT combined with the random decrement technique (RDT. The analysis results can be used to validate the current dynamic characteristic analysis methods, buffeting calculation methods, and wind tunnel test results of the long-span cable-stayed bridges.

  6. Bai, Prof. Chunli

    Indian Academy of Sciences (India)

    Date of birth: 1953. Address: Executive Vice-President, Chinese Academy of Sciences, 52, Sanlihe Road, Beijing 100864, China Contact: Office: (+86-10) 6859 7606. Fax: (+86-10) 6852 6316. Email: clbai@cas.cn. YouTube; Twitter; Facebook; Blog ...

  7. CheMentor Software System by H. A. Peoples

    Science.gov (United States)

    Reid, Brian P.

    1997-09-01

    CheMentor Software System H. A. Peoples. Computerized Learning Enhancements: http://www.ecis.com/~clehap; email: clehap@ecis.com; 1996 - 1997. CheMentor is a series of software packages for introductory-level chemistry, which includes Practice Items (I), Stoichiometry (I), Calculating Chemical Formulae, and the CheMentor Toolkit. The first three packages provide practice problems for students and various types of help to solve them; the Toolkit includes "calculators" for determining chemical quantities as well as the Practice Items (I) set of problems. The set of software packages is designed so that each individual product acts as a module of a common CheMentor program. As the name CheMentor implies, the software is designed as a "mentor" for students learning introductory chemistry concepts and problems. The typical use of the software would be by individual students (or perhaps small groups) as an adjunct to lectures. CheMentor is a HyperCard application and the modules are HyperCard stacks. The requirements to run the packages include a Macintosh computer with at least 1 MB of RAM, a hard drive with several MB of available space depending upon the packages selected (10 MB were required for all the packages reviewed here), and the Mac operating system 6.0.5 or later.

  8. A crèche on the Meyrin CERN site

    CERN Multimedia

    Association du personnel

    2013-01-01

    A few months ago (see Echo 175) we announced the opening, at the end of August, of a crèche at the CERN Staff Association’s nursery school. After a very active summer, where a new floor was added to the canteen building, the new school year started in excellent conditions and, as expected, the new crèche opened on Tuesday 27 August. This crèche, with 13 full-time equivalent places, can accept 18 children aged between three months and two years in a space fully refitted to care for the little ones. A specially designed space for breastfeeding helps mothers working on the site to respect their baby's rhythm. In compliance with the standards of supervision in the canton of Geneva six educators take care of the children in shifts. This new space is fully integrated in the nursery school so that now the crèche, Kindergarten and school of the CERN Staff Association can welcome children aged from three months to six years, from Monday to Friday, and...

  9. à l'encoche sèche

    African Journals Online (AJOL)

    Chez Hevea brasiliensis, la production de latex est affectée par l'encoche sèche qui se manifeste par l'arrêt de l'écoulement de ... coagulation pour donner le caoutchouc naturel. ..... relationship between latex sugar content, the metabolic ...

  10. Crèche and School - Important dates

    CERN Multimedia

    Staff Association

    2018-01-01

    Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Friday 2 March 2018: htt...

  11. Che cos'è la vita ?, Scienza e umanesimo

    CERN Document Server

    Schrödinger, Erwin

    1988-01-01

    A cento anni dalla nascita di Erwin Schrödinger (Viena 1887), il suo pensiero e il suo lavoro mantengono inalterati la loro attualità, come dimostra la nuova pubblicazione di molti dei suoi testi e i numerosi convegni che gli vengono dedicati.

  12. Care and education in the Danish Créche

    DEFF Research Database (Denmark)

    Broström, Stig; Hansen, Ole Henrik

    2010-01-01

    This article seeks to identify the relation between policy and lived life, for the small child in the Danish crèche. To accomplish this, the article integrates demography, traditions, national curriculum and psychological, educational, and recent developments in research. It is an attempt to reveal...... research articles. It is used in the exploration of meanings of political, social, and cultural phenomena as experienced by the involved individuals themselves, in their natural context. It is a presumption that the child’s development is a consequence of emotional and cognitive stimulation. To outline...... that, it is vital to emphasize the influence that policy causes on educational practice in the crèche, e.g., the conceptualization of education and care....

  13. La Pubblica Amministrazione in uno scenario che cambia

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2009-03-01

    Full Text Available Questo numero, mirato alle implicazioni dell'utilizzo del dato territoriale nel contesto delle PA, le Pubbliche Amministrazioni, si arricchisce di un contenuto ulteriore, particolarmente spaziale; GEOmedia esce infatti in coincidenza con una manifestazione che possiamo considerare la vetrina mediterranea privilegiata per la promozione culturale, scientifica e commerciale delle istituzioni e del segmento dell’industria aerospaziale europea ed italiana.

  14. Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ming; Wang, Dan, E-mail: danwangwdd@163.com; Li, Ning

    2016-04-22

    The transcriptional cofactor Che-1 is an RNA polymerase II (Pol II) which is involved in tumorigenesis, such as breast cancer and multiple myeloma. Che-1 can also regulate mutant p53 expression, which plays roles in many types of cancer. In this study, we aimed to investigate the effects and specific mechanism of Che-1 in the regulation of osteosarcoma (OS) cell growth. We found that Che-1 is highly expressed in several kinds of OS cells compared with osteoblast hFOB1.19 cells. MTT and flow cytometry assays showed that Che-1 depletion by siRNA markedly suppressed MG-63 and U2OS cell proliferation and promoted apoptosis. The chromatin immunoprecipitation (ChIP) assay verified the presence of Che-1 on the p53 promoter in MG-63 and U2OS cells carrying mutant p53. Further studies showed that Che-1 depletion inhibited mutant p53 expression. Notably, our study showed that the loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53. Therefore, these findings open the possibility that silencing of Che-1 will have therapeutic benefit in OS. - Highlights: • Che-1 is highly expressed in several kinds of OS cells. • Che-1 depletion suppressed MG-63 and U2OS cell growth. • Che-1 is existed in the p53 promoter in MG-63 and U2OS cells. • Che-1 depletion inhibited mutant p53 expression. • Che-1 depletion inhibits cell growth by decreasing the level of mutant p53.

  15. Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

    International Nuclear Information System (INIS)

    Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

    2012-01-01

    T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

  16. Crystallization and preliminary X-ray crystallographic analysis of CheW from Thermotoga maritima: a coupling protein of CheA and the chemotaxis receptor

    International Nuclear Information System (INIS)

    Park, SangYoun; Crane, Brian R.

    2011-01-01

    CheW from T. maritima has been crystallized (space group P6 3 , unit-cell parameters a = b = 61.265, c = 361.045 Å). Diffraction data have been collected to 3.1 Å resolution using synchrotron X-ray radiation. The CheW protein plays a key role in bacterial chemotaxis signal transduction by coupling CheA to chemotaxis receptors. CheW from Thermotoga maritima has been overexpressed in Escherichia coli and crystallized at 298 K using ammonium sulfate as a salt precipitant. X-ray diffraction data have been collected to 3.10 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group P6 3 , with unit-cell parameters a = b = 61.265, c = 361.045 Å. The asymmetric unit may contain four to six CheW molecules

  17. Finally, a crèche at CERN!

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    After many years of discussion, the CERN Staff Association’s first crèche will open its doors in September to welcome up to 20 babies and toddlers.   A delicate operation: the installation of 11 modules above the Nursery's School canteen. Image: Sigrid Knoops. The CERN Staff Association’s Nursery School, which will soon turn 50, is pleased to announce the establishment of CERN’s first crèche. This project, which has come to fruition over the past academic year with the support of the CERN Management, meets an established and growing need among the Laboratory’s personnel and users. As a modular construction, the Nursery School’s new second floor was assembled above the existing canteen in a matter of days. Its 11 modules are ultra-modern – they’re even equipped with underfloor heating. “Thanks to this extension, we will be able to accept around twenty babies at the start of the academ...

  18. Perché io credo in colui che ha fatto il mondo

    CERN Document Server

    Zichichi, Antonino

    1999-01-01

    Fin troppo spesso si sente dire che il mondo della scienza e quello della religione sono in completa opposizione e che non condividono alcuna esperienza o caratteristica in comune. Nulla potrebbe essere più falso di queste affermazioni secondo Antonino Zichichi, che in quest'opera afferma come la ricerca scientifica e l'esperienza religiosa abbiano in comune molto più di quanto si possa pensare.

  19. Heterozygous Che-1 KO mice show deficiencies in object recognition memory persistence.

    Science.gov (United States)

    Zalcman, Gisela; Corbi, Nicoletta; Di Certo, Maria Grazia; Mattei, Elisabetta; Federman, Noel; Romano, Arturo

    2016-10-06

    Transcriptional regulation is a key process in the formation of long-term memories. Che-1 is a protein involved in the regulation of gene transcription that has recently been proved to bind the transcription factor NF-κB, which is known to be involved in many memory-related molecular events. This evidence prompted us to investigate the putative role of Che-1 in memory processes. For this study we newly generated a line of Che-1(+/-) heterozygous mice. Che-1 homozygous KO mouse is lethal during development, but Che-1(+/-) heterozygous mouse is normal in its general anatomical and physiological characteristics. We analyzed the behavioral characteristic and memory performance of Che-1(+/-) mice in two NF-κB dependent types of memory. We found that Che-1(+/-) mice show similar locomotor activity and thigmotactic behavior than wild type (WT) mice in an open field. In a similar way, no differences were found in anxiety-like behavior between Che-1(+/-) and WT mice in an elevated plus maze as well as in fear response in a contextual fear conditioning (CFC) and object exploration in a novel object recognition (NOR) task. No differences were found between WT and Che-1(+/-) mice performance in CFC training and when tested at 24h or 7days after training. Similar performance was found between groups in NOR task, both in training and 24h testing performance. However, we found that object recognition memory persistence at 7days was impaired in Che-1(+/-) heterozygous mice. This is the first evidence showing that Che-1 is involved in memory processes. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  20. Altruisti, cooperativi e morali: Perché è più facile esserlo domani che oggi

    NARCIS (Netherlands)

    Giacomantonio, M.; de Dreu, C.K.W.

    2013-01-01

    Un portafogli smarrito e ritrovato. Una donazione ad un ente che si occupa di ricerca sulle malattie degenerative. Una tangente non accettata. Un divorzio che si conclude senza il ricorso al tribunale. Alla base di tutti questi eventi vi è la tendenza umana a cooperare, ad essere altruisti e ad

  1. Discovering Che-1/AATF: a new attractive target for cancer therapy

    Directory of Open Access Journals (Sweden)

    Simona eIezzi

    2015-04-01

    Full Text Available The transcriptional cofactor Che-1/AATF is currently emerging as an important component of the DNA damage response machinery, the complex signaling network that maintains genome integrity and prevents tumorigenesis. Moreover this protein is involved in a wide range of cellular pathways, regulating proliferation and survival in both physiological and pathological conditions. Notably, some evidence indicates that dysregulation of Che-1/AATF levels are associated with the transformation process and elevated levels of Che-1/AATF are required for tumor cell survival. It is for these reasons that Che-1/AATF has been regarded as an attractive, still theoretical, therapeutic target for cancer treatments. In this review, we will provide an updated overview of Che-1/AATF activities, from transcriptional regulation to DNA damage response.

  2. "A psychometric investigation of gender differences and common processes across borderline and antisocial personality disorders": Correction to Chun et al. (2017).

    Science.gov (United States)

    2017-07-01

    Reports an error in "A psychometric investigation of gender differences and common processes across borderline and antisocial personality disorders" by Seokjoon Chun, Alexa Harris, Margely Carrion, Elizabeth Rojas, Stephen Stark, Carl Lejuez, William V. Lechner and Marina A. Bornovalova ( Journal of Abnormal Psychology , 2017[Jan], Vol 126[1], 76-88). In the article, there were two errors in the article's supplemental material. The supplemental material stated, "In each case, if the relaxed model fit significantly better than the baseline model (i.e., Δ X ²> 3.84, Δ df =2), then the item under investigation was flagged as noninvariant; otherwise the item was marked as invariant." The value for Δ X ² should have been 5.99. The supplemental material also stated, "If there was no decrement in fit as a function of constraining a given item, the item in question was flagged as noninvariant." It should have stated that these items were flagged as invariant. The online version of this article has been corrected. (The following abstract of the original article appeared in record 2016-53090-001.) The comorbidity between borderline personality disorder (BPD) and antisocial personality disorder (ASPD) is well-established, and the 2 disorders share many similarities. However, there are also differences across disorders: most notably, BPD is diagnosed more frequently in women and ASPD in men. We investigated if (a) comorbidity between BPD and ASPD is attributable to 2 discrete disorders or the expression of common underlying processes, and (b) if the model of comorbidity is true across sex. Using a clinical sample of 1,400 drug users in residential substance abuse treatment, we tested 3 competing models to explore whether the comorbidity of ASPD and BPD should be represented by a single common factor, 2 correlated factors, or a bifactor structure involving a general and disorder-specific factors. Next, we tested whether our resulting model was meaningful by examining its

  3. His Excellency Professor Dr Che-Ho Wei, Chairman, National Science Council Executive Yuan, Republic of China

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.

  4. Los marcadores che y boludo: ¿un caso de rivalidad conversacional?

    Directory of Open Access Journals (Sweden)

    Markéta Šmídová

    2016-11-01

    Full Text Available It has been recently suggested that the Argentinian conversational marker che is being replaced by another typical expression, boludo. The purpose of the present paper is to provide a pilot comparative study of these two Argentinian markers in order to examine their free interchangeability and to refute it eventually. A commutation test has been used as a basic tool to compare the behavior and functions of che and boludo and the results have helped to reveal contexts in which it would be inadmissible or inappropriate to employ boludo instead of che due to the possible violation of politeness norms. In the article, che and boludo are considered mainly from the sociolinguistic and pragmatic approaches although some important cultural phenomena are discussed as well.

  5. I sei numeri dell'universo le forze profonde che spiegano il cosmo

    CERN Document Server

    Rees, Martin

    2002-01-01

    È possibile che sei semplici numeri, sei costanti universali, diano conto dell'infinita varietà e della stupefacente complessità del cosmo? L'astrofisico Martin Rees ci mostra che non soltano ciò è possibile, ma in quei sei numeri sono scritti la storia, la struttura e il futuro dell'universo, e che perfino la comparsa della vita sulla terra, e dunque la nostra stessa esistenza, non sarebbe concepibile se uno solo di quei valori numerici, definiti nell'istante che segnò la nascita del mondo, fosse differente. I sei numeri dell'universo ci introducono così ad alcune delle questioni più profonde su cui si interroga oggi la scienza.

  6. Award ceremony for the "Crèche and School" competition

    CERN Multimedia

    Staff Association

    2018-01-01

    Whenever there is a competition, there are obviously participants – and especially winners! The awards ceremony for the competition to find a new name for the CERN Staff Association's Crèche and School took place on 15 May. During the ceremony, jointly led by Céline Grobon (President of the Crèche and School Steering Committee), Carole Dargagnon (Headmistress of the Crèche and School) and Jean-Baptiste Zenner (Staff Association delegate), the proposals selected by the jury were rewarded. The first place went to Marie-Luz Cavagna for her proposal "Le jardin des petits chercheurs", and the second place to Sarah Palluel for her proposal "Le Jardin des Zélectrons". Finally, Aude Mourey and Sandra Fleury tied for third place with their respective proposals "Les petits atomes" and "La crèche des particules". Can we find the winning name of the competition among...

  7. MSL Chemistry and Mineralogy X-Ray Diffraction X-Ray Fluorescence (CheMin) Instrument

    Science.gov (United States)

    Zimmerman, Wayne; Blake, Dave; Harris, William; Morookian, John Michael; Randall, Dave; Reder, Leonard J.; Sarrazin, Phillipe

    2013-01-01

    This paper provides an overview of the Mars Science Laboratory (MSL) Chemistry and Mineralogy Xray Diffraction (XRD), X-ray Fluorescence (XRF) (CheMin) Instrument, an element of the landed Curiosity rover payload, which landed on Mars in August of 2012. The scientific goal of the MSL mission is to explore and quantitatively assess regions in Gale Crater as a potential habitat for life - past or present. The CheMin instrument will receive Martian rock and soil samples from the MSL Sample Acquisition/Sample Processing and Handling (SA/SPaH) system, and process it utilizing X-Ray spectroscopy methods to determine mineral composition. The Chemin instrument will analyze Martian soil and rocks to enable scientists to investigate geophysical processes occurring on Mars. The CheMin science objectives and proposed surface operations are described along with the CheMin hardware with an emphasis on the system engineering challenges associated with developing such a complex instrument.

  8. Che a 1: recombinant expression, purification and correspondence to the natural form.

    Science.gov (United States)

    Barderas, Rodrigo; Villalba, Mayte; Rodríguez, Rosalía

    2004-12-01

    Pollinosis to chenopods is one of the main causes of allergy in desertic regions and it is increasing in the South of Europe and Western USA. Che a 1 is a major allergen for chenopod-allergic subjects and belongs to the Ole-e-1-like family of proteins. Pichia pastoris yeast has been used as expression system to produce the recombinant form of Che a 1 (rChe a 1). The allergen was isolated using a gel permeation column and reverse-phase/high-performance liquid chromatography. Molecular characterization was performed using Edman degradation, mass spectrometry and concanavalin A staining. Sera from patients allergic to chenopod pollen, as well as polyclonal and monoclonal antibodies raised against Ole e 1, were used in immunoblotting, ELISA and inhibition assays for immunological characterization of rChe a 1. The allergen was purified to homogeneity with a final yield of 15 mg/l of cell culture and showed a glycosylated character. N-terminal amino acid sequence of rChe a 1 and molecular mass were according to those of the protein isolated from chenopod pollen. The recombinant allergen maintained the IgG and IgE epitopes of the natural allergen deduced from the immunological assays. Structural and in vitro immunological properties of rChe a 1 produced in P. pastoris were equivalent to those of the natural form of the allergen and, thus, it could be used in testing patients allergic to chenopods. 2004 S. Karger AG, Basel.

  9. Overexpression, purification, crystallization and preliminary X-ray analysis of CheY4 from Vibrio cholerae O395

    International Nuclear Information System (INIS)

    Biswas, Maitree; Khamrui, Susmita; Sen, Udayaditya; Dasgupta, Jhimli

    2011-01-01

    The chemotaxis response regulator CheY4 from V. cholerae has been cloned, overexpressed, purified and crystallized in monoclinic and hexagonal space groups; the crystals diffracted to 1.67 and 1.9 Å resolution, respectively. Chemotaxis and motility greatly influence the infectivity of Vibrio cholerae, although the role of chemotaxis genes in V. cholerae pathogenesis is poorly understood. In contrast to the single copy of CheY found in Escherichia coli and Salmonella typhimurium, four CheYs (CheY1–CheY4) are present in V. cholerae. While insertional disruption of the cheY4 gene results in decreased motility, insertional duplication of this gene increases motility and causes enhanced expression of the two major virulence genes. Additionally, cheY3/cheY4 influences the activation of the transcription factor NF-κB, which triggers the generation of acute inflammatory responses. V. cholerae CheY4 was cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY4 grown in space group C2 diffracted to 1.67 Å resolution, with unit-cell parameters a = 94.4, b = 31.9, c = 32.6 Å, β = 96.5°, whereas crystals grown in space group P3 2 21 diffracted to 1.9 Å resolution, with unit-cell parameters a = b = 56.104, c = 72.283 Å, γ = 120°

  10. The Azospirillum brasilense Che1 chemotaxis pathway controls swimming velocity, which affects transient cell-to-cell clumping.

    Science.gov (United States)

    Bible, Amber; Russell, Matthew H; Alexandre, Gladys

    2012-07-01

    The Che1 chemotaxis-like pathway of Azospirillum brasilense contributes to chemotaxis and aerotaxis, and it has also been found to contribute to regulating changes in cell surface adhesive properties that affect the propensity of cells to clump and to flocculate. The exact contribution of Che1 to the control of chemotaxis and flocculation in A. brasilense remains poorly understood. Here, we show that Che1 affects reversible cell-to-cell clumping, a cellular behavior in which motile cells transiently interact by adhering to one another at their nonflagellated poles before swimming apart. Clumping precedes and is required for flocculation, and both processes appear to be independently regulated. The phenotypes of a ΔaerC receptor mutant and of mutant strains lacking cheA1, cheY1, cheB1, or cheR1 (alone or in combination) or with che1 deleted show that Che1 directly mediates changes in the flagellar swimming velocity and that this behavior directly modulates the transient nature of clumping. Our results also suggest that an additional receptor(s) and signaling pathway(s) are implicated in mediating other Che1-independent changes in clumping identified in the present study. Transient clumping precedes the transition to stable clump formation, which involves the production of specific extracellular polysaccharides (EPS); however, production of these clumping-specific EPS is not directly controlled by Che1 activity. Che1-dependent clumping may antagonize motility and prevent chemotaxis, thereby maintaining cells in a metabolically favorable niche.

  11. A CheR/CheB fusion protein is involved in cyst cell development and chemotaxis in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Wu, Lixian; Cui, Yanhua; Hong, Yuanyuan; Chen, Sanfeng

    2011-12-20

    We here report the sequence and functional analysis of cstB of Azospirillum brasilense Sp7. The predicted cstB contains C-terminal two PAS domains and N-terminal part which has similarity with CheB-CheR fusion protein. cstB mutants had reduced swarming ability compared to that of A. brasilense wild-type strain, implying that cstB was involved in chemotaxis in A. brasilense. A microscopic analysis revealed that cstB mutants developed mature cyst cells more quickly than wild type, indicating that cstB is involved in cyst formation. cstB mutants were affected in colony morphology and the production of exopolysaccharides (EPS) which are essential for A. brasilense cells to differentiate into cyst-like forms. These observations suggested that cstB was a multi-effector involved in cyst development and chemotaxis in A. brasilense. Copyright © 2010 Elsevier GmbH. All rights reserved.

  12. Il lungo freddo storia di Bruno Pontecorvo, lo scienziato che scelse l'URSS

    CERN Document Server

    Mafai, Miriam

    2012-01-01

    Nelle parole della grande giornalista recentemente scomparsa, la documentata narrazione della storia di Bruno Pontecorvo, fisico nucleare di fama mondiale che, nel pieno della Guerra fredda, scelse di abbandonare l'Occidente e di lavorare e vivere nell'Unione Sovietica. Grazie alla capacità della Mafai nel ricostruire gli eventi cruciali della vita di Pontecorvo in un nuovo quadro rivelatore, "Il lungo freddo" non offre solo un'inedita prospettiva sulla drammatica corsa alla bomba atomica - dalle decisive scoperte del Progetto Manhattan alla tragica esplosione di Hiroshima, dalla prima atomica sovietica alla bomba all'idrogeno - ma rappresenta soprattutto la memoria collettiva di una generazione che ha posto la politica al centro delle proprie scelte di vita. E svela i drammi umani di un conflitto che per più di quarant'anni ha diviso il mondo.

  13. The new Meyrin crèche takes its first steps

    CERN Multimedia

    2008-01-01

    The new Meyrin crèche was inaugurated on 10 October and already caters for 16 children of CERN personnel. Copyright: Laurent Barlier. Copyright: Robert Tillmann. At the end of August, the new Meyrin crèche in Champs-Fréchets, the Espace de Vie Enfantine (EVE), welcomed its first intake of infants. They included 16 children of members of the CERN personnel who are benefiting from the agreement signed in 2007 with the commune of Meyrin (see Bulletin n°43&44/2007). The crèche was officially inaugurated on 10 October with several CERN representatives in attendance, including HR Department Head, Enrico Chiaveri, and Head of the Relations with the Host States Service, Friedmann Eder. The following day, EVE held an open day for the inhabitants of Meyrin and interested members of the CERN personnel. The new 1516 m2 building ‘s spaces have very clean and ...

  14. Storie ‘vere’ ed eroine dei romanzi. Rappresentare la Somalia in 'Ilaria Alpi. La ragazza che voleva raccontare l’inferno' e 'Non dirmi che hai paura'

    Directory of Open Access Journals (Sweden)

    Simone Brioni

    2016-09-01

    Full Text Available ‘True’ Stories and Heroines in Novels: The Representation of Somalia in Ilaria Alpi: The Young Woman Who Wanted to Narrate Hell and Don’t Tell Me You Are AfraidThis article analyses Gigliola Alvisi’s Ilaria Alpi: La ragazza che voleva raccontare l’inferno [Ilaria Alpi: The Young Woman Who Wanted to Narrate the Hell] (2014 and Giuseppe Catozzella’s Non dirmi che hai paura [Don’t Tell Me You Are Afraid] (2014, two novels that deal with two recent events in Somali and Italian history, the killing of the journalist Ilaria Alpi in Mogadishu in 1994 and the death of Samia Yosuf Omar while she was trying to reach the Italian shores from Libya by boat. Alvisi’s text is analysed in comparison with other fictional and journalistic representations of Ilaria Alpi, while Non dirmi che hai paura is examined through what Catozzella considers the two constitutive dimensions of the novel: documentation and identification. Drawing on Stefano Jossa’s reflections on the construction of literary heroes, the article challenges Alvisi’s and Catozzella’s claims that they represent ‘true stories’. The article also argues that the main characters of these literary works are portrayed as heroines and role models for the emancipation of Muslim women.

  15. Crèche and School: Open Day on Saturday, 3 March

    CERN Multimedia

    EVE et École

    2018-01-01

    Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesday 28 February 2018: https://doodle.com/poll/3qvrb6m73pktqbft

  16. Il fantasma dell'universo che cos'è il neutrino

    CERN Document Server

    Votano, Lucia

    2015-01-01

    Ben prima della luce, a un decimillesimo di secondo dal Big Bang, i neutrini sono apparsi nell'universo. Dopo un secondo il brodo primordiale si era raffreddato abbastanza da consentire loro di muoversi liberi e ancora oggi, dopo quasi quattordici miliardi di anni, sono numerosissimi. Ma che cosa sono i neutrini? Elusivi come fantasmi, camaleontici, viaggiano indenni attraverso la materia arrivando dritti sino a noi dagli angoli più remoti e nascosti dell'universo. Per saperne di più seguiremo i fisici che li studiano in laboratori sotterranei o in luoghi estremi come i ghiacciai polari o le profondità marine.

  17. A crèche for CERN staff The Staff Association project

    CERN Multimedia

    Association du personnel

    2006-01-01

    For many years, the Staff Association has supported the demand for the creation of a crèche for the children of CERN staff. Several studies have been carried out without leading to a concrete plan. The fact that the CERN population is getting younger and the shortage of local facilities have led to a more urgent demand for this type of social service over the past few years. Furthermore, the Equal Opportunities Panel had already recommended that crèche places be made available.

  18. Micose fungóide: estudo epidemiológico de 17 casos e avaliação da resposta terapêutica à PUVA Mycosis fungoides: epidemiologic study of 17 cases and evaluation of PUVA photochemotherapy

    Directory of Open Access Journals (Sweden)

    Ida Duarte

    2006-02-01

    Full Text Available FUNDAMENTOS: A fotoquimioterapia com PUVA é indicada para tratamento da micose fungóide, empregada como monoterapia em estágios precoces ou combinada a outras drogas nos estágios mais avançados da doença. OBJETIVOS: Avaliação da resposta terapêutica à fotoquimioterapia PUVA em pacientes com micose fungóide. MÉTODOS: Entre janeiro de 1996 e novembro de 2003 avaliaram-se 17 pacientes com micose fungóide no setor de Fototerapia da Clínica Dermatológica da Santa Casa de São Paulo. A terapia com PUVA foi realizada como monoterapia nos estádios iniciais ou como coadjuvante nos estádios avançados da doença. Avaliou-se o resultado do tratamento quanto ao aspecto clínico das lesões e parâmetros histológicos após tratamento. RESULTADOS: Quatorze de 16 pacientes responderam à fotoquimioterapia. Relacionando o estadiamento da doença à resposta terapêutica obteve-se o seguinte: cinco pacientes (um em estágio IA e quatro em IB com controle total (cura das lesões; quatro (todos IB com melhora intensa (controle de 70-99%; dois (IIB e IVA com melhora moderada (de 50 a 69%; três (IA, IB, IIA com melhora discreta (menos 50%; dois (IB, IIB inalterados (sem resposta. Um paciente teve de descontinuar o tratamento por apresentar intenso ardor. CONCLUSÃO: Houve resposta à terapia PUVA em 87% dos pacientes, com controle total ou melhora intensa da doença em 56% dos casos. Sua efetividade permitiu regressão das lesões cutâneas, principalmente nos casos precoces. A fotoquimioterapia com PUVA mostrou ser tratamento seguro e efetivo, devendo ser considerado em pacientes com micose fungóide.BACKGROUND: PUVA photochemotherapy is indicated to treat mycosis fungoides, either as monotherapy in the earlier stages of the disease or in combination with other drugs in more advanced stages of evolution. OBJECTIVES: To evaluate PUVA photochemotherapy response in patients with mycosis fungoides. METHODS: From January 1996 to November 2003, 17

  19. Demonstrating the Open Data Repository's Data Publisher: The CheMin Database

    Science.gov (United States)

    Stone, N.; Lafuente, B.; Bristow, T.; Pires, A.; Keller, R. M.; Downs, R. T.; Blake, D.; Dateo, C. E.; Fonda, M.

    2018-04-01

    The Open Data Repository's Data Publisher aims to provide an easy-to-use software tool that will allow researchers to create and publish database templates and related data. The CheMin Database developed using this framework is shown as an example.

  20. Trent'anni che sconvolsero la fisica la storia della teoria dei quanti

    CERN Document Server

    Gamow, George

    1993-01-01

    Gli anni dal 1900 al 1930 hanno portato un profondo mutamento nella visione che l'uomo aveva dell'universo: tra la prima idea di Max Planck dei quanti di luce nel 1900, e la previsione dell'esistenza delle antiparticelle formulata da P. A. M. Dirac nel 1929, corre un periodo di emozionanti progressi nel campo della fisica teorica.

  1. Reading Strategies: Issues in the Computerization of Machiavelli's "Il demonio che prese moglie".

    Science.gov (United States)

    Morgan, Leslie Zarker

    1994-01-01

    The ideal computer-based foreign language reading program must include cognitive background, a learning taxonomy, sound computer design, and knowledge of what is needed for the specific language. Machiavelli's "Il demonia che prese moglie" is chosen for study due to its historical interest. (63 references) (CK)

  2. Inwentarz fary chełmińskiej i jej biblioteki z XV wieku

    Directory of Open Access Journals (Sweden)

    Mateusz Superczyński

    2017-07-01

    Full Text Available Artykuł niniejszy prezentuje edycję nieznanego szerzej dotychczas inwentarza fary chełmińskiej i wykazu księgozbioru biblioteki farnej z XV w., które znajdują się w księdze miejskiej Chełmna – kopiariuszu przywilejów i dokumentów, założonej przez pisarza Konrada Bitschina w 1431 r. Przekaz źródłowy daje obraz biblioteki fary chełmińskiej jako ośrodka kultury w XV-wiecznym Chełmnie. Pozwala także na porównanie trzech zachowanych spisów księgozbiorów średniowiecznego Chełmna, a więc z klasztoru Franciszkanów z XIII wieku, biblioteki farnej i zrekonstruowanego spisu biblioteki Braci Wspólnego Życia z końca XV stulecia, które pochodzą z różnych okresów i odzwierciedlają przemiany w duchowości, teologii i zainteresowaniach naukowych ówczesnych elit intelektualnych miasta. Podczas gdy księgozbiory biblioteki franciszkanów czy farnej oddają ducha średniowiecznej scholastyki czy nominalizmu, to wydania, które posiadali Bracia Wspólnego Życia, zwiastują nadejście humanizmu. Odnotowane przez pisarza miejskiego tytuły, mimo zniekształceń,pozwalają także na identyfikację i odnalezienie wśród nich fundamentalnych dla średniowiecznej teologii, liturgii, historii i filozofii dzieł.

  3. The Emotional Communication in Hearing Questionnaire (EMO-CHeQ): Development and Evaluation.

    Science.gov (United States)

    Singh, Gurjit; Liskovoi, Lisa; Launer, Stefan; Russo, Frank

    2018-06-11

    The objectives of this research were to develop and evaluate a self-report questionnaire (the Emotional Communication in Hearing Questionnaire or EMO-CHeQ) designed to assess experiences of hearing and handicap when listening to signals that contain vocal emotion information. Study 1 involved internet-based administration of a 42-item version of the EMO-CHeQ to 586 adult participants (243 with self-reported normal hearing [NH], 193 with self-reported hearing impairment but no reported use of hearing aids [HI], and 150 with self-reported hearing impairment and use of hearing aids [HA]). To better understand the factor structure of the EMO-CHeQ and eliminate redundant items, an exploratory factor analysis was conducted. Study 2 involved laboratory-based administration of a 16-item version of the EMO-CHeQ to 32 adult participants (12 normal hearing/near normal hearing (NH/nNH), 10 HI, and 10 HA). In addition, participants completed an emotion-identification task under audio and audiovisual conditions. In study 1, the exploratory factor analysis yielded an interpretable solution with four factors emerging that explained a total of 66.3% of the variance in performance the EMO-CHeQ. Item deletion resulted in construction of the 16-item EMO-CHeQ. In study 1, both the HI and HA group reported greater vocal emotion communication handicap on the EMO-CHeQ than on the NH group, but differences in handicap were not observed between the HI and HA group. In study 2, the same pattern of reported handicap was observed in individuals with audiometrically verified hearing as was found in study 1. On the emotion-identification task, no group differences in performance were observed in the audiovisual condition, but group differences were observed in the audio alone condition. Although the HI and HA group exhibited similar emotion-identification performance, both groups performed worse than the NH/nNH group, thus suggesting the presence of behavioral deficits that parallel self

  4. A cheZ-Like Gene in Azorhizobium caulinodans Is a Key Gene in the Control of Chemotaxis and Colonization of the Host Plant.

    Science.gov (United States)

    Liu, Xiaolin; Liu, Wei; Sun, Yu; Xia, Chunlei; Elmerich, Claudine; Xie, Zhihong

    2018-02-01

    Chemotaxis can provide bacteria with competitive advantages for survival in complex environments. The CheZ chemotaxis protein is a phosphatase, affecting the flagellar motor in Escherichia coli by dephosphorylating the response regulator phosphorylated CheY protein (CheY∼P) responsible for clockwise rotation. A cheZ gene has been found in Azorhizobium caulinodans ORS571, in contrast to other rhizobial species studied so far. The CheZ protein in strain ORS571 has a conserved motif similar to that corresponding to the phosphatase active site in E. coli The construction of a cheZ deletion mutant strain and of cheZ mutant strains carrying a mutation in residues of the putative phosphatase active site showed that strain ORS571 participates in chemotaxis and motility, causing a hyperreversal behavior. In addition, the properties of the cheZ deletion mutant revealed that ORS571 CheZ is involved in other physiological processes, since it displayed increased flocculation, biofilm formation, exopolysaccharide (EPS) production, and host root colonization. In particular, it was observed that the expression of several exp genes, involved in EPS synthesis, was upregulated in the cheZ mutant compared to that in the wild type, suggesting that CheZ negatively controls exp gene expression through an unknown mechanism. It is proposed that CheZ influences the Azorhizobium -plant association by negatively regulating early colonization via the regulation of EPS production. This report established that CheZ in A. caulinodans plays roles in chemotaxis and the symbiotic association with the host plant. IMPORTANCE Chemotaxis allows bacteria to swim toward plant roots and is beneficial to the establishment of various plant-microbe associations. The level of CheY phosphorylation (CheY∼P) is central to the chemotaxis signal transduction. The mechanism of the signal termination of CheY∼P remains poorly characterized among Alphaproteobacteria , except for Sinorhizobium meliloti , which

  5. Open Day at Crèche and School of the CERN Staff Association

    CERN Multimedia

    Staff Association

    2018-01-01

    In the morning of Saturday, 3 March 2018, the Crèche and School of the CERN Staff Association opened its doors for parents who wished to visit the establishment. Once again, the Open Day was a great success and brought together more than 50 families for two information sessions, which included: a general presentation of the establishment by the Headmistress, and a visit of the facilities led by the Headmistress and her deputy. At the end of the visit, parents were invited for a drink. This was an opportunity for both parents and professionals to have interesting discussions regarding the general conditions of the establishment and the pedagogical approach applied in the crèche and the school. The management team was delighted to offer the parents the opportunity to participate in this event, where everyone could express their views, ask questions and find answers in a friendly and relaxed atmosphere.

  6. Sulle ipotesi che stanno alla base della geometria e altri scritti scientifici e filosofici

    CERN Document Server

    Riemann, Bernhard

    1994-01-01

    Il volume raccoglie, oltre al testo della lezione del 1854 che dà il titolo all'opera, alcuni scritti di carattere scientifico e filosofico di Riemann. A saggi di argomento scientifico si affiancano scritti di argomento più direttamente metodologico. La concezione della scienza che ci viene offerta da questi scritti è assai significativa del personaggio e della sua epoca. Per Riemann la matematica non è un mero strumento esteriore da applicare, appunto dall'esterno, ai fenomeni. Al contrario, essa consente di spingersi con il rigore necessario oltre alla superficie dei fenomeni e di penetrare sempre più a fondo nella realtà, nell'ottica di un sistema unitario e quasi metafisico del sapere scientifico.

  7. Il museo che non c’è. Note sulla dispersione del patrimonio in Gran Bretagna

    Directory of Open Access Journals (Sweden)

    Caroline Patey

    2011-03-01

    Full Text Available Indifferente alla loro recente moltiplicazione come al sodalizio che vi si celebra con l’architettura di grido, un fantasma si aggira per i musei. Sordo al nome di Jean Nouvel (Reina Sofia, Louvre quanto a quelli di Herzog & De Meuron (Tate Modern, impermeabile ai fasti del British Museum (Norman Foster come ai restauri della Tate Britain (James Stirling, disinteressato alle fortune del ‘nuovo’ Victoria and Albert Museum e malinconico come si addice alla sua natura, il fantasma invita a interrogare tanta luccicante spettacolarità e forse a non dimenticare che, per quanto custode di memoria e guardiano di culture, il museo è anche il luogo dove vengono consumate, direttamente o meno, amnesie e damnatio memoriae e in nome del quale continuano a perpetrarsi non poche violazioni e disseminazioni.

  8. Site-specific and synergistic stimulation of methylation on the bacterial chemotaxis receptor Tsr by serine and CheW

    Directory of Open Access Journals (Sweden)

    Weis Robert M

    2005-03-01

    Full Text Available Abstract Background Specific glutamates in the methyl-accepting chemotaxis proteins (MCPs of Escherichia coli are modified during sensory adaptation. Attractants that bind to MCPs are known to increase the rate of receptor modification, as with serine and the serine receptor (Tsr, which contributes to an increase in the steady-state (adapted methylation level. However, MCPs form ternary complexes with two cytoplasmic signaling proteins, the kinase (CheA and an adaptor protein (CheW, but their influences on receptor methylation are unknown. Here, the influence of CheW on the rate of Tsr methylation has been studied to identify contributions to the process of adaptation. Results Methyl group incorporation was measured in a series of membrane samples in which the Tsr molecules were engineered to have one available methyl-accepting glutamate residue (297, 304, 311 or 493. The relative rates at these sites (0.14, 0.05, 0.05 and 1, respectively differed from those found previously for the aspartate receptor (Tar, which was in part due to sequence differences between Tar and Tsr near site four. The addition of CheW generated unexpectedly large and site-specific rate increases, equal to or larger than the increases produced by serine. The increases produced by serine and CheW (added separately were the largest at site one, ~3 and 6-fold, respectively, and the least at site four, no change and ~2-fold, respectively. The rate increases were even larger when serine and CheW were added together, larger than the sums of the increases produced by serine and CheW added separately (except site four. This resulted in substantially larger serine-stimulated increases when CheW was present. Also, CheW enhanced methylation rates when either two or all four sites were available. Conclusion The increase in the rate of receptor methylation upon CheW binding contributes significantly to the ligand specificity and kinetics of sensory adaptation. The synergistic effect of

  9. LA LINGUA FILMATA: "L'UOMO CHE VERRÀ" DI GIORGIO DIRITTI

    Directory of Open Access Journals (Sweden)

    Marta Idini

    2016-02-01

    Full Text Available La lingua filmata appare oggi uno dei campi linguistici in cui il dialetto torna ad essere scelta registica e veicolo di nuove istanze comunicative, in stretta relazione con un nuovo modo di intendere e praticare il cinema. Il presente articolo introduce il lettore alla consuetudine cinematografica del dialetto, analizzandone la presenza e le funzioni che gli sono state attribuite nei decenni trascorsi e presenti, e guarda a L’Uomo che verrà quale espressione attuale di una nuova risorgenza dialettale all’interno delle pellicole nostrane. Attraverso un’analisi attenta dei fenomeni vernacolari in esso presenti, l’indagine si sofferma sulle motivazioni e l’efficacia comunicativa cui perviene l’uso del dialetto e si interroga su quale grado di realismo o mimesi linguistica Diritti abbia raggiunto. Language of film: "L’uomo che verrà" by Giorgio DirittiLanguage in films is one of the fields where dialect becomes a choice and a vehicle for new communicative demands, closely related the new way of understanding and practicing the cinema. This article introduces the reader to the use of dialect in films, analyzing the presence and functions that have been attributed to it in the past and present decades, and looks at L’Uomo che verrà as an expression of the new resurgence of dialect in Italian films. Through careful analysis of the vernacular, the paper focuses on the motivations and the communicative effectiveness of the use of dialect and questions the degree of realism or linguistic mimesis that Diritti was able to reach.

  10. CheShift-2 resolves a local inconsistency between two X-ray crystal structures

    International Nuclear Information System (INIS)

    Vila, Jorge A.; Sue, Shih-Che; Fraser, James S.; Scheraga, Harold A.; Dyson, H. Jane

    2012-01-01

    Since chemical shifts provide important and relatively accessible information about protein structure in solution, a Web server, CheShift-2, was developed for structure interrogation, based on a quantum mechanics database of 13 C α chemical shifts. We report the application of CheShift-2 to a local inconsistency between two X-ray crystal structures (PDB IDs 1IKN and 1NFI) of the complex between the p65/p50 heterodimer of NFκB and its inhibitor IκBα. The availability of NMR resonance assignments that included the region of the inconsistency provided an opportunity for independent validation of the CheShift-2 server. Application of the server showed that the 13 C α chemical shifts measured for the Gly270-Pro281 sequence close to the C-terminus of IκBα were unequivocally consistent with the backbone structure modeled in the 1IKN structure, and were inconsistent with the 1NFI structure. Previous NOE measurements had demonstrated that the position of a tryptophan ring in the region immediately N-terminal in this region was not consistent with either structure. Subsequent recalculation of the local structure in this region, based on the electron density of the deposited structure factors for 1IKN, confirmed that the local backbone structure was best modeled by 1IKN, but that the rotamer of Trp258 is consistent with the 1NFI structure, including the presence of a hydrogen bond between the ring NεH of Trp258 and the backbone carbonyl group of Gln278. The consensus between all of these measures suggests that the CheShift-2 server operates well under circumstances in which backbone chemical shifts are available but where local plasticity may render X-ray structural data ambiguous.

  11. Report to EuCheMS Division of Analytical Chemistry on CITAC Activity

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Wegsheider, Wolfhard

    Although the CITAC organisation [1] was founded on traceability, it embraces a variety of concepts allocated specifically to quality assurance. Collaboration with other organisations that promote practices and procedures of quality assurance is essential, and appointed liaison persons...... are encouraged to support this effort. In continuation of this aim a close contact to EuCheMS is desired together with contacts to IUPAC, ISO/REMCO, BIPM/CCQM, ILAC, EA, APLAC, EUROMET, SIM, APMP, AOACI, IAEA, IFCC and SADCMET....

  12. La macchina che cerca Dio. Nasce LHC forse scoprira' Higgs elusiva particella della creazione

    CERN Multimedia

    Bianucci, P

    2003-01-01

    "LEON Lederman, premio Nobel per la fisica, l'ha misticamente definita la particella di Dio perche' sarebbe il pilastro sul quale si appoggia tutta la materia dell'universo che conosciamo. Piu' tecnicamente, e' la "particella di Higgs", un bosone previsto dal Modello Standard del microcosmo la cui esistenza sarebbe necessaria per giustificare, anche quantitativamente, la massa di tutte le particelle" (1/2 page).

  13. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  14. X-Ray Diffraction on Mars: Scientific Discoveries Made by the CheMin Instrument

    Science.gov (United States)

    Rampe, E. B.; Blake, D. F.; Ming, D. W.; Bristow, T. F.

    2017-01-01

    The Mars Science Laboratory Curiosity landed in Gale crater in August 2012 with the goal to identify and characterize habitable environments on Mars. Curiosity has been studying a series of sedimentary rocks primarily deposited in fluviolacustrine environments approximately 3.5 Ga. Minerals in the rocks and soils on Mars can help place further constraints on these ancient aqueous environments, including pH, salinity, and relative duration of liquid water. The Chemistry and Mineralogy (CheMin) X-ray diffraction and X-ray fluorescence instrument on Curiosity uses a Co X-ray source and charge-coupled device detector in transmission geometry to collect 2D Debye-Scherrer ring patterns of the less than 150 micron size fraction of drilled rock powders or scooped sediments. With an angular range of approximately 2.52deg 20 and a 20 resolution of approximately 0.3deg, mineral abundances can be quantified with a detection limit of approximately 1-2 wt. %. CheMin has returned quantitative mineral abundances from 16 mudstone, sandstone, and aeolian sand samples so far. The mineralogy of these samples is incredibly diverse, suggesting a variety of depositional and diagenetic environments and different source regions for the sediments. Results from CheMin have been essential for reconstructing the geologic history of Gale crater and addressing the question of habitability on ancient Mars.

  15. Pretreatment with P-Nitrophenyl Phosphoramides: Spontaneous Reactivation of Blood ChE after Oral Administration to Guinea Pigs

    National Research Council Canada - National Science Library

    Polhuijs, M

    1997-01-01

    ... and of the reference compounds pyridostigmine and physostigmine has been studied in the guinea pig, as determined by measuring spontaneous reactivation of blood ChE inhibited by these pretreatment compounds...

  16. Distinct Domains of CheA Confer Unique Functions in Chemotaxis and Cell Length in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Gullett, Jessica M; Bible, Amber; Alexandre, Gladys

    2017-07-01

    Chemotaxis is the movement of cells in response to gradients of diverse chemical cues. Motile bacteria utilize a conserved chemotaxis signal transduction system to bias their motility and navigate through a gradient. A central regulator of chemotaxis is the histidine kinase CheA. This cytoplasmic protein interacts with membrane-bound receptors, which assemble into large polar arrays, to propagate the signal. In the alphaproteobacterium Azospirillum brasilense , Che1 controls transient increases in swimming speed during chemotaxis, but it also biases the cell length at division. However, the exact underlying molecular mechanisms for Che1-dependent control of multiple cellular behaviors are not known. Here, we identify specific domains of the CheA1 histidine kinase implicated in modulating each of these functions. We show that CheA1 is produced in two isoforms: a membrane-anchored isoform produced as a fusion with a conserved seven-transmembrane domain of unknown function (TMX) at the N terminus and a soluble isoform similar to prototypical CheA. Site-directed and deletion mutagenesis combined with behavioral assays confirm the role of CheA1 in chemotaxis and implicate the TMX domain in mediating changes in cell length. Fluorescence microscopy further reveals that the membrane-anchored isoform is distributed around the cell surface while the soluble isoform localizes at the cell poles. Together, the data provide a mechanism for the role of Che1 in controlling multiple unrelated cellular behaviors via acquisition of a new domain in CheA1 and production of distinct functional isoforms. IMPORTANCE Chemotaxis provides a significant competitive advantage to bacteria in the environment, and this function has been transferred laterally multiple times, with evidence of functional divergence in different genomic contexts. The molecular principles that underlie functional diversification of chemotaxis in various genomic contexts are unknown. Here, we provide a molecular

  17. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  18. Crew Health Care System (CHeCS) Design Research, Documentations, and Evaluations

    Science.gov (United States)

    CLement, Bethany M.

    2011-01-01

    The Crew Health Care System (CHeCS) is a group within the Space Life Science Directorate (SLSD) that focuses on the overall health of astronauts by reinforcing the three divisions - the Environmental Maintenance System (EMS), the Countermeasures System (CMS), and the Health Maintenance System (HMS). This internship provided opportunity to gain knowledge, experience, and skills in CHeCS engineering and operations tasks. Various and differing tasks allowed for occasions to work independently, network to get things done, and show leadership abilities. Specific exercises included reviewing hardware certification, operations, and documentation within the ongoing Med Kit Redesign (MKR) project, and learning, writing, and working various common pieces of paperwork used in the engineering and design process. Another project focused on the distribution of various pieces of hardware to off-site research facilities with an interest in space flight health care. The main focus of this internship, though, was on a broad and encompassing understanding of the engineering process as time was spent looking at each individual step in a variety of settings and tasks.

  19. Finally a crèche at CERN, thanks to the Staff Association

    CERN Multimedia

    Staff Association

    2013-01-01

    Setting up at CERN a collective structure to mind children younger than two years, a so-called “crèche”, has been discussed at least since the early 1990s. Then, in February 2001, the Equal Opportunities Advisory Panel produced a memo to the Director of Administration in which it “invites the CERN Management to re-consider the possibility of creating a crèche at CERN”. As a result an ad hoc task force (“Bethléem”) was set up, which based its work on an informal questionnaire sent to CERN families with small children. Its study came up with some relevant parameters for “should CERN Management intend to undertake a minimal effort toward solving the crèche problem for its staff members”. Nothing was undertaken at that time. In the framework of the 2005 five yearly review “Working Group 6: Crèche” made another study of public and private  cr&a...

  20. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    Directory of Open Access Journals (Sweden)

    Susy Bigontina

    2012-01-01

    Full Text Available Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Betlemme nella notte di Natale, che mescola icone della tradizione italiana della Natività – alcuni pezzi, ad esempio, sono preziosi manufatti di scuola napoletana – ed elementi naturali tipici della terra delle gravine. Il presepe del Rosario, inoltre, mostra un’interessante ricerca dell’effetto prospettico e forse un ancor più interessante cornice di ciclicità, ottenuta tramite l’alternanza del giorno e della notte, musica ed effetti sonori, che proietta la scena verso un orizzonte atemporale. Questo articolo nasce dalla visita degli autori a Mottola, in occasione della presentazione del libro La Settimana Santa a Mottola, di cui essi sono stati co-autori, e quindi rappresenta il frutto di un nuovo capitolo di lavoro con la viva comunità mottolese ed i suoi riti. Abstract – FR Pour l'occasion de Noël, les rues de la villes de Mottola (Ta, Italie sont embellies de crèches que les visiteurs peuvent admirer en toute liberté. La tradition de la crèche est une tradition très ressentie par les habitants de la petite ville pugliaise, dans laquelle on prépare une grande crèche qui occupe et cache tout le nef de l'église du très Ss. Sacramento e Rosario. Les préparateurs qui appartiennent à une Confrérie historique locale dédient plusieurs semaines pour la construction d'une crèche comme celle de Betleemme de la nuit de Noël - certaines pièces, par exemple, sont de précieux produits manufacturés provenant de l'école napolitaine - et

  1. Tempi che cambiano, luoghi che si trasformano: i mutamenti nei nuraghi fra l’età del Bronzo ed il Primo Ferro

    Directory of Open Access Journals (Sweden)

    Mauro Perra

    2017-01-01

    Full Text Available Riassunto: Il lungo percorso della Civiltà Nuragica, compreso fra XVII e X-IX secolo a.C., si caratterizza come un’epoca di grandi trasformazioni che si susseguono nel tempo e lasciano visibili tracce in un paesaggio mutevole, come in un succedersi di macroscopiche unità stratigrafiche. Si trasformano profondamente così non solo i monumenti ed il paesaggio, ma anche le stesse strutture sociali e politiche delle comunità nuragiche fino alla trasfigurazione del ricordo in mito nei centri cerimoniali o santuari. Abstract: The long trajectory of the Nuragic civilisation (17th - 10th/9th centuries B.C. is characterised by a succession of dramatic changes leaving visible traces in a varying landscape, like stratigraphy on a regional scale. These changes affect not only the Nuragic monuments and landscape but also the social and political institutions of Nuragic communities, culminating in a transfiguration of memory and a new mythology apparent in ceremonial centres and sanctuaries.

  2. Serum cholinesterase polymorphism (CHE1 and CHE2 loci) among several Indian groups from Amazon region of Brazil, and segregation of the C5 variant in families.

    Science.gov (United States)

    Guerreiro, J F; Santos, S E; Aguiar, G F

    1989-04-01

    Eight Indian tribes from the Amazon region of Brazil (Araweté, Arara, Yamamadi, Kararaô, Karitiana, Waiampi, Surui and Cinta Larga) were studied for the distribution of the atypical and C5 variants of serum cholinesterase. None of them presented the CHE1*A allele, but the C5 variant was found in the Araweté (20.4%), Kararaô (15.6%), Karitiana (50.5%), Surui (12.3%) and Cinta Larga (19.6%) tribes. The frequency of the C5+ phenotype in the Karitiana is the highest reported thus far in human populations. Segregation studies considering the C5 variant were made among the Karitiana, and also among the Urubu-Kaapor and Munduruku tribes previously studied by Guerreiro et al [1987a, 1987b]. Most of the data were in agreement with the genetic hypothesis, but they also revealed a significant lack of the C5+ phenotype in offspring from C5+ X C5+ matings, as well as the occurrence of two C5+ children from C5- X C5- unions, in the Urubu-Kaapor tribe.

  3. The new "Jardin de Capucine" crèche brings a breath of fresh air for young CERN parents

    CERN Multimedia

    HR Department

    2011-01-01

    On 19 January 2011, CERN's Director-General, Rolf Heuer, signed an agreement with the company "Le Jardin de Zébulon" for the provision of 40 places at the "Jardin de Capucine", a new private crèche due to open this autumn.   In 2008, the "Jardin de Zébulon", a private bilingual crèche for children aged 1 to 4, was opened by Ariane Boucheron at the Technoparc industrial estate in Saint-Genis Pouilly (France). The following year, the number of places was increased from 20 to 37 to meet demand. The "Jardin de Zébulon" has taken in a number of children of CERN personnel ever since it was created. With no let-up in the demand for new crèche places, Ariane Boucher is currently engaged in the construction of a new centre, the "Jardin de Capucine", next-door to the existing crèche. Forty places at the new crèche will...

  4. Data from the Mars Science Laboratory CheMin XRD/XRF Instrument

    Science.gov (United States)

    Vaniman, David; Blake, David; Bristow, Tom; DesMarais, David; Achilles, Cherie; Anderson, Robert; Crips, Joy; Morookian, John Michael; Spanovich, Nicole; Vasavada, Ashwin; hide

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity uses a Co tube source and a CCD detector to acquire mineralogy from diffracted primary X-rays and chemical information from fluoresced X-rays. CheMin has been operating at the MSL Gale Crater field site since August 5, 2012 and has provided the first X-ray diffraction (XRD) analyses in situ on a body beyond Earth. Data from the first sample collected, the Rocknest eolian soil, identify a basaltic mineral suite, predominantly plagioclase (approx.An50), forsteritic olivine (approx.Fo58), augite and pigeonite, consistent with expectation that detrital grains on Mars would reflect widespread basaltic sources. Minor phases (each XRD. This amorphous component is attested to by a broad rise in background centered at approx.27deg 2(theta) (Co K(alpha)) and may include volcanic glass, impact glass, and poorly crystalline phases including iron oxyhydroxides; a rise at lower 2(theta) may indicate allophane or hisingerite. Constraints from phase chemistry of the crystalline components, compared with a Rocknest bulk composition from the APXS instrument on Curiosity, indicate that in sum the amorphous or poorly crystalline components are relatively Si, Al, Mg-poor and enriched in Ti, Cr, Fe, K, P, S, and Cl. All of the identified crystalline phases are volatile-free; H2O, SO2 and CO2 volatile releases from a split of this sample analyzed by the SAM instrument on Curiosity are associated with the amorphous or poorly ordered materials. The Rocknest eolian soil may be a mixture of local detritus, mostly crystalline, with a regional or global set of dominantly amorphous or poorly ordered components. The Rocknest sample was targeted by MSL for "first time analysis" to demonstrate that a loose deposit could be scooped, sieved to <150 microns, and delivered to instruments in the body of the rover. A drilled sample of sediment in outcrop is anticipated. At the time of writing this abstract, promising outcrops are

  5. Astrobiological Significance of Definitive Mineralogical Analysis of Martian Surface Samples Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Feldman, S. M.; Blake, D. F.; Sarrazin, P.; Bish, D. L.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    The search for evidence of habitability, or of extant or extinct life on Mars, will initially be a search for evidence of past or present conditions supportive of life. The three key requirements for the emergence of life are thought to be liquid water; a suitable energy source; and chemical building blocks. CheMin is a miniaturized XRD/XRF (X-Ray diffraction / X-ray fluorescence) instrument which has been developed for definitive mineralogic analysis of soils and rocks on the Martian surface. The CheMin instrument can provide information that is highly relevant to each of these habitability requirements as summarized below.

  6. Fractional derivatives. An introduction; Derivate frazionarie. Che cosa sono, a cosa servono

    Energy Technology Data Exchange (ETDEWEB)

    Dattoli, G. [ENEA, Div. Fisica Applicata, Centro Ricerche Frascati, Rome (Italy)

    2001-07-01

    In this item is presented a brief survey of fractional calculus and of the relevant applications. In the work are discussed different points of view of the operation of fractional derivative and present a unifying definition. The role played by fractional derivatives and integrals within the framework of integral transform is analyzed. [Italian] In questo articolo si traccia un profilo del cosidetto calcolo frazionario e delle relative applicazioni a problemi di matematica pura ed applicata. Si discutono varie definizioni dell'operazione di derivata frazionaria, non tutte coincidenti fra loro, e si mostra come sia possibile proporre una definizione univoca che inglobi tutte le altre. Si analizza infine il ruolo giocato dalle derivate e dagli integrali frazionari e, piu' in generale, quello degli operatori differenziali ad esponente frazionario, nell'ambito della teoria delle rappresentazioni integrali.

  7. CheD: chemical database compilation tool, Internet server, and client for SQL servers.

    Science.gov (United States)

    Trepalin, S V; Yarkov, A V

    2001-01-01

    An efficient program, which runs on a personal computer, for the storage, retrieval, and processing of chemical information, is presented, The program can work both as a stand-alone application or in conjunction with a specifically written Web server application or with some standard SQL servers, e.g., Oracle, Interbase, and MS SQL. New types of data fields are introduced, e.g., arrays for spectral information storage, HTML and database links, and user-defined functions. CheD has an open architecture; thus, custom data types, controls, and services may be added. A WWW server application for chemical data retrieval features an easy and user-friendly installation on Windows NT or 95 platforms.

  8. Lessons Learned from the Crew Health Care System (CHeCS) Rack 1 Environmental Control and Life Support (ECLS) Design

    Science.gov (United States)

    Williams, David E.

    2006-01-01

    This paper will provide an overview of the International Space Station (ISS) Environmental Control and Life Support (ECLS) design of the Crew Health Care System (CHeCS) Rack 1 and it will document some of the lessons that have been learned to date for the ECLS equipment in this rack.

  9. Efficient Computation of Sparse Matrix Functions for Large-Scale Electronic Structure Calculations: The CheSS Library.

    Science.gov (United States)

    Mohr, Stephan; Dawson, William; Wagner, Michael; Caliste, Damien; Nakajima, Takahito; Genovese, Luigi

    2017-10-10

    We present CheSS, the "Chebyshev Sparse Solvers" library, which has been designed to solve typical problems arising in large-scale electronic structure calculations using localized basis sets. The library is based on a flexible and efficient expansion in terms of Chebyshev polynomials and presently features the calculation of the density matrix, the calculation of matrix powers for arbitrary powers, and the extraction of eigenvalues in a selected interval. CheSS is able to exploit the sparsity of the matrices and scales linearly with respect to the number of nonzero entries, making it well-suited for large-scale calculations. The approach is particularly adapted for setups leading to small spectral widths of the involved matrices and outperforms alternative methods in this regime. By coupling CheSS to the DFT code BigDFT, we show that such a favorable setup is indeed possible in practice. In addition, the approach based on Chebyshev polynomials can be massively parallelized, and CheSS exhibits excellent scaling up to thousands of cores even for relatively small matrix sizes.

  10. Molecular Interaction and Cellular Location of RecA and CheW Proteins in Salmonella enterica during SOS Response and Their Implication in Swarming.

    Science.gov (United States)

    Irazoki, Oihane; Aranda, Jesús; Zimmermann, Timo; Campoy, Susana; Barbé, Jordi

    2016-01-01

    In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  11. Molecular interaction and cellular location of RecA and CheW proteins in Salmonella enterica during SOS response and their implication in swarming

    Directory of Open Access Journals (Sweden)

    Oihane Irazoki

    2016-10-01

    Full Text Available In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  12. European analytical column No. 36 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Emons, Hendrik; Andersen, Jens Enevold Thaulov

    2008-01-01

    European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)......European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)...

  13. El Che - más que médico

    Directory of Open Access Journals (Sweden)

    Natalia I. Osorio Curbelo

    2015-12-01

    Full Text Available Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más conocido de los ajedrecistas cubanos José Raúl Capablanca, obtuvo la medalla de Oro en el primer tablero, convirtiéndose en noticia mundial. La gran pasión por el juego ciencia  se puso de manifiesto durante toda su vida, jugó Ajedrez cuando estaba viajando en un avión, cuando  estuvo detenido en alguna estación policial o, simplemente, a las tres de la madrugada recibía una delegación mexicana para jugar una partida después de conversar sobre los temas generales comunes. Ernesto Guevara, eternamente Che, revolucionario integral y multifacético, sintió gran afición por los deportes y aunque por lo general se le cita como amante del ajedrez y el fútbol, también, desde niño, practicó con derroche de coraje y voluntad otros no tan divulgados. A sus prácticas deportivas también se entregó con la voluntad, coraje y pasión que lo caracterizaron a lo largo de su vida. Luego del triunfo de la Revolución cubana, en la que ganó  los grados de Comandante, hubo  un deporte priorizado  en la vida del Che: el Ajedrez.  Dos veces ganó en los campeonatos patrocinados por el Ministerio de Industria, que él presidía,  y participó, además, en los Torneos del INDER donde ascendió, por los resultados alcanzados, a la primera categoría. Se enfrentó en partidas simultáneas a varios de los mejores jugadores de esos días, entre ellos los grandes maestros soviéticos Victor Korchnoi y Mijail Tal y el argentino Miguel Najdorf, d

  14. Cherenkov and scintillation light separation on the CheSS experiment

    Science.gov (United States)

    Caravaca, Javier; Land, Benjamin; Descamps, Freija; Orebi Gann, Gabriel D.

    2016-09-01

    Separation of the scintillation and Cherenkov light produced in liquid scintillators enables outstanding capabilities for future particle detectors, the most relevant being: particle directionality information in a low energy threshold detector and improved particle identification. The CheSS experiment uses an array of small, fast photomultipliers (PMTs) and state-of-the-art electronics to demonstrate the reconstruction of a Cherenkov ring in liquid scintillator using two techniques: based on the photon density and using the photon hit time information. A charged particle ionizing a scintillation medium produces a prompt Cherenkov cone and late isotropic scintillation light, typically delayed by several ns. The fast response of our PMTs and DAQ provides a precision well below the ns level, making possible the time separation. Furthermore, the usage of the new developed water-based liquid scintillators (WbLS) enhances the separation since it allows tuning of the Cherenkov/Scintillation ratio. Latest results on the separation for pure liquid scintillators and WbLS will be presented.

  15. Start of enrolment for the Champs-Fréchets crèche (EVE)

    CERN Multimedia

    HR Department

    2008-01-01

    As announced in Bulletin 43/2007, CERN signed an agreement with the commune of Meyrin on 17 October 2007 under which 20 places will be reserved for the children of CERN personnel in the Champs-Fréchets day care centre (EVE), which will open on Monday, 25 August, and CERN will contribute to the funding. This agreement allows members of the CERN personnel (employees and associates) access to the crèche, for children aged between 4 months and 4 years, irrespective of where they are living. Applications for the school year starting autumn 2008 will be accepted from Monday 17 March until Monday 30 June 2008. Members of the personnel must complete the enrolment formalities with the Meyrin infant education service themselves: Mairie de Meyrin Service de la Petite Enfance 2 rue des Boudines Case postale 367 - 1217 Meyrin 1 - Tel. + 41 (0)22 782 21 21 mailto:meyrin@meyrin.ch http://www.meyrin.ch/petiteenfance Application forms (in PDF) can be downloaded from the website of the com...

  16. LE SOLUTRÉEN ANCIEN EN ARDÈCHE (FRANCE: UNE RÉVISION CRITIQUE DES INDUSTRIES LITHIQUES

    Directory of Open Access Journals (Sweden)

    Sophie Guegan

    2013-11-01

    Full Text Available S’inscrivant dans un travail de Doctorat sur les peuplements des deux rives de la vallée du Rhône au Maximum Glaciaire, cet article propose un état des connaissances sur la phase ancienne du Solutréen en Ardèche (rive droite du Rhône, donnant lieu à une révision critique des industries lithiques s’y rapportant. En effet, depuis les travaux de P.E.L. Smith et J. Combier, et plus récemment le travail d’A. Barbiero consacré aux pointes à face plance et pointes à cran d’une collection ancienne à la Baume d’Oullins (Gard-Ardèche, France, aucun réexamen global n’avait été entrepris. Trois gisements de référence pour cette phase ancienne, ont ainsi été sélectionnés: les grottes d’Oullins (Gard-Ardèche, France, de Chabot (Gard, France et de Granouly (Ardèche, France. Nous présentons ici les réslutats préliminaires à cette étude. En premier lieu, une approche typologique a été menée principalement autour de la pointe à face plane, objet emblématique de cette phase, permettant d’en préciser les principaux caractères. Dans un deuxième temps, une approche technologique a permis de confirmer l’homogénéité dans les choix techniques des Solutréens entre l’Ardèche et les régions du Sud-Ouest et du Bassin Parisien. Enfin, une étude des matières premières, a révélé pour l’heure des choix économiques étonnants pour le contexte paléo-climatique, avec des déplacements vers le nords et un franchissement du Rhône.In the frame of a doctoral dissertation on the Late Glacial Maximum occupations of both sides of the Rhône valley, this paper presents a state of the art and a critical reappraisal of the lithic assemblages from the early phases of the Solutrean in Ardeche (right bank of the Rhône river. Indeed, since the works of P.E.L. Smith and J. Combier, except the work of A. Barbiero, on the unifacial leaf-points and shouldered points from Baume d'Oullins, no complete study of these

  17. Méthodes de levée de dormance de la noix de cola fraîche ( Cola ...

    African Journals Online (AJOL)

    Cette étude avait pour objectif de proposer une méthode efficace de germination de la noix de cola fraîche, en vue d'une réduction significative du délai de germination à travers un test comparatif de traitement de la noix par blessure, humidification et chaleur. Méthodologie et résultats: L'étude a été mise en place selon un ...

  18. “Nell’occhio che riscopre la luce”: tempo, Storia e memoria nella poesia di Salvatore Quasimodo

    OpenAIRE

    Alessandro Martini

    2015-01-01

    La riflessione sul rapporto dell’uomo con il tempo e con la storia percorre senza soluzione di continuità l’opera poetica di Salvatore Quasimodo. Spesso a disagio in una dimensione temporale fissa e definita, schiacciato tra dolore dell’esilio, insensatezza della guerra e crisi del dopoguerra, il poeta interroga gli evi passati e le ere future in cerca di un’armonia che appare il più delle volte sfuggente.

  19. The chemotaxis-like Che1 pathway has an indirect role in adhesive cell properties of Azospirillum brasilense.

    Science.gov (United States)

    Siuti, Piro; Green, Calvin; Edwards, Amanda Nicole; Doktycz, Mitchel J; Alexandre, Gladys

    2011-10-01

    The Azospirillum brasilense chemotaxis-like Che1 signal transduction pathway was recently shown to modulate changes in adhesive cell surface properties that, in turn, affect cell-to-cell aggregation and flocculation behaviors rather than flagellar-mediated chemotaxis. Attachment to surfaces and root colonization may be functions related to flocculation. Here, the conditions under which A. brasilense wild-type Sp7 and che1 mutant strains attach to abiotic and biotic surfaces were examined using in vitro attachment and biofilm assays combined with atomic force microscopy and confocal microscopy. The nitrogen source available for growth is found to be a major modulator of surface attachment by A. brasilense and could be promoted in vitro by lectins, suggesting that it depends on interaction with surface-exposed residues within the extracellular matrix of cells. However, Che1-dependent signaling is shown to contribute indirectly to surface attachment, indicating that distinct mechanisms are likely underlying flocculation and attachment to surfaces in A. brasilense. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  20. Reconocimiento Mapu-Che de Chile: Tratado ante Constitución, Historia frente a Derecho

    Directory of Open Access Journals (Sweden)

    Bartolomé CLAVERO SALVADOR

    2011-04-01

    Full Text Available Desde el año 1991, el compromiso adquirido por los sucesivos gobiernos chilenos para reconocer a nivel constitucional la presencia indígena en el ordenamiento del Estado ha puesto de manifiesto el desconocimiento académico y jurídico mutuo por parte de Chile con respecto a las evidencias para una reposición de Mapu-Che. El presente trabajo hace un recorrido histórico y jurídico por las formas de relación entre el Estado chileno y el Estado Mapu, que hasta la conquista chilena de Mapu en la década de los ochenta del siglo XIX se manifestaron a través de Tratados y Parlamentos que implicaban un reconocimiento mutuo de ambas entidades en una esfera internacional. Las comisiones de estudios, informes oficiales e invocaciones de verdad para un nuevo trato, primero de las Naciones Unidas, y después de la República de Chile, han observado estas evidencias de la significación constitucional e internacional de los Tratados, pero Chile ha convertido su peculiar forma de reconocimiento constitucional de la presencia indígena en un alarde de unidad e indivisibilidad nacional. Este encubrimiento nace del deseo de mantener una Constitución exclusiva, al que se une la certeza de que otra forma de reconocimiento obligaría a un replanteamiento de las propias raíces de los fundamentos constitucionales de la República de Chile.

  1. SYM1, l’ortologo di lievito del gene umano MPV17, codifica per una proteina indotta da stress che modula lo stato bioenergetico e morfogenetico del mitocondrio

    OpenAIRE

    Dallabona, Cristina

    2010-01-01

    Mutazioni nel gene MPV17 causano l’insorgenza di una forma epatocerebrale della sindrome da deplezione del DNA mitocondriale. MPV17 codifica per una piccola proteina idrofobica localizzata nella membrana mitocondriale interna con funzione sconosciuta. Per cercare di chiarire le basi molecolari che causano la patologia, abbiamo utilizzato il lievito S. cerevisiae come organismo modello grazie alla presenza di un ortologo di MPV17: SYM1. Abbiamo dimostrato che la proteina Sym1 è essenziale per ...

  2. La nascita imperfetta delle cose la grande corsa alla particella di Dio e la nuova fisica che cambierà il mondo

    CERN Document Server

    AUTHOR|(CDS)2068901

    2016-01-01

    In quel preciso momento, un centesimo di miliardesimo di secondo dopo il Big Bang, si è deciso il nostro destino. In un universo in cui materia e antimateria si equivalevano, e che quindi avrebbe potuto, in ogni istante, tornare a essere pura energia, può essere bastata una leggerissima preferenza del bosone di Higgs per la materia anziché per l'antimateria ed ecco che si è prodotto il mondo che abbiamo sotto gli occhi. "Ecco qua il minuscolo difetto, la sottile imperfezione da cui è nato tutto. Un'anomalia che dà origine a un universo che può evolvere per miliardi di anni." Se tutto nasce da lì, dobbiamo capire in ogni dettaglio quel momento cruciale, ricostruirlo fotogramma per fotogramma, al rallentatore e da diverse angolature. Per questo al Cern di Ginevra è stato realizzato Lhc, l'acceleratore di particelle più potente del mondo, il posto più simile al primo istante di vita dell'universo che l'uomo sia stato in grado di costruire. Per questo da anni i migliori fisici del mondo lavorano giorno...

  3. The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima

    International Nuclear Information System (INIS)

    Vu, Anh; Hamel, Damon J.; Zhou Hongjun; Dahlquist, Frederick W.

    2011-01-01

    The bacterial histidine autokinase CheA contains a histidine phosphotransfer (Hpt) domain that accepts a phosphate from the catalytic domain and donates the phosphate to either target response regulator protein, CheY or CheB. The Hpt domain forms a helix-bundle structure with a conserved four-helix bundle motif and a variable fifth helix. Observation of two nearly equally populated conformations in the crystal structure of a Hpt domain fragment of CheA from Thermotoga maritima containing only the first four helices suggests more mobility in a tightly packed helix bundle structure than previously thought. In order to examine how the structures of Hpt domain homologs may differ from each other particularly in the conformation of the last helix, and whether an alternative conformation exists in the intact Hpt domain in solution, we have solved a high-resolution, solution structure of the CheA Hpt from T. maritima and characterized the backbone dynamics of this protein. The structure contains a four-helix bundle characteristic of histidine phosphotransfer domains. The position and orientation of the fifth helix resembles those in known Hpt domain crystal and solution structures in other histidine kinases. The alternative conformation that was reported in the crystal structure of the CheA Hpt from T. maritima missing the fifth helix is not detected in the solution structure, suggesting a role for the fifth helix in providing stabilizing forces to the overall structure.

  4. The Crèche and School structure of the CERN Staff Association is looking for a new name

    CERN Multimedia

    Staff Association

    2018-01-01

    The CERN Staff Association is launching a competition to find a new name to replace the current acronym EVEE (Espace de Vie Enfantine et École). The competition is open to everyone from Thursday, 1 February 2018 to Thursday, 15 March. All participants can send their name suggestions via the form available on the websites of the Staff Association and the Crèche and School. Good luck to all – may the best one win! P.S. The Rules of the Competition are available on both websites

  5. Determination of the Index of Consumption of Petroleum of the Calcining Kiln of the Ernesto Che Guevara Commander Undertaking

    Directory of Open Access Journals (Sweden)

    Yarilys Gaínza-Delgado

    2016-07-01

    Full Text Available This work presents the results obtained in carrying out the mass and energy balances in the calcining kiln of the company commander Ernesto Che Guevara, for determining the consumption index of petroleum used for obtaining nickel oxide through thermal decomposition of the basic nickel carbonate. It was shown that for a production of basic nickel carbonate of              12 t / h with 69% moisture, it is necessary to feed about 1100 kg / h of fuel, for an consumption index of 91.67 kg of fuel per ton of load.

  6. Il mondo secondo la fisica quantistica segreti e meraviglie della scienza che sta cambiando la nostra vita

    CERN Document Server

    Fracas, Fabio

    2017-01-01

    Questo libro è un'avventura esclusiva e affascinante. Un viaggio, anche nel tempo, alla scoperta di qualcosa di nuovo e di straordinario: la Fisica Quantistica, nelle sue logiche, nelle sue potenzialità, nelle sue applicazioni e nei suoi possibili sviluppi. All'interno del volume vengono ricostruiti passo dopo passo i momenti fondamentali del pensiero quantistico, le questioni su cui si sono interrogati i più grandi scienziati degli ultimi decenni, e i diversi contesti nei quali si sono evoluti i principali modelli della Meccanica Quantistica. Sullo sfondo delle ricerche più attuali - come per esempio quella sulle onde gravitazionali che ha portato al Nobel per la Fisica 2017 -, vengono indagati anche i rapporti esistenti fra Fisica Quantistica, Relatività Einsteiniana e Teoria delle Stringhe. Inoltre, fra i tanti temi trattati nelle sue pagine, trovano spazio persino le incredibili ricadute che gli studi sulla Fisica Quantistica stanno avendo negli ambiti della medicina e delle ricerche sul cervello e s...

  7. Crèche and School of the Staff Association: a programme for children from 2 to 4 year old

    CERN Multimedia

    Staff Association

    2018-01-01

    Find out how children between the ages of two to four and their families can benefit from the Staff Association Crèche and School programme. Classes for children aged between two and four years have been set-up to ensure the initial transition from home to school is as smooth as possible. Children attend mornings only and are welcomed by the same group of teaching staff throughout the week, allowing the children to establish a link between their home life and the crèche/school. The challenge of these classes is to offer the children a happy environment where they can feel emotionally secure, and the teaching staff can create a harmonious atmosphere allowing them to learn by moving, manipulating, exchanging, making mistakes… playing. Creativity takes a central role as it enables the child to express him or herself and increase their ability to handle their emotions constructively. According to Albert Einstein ‘Play is the highest form of research’. &nbs...

  8. The Drosophila gene CheB42a is a novel modifier of Deg/ENaC channel function.

    Directory of Open Access Journals (Sweden)

    Yehuda Ben-Shahar

    2010-02-01

    Full Text Available Degenerin/epithelial Na(+ channels (DEG/ENaC represent a diverse family of voltage-insensitive cation channels whose functions include Na(+ transport across epithelia, mechanosensation, nociception, salt sensing, modification of neurotransmission, and detecting the neurotransmitter FMRFamide. We previously showed that the Drosophila melanogaster Deg/ENaC gene lounge lizard (llz is co-transcribed in an operon-like locus with another gene of unknown function, CheB42a. Because operons often encode proteins in the same biochemical or physiological pathway, we hypothesized that CHEB42A and LLZ might function together. Consistent with this hypothesis, we found both genes expressed in cells previously implicated in sensory functions during male courtship. Furthermore, when coexpressed, LLZ coprecipitated with CHEB42A, suggesting that the two proteins form a complex. Although LLZ expressed either alone or with CHEB42A did not generate ion channel currents, CHEB42A increased current amplitude of another DEG/ENaC protein whose ligand (protons is known, acid-sensing ion channel 1a (ASIC1a. We also found that CHEB42A was cleaved to generate a secreted protein, suggesting that CHEB42A may play an important role in the extracellular space. These data suggest that CHEB42A is a modulatory subunit for sensory-related Deg/ENaC signaling. These results are consistent with operon-like transcription of CheB42a and llz and explain the similar contributions of these genes to courtship behavior.

  9. Animals′ Role in Proper Behaviour: Cheŵa Women′s Instructions in South-Central Africa

    Directory of Open Access Journals (Sweden)

    Leslie F Zubieta

    2016-01-01

    Full Text Available The most common role of animals in the Cheŵa culture of south-central Africa is twofold: they are regarded as an important source of food, and they also provide raw materials for the creation of traditional medicines. Animals, however, also have a nuanced symbolic role that impacts the way people behave with each other by embodying cultural protocols of proper — and not so proper — behaviour. They appear repeatedly in storytelling and proverbs to reference qualities that people need to avoid or pursue and learn from the moral of the story in which animals interplay with each other, just as humans do. For example, someone who wants to prevent the consequences of greed is often advised to heed hyena stories and proverbs. My contribution elaborates on Brian Morris's instrumental work in south-central Africa, which has permitted us to elucidate the symbolism of certain animals and the perception of landscape for Indigenous populations in this region. I discuss some of the ways in which animals have been employed to teach and learn proper behaviour in a particular sacred ceremony of the Cheŵa people which takes place in celebration of womanhood: Chinamwali.

  10. Cloning, overexpression, purification, crystallization and preliminary X-ray analysis of CheY3, a response regulator that directly interacts with the flagellar ‘switch complex’ in Vibrio cholerae

    International Nuclear Information System (INIS)

    Khamrui, Susmita; Biswas, Maitree; Sen, Udayaditya; Dasgupta, Jhimli

    2010-01-01

    A chemotaxis response regulator CheY3 from V. cholerae has been cloned, overexpressed, purified and crystallized. The crystals of CheY3 diffracted to 1.86 Å resolution. Vibrio cholerae is the aetiological agent of the severe diarrhoeal disease cholera. This highly motile organism uses the processes of motility and chemotaxis to travel and colonize the intestinal epithelium. Chemotaxis in V. cholerae is far more complex than that in Escherichia coli or Salmonella typhimurium, with multiple paralogues of various chemotaxis genes. In contrast to the single copy of the chemotaxis response-regulator protein CheY in E. coli, V. cholerae contains four CheYs (CheY1–CheY4), of which CheY3 is primarily responsible for interacting with the flagellar motor protein FliM, which is one of the major constituents of the ‘switch complex’ in the flagellar motor. This interaction is the key step that controls flagellar rotation in response to environmental stimuli. CheY3 has been cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY3 were grown in space group R3, with a calculated Matthews coefficient of 2.33 Å 3 Da −1 (47% solvent content) assuming the presence of one molecule per asymmetric unit

  11. A technician monitors the CHeX, a USMP-4 experiment which will be flown on STS-87, in the SSPF

    Science.gov (United States)

    1997-01-01

    United States Microgravity Payload-4 (USMP-4) experiments are prepared to be flown on Space Shuttle mission STS-87 in the Space Station Processing Facility at Kennedy Space Center (KSC). Here, a technician is monitoring the Confined Helium Experiment, or CHeX, that will use microgravity to study one of the basic influences on the behavior and properties of materials by using liquid helium confined between silicon disks. CHeX and several other experiments are scheduled for launch aboard STS-87 on Nov. 19 from KSC.

  12. Novel activation domain derived from Che-1 cofactor coupled with the artificial protein Jazz drives utrophin upregulation.

    Science.gov (United States)

    Desantis, Agata; Onori, Annalisa; Di Certo, Maria Grazia; Mattei, Elisabetta; Fanciulli, Maurizio; Passananti, Claudio; Corbi, Nicoletta

    2009-02-01

    Our aim is to upregulate the expression level of the dystrophin related gene utrophin in Duchenne muscular dystrophy, thus complementing the lack of dystrophin functions. To this end, we have engineered synthetic zinc finger based transcription factors. We have previously shown that the artificial three-zinc finger protein named Jazz fused with the Vp16 activation domain, is able to bind utrophin promoter A and to increase the endogenous level of utrophin in transgenic mice. Here, we report on an innovative artificial protein, named CJ7, that consists of Jazz DNA binding domain fused to a novel activation domain derived from the regulatory multivalent adaptor protein Che-1/AATF. This transcriptional activation domain is 100 amino acids in size and it is very powerful as compared to the Vp16 activation domain. We show that CJ7 protein efficiently promotes transcription and accumulation of the acetylated form of histone H3 on the genomic utrophin promoter locus.

  13. Review: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven (2012

    Directory of Open Access Journals (Sweden)

    Geert Castryck

    2015-01-01

    Full Text Available Review of the edited volume: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven, Cologne: Rüdiger Köppe Verlag, 2012, ISBN 9783896458292, 572 pages

  14. Noi siamo quello che ricordiamo - Le frazze di Crucoli: il teatro, il rito, il riscatto sociale

    Directory of Open Access Journals (Sweden)

    Tonia Mingrone

    2012-01-01

    Full Text Available Abstract - IT Questo lavoro nasce da una ricerca di campo sulle frazze, termine dialettale che indica le farse di Carnevale che si rappresentavano fino a cinquant’anni fa in molti paesi calabresi, tra cui il mio, Crucoli, in provincia di Crotone. Lo scopo di questo lavoro non è fare un resoconto esaustivo di tutto ciò che accadeva a Crucoli durante la celebrazione del Carnevale, impresa assai difficile dal momento che non ci sono documenti scritti e quindi bisogna affidarsi ai racconti orali delle persone intervistate, spesso non fedeli alla realtà, perché modificati dal tempo e dalla memoria. L’approccio con cui ho intrapreso questa ricerca è sicuramente legato all’aspetto teatrale e performativo dell’evento, senza trascurarne la rilevanza antropologica. Il materiale raccolto è frutto di interviste e colloqui con la gente del posto unito ad un grande lavoro di ricerca bibliografica di autori che avevano trattato di questo argomento in relazione ai loro paesi di origine.Lo scopo è quello di delineare l’organizzazione e lo svolgimento delle frazze, cercando di ricostruire la sua durata e le ripercussioni sulla comunità, nonché dimostrare ancora una volta come il teatro, messo a disposizione di alcuni eventi, diventi un mezzo forte di liberazione e di contestazione. Abstract - FR Cet article prend sa naissance par une recherche sur champ concernant les frazze, terme dialectal qui dénote les farces du Carnaval mises en scène jusqu'à il y a cinquante ans dans plusieurs villages en Calabria, entre eux le mien, Crucoli, dans la province de Crotone. La raison de ce travail n'est pas d'accomplir un compte rendu exhaustif de tout ce qui avait lieu à Crucoli pendant la célébration du Carnaval, l'exploit étant très difficile, du moment qu'aucun document écrit a été parvenu et par conséquence il est nécessaire de se remettre aux contes des témoins interviewés, souvent pas fidèles au réel, parce-que détournés par les

  15. RESISTENCIA MICROBIANA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA. ESTUDIO DE 5 AÑOS / Microbial resistance at the “Ernesto Che Guevara” Cardiology Hospital. A five year study

    Directory of Open Access Journals (Sweden)

    Nérida Rodríguez Oliva

    2009-06-01

    Full Text Available Introduction and Objectives: The appearance of nosocomial bacterial resistance represents a problem of growing concern because it largely affects the evolution of patients and the health resources devoted to it. The objective of this work was to determine the most common germs and their microbial resistance. Methods: A descriptive retrospective study was carried out analyzing the result of the isolation of germs from all type of secretions and from the blood cultures of a group ofpatients hospitalized at the Ernesto Che Guevara Cardiology Hospital in a five year period. Results: A total of 397 strains were isolated, 77 Staphylococcus aureus and 320 Enterobacteriaceae. The former presented 100% resistance to penicillin. The Staphylococcus sensitive to methicillin presented 4.9 % resistance to cotrimoxazole and gentamicin. The strains resistant to methicillin or oxacillin had a high resistance to gentamicin (87.5 % and ciprofloxacin (81.2 %, a medium resistance to cefazolin and oxacilline (20.5 %, and just 12.5 percent resistance to cotrimoxazole. Conclusions: the Staphylococcus aureus and the Enterobacteriaceae were the most common germs. The preoperative prophylaxis in these patients must not be done with cefazolin as a routine because the staphylococci resistant to methicillin or oxacillin have influence on other antimicrobials.

  16. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    International Nuclear Information System (INIS)

    Shi, Jade; Schwantes, Christian; Bilsel, Osman

    2017-01-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. We report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. The resulting prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. We then predict incisive single molecule FRET experiments, using these results, as a means of model validation. Our study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  17. Chun Doo Hwan's Manipulation of the Kwangju Popular Uprising

    National Research Council Canada - National Science Library

    Sohn, Donald

    1998-01-01

    Many scholars and journalists point to the tragic events that occurred in the Kwangju Popular Uprising as a pronounced materialization of the dependent nature of the relationship between U.S. and South Korea...

  18. Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Ivett María Ramírez-Pérez

    2017-01-01

    Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

  19. Effects of Kapton Sample Cell Windows on the Detection Limit of Smectite: Implications for CheMin on the Mars Science Laboratory Mission

    Science.gov (United States)

    Achilles, C. N.; Ming, Douglas W.; Morris, R. V.; Blake, D. F.

    2012-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity is an X-ray diffraction (XRD) and X-ray fluorescence (XRF) instrument capable of providing the mineralogical and chemical compositions of rocks and soils on the surface of Mars. CheMin uses a microfocus X-ray tube with a Co target, transmission geometry, and an energy-discriminating X-ray sensitive CCD to produce simultaneous 2-D XRD patterns and energy-dispersive X-ray histograms from powdered samples. CheMin has two different window materials used for sample cells -- Mylar and Kapton. Instrument details are provided elsewhere. Fe/Mg-smectite (e.g., nontronite) has been identified in Gale Crater, the MSL future landing site, by CRISM spectra. While large quantities of phyllosilicate minerals will be easily detected by CheMin, it is important to establish detection limits of such phases to understand capabilities and limitations of the instrument. A previous study indicated that the (001) peak of smectite at 15 Ang was detectable in a mixture of 1 wt.% smectite with olivine when Mylar is the window material for the sample cell. Complications arise when Kapton is the window material because Kapton itself also has a diffraction peak near 15 Ang (6.8 deg 2 Theta). This study presents results of mineral mixtures of smectite and olivine to determine smectite detection limits for Kapton sample cells. Because the intensity and position of the smectite (001) peak depends on the hydration state, we also analyzed mixtures with "hydrated" and "dehydrated"h smectite to examine the effects of hydration state on detection limits.

  20. Il mito della precarietà: quando la precarietà è un valore che decostruisce l’immaginario della precarietà

    Directory of Open Access Journals (Sweden)

    Antonio Casillo

    2011-07-01

    Full Text Available Oggi la ricerca del posto “fisso” sembra essere il sogno irraggiungibile di molti giovani precari e la “flessibilità”, una parola d’ordine con cui si aspirava a riformare il mondo del lavoro e che tanto in voga sembrava essere negli anni ’90, è diventata sinonimo di incertezza, precarietà, se non addirittura sfruttamento. Ma c’era chi proprio nel lavoro che oggi definiremo precario, vedeva l’unica possibilità per restare libero dalle leggi di mercato e dai potenti poteri editoriali Newyorkesi. In questo articolo proviamo a gettare uno sguardo al mito letterario con cui, il rifiutare un posto fisso, significava rivendicare la propria libertà, un mito romantico certo, e sicuramente distante dalla realtà, ma che ha affascinato un’intera generazione di scrittori, poeti, musicisti. Da Jack London, passando attraverso la San Francisco Renaissance e la Beat Generation, fino ad arrivare al fenomeno della così detta generazione Hippy, il sogno americano sembrava essere quello di una frontiera mobile in cui, la strada, sembrava non avere mai fine.

  1. Un uomo che valuta

    Directory of Open Access Journals (Sweden)

    Massimiliano Nicoli

    2015-12-01

    Full Text Available This article – written as a short story in the second-person narrative mode – focuses on the subjective, everyday experience of an individual concerned by some practices of evaluation. Through the telling of this concrete experience, it aims at giving substance to the idea that the practices of evaluation constitute an «environmental technology of government» typical of neoliberal governmentality as well as a self-disciplined technique of building one’s own «soul» as human capital.

  2. Department of Che

    African Journals Online (AJOL)

    USER

    2015-03-26

    Mar 26, 2015 ... watering, fish culturing and nursery of seedlings. Air is also very ... synthesized organic and inorganic fertilizers are made, synthesized pesticides and herbicides for ..... production and nutritional quality of grains. (Graham and ...

  3. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  4. Nouvelles fonctions de l'agriculture et dynamiques des exploitations: une analyse chorématique dans les monts d'Ardèche

    Directory of Open Access Journals (Sweden)

    Muriel Bonin

    2001-06-01

    Full Text Available Les modèles spatiaux sont utilisés pour l'analyse des trajectoires d'exploitations agricoles pour mettre en évidence les liens entre les transformations socio-économiques et les dynamiques de territoires. Les traits de dynamiques spatiales sont identifiés et utilisés pour analyser l'impact de l'introduction de l'agritourisme dans les exploitations dans le Parc naturel régional des monts d'Ardèche.

  5. Automatización del control del cálculo de extracciones en la mina de la empresa niquelera Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Arístides A. Legrá-Lobaina

    2010-03-01

    Full Text Available En el artículo se muestran los elementos fundamentales de un algoritmo cuyo objetivo es establecer el contenido y el orden de los procedimientos necesarios para realizar el control del cálculo de extracciones en la mina de la empresa Ernesto Che Guevara que explota, a cielo abierto, yacimientos lateríticos ferroniquelíferos en la región de Moa, Cuba. Asimismo se presenta el diseño de los diálogos informáticos que han automatizado el algoritmo en la aplicación informática Tierra.

  6. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d’Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean–François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d’Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d’Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey. PMID:26745626

  7. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d'Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean-François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d'Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d'Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey.

  8. Rachunek dochodów i wydatków budżetu jednostki samorządu terytorialnego na przykładzie gminy Chełmiec w latach 2011-2013

    OpenAIRE

    Rodak, Anna

    2015-01-01

    Przedłożona praca ma na celu wskazanie źródeł i struktury dochodów budżetowych oraz charakteru wydatkowania środków budżetowych gminy Chełmiec, a także dokonanie rzetelnej oceny sytuacji finansowej wymienionej powyżej jednostki. Analiza budżetu obejmuje zakres czasowy od 2011 do 2013 roku. Szczegółowe pytania, na które starano się w niniejszej pracy odpowiedzieć są następujące: Czy gmina Chełmiec jest gospodarna w wykorzystywaniu środków budżetowych? oraz jak gmina Chełmiec mając do dyspozycj...

  9. Evita Perón y el Che Guevara: De la historia a la construcción literaria del mito biográfico

    Directory of Open Access Journals (Sweden)

    Cecilia López Badano

    2014-06-01

    Full Text Available Eva Perón y el Che Guevara son dos de las figuras paradigmáticas argentinas, conocidas internacionalmente a través no sólo de sus vidas, que pueden reconstruirse a partir de documentos históricos, sino por el mito nacional - e internacional - que la muerte temprana ha configurado con ambos mediante la ayuda de la literatura y el cine, expandiendo ficcionalmente el matiz revolucionario de su accionar. El presente texto se propone, en consecuencia, dar cuenta de esas "capas" ficcionales que conforman la construcción estética de los dos mitos biográficos e inciden en la evaluación de sus protagonistas reales, modelando la percepción de ambos, particularmente, la considerada por el gran público más que por los especialistas.

  10. Nascita e destino della soggettività. Dai ruoli professionali ai processi di cura, attraverso una lettura di "Quel che resta del giorno" di Kazuo Ishiguro

    Directory of Open Access Journals (Sweden)

    Gabriele Profita

    2017-07-01

    Full Text Available Questa riflessione affronta un tema assai rilevante per le professioni di cura, con uno sguardo particolare alla psicoterapia. Per chiarire il ruolo della soggettività e della nascita e maturazione di un ruolo professionale riporterò un’analisi di un testo letterario attraverso il quale sarà più agevole scoprire come si forma l’identità di un ruolo professionale e come si avvia alla sua maturazione e alla sua codificazione. In particolare quali sono i rischi legati ad una sua rigida codificazione rivolta alla sua normatività tecnica? Mi propongo di tracciare un confronto con alcune forme di costruzione della soggettività che nel corso dei secoli hanno fondato il modello dell’uomo occidentale nelle sue articolazioni professionali.

  11. Changes of serum levels of prealbumin (PAB), cholinesterase (CHE), total bile acid (TBA) and ALT as related to the severity of inflammatory process and hepatic fibrosis in patients with chronic virus B hepatitis

    International Nuclear Information System (INIS)

    Chi Xiaoxia; Chen Jianxiong; Xiong Ying

    2005-01-01

    Objective: To study the correlationship between the serum levels of PAB, CHE, TBA, ALT and the severity of the disease process in patients with chronic virus B hepatitis. Methods: Serum levels of PAB, CHE, ALT (with biochemical methods) and TBA (with RIA) were examined in 93 patients with biopsy proven virus B hepatitis and 46 controls. Results: The 93 patients were of two groups: a less advanced group (n=51) and a more advanced group (n=42). Serum TBA, ALT levels were significnatly higher and serum PAB, CHE levels were significantly lower in the more advanced group than those in the less advanced group (P 0 to s 4 . Changes of levels of ALT were of no regular pattern, but serum levels of TBA regularly increased and levels of PAB, CHE regularly decreased as the fibrosis grading proceeded from s 0 to s 4 and the differences between the levels in s 4 and any other grading were significant (P<0.01). Conclusion: Combined determination of these serum markers might reflect the degree of inflammatory process and hepatic fibrosis in patients with virus B hepatitis, leading to earlier detection of cirrhosis. (authors)

  12. Conditions of concentration and composition of suspended load in the Vistula River between Wyszogród and Chełmno

    Science.gov (United States)

    Kaszubski, Michal

    2014-05-01

    The main objective of the study is to explain causes of variations of concentration, particle size distribution and composition of suspended load in the riverbed of the lower Vistula between Wyszogród and Chełmno. The study was conducted in seven bridge cross-sections (three above and four below the Włocławek reservoir). In each cross-section, three water samples were collected in the characteristic parts of the riverbed. Since July 2012 fifteen measurement series were carried out. During each measurement series 22 samples of water were collected. In each sample the overall concentration of suspended load, the proportion of the organic matter and particle size distribution of the mineral fraction were measured. Variation of concentration and characteristics of suspended load were studied both in the cross-sections of the Vistula riverbed and along its longitudinal profile. The study focus primarily on determining the qualitative and quantitative variation in the properties of suspended load in the cross-sections located in different morphological riverbed type, various level of its hydrotechnical management, including the operation on the Włocławek reservoir, and the diversity of the water flow conditions. The author tested the correlation occurring between the size of suspended load concentration as well as the flow rate and flow velocity at the water sampling sites. Moreover, the author determined the effect of morphological variation of the Vistula riverbed (the riverbed depth and the location of points of collecting water samples relative to the riverbed mesoforms) on the concentration size, composition structure and the particle size distribution of suspended load. Measurement sessions were chosen in such a way as to cover the widest possible spectrum of the water flow conditions in the riverbed of the Vistula. In addition to the low and medium flow the variability in concentration during flood flows of various types (ice jam, snowmelt and rainfall) were

  13. The CheMin XRD on the Mars Science Laboratory Rover Curiosity: Construction, Operation, and Quantitative Mineralogical Results from the Surface of Mars

    Science.gov (United States)

    Blake, David F.

    2015-01-01

    The Mars Science Laboratory mission was launched from Cape Canaveral, Florida on Nov. 26, 2011 and landed in Gale crater, Mars on Aug. 6, 2012. MSL's mission is to identify and characterize ancient "habitable" environments on Mars. MSL's precision landing system placed the Curiosity rover within 2 km of the center of its 20 X 6 km landing ellipse, next to Gale's central mound, a 5,000 meter high pile of laminated sediment which may contain 1 billion years of Mars history. Curiosity carries with it a full suite of analytical instruments, including the CheMin X-ray diffractometer, the first XRD flown in space. CheMin is essentially a transmission X-ray pinhole camera. A fine-focus Co source and collimator transmits a 50µm beam through a powdered sample held between X-ray transparent plastic windows. The sample holder is shaken by a piezoelectric actuator such that the powder flows like a liquid, each grain passing in random orientation through the beam over time. Forward-diffracted and fluoresced X-ray photons from the sample are detected by an X-ray sensitive Charge Coupled Device (CCD) operated in single photon counting mode. When operated in this way, both the x,y position and the energy of each photon are detected. The resulting energy-selected Co Kalpha Debye-Scherrer pattern is used to determine the identities and amounts of minerals present via Rietveld refinement, and a histogram of all X-ray events constitutes an X-ray fluorescence analysis of the sample.The key role that definitive mineralogy plays in understanding the Martian surface is a consequence of the fact that minerals are thermodynamic phases, having known and specific ranges of temperature, pressure and composition within which they are stable. More than simple compositional analysis, definitive mineralogical analysis can provide information about pressure/temperature conditions of formation, past climate, water activity and the like. Definitive mineralogical analyses are necessary to establish

  14. RELÉ ELECTRÓNICO PARA LA DETECCIÓN DEL MOVIMIENTO EN LOS TANQUES DE SEDIMENTACIÓN DE LA EMPRESA COMANDANTE ¨ERNESTO CHE GUEVARA¨

    Directory of Open Access Journals (Sweden)

    Orlys Ernesto Torres Breffe

    2011-02-01

    Full Text Available En este trabajo se muestran los resultados del diseño de un dispositivo electrónico para detectar el movimiento del tanquede sedimentación de la planta de lixiviación de la Empresa Ernesto Che Guevara.Estos tanque actualmente se encuentran sin esta protección y su parada por avería solo es detectada de forma visual por eloperario o cuando la densidad de la pulpa aumente a valores tan altos que sea reflejado en el sistema de monitoreo instalado(EROS. La parada inadvertida de estos tanque casi siempre sucede por razones fácilmente corregibles, pero si no se detectaa tiempo la sedimentación del minerales es casi inevitable y las pérdidas de recursos y materiales son cuantiosas.La propuesta electrónica en sustitución a las desechas electromagnéticas, es muy barata y su reproducción es fácilmenterealizable en la propia empresa, dado que los elementos que se utiliza son clásicos, sin exigencias de fabricación, tolerancias,etc.  The main goal of this research paper is to show the electronic device design results while dealing with the location of thesedimentation tank on the leaching plant located on Ernesto Che Guevara factory.Nowadays there is no protection for this tank, thus, if it stops working it can only be noticed by the engine sunner on avisual way or when the extremely high figures of the pulp density are reflected on the available monitor system (EROS.The unnoticed misfunctioning of this device is caused mainly to easily solved reasons. Nevertheless, when not detected ontime, the mineral sedimentation is almost unavoidable which results on the losses of resources.The electronic proposal to substitute the electromagnetic scraps is very cheap and easily to reproduce on the factory itself forthe needed elements are classic with no resistance and manufacture demands.

  15. Rock shelter occupation during isotopic stage 5: level D of the site of Payre (Ardèche, France. Territorial organisation and intra-site activities

    Directory of Open Access Journals (Sweden)

    Moncel, Marie-Hélène

    2007-06-01

    Full Text Available This paper presents the results obtained from an interdisciplinary study of the level D archaeological assemblages from Payre (Ardèche, France. This site is dated to the final of OIS 6 and the beginning of OIS 5. The combined analysis of the lithic and faunal assemblages accumulated and their management “into” and “out of” the site gives a better understanding of the behaviour of the Neanderthal groups that inhabited it. This study has allowed us to correlate the territorial exploitation for game hunting and for raw material procurement, within the context of seasonal short term occupations probably during the end of autumn and the beginning of winter.  

    Este artículo presenta los resultados obtenidos a través del estudio multidisciplinar del registro arqueológico del nivel D del yacimiento de Payre (Ardèche, Francia datado entre el final del OIS 6 y el comienzo del OIS 5. El análisis conjunto de la industria lítica y de los restos óseos recuperados en el yacimiento y de la gestión de dichos recursos dentro y fuera de él, ha hecho posible la comprensión de los comportamientos humanos de los grupos neandertales que lo ocuparon. Dicho estudio nos ha permitido poner en relación el tipo de explotación del territorio de caza y de captación de materias primas, dentro del marco de ocupaciones estacionales de corta duración desarrolladas probablemente entre el final del otoño y el principio del invierno.  

  16. LA DIAGNOSI DELLE COMPETENZE LINGUISTICHE IN UN CONTESTO MULTILINGUE: UN PROCESSO CONTINUO CHE FAVORISCE L’INSEGNAMENTO E L’APPRENDIMENTO INDIVIDUALIZZATO

    Directory of Open Access Journals (Sweden)

    Drorit Lengyel

    2011-07-01

    Full Text Available Il presente studio affronta il problema della valutazione diagnostica delle competenze linguistiche in contesti educativi multilingui, con particolare attenzione ai bisogni dei bambini e degli adolescenti immigrati. Vengono brevemente esposti gli obiettivi, le funzioni e i principi della valutazione diagnostica e della valutazione formativa considerate parte integrante di una educazione linguistica continua che prevede un insegnamento-apprendimento individualizzato. Sul piano teorico le procedure della valutazione diagnostica delle competenze linguistiche in contesti multilingui fanno riferimento all’apprendimento delle lingue inteso come attività socio-culturale.     Language diagnostics in multilingual settings with respect to continuous procedures as accompaniment of individualized learning and teaching   This study provides an introduction to language diagnostics in multilingual educational settings, with particular reference to the needs of children and adolescents from migrant backgrounds. It summarises the objectives and functions of language diagnostics and the principles that govern diagnostics including formative assessment, considered to be an integral part of continuous language education that emphasises individualised teaching and learning. From a theoretical perspective, diagnostic procedures in multilingual settings treat language learning as a socio-cultural activity.  

  17. Il Salento che abbiamo attraversato: Rina Durante e Bruno Brancher, il racconto di due vite diverse sulle strade di terra d'Otranto

    Directory of Open Access Journals (Sweden)

    Massimo Melillo

    2015-07-01

    Full Text Available Rina Durante ha rappresentato il meglio della cultura meridionale, ne ha raccolto l’eredità e ne è stata tra le interpreti più acute. Abbiamo avuto l’onore della sua amicizia fraterna e solidale, conosciuto l’azzardo e la radicalità delle sue scelte di vita, la sua dolce timidezza e l’ardita padronanza e consapevolezza del suo ruolo: anni di discussioni, di confronto, di legame cementato da infuocati innamoramenti intellettuali per uno scrittore, un poeta, un regista, di accese ironie sui nostri caratteri, di scontri politici e furibondi litigi finiti in un abbraccio. Anche per Bruno Brancher, milanese di tutti e di nessuno, il ricordo si fa memoria per le sue mille improvvise e imprevedibili incursioni in terra salentina. Non era un uomo facile, anche se aveva dalla sua parte il puntiglio dell’innocenza tipica del ladro gentiluomo. Portava leggero il fardello di due vite in una: la prima segnata da una marginalità, fattasi a volte precariamente lussuosa con i proventi di furti e disarmanti rapine; l’altra con la faccia del redento, che con la scoperta della scrittura diventa cosciente di sé.

  18. Evaluation of the Addition liquor with high ammonia and Carbon Dioxide contentin the still 208 of the “Comandante Che Guevara” industry (ECG

    Directory of Open Access Journals (Sweden)

    María Elena Magaña-Haynes

    2015-12-01

    Full Text Available Adding fresh liquor through the 5th ring in still 208 of distilling liquor product (liquor obtained as a result of ammonium carbonate leaching of lateritic ore in the “Comandante Che Guevara” industry, were evaluated with the objective of reducing the dissolved nickel content of the effluent there from, as well as to improve the characteristics of the nickel carbonate which is delivered to the calcinations process. For the development of the survey, the same methodology used in 2001 for the test was applied. The results showed that by adding fresh liquor, it is possible to reduce the dissolved nickel content at the exit of the distillation column, so that the need for precipitation is minimized, thereby reducing the consumption of reagents and the and the cost for their acquisition. It was possible to corroborate the relationship between the content of NH3 at the discharge and the nickel dissolved therein appreciating that to achieve these results it is necessary to maintain the ammonia in the discharge between 1,0-1,8 g/L. The carbonate obtained in the column where liquor is added with high CO2 and NH3 reached high values of this last element in its composition and to the extent that increased sulphur content decreased. It was also seen an increase in the size of the coarse carbonates particles, which will influence in a decrease of energy consumption.

  19. Mineralogy, provenance, and diagenesis of a potassic basaltic sandstone on Mars: CheMin X-ray diffraction of the Windjana sample (Kimberley area, Gale Crater)

    International Nuclear Information System (INIS)

    Treiman, Allan H.; Bish, David L.; Chipera, Steve J.; Blake, David F.

    2015-01-01

    The Windjana drill sample, a sandstone of the Dillinger member (Kimberley formation, Gale Crater, Mars), was analyzed by CheMin X-ray diffraction (XRD) in the MSL Curiosity rover. From Rietveld refinements of its XRD pattern, Windjana contains the following: sanidine (21% weight, ~Or 95 ); augite (20%); magnetite (12%); pigeonite; olivine; plagioclase; amorphous and smectitic material (~25%); and percent levels of others including ilmenite, fluorapatite, and bassanite. From mass balance on the Alpha Proton X-ray Spectrometer (APXS) chemical analysis, the amorphous material is Fe rich with nearly no other cations—like ferrihydrite. The Windjana sample shows little alteration and was likely cemented by its magnetite and ferrihydrite. From ChemCam Laser-Induced Breakdown Spectrometer (LIBS) chemical analyses, Windjana is representative of the Dillinger and Mount Remarkable members of the Kimberley formation. LIBS data suggest that the Kimberley sediments include at least three chemical components. The most K-rich targets have 5.6% K 2 O, ~1.8 times that of Windjana, implying a sediment component with >40% sanidine, e.g., a trachyte. A second component is rich in mafic minerals, with little feldspar (like a shergottite). A third component is richer in plagioclase and in Na 2 O, and is likely to be basaltic. The K-rich sediment component is consistent with APXS and ChemCam observations of K-rich rocks elsewhere in Gale Crater. The source of this sediment component was likely volcanic. Finally, the presence of sediment from many igneous sources, in concert with Curiosity's identifications of other igneous materials (e.g., mugearite), implies that the northern rim of Gale Crater exposes a diverse igneous complex, at least as diverse as that found in similar-age terranes on Earth.

  20. Quality of the Fosso della Casaccia: analysis of the macroinvertebrates colonizing artificial substrates; Stato di qualita` del fosso della Casaccia: analisi dei macroinvertebrati che colonizzano substrati artificiali

    Energy Technology Data Exchange (ETDEWEB)

    Prato, S.; Morgana, J.G.; Antonelli, D.; Folletto, A. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-01-01

    Aim of this work is to analyse the environmental quality of a small stream, the Fosso della Casaccia, flowing near Research Centre of ENEA (Rome, Central Italy). The study was carried out comparing zoo benthic communities of two sampling sites, chosen upstream and downstream the sewage of the Research Centre. Macro invertebrates were sampled using artificial substrates and standard hand net. Taxa number and distribution along along the watercourse were compared. Moreover, biotic index values (I.B.E.=Indice Biotico Esteso) were calculated using data on macro invertebrates collected with both sampling methodologies. Artificial substrates were also useful in establishing colonization patterns at each sampling site, and bio masses of individuals belonging to different trophic groups. The results show the greater sampling effectiveness of artificial substrates, confirming their usefulness for establishing the environmental quality. [Italiano] Il presente lavoro prende in considerazione la qualita` ambientale del Fosso della Casaccia, un piccolo corso d`acqua che scorre in prossimita` del Centro di Ricerche ENEA Casaccia (Italia Centrale). Lo studio e` stato realizzato in base al confronto fra le comunita` zoobentoniche di due stazioni sperimentali situate a monte e a valle dello scarico di acque reflue del centro. Il campionamento dei macroinvertebrati e` stato effettuato utilizzando due diversi metodi di raccolta: i substrati artificiali e il retino immanicato standard. Gli organismi sono stati classificati in unita` sistematiche, e si e` analizzata la loro distribuzione lungo il corso d`acqua. Inoltre sono stati calcolati i valori degli indici biotici I.B.E. (Indice Biotico Esteso) utilizzando i dati ottenuti con le due metodologie di campionamento. L`uso di substrati artificiali in ogni stazione di campionamento e` stato utile anche per stabilire il tipo di colonizzazione, l`abbondanza e le biomasse degli individui appartenenti ai vari gruppi trofici. I nostri

  1. Issues relating to classification of colluvial soils in young morainic areas (Chełmno and Brodnica Lake District, northern Poland

    Directory of Open Access Journals (Sweden)

    Świtoniak Marcin

    2015-06-01

    Full Text Available Colluvial soils (in Polish: gleby deluwialne are an important part of the soil cover in young morainic landscapes of northern Poland. They evolved as a result of the accumulation of eroded material at the foot of the slopes and bottoms of closed depressions. The aim of this study was to determine the systematic position of colluvial soils commonly found in the Chełmno and Brodnica Lake District, northern Poland. Ten soil pits located in different types of landscapes were selected for testing soil properties. The colluvial material is characterized by diversified properties: thickness, particle-size distribution, organic carbon content, color, pH, and base saturation. As a result, the investigated soils represent broad spectrum of typological units according to Polish Soil Classification (2011. Some of them contain epipedons mollic and meet the criteria of colluvial chernozemic soils. They were found mainly on buried black earths in areas with small slope inclinations. Many pedons contain pale colored acidic colluvial material with low base saturation and low organic carbon content and must be classified as other types: arenosols (in Polish: arenosole or rusty soils (in Polish: gleby rdzawe. These soils occur mostly in areas with intensive relief and overlay the different soil types, including rusty soil and organic soils. They are formed as a result of soils lessivés and rusty soils truncation. An introduction of the additional units of “proper colluvial soils” which have epipedon ochric, and “rusty-colluvial soils” with endopedon sideric to the next edition of Polish Soil Classification would enable a more precise expression of the genesis of these soils in the type rank. Moreover, the definition of chernozemic colluvial soils could be extended to colluvial soils with umbric horizon. Classifying soils derived from colluvial material as soils of other types leads to the disappearance of this units on maps and underestimation of the

  2. Architecture of buried reverse fault zone in the sedimentary basin: A case study from the Hong-Che Fault Zone of the Junggar Basin

    Science.gov (United States)

    Liu, Yin; Wu, Kongyou; Wang, Xi; Liu, Bo; Guo, Jianxun; Du, Yannan

    2017-12-01

    It is widely accepted that the faults can act as the conduits or the barrier for oil and gas migration. Years of studies suggested that the internal architecture of a fault zone is complicated and composed of distinct components with different physical features, which can highly influence the migration of oil and gas along the fault. The field observation is the most useful methods of observing the fault zone architecture, however, in the petroleum exploration, what should be concerned is the buried faults in the sedimentary basin. Meanwhile, most of the studies put more attention on the strike-slip or normal faults, but the architecture of the reverse faults attracts less attention. In order to solve these questions, the Hong-Che Fault Zone in the northwest margin of the Junggar Basin, Xinjiang Province, is chosen for an example. Combining with the seismic data, well logs and drill core data, we put forward a comprehensive method to recognize the internal architectures of buried faults. High-precision seismic data reflect that the fault zone shows up as a disturbed seismic reflection belt. Four types of well logs, which are sensitive to the fractures, and a comprehensive discriminated parameter, named fault zone index are used in identifying the fault zone architecture. Drill core provides a direct way to identify different components of the fault zone, the fault core is composed of breccia, gouge, and serpentinized or foliated fault rocks and the damage zone develops multiphase of fractures, which are usually cemented. Based on the recognition results, we found that there is an obvious positive relationship between the width of the fault zone and the displacement, and the power-law relationship also exists between the width of the fault core and damage zone. The width of the damage zone in the hanging wall is not apparently larger than that in the footwall in the reverse fault, showing different characteristics with the normal fault. This study provides a

  3. Dose evaluation for workers employed in an industry involving enamel paints containing zirconium silicate; Valutazione di dose per i lavoratori occupati in una industria che utilizza vernici a smalto contenenti silicato di zirconio

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Berico, M.; De Zaiacomo, T.; Formignani, M.; Ianni, A.; Nobili, C.; Sandri, S.; Vasselli, R. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    In the frame of the European Recommendations for radiological protection, an evaluation of the annual dose has been made for workers employed in an industry for the production of sanitary equipment involving the use of enamel paints containing zirconium silicate. [Italian] Nella prospettiva dell'applicazione della direttiva europea relativa alla protezione radiologica dei lavoratori, vengono presentati i risultati relativi alla valutazione di dose annuale complessiva per i lavoratori occupati in una industria per la produzione di articoli igienico-sanitari che utilizza vernici a smalto contenenti silicato di zirconio. Il fine e' la valutazione del problema radioprotezionistico per gli addetti a causa delle impurezza radioattive presenti nei materiali utlizzati.

  4. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible) by David Fassmann (1725)

    OpenAIRE

    Ekaterina A. Skvortcova

    2017-01-01

    The journal created by David Fassmann (1683–1744), Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987). The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, w...

  5. ‘Unkind and cruel, to deceive your Son | In borrow’d Shapes, and his Embrace to shun’: Mother-son love in T. S. Eliot’s ‘La Figlia Che Piange’

    Directory of Open Access Journals (Sweden)

    Matthew Geary

    2015-01-01

    Full Text Available T. S. Eliot's "La Figlia Che Piange" (1916 is a curious anomaly in his early works. It stands out as a love poem of outstanding grace portraying a more positive relationship to the feminine compared to other poems contemporaneous with its writing such as "The Love Song of St. Sebastian" (1914 and "Hysteria" (1915. This essay shows the import of Eliot's chosen epigraph for "La Figlia" taken from Virgil's Aeneid to have been largely neglected or misread by critics. As a consequence, it argues that critical readings have crucially missed the presence of a shrouded maternal aspect within the poem. Through the lens of Lacanian psychoanalysis and the work of adherents to Lacanian theory — such as Bruce Fink, Shoshana Felman and Slavoj Zizek — this paper newly argues that the poem's meditation on the issues of union and separation between two lovers is in fact a screen for deeper unconscious ambivalent feelings between mother and son. That is to say, Eliot's "La Figlia Che Piange" shows a failed attempt to reconstruct, traverse and separate from the "fundamental fantasy" unconsciously orientating the male speaker of the poem and his desire.

  6. Genesis and classification of the soils developed from the sediments of the former Oleszek mill pond basin (the Chełmińskie Lakeland, N Poland / Geneza i pozycja systematyczna gleb wykształconych z osadów niecki dawnego stawu młyńskiego Oleszek (Pojezierze Chełmińskie

    Directory of Open Access Journals (Sweden)

    Mendyk Łukasz

    2015-03-01

    Full Text Available Budowa i funkcjonowanie młynów wodnych znacznie wpłynęły na przekształcenie środowiska przyrodniczego w ich otoczeniu, przede wszystkim na zmiany rzeźby terenu i warunków wodnych. Obszar badañ obejmuje nieckę dawnego stawu młyńskiego Oleszek w okolicach wsi Borówno, w zachodniej części Pojezierza Chełmińskiego, około 20 km na północny wschód od Torunia. Celem badañ było określenie genezy gleb wykształconych z osadów zakumulowanych w niecce dawnego stawu młyńskiego Oleszek. Pięć profili glebowych w transekcie o długości około 550 m zlokalizowanym wzdłuż Strugi Rychnowskiej stanowiącej oś podłużną niecki. Wszystkie przeanalizowane gleby zbudowane są z osadów wypełniających nieckę dawnego stawu młyńskiego. Gleby w opisywanej niecce powstały w wyniku wielu nakładających się procesów, takich jak: proces mułotwórczy, aluwialny, koluwialny oraz glejowy. Dwa z analizowanych profili glebowych (profile 3 i 4 spełniaj¹ kryteria wydzielania gleb organicznych limnowych typowych (Systematyka gleb Polski 2011. Jako pozycję systematyczną kolejnych dwóch gleb (profile 2 i 5 zaproponowano gleby mułowate. W związku z problemami klasyfikacyjnymi dotyczącymi tego typu gleb, przy opracowaniu aktualizacji Systematyki gleb Polski należałoby wprowadzić w typie gleb glejowych podtyp gleb mułowatych lub mułowato-glejowych, obejmuj¹cy gleby wytworzone z mineralno-organicznych utworów aluwialno-mułowych. Cztery wymienione powyżej profile zostały zaklasyfikowane jako Histosols (3 i 4 i Gleysols (2 i 5 według klasyfikacji WRB (2014. Jednostki glebowe wykształcone z osadów aluwialnych (mady wg SgP 2011 lub Fluvic Phaeozems wg WRB 2014 występują w proksymalnej części stawu (cofce.

  7. Il piu grande centro europeo di ricerca oggi festeggia l'anniversario del Nobel di Rubbia e Van der Meer. Cern, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia

    CERN Multimedia

    Durante, E

    2003-01-01

    "CERN, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia" [CERN, twenty years of looking towards the future. The present challenge is the particle accelerator that will be ready in 2007, which will try to reveal the secrets of matter] (2 pages)

  8. Analytical developments in the Wong-Fung-Tam-Gao radiation model of thermal diffusivity

    International Nuclear Information System (INIS)

    Lucia, U.; Maino, G.

    2004-01-01

    When the thermal diffusivity, χ, of a thin film on a substrate is measured by means of the mirage method, the photothermal deflection of the probe beam is determined by the heat radiation field contributed by the film and the substrate, heated by the pump beam. A two-dimensional algorithm is here presented in order to deduce the measure of the diffusivities of the film and the substrate in one set of mirage detection from the experimental data

  9. a preliminary study of soil fung study of soil fungal diversity of dye

    African Journals Online (AJOL)

    userpc

    of fungal species capable of surviving in dye-contaminated soils, a capability to ... soil, water, flora, fauna, livestock and hum population. ... Similarly, the impact of the discharged effluents from this .... Integrated water management and CP.

  10. Pathogenicity evaluation of native isolates of entomopathogenic fungí against andean weevil, Premnotrypes vorax (Hustache

    Directory of Open Access Journals (Sweden)

    Giselle Rivera

    2001-07-01

    Full Text Available The main goal of this study was pathogenicity evaluation of Beauveria bassiana and Metarhizium anisopliae native isolates, obtained from natural habitats and stocked potato, against potato andean weevil, Premnotrypes vorax (Hustache (COLEOPTERA: Curculionidae, and important potato insect pest in Colombia and other Andean countries. Patogenicity was determined by laboratory bioassays, using either reared insects or field captured insects. Insect rearing data are presented. Pathogenicity evaluation was express as mortality against time, estimating LT50 and LT90 for all the fungal isolates, and mortality against spore concentration, estimating CL50 for two selected isolates. In all cases, total mortality percentils were above 45%. Differences between reared and field captured insects were evident. According to obtained data one of the fungal isolates: B. bassiana 9770, obtained from R vorax larva (TL50: 4.7 days - 9.8 days; TL90: 14.1 days - 20.8 days; CL50:7.03 x 104spores/ml appears as a promisory fungal isolate for further studies. Out of this study, differences in the andean weevil, P. vorax, adult mortality, with regard to entomopathogenic fungal isolate and insect origin were manifest.

  11. Produkt- und Innovationsmanagement (PIM ZB MED. Prozess zur laufenden Überprüfung des Angebots

    Directory of Open Access Journals (Sweden)

    Gail, Fabian

    2015-12-01

    Full Text Available With the integrated process of “product and innovation management” ZB MED has created the basis for the continuous updating of the product portfolio. The existing products are maintained by those in charge with the help of product sheets, tested ideas for changes to existing or new products are checked transparently.

  12. Talaromyces marneffei-fungæmi i patient fra Thailand med nydiagnosticeret hiv

    DEFF Research Database (Denmark)

    Nørredam, Marie; Porskrog, Anders; Ocias, Lukas Frans

    2017-01-01

    had a stopover in Copenhagen on her way to Thailand from Greenland. A thoracic X-ray showed bilateral interstitial changes. Examinations showed positive HIV-test with a CD4-count of 21/microlitre. Moreover, fungaemia with T. marneffei was detected by cultivation. Highly active antiretroviral therapy...

  13. Louis Blajan, Dottore in Medicina Veterinaria: Il dinamico veterinario che seppe traghettare l’Organizzazione Mondiale per la Sanità Animale (Office International des Épizooties: OIE nel mondo moderno

    Directory of Open Access Journals (Sweden)

    Anon.

    2010-03-01

    Full Text Available Nato il 10 aprile 1924 a Lahage (nell’Alta Garonna, in Francia, Louis Blajan si è spento lo scorso 10 febbraio 2010 a Mont-de-Marsan.Dopo aver frequentato il Lycée Pierre de Fermat di Tolosa, nel 1948 Louis completa gli studi presso la Scuola di Veterinaria di Tolosa. Nel 1949, si diploma all’Institut d’élevage et de médecine vétérinaire des pays tropicaux (IEMVT e dal 1949 al 1952 è nel territorio d’oltremare francese del Mali. Tornato in Francia, dal 1953 al 1968 Louis esercita come veterinario di Stato presso il Ministero dell’Agricoltura, responsabile per l’afta epizootica, la peste suina e la malattia di Newcastle, nonché come Presidente del Comitato consultivo per le malattie infettive. In seguito, viene nominato Ispettore capo veterinario e Responsabile per la politica di controllo delle frontiere.Nel 1952, Louis sposa Janine, moglie affezionata che lo appoggia con ardore in ogni fase della sua carriera e perde la vita in un incidente un mese prima che il marito vada in pensione nel 1990.Dal 1968 al 1977, Louis è Direttore tecnico di Cofranimex (Compagnie Française pour l’importation et l’exportation des animaux reproducteurs et leur semence e dal 1977 al 1978 riveste il ruolo di Direttore dell’Association pour le développement des techniques de l’élevage français (ADETEF.Louis entra a lavorare nell’Office International des Épizooties (oggi noto come Organizzazione Mondiale per la Sanità Animale o ‘OIE’ dove, dal 1978 al 1980, occupa la posizione di Direttore del Dipartimento tecnico. Due anni più tardi, nel 1980, viene eletto Direttore Generale, coronando il sogno di ogni professionista della medicina veterinaria e raggiungendo l’apice della propria carriera. Rieletto nel 1985, si ritira dalla vita lavorativa nel 1990.Durante gli anni in cui fu a capo dell’OIE, Louis seppe trasformare quella che all’epoca era una struttura antiquata in un’organizzazione internazionale moderna ed

  14. Analyse de l’effet du type de tâche sur l’évolution des connaissances à la suite d’un processus d’apprentissage collaboratif

    Directory of Open Access Journals (Sweden)

    Sabine Pohl

    2009-04-01

    Full Text Available L’article analyse l’effet du type de tâche sur le partage des connaissances à la suite d’un processus d’interaction dans un contexte d’apprentissage collaboratif. Cet apprentissage collaboratif est réalisé dans le cadre d’une formation universitaire. Deux types de tâches sont réalisés par les apprenants. Ils se distinguent selon que la solution nécessite ou non la confrontation de points de vue portant sur le champ conceptuel lié à l’apprentissage à réaliser. La méthode de collecte des données consiste en un entretien semi-directif. Les résultats montrent un effet du type de tâches sur l’évolution des connaissances partagées des apprenants.This longitudinal research analyses the effect of the type of task on the development of knowledge following an interaction process in a collaborative learning context. The framework for this collaborative learning is a university education. Two types of tasks are provided to the learners. They differ depending on whether or not the solution requires the comparison of points of view on the conceptual scope of what is to be learned. The data are collected through a semi-directive interview. The results show that the type of task has an effect on the development of shared knowledge.

  15. William Franke, Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura William Franke, On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Interpretation of Literature

    Directory of Open Access Journals (Sweden)

    Laura Lucia Rossi

    2010-06-01

    Full Text Available

    In this article we propose the translation of William Franke’s paper On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Criticism of Literature, in which the American scholar presents the hermeneutic method of the ancient commentators of Homer, with particular reference to the critic practice applied by the Neoplatonic Porphyry in his De Antro Nympharum. With this treatment Franke proposes and hopes for the return to an interpretive method, called philosophical or speculative, also for contemporary criticism.

    In questo articolo è presentata la traduzione del saggio di William Franke Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura, in cui lo studioso americano presenta il metodo ermeneutico degli antichi commentatori di Omero, con particolare riferimento alla critica praticata dal neoplatonico Porfirio, proponendo e auspicando il ritorno ad una modalità interpretativa, detta filosofica o speculativa, anche per la critica contemporanea.

  16. Impact of environmental pollution on the incidence of malignant neoplasms of upper respiratory tract in the population of Mysłowice, Imielin and Chełm Śląski

    Directory of Open Access Journals (Sweden)

    Jerzy Stockfisch

    2014-03-01

    Full Text Available Background. The paper presents a retrospective analysis of cases of the upper respiratory tract malignant tumors in the settlement: Mysłowice, Imielin, Chełm Śląski based on the patients’ medical history treated in a hospital laryngological ward in Mysłowice between 1995 and 2004. The inspiration to write the paper was the significant frequency of the upper respiratory tract malignant tumor cases in the main areas of Mysłowice; Piasek and Rymera estate. The aim of the study was the assessment of relationship between environmental pollution and territorial diversity in the morbidity of head and neck cancer. Material and methods. The study involved a group of 130 patients with cancer of the upper respiratory tract and a control group of 145 healthy subjects of similar age and sex, living in the different regions of the surveyed towns in the comparable proportions and in the group of patients. The paper aimed to assess the relationship between territorial diversity of the upper respiratory tract cancers, and environmental risk factors. Results. The analysis was based on environmental pollution data. It was confirmed that the geographic picture of the incidence of the upper airways malignant tumors showed that Mysłowice central districts: Piasek and estate Rymera, indicated this region to be particularly critical one. Conclusions. The increased number of morbidity cases in these districts may be associated with: environmental risk factors, increased consumption of high percentage alcohol, excessive amount of smoked cigarette and low socio-economic status of the patients.

  17. Zur chemie der marsoberfläche

    Science.gov (United States)

    Keil, Klaus; Clark, Benton C.; Baird, A.K.; Toulmin, Priestley; Rose, Harry J.

    1978-01-01

    Analyses of 13 samples of Martian surface materials with the Viking X-ray fluorescence spectrometers show SiO2 similar to that of terrestrial mafic rocks, whereas Fe2O3, Cl, and S are higher and Al2O3, K2O, Rb, Sr, Y, and Zr are lower. Low totals suggest presence of CO2, H2O, and Na2O. Duricrust fragments are higher in S than fines, but samples from both landing sites are surprisingly similar. We suggest that Martian surface materials are aeolian deposits of complex mixtures of weathering products of maficultramafic rocks, possibly consisting of iron-rich clays, sulfates, iron oxides, carbonates, and chlorides.

  18. La nuova fisica che ci aspetta

    CERN Multimedia

    Shiga, David

    2007-01-01

    The big accelerator that will enter in function at CERN at the end of the year will have the hard task to verify the relevance of the string theory, today the better candiddate to be the famous "theory of everything" that physicists are looking for since decades. (1 page)

  19. Using Screencasts in ChE Courses

    Science.gov (United States)

    Falconer, John L.; deGrazia, Janet; Medlin, J. Will; Holmberg, Michael P.

    2009-01-01

    Screencasts are digital recordings of the output from a computer monitor, including narration. Their use was piloted in five chemical engineering courses and the feedback from students was overwhelmingly positive. The screencasts were produced on Tablet PCs using Camtasia Studio software and were posted to the Blackboard classroom management…

  20. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible by David Fassmann (1725

    Directory of Open Access Journals (Sweden)

    Ekaterina A. Skvortcova

    2017-12-01

    Full Text Available The journal created by David Fassmann (1683–1744, Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987. The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, which is significant as they were an important instrument for disseminating certain notions about Russia. While the illustration to the first dialogue of the suite juxtaposes Peter and Ivan, the illustration to the second one emphasizes the similarities between them. So the image of the “tyrant” and “barbarian” Ivan becomes a reference point with which a reader is urged to compare Peter’s deeds, seeing not only the differences but also the similarities. This greatly contributes to the creation of the multifaceted image of Russia of the early 18th century. The characters of the second illustration—a tiger and an executioner—can be identified as Ivan and Peter only if the reader takes into consideration an epigram to the illustration, the illustration to the previous dialogue, the text of the next Entrevuë, and facts about the execution of the strel’tsy known from other texts and images, about which Fassmann remains silent in the spirit of ars dissimulandi, which was typical for baroque culture. The paper offers an attempt to trace the iconography of the tyrant as a tiger. In the frontispiece to the 85th Entrevuë, a secretary bringing news from the world of the living and a portrait of Catherine I emphasize the connection of the past and the present, i.e., history and policy. Finally, the illustration to the last dialogue of the series returns to the glorification of Peter the Great declared in the first dialogue.

  1. A Comprehensive Model of the Dry Desulphurisation Process Une modélisation non empirique du procédé de désulfuration par voie sèche

    Directory of Open Access Journals (Sweden)

    Flament P.

    2006-11-01

    humide des fumées, le procédé de désulfuration par voie sèche reste un moyen attractif pour éliminer le dioxyde de soufre lorsque le taux de réduction souhaité ne dépasse pas 90 %. Dans cette technique, l'élimination du SO2 se fait en injectant directement dans les produits de combustion de très fines particules d'un absorbant calcique tel que le calcaire (CaCO3 ou la chaux (Ca(OH². L'absorbant est tout d'abord transformé en oxyde de calcium (CaO avant de réagir avec le SO2 pour former un composé stable : le sulfate de calcium (CaSO4. Bien que les réactions globales soient extrêmement simples, une description complète des mécanismes nécessite de connaître à la fois, les propriétés physiques initiales de l'absorbant et leur évolution durant la réaction. De plus, les conditions d'injection des particules jouent un rôle prépondérant dans le procédé de désulfuration par voie sèche. Tous ces aspects sont traités dans ce papier. Le modèle de désulfuration a d'abord été testé seul par comparaison avec les données cinétiques de la Fondation Internationale de Recherches sur les Flammes (FRIF, puis, couplé avec le code KIVA, il a été utilisé pour simuler la désulfuration dans un nouveau type de chaudière développée par Babcock Entreprise et l'Institut Français du Pétrole (chaudière 'AUDE'. Dans ce dernier cas, l'objectif poursuivi était de déterminer la meilleure configuration à donner au système d'injection des particules pour obtenir un taux de désulfuration maximum. La dispersion des particules étant un paramètre important du procédé de désulfuration, un exemple de validation du modèle de dispersion est également traité. L'injection de particules dans une couche de mélange a été choisie comme cas test. L'accord entre les valeurs expérimentales de Ando et al. (1990 et les calculs effectués avec KIVA est satisfaisant.

  2. La spirale dell’azzardo: una subcultura del gioco che “evapora” le relazioni / La spirale du jeu de hasard : une sous-culture qui empêche toute relation / The gambling: a subculture of game that “burns” the relationships

    Directory of Open Access Journals (Sweden)

    Molin Valentina

    2011-07-01

    Full Text Available In this paper I have analysed the characteristics of what I define the “gambling subculture”, which is detectable in certain gaming environments and in subgroups of particularly “rabid” players. Within these subcultures there have been identified rules and sanctions, values, consolidate behaviours, characterization of relationships and interactions, and the conclusion is that what is built within the gambling environment is a separate universe, an “outer reality”, in which the values of the world “outside” change. It was also possible to conclude that, to join the gambling world for a gambler – learning its rules, sharing its values, developing relations inside it – represents a stimulus for gambling habits, as it allows to consider as “normal” their behaviour thanks to positive feedback from their groups of fellow players, and to the neutralization of possible negative feedback from “non-players”.Nel presente contributo vengono analizzate le caratteristiche di quella che ho definito “subcultura dell'azzardo”, rilevabile in determinati ambienti ludici e in sotto-gruppi di giocatori particolarmente “accaniti”. Di queste forme di subcultura sono state individuate norme e sanzioni, valori, comportamenti consolidati, caratterizzazione delle relazioni e delle interazioni, giungendo alla conclusione che quello che viene costruito negli spazi di gioco rappresenta un universo separato, un “extraluogo”, nel quale vengono scritte nuove regole e nel quale cambiano i valori rispetto al mondo “esterno”. È stato possibile inoltre concludere che l'adesione all'“universo gioco” – l'interiorizzazione delle sue norme, la condivisione dei suoi valori, lo sviluppo di relazioni al suo interno – rappresenta un fattore di mantenimento della condotta ludica, poiché permette di considerare “normale” il proprio comportamento grazie ai rinforzi positivi che giungono dal gruppo dei compagni-giocatori e alla

  3. La normativa italiana sui contratti di lavoro a tempo determinato nel settore della scuola è contraria al diritto dell’Unione: la Corte di Giustizia UE apre al risarcimento per i docenti che abbiano svolto supplenze annuali per la copertura di posti vacanti

    Directory of Open Access Journals (Sweden)

    Arando Plaia

    2015-01-01

    Full Text Available La Corte di Giustizia UE con sentenza 26 novembre 2014, cause riunite C-22/13, C-61/13, C-62/13, C-63/13, C-418/13, Mascolo, ha ritenuto che la normativa europea sul lavoro a tempo determinato, applicabile anche al settore pubblico della scuola (casi Rosado Santana, Marrosu Sardino e Adelener, osta ad un sistema di assunzione per svolgere “supplenze annuali” nelle scuole pubbliche che non prevede almeno una delle seguenti “misure di prevenzione”: l’indicazione delle “ragioni oggettive” che giustificano il rinnovo dei contratti; la determinazione della “durata massima totale dei contratti” o del “numero dei loro rinnovi”, in assenza peraltro di una misura sanzionatoria proporzionata, effettiva e dissuasiva, da applicarsi in caso di utilizzo abusivo di successione di contratti a tempo determinato (clausola 5 dell’accordo quadro 18 marzo 1999 allegato dir. 1999/70/CE. Sebbene dunque il settore dell’insegnamento implichi inevitabilmente una certa “flessibilità”, e la normativa europea non enunci un obbligo generale degli Stati membri di prevedere la sanzione della trasformazione dei contratti di lavoro a tempo determinato in contratti a tempo indeterminato (CGUE 3 luglio 2014, Fiamingo, causa C-362/13, la normativa italiana non prevede misure atte a “prevenire” o “sanzionare” l’utilizzo abusivo di successione di contratti a tempo determinato. Questo (e non altro il principio di diritto affermato dalla Corte di giustizia: la sentenza ribadisce l’assenza di misure di prevenzione imposte dalla disciplina europea nonché di una sanzione risarcitoria rispetto al ricorso abusivo ai contratti a tempo determinato nel settore scolastico.

  4. Doutorado-sanduíche em enfermagem: relato de experiência Doctorado sándwich en enfermería: relato de experiencia Sandwich doctoral program in nursing: an experience report

    Directory of Open Access Journals (Sweden)

    Rosane Arruda Dantas

    2009-06-01

    Full Text Available Relato de experiência acerca de estágio de doutorando-sanduíche realizado com bolsa da Coordenação de Aperfeiçoamento de Pessoal de Nível Superior, durante o período de outubro de 2005 a janeiro de 2006, na Faculdade de Enfermagem de D. Ana Guedes, no Porto, em Portugal, instituição já visitada na graduação. Tive a oportunidade de replicar a metodologia de parte da dissertação com crianças portuguesas. Isso permitiu estudo comparativo entre duas culturas que guardam afinidades, mas têm características distintas. Além disso, ministrei aulas, participei de cursos e seminários e aprofundei os conhecimentos acerca da Teoria da Universalidade e Diversidade do Cuidado Cultural. Considero que esta experiência é um estímulo para a garantia da autonomia do enfermeiro na assistência de enfermagem, como pesquisador e docente, ampliando conhecimentos e os inserindo no processo de cuidado. Ademais, influencia positivamente no amadurecimento psicológico, cultural e social do doutorando.Relato de experiencia acerca de pasantía de doctorado sándwich realizado con suporte financiero de la Coordinación de Mejora del Personal del Nivel Superior, durante el período de octubre de 2005 a enero de 2006, en la Facultad de Enfermería de D. Ana Guedes, en Porto, Portugal, institución ya visitada durante la graduación. Tuve la oportunidad de replicar la metodología de parte de la disertación junto a niños portugueses. Esto permitió un estudio comparativo entre dos culturas que guardan afinidades, pero tienen características distintas. Además, ministré clases, participé de cursos y seminarios y me profundicé en los conocimientos acerca de la Teoría de la Universalidad y Diversidad del Cuidado Cultural. Considero que esta experiencia es un estímulo para la garantía de la autonomía del enfermero en la atención de enfermería, como investigadora y docente, ampliando conocimientos e insertándolos en el proceso de cuidado. Adem

  5. Variations autour de la tâche dans l'enseignement / apprentissage des langues aujourd'hui What kind of tasks are used for L2 teaching and learning today?

    Directory of Open Access Journals (Sweden)

    Elke Nissen

    2011-10-01

    Full Text Available Cet article se donne pour objectif d'identifier les types de tâches, et leurs dénominateurs communs, qui sont présentés aujourd'hui – où "l'approche par les tâches" est soutenue par le Conseil de l'Europe – aux apprenants. Il analyse pour cela les articles issus de deux numéros de revues et un ouvrage collectif récents. Il apparaît que la grande majorité des scénarios pédagogiques s'y inscrit dans la perspective actionnelle... du moins d'après la déclaration des auteurs, car leur définition de ce qu'est une tâche ne correspond pas toujours à celle du CECR. Pour le public visé, étudiants ou professionnels, on propose le plus souvent des mono-tâches, mais également des projets, ou encore des simulations avec un enchaînement de plusieurs tâches. Elles s'inscrivent généralement dans la (future réalité sociale des apprenants, mais certaines laissent également la place à des thèmes artistiques ou (interculturels. Contrairement à ce que l'on aurait pu attendre dans une démarche qui responsabilise l'apprenant, le recours à Internet n'est pas toujours systématique.At a time when action- and task-based learning is sustained by the European Council, this paper explores which types of tasks are given to second language learners today and what aspects these tasks have in common. The paper analyses two recent issues of scientific journals and one collective book. The analysis shows that the majority of pedagogical scenarios described in these texts claim to adopt an action- and task-based approach. However, in reality the way they define a task does not always correspond to the definition given by the European Framework of Reference for Languages. The described tasks are exclusively dedicated to higher and professional education; they are mostly single tasks, but they can also be projects and simulations including several successive tasks. They generally correspond to the learners' (future reality, with themes that are

  6. Approche multidimensionnelle de la difficulté objective dans une tâche d’anticipation coï ncidence Multidimensional approach of objective difficulty in an aiming task

    Directory of Open Access Journals (Sweden)

    P. Deneuve

    2010-09-01

    Full Text Available

     

    Cet article a pour objet de proposer une nouvelle procédure pour classer les tâches motrices à caractère informationnel à partir d’une approche multidimensionnelle de la difficulté. L’expérimentation a consisté à faire passer des tests de pointage à 345 sujets sur cibles mobiles créées et gérées par ordinateur. Les paramètres des cibles ont été choisis pour leur indépendance et la possibilité de les positionner sur des échelles numériques. Trois descripteurs ont été retenus : la vitesse de déplacement, la surface de la cible et l’incertitude spatiale. La performance ne semblant pas être la seule variable dépendante résumant la difficulté, il lui a été adjoint trois autres variables : les tentatives, le temps de réaction et le temps moteur. En utilisant des outils statistiques permettant des analyses de données multidimensionnelles (CAH, AFC, il a été possible soit d’agréger des tâches aux profils identiques soit de les différencier en fonction du poids de chaque descripteur sur les variables dépendantes. Surtout, il est envisageable de préciser l’apport de chaque variable dans la définition de la difficulté que se donne a posteriori le chercheur.
    PALABRAS CLAVE: Difficulté, traitement de l’information, tâche motrice, classification, analyse de données.

    This article deals with a new method to classify informational motor tasks, through a multidimensional approach of difficulty. The following experiment is used: 345 subjects are asked to point at computer-managed mobile targets. The 3 selected target parameters are: velocity, area and spatial uncertainty. Independence and numerical scalability are the reasons for this choice. As performance does not sump up difficulty, other dependent variables have been added: number of attempts, reaction time and motor time. The use of

  7. Mündlich-praktischer Teil des Zweiten Abschnitts der Ärztlichen Prüfung in Freiburg 2012 - Analyse der Notenvergabe zur Überprüfung von Qualitätssicherungsmaßnahmen

    OpenAIRE

    Schickler, A; Brüstle, P; Biller, S

    2015-01-01

    Aim: The aim of this study is to analyze the grades given for the oral/practical part of the German State Examination at the Medical Faculty of Freiburg. We examined whether or not the grades given for the written and the oral/practical examinations correlated and if differences in grading between the Freiburg University Medical Center (UMC) and the other teaching hospitals could be found.In order to improve the quality of the state examination, the medical school has been offering standardi...

  8. Doutorado sanduíche: considerações para uma experiência de sucesso no exterior Doctorado sándwich: consideraciones para una experiencia exitosa en el extranjero 'Sandwich PhD': considerations for a successful experience abroad

    Directory of Open Access Journals (Sweden)

    Marina de Goes Salvetti

    2013-03-01

    Full Text Available O estágio de doutorado no exterior, conhecido, no Brasil, como "Doutorado Sanduíche", é uma oportunidade de aprimorar as habilidades em pesquisa, destacar-se no meio acadêmico e estabelecer e/ou ampliar oportunidades de trabalho em contexto internacional. Neste artigo, descrevemos elementos-chave do processo de planejamento e desenvolvimento do Doutorado Sanduíche aprendidos por professores e alunos envolvidos na colaboração entre a Escola de Enfermagem da Universidade de São Paulo e a Lawrence S. Bloomberg Faculty of Nursing, Universidade de Toronto, Canadá, e apresentamos a participação em uma rede de doutorados, como alternativa ao Doutorado Sanduíche. A experiência internacional, quando bem planejada e desenvolvida, promove o desenvolvimento pessoal e profissional do aluno, favorece a internacionalização dos programas de pós-graduação e dos grupos de pesquisa brasileiros.Una estancia de doctorado internacional, "Doctorado Sándwich" como es conocido en Brasil, es una oportunidad de mejorar las habilidades de investigación, hacerse conocido académicamente y establecer y/o agrandar las oportunidades de trabajo en el contexto internacional. En este artículo, nosotros describimos factores importantes del proceso de la planificación y desarrollo del "Doctorado Sándwich" aprendidos por estudiantes y profesores involucrados en la colaboración entre la Escuela de Enfermería de la Universidad de São Paulo y la Facultad de Enfermería Lawrence S. Bloomberg, Universidad de Toronto, Canadá y presentamos la participación en una red de doctorados como una alternativa a la estancia doctoral internacional. La experiencia internacional, cuando bien planeada y desarrollada, promueve el desarrollo personal y profesional del estudiante y favorece la internacionalización de los programas de postgrado y de los grupos de investigación brasileños.International PhD internship, named "Sandwich PhD'" in Brazil, is an opportunity to

  9. Dicty_cDB: CHE694 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxcynxlrinqkxn*klqvnkik Translated Amino Acid seq...ANXPDNTPSATAREEVMGVVRSRFPPEFLNRIDDMILFNRLXRKDMDKI VEIQLXDLRKLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxc

  10. Che cos'è la conoscenza? un universo in espansione

    CERN Document Server

    Franceschini, Guiliano

    2017-01-01

    Il testo propone un viaggio nell'universo della conoscenza, tra le galassie di conoscenza (religione, scienza, arte), nel cervello (percezione, apprendimento, memoria) e nell'etica (dalla conoscenza all'educazione). Le argomentazioni si espandono attraverso un registro comunicativo intuitivo, tra divulgazione e speculazione, attraverso esempi e riferimenti concreti, rivolgendosi in alcuni casi direttamente al lettore.

  11. Dicty_cDB: CHE829 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dsl**sx*frlw*rf*m*n*t*wfpmlcpfrkttpttt*xm**xmpxrp*m* s*stckrmmrccp*tttxmxfkmsxkt*m*sxplx*rmlcxxxpr*mfixmsxrp...xm*s* stwkrmxrccp*ttxkmxixmsxkt*m*nqsxw*rmlc*kxx*lf Frame B: lfnfifnhsn*kknnn*ls*

  12. Dicty_cDB: CHE174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stallinum mRNA for putative vacuolar ATPase subunit 100 kDa subunit (vpha-a gene). 46 1e-10 4 CV164410 |CV164410.1 rsmsx...54 8e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia mil

  13. Pragmatic Idealism: Ernesto Che Guevaras Strategic Choice for Bolivia

    Science.gov (United States)

    2017-06-01

    security could be achieved through a more mature guerrilla movement. B. LITERATURE REVIEW A review of previous analysis and criticism regarding...was, he split his time prior to Bolivia between Tanzania and Czechoslovakia.24 Whether Guevara spent the majority of his time nursing the emotional ...believed it rational to pursue revolution prior to the maturation of a revolutionary movement as long as the objective

  14. Che fatica far festa all’Odin Teatret!

    DEFF Research Database (Denmark)

    Chemi, Tatiana

    2004-01-01

    A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark.......A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark....

  15. Dicty_cDB: CHE366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxxkxvkxxxxxkxgxxxxxxxx...xxxxg* TIXKXVXXFXXYNIXXXSXXXLVLRLXGGMQXFVKTXXGKTITLEVEGXDNIENVKXKIQ DKEGIPPDQQRXIFX...MQIFVKTLTGKTITLEVEGSDNIENVX Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxgxxfxxxxxxgxxxx...fxkxkxxxxxxxcxxxxxxxxrxxxxxxxxxxfxwv nnxkxgxxxxgx*hxkxixxpxsfkixrwyanxc*nxxw*nnhfrs*...tirrwsysf*lqyskrihspfsfkikr wyanlc*nshw*nnhfrs*rf**h*kcx Frame B: ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxx

  16. Le sfide che i figli degli immigrati devono affrontare

    Directory of Open Access Journals (Sweden)

    Sandra Sicurella

    2015-05-01

    Full Text Available Economic changes, poverty, wars, violence and socio-political conditions generated waves of migrants that irreversibly affect the daily lives in our country too. Children of migrants are requested to face many difficulties which are transformed into challenges on a daily basis in order to assert a position in the host society. The number of admissions of foreign children is constantly growing and often the culture clash may lead to exclusion. This is an extremely difficult situation, especially for children who sometimes do not have the adequate tools to deal with this.

  17. Einstein: I cento anni che sconvolsero il mondo

    CERN Multimedia

    Di Giorgio, Claudia

    2005-01-01

    In 1905, the german physicist published five articles about relativity, a theory which changed for ever our knowledge and our life. This beginning year will be "the mondial Year of Physcis" and the physics Community celebrate the Nobel Prize (⅓ page)

  18. Le parole che noi usiamo: l’errore in storia

    Directory of Open Access Journals (Sweden)

    Aurelio Musi

    2017-04-01

    Full Text Available Unlike the hard sciences, historiography lacks a specific nomenclature. The lexicon employed by historians is drawn from the plain language of everyday life. Therefore, the words of history are to be defined within the spatio-temporal framework, and to be construed through processes of contextualization and comparison. My work here stems from these considerations, and attempts to chart the occurrence of errors in historiography. In particular, I take into account the way in which historiographic mistakes arise from the intermingling of words, space, and historical time. Another significant aspect concerns the relationship between history, fiction, and arbitrariness. The latter concept is linked to historical interpretation, which constitutes the last stage of historiographical work, after the analysis and the reconstruction of events. The last part of this paper offers a typology of frequent errors in historiography.

  19. Dicty_cDB: CHE216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TNTTTAGTTCAATTGCAAACTTTATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCT...ATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCTTAAAACTTTAGNTGCCGAAACTA

  20. Il derubato che sorride. La tragedia umoristica di Pasolini

    Directory of Open Access Journals (Sweden)

    Stefano Casi

    2017-02-01

    Full Text Available In the studies about Pasolini’s work the analysis of the use of comedy and humor is often ignored. This article analyzes the relationship of Pasolini with the forms of comedy, from the indication of Charlot as emblematic point of reference for his own intellectual commitment to the development of an original meaning of the concept of humor. By analyzing statements and plays, a new aspect of Pasolini comes to light. In a conscious and tormented way, Pasolini adheres to humor as the main means of the bourgeoisie, entrusting to it much of its work in the last decade of his life. For Pasolini humor is the communication code of the bourgeoisie, that bourgeoisie uses to distance itself from reality. Thus, by using humor as alienating weapon inside the form-tragedy, Pasolini plans to fight bourgeoisie, challenging it on the ground of the theatrical representation of reality, through its own communication means.

  1. Integrating the ChE Curriculum via a Recurring Laboratory

    Science.gov (United States)

    Kubilius, Matthew B.; Tu, Raymond S.; Anderson, Ryan

    2014-01-01

    A recurring framework has been integrated throughout the curriculum via a Continuously Stirred Tank Reactor (CSTR) platform. This laboratory is introduced during the material and energy balance course, and subsequent courses can use these results when explaining more advanced concepts. Further, this laboratory gives students practical experience…

  2. Dicty_cDB: CHE818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8.1 Habrotrocha constricta 82 kDa heat shock protein 2 (hsp82-2) gene, partial cds. 88 3e-48 4 AF143854 |AF143854.1 Sinantherina soci...alis 82 kD heat shock protein (hsp82) gene, partial cds.

  3. CHE COSA RESTA DI CHERUBINI OGGI? DUE CASI DI STUDIO

    Directory of Open Access Journals (Sweden)

    Emanuele Miola

    2016-09-01

    Full Text Available A partire dagli anni Duemila, il fenomeno delle cosiddette risorgenze dialettali si è manifestato, nel panorama linguistico italiano, anche attraverso l’emergenza dei dialetti negli ambiti propri della Comunicazione Mediata dal Computer e, specialmente, sui siti internet creati ‘dal basso’, come l’enciclopedia libera e multilingue online Wikipedia. In questo articolo, si esaminerà il lascito di Cherubini e del suo Vocabolario milanese-italiano sull’edizione regionale lombarda della Wikipedia: gli articoli di quest’ultima saranno passati in rassegna, sia dal punto di vista ortografico, comparando le scelte del lessicografo milanese con quelle più in voga online, sia dal punto di vista morfo-sintattico, discutendo in questo secondo caso la presenza e la produttività di alcuni verbi sintagmatici. What remains of Cherubini today? Two case studies Since the beginning of the twenty-first century, the phenomenon of dialect resurgence has manifested in Italy through the emergence of dialects in Computer Mediated Communication, especially, on bottom-up created Web sites, like the free, multilingual, online encyclopedia Wikipedia. In this article, we will examine the legacy of Cherubini and his Milanese-Italian dictionary on the regional Lombard version of Wikipedia. We will review the articles both in terms of spelling, comparing the choices of Milanese lexicographer with those most utilized currently online, and from a morpho-syntactic point of view, discussing the presence and the productivity of some phrasal verbs.

  4. P. RICOEUR: UN’ANTROPOLOGIA CHE NON ESCLUDE IL FONDAMENTO

    Directory of Open Access Journals (Sweden)

    Attilio Danese

    2013-08-01

    Full Text Available A filosofia de Paul Ricoeur estáligada a uma exigência filosofica de não exclusão das inquietações que dizem respeito ao sentido do agir e do viver, demonstrando o laço indissolúvel entre antropologia, filosofia e busca das verdades últimas que dão sentido ao viver.

  5. Dicty_cDB: CHE850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DILFNGI EYQCKGWISGFTKCDWKGDSIER--- ---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*frid...---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticskn

  6. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    Santé Publique (ENSP) à Rennes et le Centre National de Référence des vibrions et du Choléra (CNRVC) à l'Institut Pasteur ... l'Alimentation, en France, dans le but de normaliser les protocoles d'étude et de recherche de V. cholerae et ..... Vibrio présente dans l'environnement avec les méthodes de détection habituelles.

  7. Dicty_cDB: CHE555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je

  8. ChE Undergraduate Research Projects in Biomedical Engineering.

    Science.gov (United States)

    Stroeve, Pieter

    1981-01-01

    Describes an undergraduate research program in biomedical engineering at the State University of New York at Buffalo. Includes goals and faculty comments on the program. Indicates that 58 percent of projects conducted between 1976 and 1980 have been presented at meetings or published. (SK)

  9. Una presenza che si fa ombra in Oriente

    OpenAIRE

    Giovanni Azzaroni

    2017-01-01

    In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre), China (shadow theatre) and Indonesia (shadow theatre), to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  10. Una presenza che si fa ombra in Oriente

    Directory of Open Access Journals (Sweden)

    Giovanni Azzaroni

    2017-03-01

    Full Text Available In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre, China (shadow theatre and Indonesia (shadow theatre, to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  11. 97 Luigi Malerba, Che vergogna scrivere, Milano: Mondadori, 1996 ...

    African Journals Online (AJOL)

    User

    This collection of four loosely-connected essays deals, inter alia, with the status of literature and the writer in society. The first, "Lo scrittore come fantasma", moves from the servile position of the author during the Renaissance, to the author becoming a producer of commodities with the advent of copyright in 1793, pointing.

  12. The bumpy face of che guevara: An interesting case

    Directory of Open Access Journals (Sweden)

    Kingshuk Chatterjee

    2017-01-01

    Full Text Available Placement of decorative tattoo on the skin may lead to various immunological, infective, and coincidental complications. Inoculation of human papillomavirus leading to development of verruca is an uncommon complication of tattoos. The present report highlights the development of verruca vulgaris, developing after 2 years of tattooing in a young male.

  13. à l'encoche sèche

    African Journals Online (AJOL)

    naturel est une matière première importante en industrie. Il intervient à 70% dans la ... caoutchouc naturel de cette région est en constante progression, due au .... L'analyse a été effectuée avec le test statistique de Duncan au risque alpha = 5 % avec les valeurs de LEM transformées en Arc Sinus. Racine carrée de LEM ...

  14. El Che y la natación

    Directory of Open Access Journals (Sweden)

    Ana Maria Peña Rojas

    2009-09-01

    Full Text Available Sobre la vida de Ernesto Guevara de la Serna se puede hablar de una trayectoria tan rica en todos los campos; que se pudiera decir del héroe de nuestra América, el guerrillero, el economista, el escritor, el fotógrafo y un gran apasionado por el deporte. Se aborda algunos aspectos relacionados con el Ché como practicante sistemático de la Natación en el sector residencial y escolar durante su vida, pues siempre le interesó la actividad deportiva a pesar de su escasa salud, por el padecimiento de asma bronquial desde su nacimiento. Tuvo junto a sus padres estancia en varios lugares, buscando condiciones para el progreso de su salud, pues además era el hijo primogénito y su madre padeció de la misma enfermedad durante su niñez, aunque heredó otras cosas muy buenas de ella. Supo sobreponerse con tesón y voluntad, tuvo gran incidencia en actividades relacionadas con la natación y otros deportes. Demostró gran destreza en el estilo Mariposa; aunque también practicaba el estilo pecho y el clavado. Su interactuar apasionado como deportista durante su juventud y adultez, lo hicieron más fuertes para enfrentar la vida, lo que posibilitó una formación integra en su persona; aquí se expresa la versatilidad e integridad y fortaleza de un hombre apasionado por la naturaleza, la formación de un hombre nuevo, con diferentes matices de ejemplaridad y paradigma de los pueblos de América Latina.

  15. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    polyunsaturated fatty acids omega 3 (EPA and DHA) of frozen sardine. The results ... Keywords : conservability, sardine, freezing, chemical weathering, omega-3 fatty acids, EPA, DHA, TVB-N ...... deterioration of salmon during frozen storage.

  16. L'impronta idrica di quello che mangiamo

    NARCIS (Netherlands)

    Bacenetti, J.; Lovarelli, D.; Fiala, M.; Hoekstra, Arjen Ysbert

    2015-01-01

    È stata recentemente approvata la norma ISO (ISO 14046 Water footprint – requirements and guidelines) per la definizione dell’impronta idrica (Water Footprint) (vedi box). Questo nuovo indicatore di sostenibilità ambientale permette di quantificare il consumo di acqua dolce associato, direttamente o

  17. Dicty_cDB: CHE547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 Translated Amino Acid sequence glleninni*q*tk*INKKKNNNHFFFLXFXIKN--- ---MNWAIRDGTYESFKGSPASKGILQFDMWNVTPS...r*cnsihc*snrisnskts*k*yklnytt*nsn*n skll Frame C: glleninni*q*tk*INKKKNNNHFFFLXFX

  18. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  19. Il sapore dell’ italia: i nomi delle marche alimentari pseudoitaliane in Germania

    Directory of Open Access Journals (Sweden)

    Marie A. Rieger

    2013-10-01

    Full Text Available La cucina italiana è famosa e apprezzata in tutto il mondo. Per molti, la sua varietà e leggerezza sono l’espressione tangibile della proverbiale gioia di vivere degli italiani, per altri evoca il sole, il mare e le vacanze. Sicuramente tutti concordano sul fatto che la cucina italiana sia sinonimo di bontà e qualità. In Germania, in particolare, la gastronomia italiana può vantare quasi sessant’anni di storia e un fatturato annuale che supera i tre miliardi di Euro. Il successo del mangiare all’italiana si rispecchia anche sugli scaffali dei supermercati che sono pieni di prodotti alimentari tipici della cucina italiana. Ma accanto alle marche BARILLA, BUITONI e LAVAZZA si possono trovare anche gli spaghetti COMBINO, la pizza RIGGANO e il caffè BELLAROM. A differenza dei primi tre nomi, tutte marche tradizionali italiane, gli ultimi tre sono marche commerciali tedesche che hanno l’evidente obiettivo di suggerire l’origine italiana dei rispettivi prodotti. Poiché l’origine italiana è garante di bontà e qualità, anche aziende tedesche cercano di sfruttare il cosiddetto country-of-origin effect. L’analisi linguistica di un corpus di 41 nomi di marche tedesche italianizzanti dimostra che le naming strategies possono essere ricondotte a pochi modelli formativi, il che sembrerebbe violare l’imperativo dell’innovazione e della diversità imposto dalle strategie del marketing. Eppure, i nomi sono perfettamente funzionali: dal momento che corrispondono all’idea che i tedeschi hanno della lingua italiana, come dimostrano degli studi empirici condotti da me, tali nomi sono percepiti come italiani e ai rispettivi prodotti viene attribuita un’origine italiana che funge, a sua volta, da marchio di qualità.

  20. 專論/專利指標發展研究/阮明淑、梁峻齊(Ming-Shu Yuan, Chun-Chi Liang

    Directory of Open Access Journals (Sweden)

    阮明淑、梁峻齊 Ming-Shu Yuan, Chun-Chi Liang

    2009-10-01

    Full Text Available 有鑑於專利資訊在現今產業發展中扮演重要的角色,專利指標成為度量專利資訊的重要參考。本文整理專利指標的發展演進及其在臺灣地區的相關研究,歸納出專利指標的應用分類與意涵。目前在臺灣地區的專利指標相關應用研究中,可以將專利指標區分為專利一般特性指標、專利引用指標與專利技術指標等,分別描述專利的一般特徵、引用與被引用的情況,以及技術的表現。如此正好呈現專利資訊的本質,若再配合時間與專業領域的因素,並以數量、頻率或複合指標的形式呈現,即可對公司、產業與國家等不同的對象���供適切之參考依據。本研究說明目前專利指標研究的概況,可以作為未來相關專利指標研究發展的基礎,更希望可以提供相關政策制定和產業佈局上專利指標選用之參考。 Because nowadays the patent information plays the important role of the industrial development, the patent indexes become the important reference to evaluate the patent information. This article provides the development of the patent indexes and related researches in Taiwan, and generalizes the application of classification and implication of the patent indexes. Presently the related patent index researches in Taiwan could be distinguished the patent indexes into general characteristic, the quotation and the technology and so on. Such discrimination shows the essence of the patent information and if it can compare with the factors of time and professional fields and presents in the forms of the quantity, frequency or composite indexes, it can provide the appropriate information to the company, the industry or the country. This article not only offers the understanding of the present researches of the patent indexes, but also provides the reference of the policy formulation and the industrial layout. 頁次:88-106

  1. Indigenous Communities and Cross­Strait Rapprochement: A Case Study of Chun­-ri and Shih-­wen

    Directory of Open Access Journals (Sweden)

    Andi Kao

    2015-08-01

    Full Text Available Absent from most public debates on Taiwan’s embrace of neoliberal capitalism are the potential consequences of economic liberalization for Taiwan’s indigenous peoples. Deregulating markets and unfettering capital and resources are tied inextricably with cross-Strait politics. With a deep-seated apprehension of China still felt in many corners of the Taiwanese society, these issues are often framed with particular emphasis on the “China Factor”, overshadowing other relevant economic and societal considerations and thereby narrowing the scope of debate over government policies. Nevertheless, the potential influx of foreign capital investment, long- and short-term migrant labor and international visitors may have profound effects on Taiwan’s most vulnerable citizens, including the indigenous peoples. This paper will report the results of field research conducted among the Paiwan ethnic group, assessing actual and potential future changes affecting their individual families and communities. Preliminary assessment indicates that official policies liberalizing visitation and trade between China and Taiwan have already affected the Paiwan communities. Whether these changes become handicaps or opportunities depends on realistic evaluation, strategic planning, education, implementation, and periodic re-evaluation. This paper will contribute to the larger discussion of possible responses to the effects of inter-regional migration and transformations on minority societies by providing an assessment of current and potential conditions among the Paiwan of Taiwan.

  2. Composition and repellency of the essential oils of Evodia calcicola Chun ex Huang and Evodia trichotoma (Lour.) Pierre against three stored product insects.

    Science.gov (United States)

    Yang, Kai; You, Chun-Xue; Wang, Cheng-Fang; Guo, Shan-Shan; Li, Yin-Ping; Wu, Yan; Geng, Zhu-Feng; Deng, Zhi-Wei; Du, Shu-Shan

    2014-01-01

    During our screening program for agrochemicals from Chinese medicinal herbs and wild plants, the essential oils of Evodia calcicola and Evodia trichotoma leaves were found to possess strong repellency against the red flour beetle Tribolium castaneum adults, the cigarette beetle Lasioderma serricorne adults and the booklouse Liposcelis bostrychophila. The two essential oils obtained by hydrodistillation were investigated by GC-MS. The main components of E. calcicola essential oil were identified to be (-)-β-pinene (44.02%), β-phellandrene (20.93%), ocimene (16.49%), and D-limonene (9.87%). While the main components of the essential oil of E. trichotoma were D-limonene (69.55%), 1R-a-pinene (11.48%), caryophyllene (2.80%) and spathulenol (2.24%). Data showed that T. castaneum was the most sensitive than other two stored product insects. Compared with the positive control, DEET (N, N-diethyl-3- methylbenzamide), the two essential oils showed the same level repellency against the red flour beetle. However, the essential oil of E. trichotoma showed the same level repellency against the cigarette beetle, while E. calcicola essential oil possessed the less level repellency against L. serricorne, relative to the positive control, DEET. Moreover, the two crude oils also exhibited strong repellency against L. bostrychophila, but lesser level repellency than the positive control, DEET. Thus, the essential oils of E. calcicola and E. trichotoma may be potential to be developed as a new natural repellent in the control of stored product insects.

  3. Intercâmbio educacional internacional na modalidade doutorado sanduíche em enfermagem: relato de experiência Intercambio educacional internacional en la modalidad doctorado sándwich: relato de experiencia International educational exchange in nursing s andwich doctorate modality: experience report

    Directory of Open Access Journals (Sweden)

    Kleyde Ventura de Souza

    2008-06-01

    Full Text Available Relato de experiência de estágio de Doutorado Sanduíche oferecido pela Coordenação de Aperfeiçoamento de Pessoal de Nível Superior, realizado na Faculté des Sciences Infirmières/Université de Montreal, no período de agosto a dezembro de 2004. O estágio teve como enfoque o aprofundamento dos aspectos conceituais e práticos relacionados à saúde da mulher e seus direitos sexuais e reprodutivos. Este artigo tem como propósito apresentar as atividades realizadas e despertar o interesse dos estudantes de doutorado dos programas brasileiros de pós-graduação nessa modalidade de intercâmbio. Destacam-se a participação em cursos, reuniões de grupos de pesquisas e em eventos científicos; visitas técnicas e troca de experiências com pesquisadores e integrantes de organizações sociais e conferências. Com esta experiência, verificou-se a importância da cooperação entre pesquisadores e instituições do Brasil e do exterior e fortaleceu-se o compromisso com um projeto de emancipação profissional e social, por meio da pesquisa e deste tipo de cooperação.El artículo relaciona a la experiencia del entrenamiento del Doctorado Sándwich, ofrecido por Cordenación de Perfeccionamiento de Personal de Nivel Superior y realizado en la Faculté de Sciences Infirmières/Université de Montreal, de agosto al diciembre de 2004. El entrenamiento enfocó en profundizar los aspectos conceptuales y prácticos relacionados con la salud de la mujer y con sus derechos sexuales y reproductivos. Este artículo se trata de presentar las actividades realizadas e inspirar el interés de estudiantes de los programas brasileños de la post-grado en esta modalidad del intercambio. Este intercambio era distinguido por la participación en cursos, en reuniones de grupos de investigación y en conferencias científicos, y en las visitas técnicas y el intercambio de experiencias entre investigadores y miembros de organizaciones social. La experiencia

  4. 專論/數位環境的著作權法制思考/賴文智;王文君 | Rethinking Copyright Law System in Digital Environment / Wen-chi Lai;Wen-chun Wang

    Directory of Open Access Journals (Sweden)

    賴文智、王文君

    2007-04-01

    Full Text Available

    本文研究議題為著作權法制面對數位環境衝擊之制度調整思考。本文首先說明數位與網路科技不僅為當代社會著作利用帶來相當多的變化,也使著作權制度面 臨諸多困難議題。藉由對著作權法制發展史與著作權法第1條規定的檢視,本文提出「促進著作流通利用」乃達致著作權法各項立法目的之共同且最主要之途徑(方 法),並嘗試在此脈絡下,檢視合理使用、公開傳輸權、權利管理電子資訊、防盜拷措施的保護及著作權仲介團體條例等制度設計。最終重申並闡釋「促進著作流通 利用」乃是用以檢視著作權制度是否合於當代社會需求之關鍵。

    At first, this paper raises the question on the impacts of Copyright System in digital environment. From reviewing history of Copyright System and Article 1 of Copyright Act, this paper holds that encouraging circulation and use of copyrighted work is main purpose of Copyright Act. This paper describes that facing digital and network technologies, the use of copyrighted work in our society has several changes. These changes, from the point of view that the main purpose of Copyright System is encouraging circulation and use of copyrighted work, make Copyright System facing several difficult issues. Finally, this paper examines several issues of Copyright System, such as, fair use, right of public transmission, electronic rights management information, protection of technological protection measures and Copyright Intermediary Organization Act. Encouraging circulation and use of copyrighted work is always the key of examining whether the Copyright System fit the need of current society.

    頁次:30-38

  5. Che cosa comporta introdurre nuove tecnologie didattiche a scuola : un modello

    Directory of Open Access Journals (Sweden)

    Alessandro Antonietti

    2009-01-01

    Full Text Available This article discusses a model on the set of factors that come into play in seguitodell'introduzione to school for a new educational technology. The model regards the relations between gliobiettivi or needs that motivate the adoption of a new educational tool, the choice of this instrument, the way it is impiegatoe the effects it produces. The model also takes into account the relationship between the individual and social representations sisviluppano about the needs and objectives of the technological tool, its use and changes induce.Vengono discussed the implications of the model for the management of these complex relationships in the school context.

  6. QUEL CHE RESTA DELLA PSICANALISI. UNA LETTURA MERLEAU‐PONTIANA DI FREUD

    Directory of Open Access Journals (Sweden)

    Scotti, Alessandra

    2015-12-01

    Full Text Available This paper investigates Maurice Merleau‐Ponty’s interest about Freud’s philosophical works. It invokes the Freud’s recognition as “Master of the School of suspicion”, a famous definition made by Paul Ricœur. According to Ricœur, Freud’s theories take place within the philosophical stream that looks at “constituted cogito” with deep mistrust. Through the analysis of “Phenomenology of Perception” we can observe the accusation of “pansexuality” moved by Merleau‐Ponty. However, as Merleau‐ Ponty’s philosophy develops and his view changes from “existential” to “ontological”, the relation between Freud and Merleau‐Ponty changes accordingly, until the acknowledgment of the unconscious as a prediction of the “chair”.

  7. Effort de pêche et production poscicole au lac d'ayame i

    African Journals Online (AJOL)

    -made Lake Ayamé I, from August 2004 to July 2005, allowed to evaluate at 236.9 t the landed catches of these stations. The global production of the lake, estimated to 381.8 t was below the 1060 t reported in 1996 before the closing of this ...

  8. Assai più che eutanasia. Prelegomeni a ogni futura interpretazione filosofica del tradimento

    Directory of Open Access Journals (Sweden)

    Vincenzo Cicero

    2015-12-01

    Full Text Available At the very central point of the first episode in the Matrix Trilogy (1999-2003 is the cornerstone of the film’s narrative: the scene of Cypher’s betrayal, also known as the restaurant scene, which immediately received special attention from scholars. As regards the tone of interpretations, so far it has been almost a competition to issue the more sophisticated and persuasive verdict of guilty, and all of them agree, even the not incriminating ones, in believing Cypher as an incurable selfish hedonist. Their hermeneutical common limits are basically three: a they treat the Cypher case only by analyzing the verbal level, that is the script, and then by abstracting from the fact that it’s a story in a filmic text; b they isolate and crystallize the character in Chapter 19 of Matrix (the dialogue between Neo and Cypher and the restaurant scene, as though he appeared only in this specific context and not already at the beginning of the film; c they apply from above and extrinsically the theoretical formulas of some philosophers (no matter if Kant, Mill, Nietzsche, Nozick etc. dealt with as if taken from a handbook. The suggested interpretation sounds like a completely different register. We do not refer to any philosopher, instead we refer to the verse from a book of VT, Judges 16.30, in which a very similar impulse to the one moving Cypher is found. And of this character, who has an extraordinary tragic depth, the simulational and cryptogramatic structural shape is shown.

  9. Wie aus dem Nichts etwas entsteht Gespräche über Antimaterie

    CERN Document Server

    AUTHOR|(CDS)2051122

    2018-01-01

    Antimaterie beschäftigt nicht nur Physiker, sondern auch die Phantasie von Science fiction-Autoren, Star Trek-Fans und Laien. Aber was ist eigentlich Antimaterie, und wie stellt man sie her? Kann man sie speichern? Wird sie bald eine Rolle im Alltag spielen? Und warum verdanken wir unsere Existenz – und die unseres Universums – einem winzigen Unterschied zwischen Materie und Antimaterie? Rolf Landua, einer der weltweit führenden Experten auf diesem Gebiet, beantwortet in seinem neuen Buch anschaulich diese und andere Fragen.

  10. Future of Chemical Engineering: Integrating Biology into the Undergraduate ChE Curriculum

    Science.gov (United States)

    Mosto, Patricia; Savelski, Mariano; Farrell, Stephanie H.; Hecht, Gregory B.

    2007-01-01

    Integrating biology in the chemical engineering curriculum seems to be the future for chemical engineering programs nation and worldwide. Rowan University's efforts to address this need include a unique chemical engineering curriculum with an intensive biology component integrated throughout from freshman to senior years. Freshman and Sophomore…

  11. “Le parole che vengono da fuori”: i forestierismi nella lingua cinese contemporanea

    Directory of Open Access Journals (Sweden)

    Alessandro Tosco

    2015-10-01

    Full Text Available This article explores how the words of foreign origin (loanwords, in Chinese wailaici are integrated in the modern and contemporary Chinese language. The phenomenon of the introduction of the loanwords in Chinese has become more and more productive, specially in the last thirty years. Over the time the Chinese language has devised many strategies to integrate foreign words; most of the words of Japanese origin are introduced as graphic loans, while the words introduced by Western languages (specially English are integrated as phonemic loans, loan-translations, semantic loans, or hybrid words. In recent years, many loanwords and neologisms have been created by using the language of the network, as the acronyms written in Latin letters.

  12. El Che - más que médico

    OpenAIRE

    Natalia I. Osorio Curbelo

    2015-01-01

    Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más con...

  13. In Teufels Küche – Bohrungen ins Innere von Vulkanen

    OpenAIRE

    T. Wiersberg; Samuel Niedermann; Martin Zimmer

    2014-01-01

    Volcanoes fascinate both scientists and the general public alike. Their hazard risk, their capability to provide unique samples from depth, and their geothermal potential renders them important targets for scientific drilling. To date, a total of seven ICDP volcano drilling projects have been in operation or completed, while several others are in planning. Here we report on the Hawaii Scientific Drilling Project HSDP (USA), the Unzen Scientific Drilling Project USDP (Japan) and the C...

  14. La tortura in Italia. Il reato che non c’è

    Directory of Open Access Journals (Sweden)

    Rossana Gabrieli

    2016-07-01

    Full Text Available After having introduced a definition of the word “torture” and briefly analysed from a historic point of view, this behaviour thanks to well-known events (Dozier kidnapping and G8 summit in Genoa, in this article the author will first discuss the lack of an appropriate legislation on this topic in Italy. Then, she will analyse some aspects of the criminological profile of a torturer.

  15. Che cos'è la matematica? introduzione elementare ai suoi concetti e metodi

    CERN Document Server

    Courant, Richard

    1971-01-01

    I numeri naturali ; la teoria dei numeri ; il sistema dei numeri nella matematica ; l'algebra delle classi ; costruzioni geometriche, l'algebra nei campi di numeri ; geometria proiettiva, assiomatica, geometrie non euclidee ; topologia ; funzioni e limiti ; ulteriori esempi sui limiti e sulla continuità ; massimi minimi ; il calcolo.

  16. Resti che ritornano testi: il ruolo della memoria in una possibile risemantizzazione di luoghi.

    Directory of Open Access Journals (Sweden)

    Amedeo Trezza

    2012-08-01

    involved towards planning and managing of the territory. In this way the memory of what is left as a mark on the territory of a pre-existent order (already disappeared or disappearing could offer suggestions to political debates about planning. In this manner a radical change of the study perspective could be achieved; for instance, manufactures should be assumed not merely as precipitates of ideologies and political strategies but in fact as expressive, material and concrete rests (concretions... able to activate semiotic processes of recognizing identities and possibilities along with the opening of new meanings.

  17. Definitive Mineralogical Analysis of Mars Analog Rocks Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Blake, D. F.; Sarrazin, P.; Bish, D. L.; Feldman, S.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    Mineral identification is a critical component of Mars Astrobiological missions. Chemical or elemental data alone are not definitive because a single elemental or chemical composition or even a single bonding type can represent a range of substances or mineral assemblages. Minerals are defined as unique structural and compositional phases that occur naturally. There are about 15,000 minerals that have been described on Earth, all uniquely identifiable via diffraction methods. There are likely many minerals yet undiscovered on Earth, and likewise on Mars. If an unknown phase is identified on Mars, it can be fully characterized by structural (X-ray Diffraction, XRD) and elemental analysis (X-ray Fluorescence, XRF) without recourse to other data because XRD relies on the principles of atomic arrangement for its determinations. XRD is the principal means of identification and characterization of minerals on Earth.

  18. Neanderthal teeth from Moula-Guercy, Ardèche, France.

    Science.gov (United States)

    Hlusko, Leslea J; Carlson, Joshua P; Guatelli-Steinberg, Debbie; Krueger, Kristin L; Mersey, Ben; Ungar, Peter S; Defleur, Alban

    2013-07-01

    Here we describe dental remains from a Neanderthal fossil assemblage from Moula-Guercy, France. Our report demonstrates that the Moula-Guercy hominid remains contribute important morphological, developmental, and behavioral data to understanding Neanderthal evolutionary history. We include gross comparative morphological descriptions and enamel surface microstructure and microwear data. These teeth reveal numerous characteristics that are diagnostic of Neanderthals and provide no evidence for the presence of any other hominid taxa. Enamel growth increment data from the Moula-Guercy specimens yield evidence of a Neanderthal pattern of development, although at the lower end of the range of variation. The presence of a significant number of linear enamel hypoplasias indicates that these individuals were stressed during childhood. Molar microwear data suggest that these Neanderthals did not differ significantly from modern humans in terms of the fracture properties of the food they were consuming. The incisor microwear and macro striations provide evidence that these individuals may have been using their anterior teeth as tools, similar to the practices of several modern human populations such as the Inuit, Ipiutak, and Australian Aboriginals, and reminiscent of evidence from other Neanderthals from Krapina, Croatia, as well as the 600,000 year old hominids from Sima de los Huesos, Spain. Am J Phys Anthropol 151:477-491, 2013.© 2013 Wiley Periodicals, Inc. Copyright ©2013 Wiley Periodicals, Inc.

  19. Sprüche, Sentenzen, Zitate als Kurzformen oder "einfache Formen" der Textsorten in interkultureller Sicht

    Directory of Open Access Journals (Sweden)

    Mirko Križman

    1998-12-01

    Full Text Available Eine systematische sprachliche Behandlung der Sprichwörter in bezug auf die verschiedenen Sprachen und auf die sprachliche Varianz nur einer Sprache wäre eine umfangreiche Arbeit. Man kann aber doch in einem Beitrag, wo zwei oder drei Sprachen in Betracht gezogen werden, zuerst einige allgemeine Feststellungen erwähnen, womit die Varianz, die in den Bereich der Sprachwissenschaft gehört, einigermaßen prinzipiell zu lösen wäre und etliche Details der Stilistik (auch im ästhetischen Sinn gezeigt werden können.

  20. What is philosophy of medicine? : (Che cos’è la filosofia della medicina?)

    NARCIS (Netherlands)

    Kingma, E.M.

    2011-01-01

    Philosophy of Medicine is considered a new and emerging discipline. This paper presents an overview of philosophy of medicine, discusses its relation to bioethics and to other areas of philosophy, and introduces three potential topics for research in the philosophy of medicine: concepts of health

  1. Sui diritti dell’infanzia e la libertà che comincia

    Directory of Open Access Journals (Sweden)

    Mariangela Caporale

    2014-06-01

    Full Text Available The present article deals with children’s rights. It focuses on the problematic aspect regarding all the documents – included the Convention on the Rights of the Child - that only support adults’ point of view about life and world without considering the peculiarity of the reason and freedom of childhood, that is its autonomy.

  2. A Theory of Revolutionary Warfare and its Application to the Bolivian Adventure of Che Guevara

    Science.gov (United States)

    1973-01-01

    training in Cuba Molses Nato Molses Guevara Rodriguez Julio Mendez Cano .Member of Center; later Joined the Rearguard; recrui ter Member of...Fort Bragg, North Carolina, 1965. Carol ! na. Counterinsurgency Planning Guide. ST-31-176, Fort Bragg, North Von Lsz&r, Arpad and Robert R. Kaufman

  3. Il PIL: oltre il PIL. E oltre il PIL che c’è?

    Directory of Open Access Journals (Sweden)

    Giuseppe Alvaro

    2011-01-01

    Full Text Available The article criticises the recent Stiglitz-Sen-Fitoussi Report arguing that the suggestion of developing a series of indicators that would complement the traditional GDP will in fact end up in confirming the centrality of the GDP, which would remain the central theoretical reference point as well as the main policy target. What is needed is a new conceptual framework of which the GDP is only a part, that has the potential to lead to a new synthetical index, replacing the GDP altogether. The article sketches the main characteristics of such a new index.

  4. Segui le orme che portano alle ceneri del focolare. Il Festival Culturale Gattjirrk di Milingimbi

    Directory of Open Access Journals (Sweden)

    Franca Tamisari

    2016-12-01

    Full Text Available This article considers the socio-cultural meaning of the Gattjirk Cultural Festival of Milingimbi, an event that is annually held in the indigenous Yolngu community in the Northern Territory, Australia. Despite its small-scale dimensions and ludic nature, the Festival provides an arena where the postcolonial realities the Yolngu people live in are negotiated. Focusing not only on the organisers' point of view - who see the Festival as an opportunity to "share culture" - but also on that of the youth - who reveal their experiences and visions through hip-hop and comic dances - I argue that the Festival creates a space in which both generational tensions, within the community, and those between Indigenous and non indigenous people, can be displayed and mediated. If, on the one hand, the Festival is a moment of encounter where culture can be shared, on the other it also generates new modalities of confrontation and defiance. By weaving together elements of Yolngu cultural heritage and pop culture, I argue that hip-hop and comic dances, which are mainly performed by the youth, are tactics of cultural remix that demand attention through laughter and irony: a mutual recognition which equally engages performers and spectators, the elders and the youth, indigenous and non indigenous people to participate and respond. These performances thus generate connections and relationships that remix the old and the new, the elders and the youth, indigenous and non indigenous people in an encounter which is at once efficacious yet ephemeral.

  5. BIOACTIVITIES AND CHEMICAL CONSTITUENTS OF A VIETNAMESE MEDICINAL PLANT JASMINUM SUBTRIPLINERVE BLUME (CHE VANG )

    OpenAIRE

    Dai, Hue Ngan

    2006-01-01

    #This thesis encompasses two parts. The first part deals with general introduction to isolation, characterization, and bioactivities of natural products, with emphasis on Jasminum Subtriplinerve Blume spp., and its genus. The second is experimental study of J.subtriplinerve Bl. about its bioactivities and chemical constituents. In first part (from chapter 1 to 6), the botanical of two varieties of J.subtriplinerve Bl., a medicinal plant widely distributed in Middle area of Vietnam that has ju...

  6. Bioactivities and chemical constituents of a Vietnamese medicinal plant Che Vang, Jasminum subtriplinerve Blume (Oleaceae).

    Science.gov (United States)

    Ngan, Dai Hue; Hoai, Ho Thi Cam; Huong, Le Mai; Hansen, Poul Erik; Vang, Ole

    2008-01-01

    Five crude extracts were made from leaves and stems of Jasminum subtriplinerve Blume (Oleaceae) and investigated for antimicrobial, antioxidant and cytotoxic activities. The extractions were done with petroleum ether, ethyl acetate, ethanol, methanol or water. All extracts exhibited anti-bacterial activity except the water fraction. On the other hand, all extracts exhibit antioxidant activity except the petroleum ether fraction using the DPPH radical scavenging assay. Only the petroleum ether fraction showed a cytotoxicity activity against tested cell-lines, Hep-G2 and RD with IC(50) values of 19.2 and 20 microg mL(-1), respectively. From the petroleum ether and ethyl acetate extracts, two triterpenes namely 3beta-acetyl-oleanolic acid and lup-20-en-3beta-ol and a sterol, stigmast-5-en-3beta-ol were isolated. The structure of those compounds were elucidated by spectrometric methods IR, MS, 1D-NMR, 2D-NMR and simulated ACD/NMR spectra. The data presented here indicate that J. subtriplinerve do contain compounds with interesting biological activity.

  7. Usage based language acquisition in the Danish crèche

    DEFF Research Database (Denmark)

    Hansen, Ole Henrik

    2010-01-01

    Forskning i det lille barns sprogtilegnelse i den danske vuggestue må tage højde for diverse sprogsyn og videnskabelige grundsyn, for at kunne udtrykke noget validt om barnets første sprog....

  8. Bioactivities and chemical constituents of a vietnamese medicinal plant Che Vang, Jasminum subtriplinerve Blume (Oleaceae)

    DEFF Research Database (Denmark)

    Dai Hue, Ngan; Thi Cam, Hoai; Le Mai, Huong

    2008-01-01

    Five crude extracts were made from leaves and stems of Jasminum subtriplinerve Blume (Oleaceae) and investigated for antimicrobial, antioxidant and cytotoxic activities. The extractions were done with petroleum ether, ethyl acetate, ethanol, methanol or water. All extracts exhibited anti-bacteria...

  9. Maria Rizzarelli, Una terra che è solo visione. La poesia di Pasolini tra cinema e pittura

    Directory of Open Access Journals (Sweden)

    Paolo Lago

    2016-11-01

    Full Text Available La contaminazione tra scrittura e visione, la «natura anfibologica» tra parola e immagine, secondo una definizione dello stesso autore, risulta fondamentale nell’intera opera letteraria di Pier Paolo Pasolini.

  10. Safety technical considerations on the 2012 periodic safety verification of the Beznau nuclear power plant; Sicherheitstechnische Stellungnahme zur Periodischen Sicherheitsüberprüfung 2012 des Kernkraftwerks Beznau

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-12-15

    According to nuclear legislation, the owner of an operational license for a nuclear power plant has to provide a periodic safety verification (PSU) every 10 years. The 'North Eastern Power Plants' company (NOK), today AXPO Power AG already performed such a PSU for the Beznau-2 nuclear reactor block (KKB2) in 2002. The Beznau-1 nuclear reactor block (KKB1) received its definitive operational license in October 1970, after test operation during 7 months. After the license for test operation received on July 16{sup th}, 1971, the operational license of KKB2 was renewed several times, each time for a certain period of validity. In 1991, NOK requested a definitive operational license for KKB2, but in 1994 the Swiss Federal Council lengthened the license for only 10 years. Moreover, it laid down that NOK has to periodically report on the safety of the facility. With its letter of August 23{sup rd}, 1998, the Federal Office of Energy defined the documents to be produced for the PSU. The extent of the PSU was defined in such a way that many documents concern the whole power plant, i.e. both nuclear reactor blocks. On December 3{sup rd}, 2004, the Swiss Federal Council granted KKB2 an operational license of limited validity. The present report reviews the 2012 PSU, which covers the time interval from January 1{sup st}, 2002, to December 31{sup st}, 2011, from the point of view of safety. It contains documents for the evaluation of both reactor blocks at KKB. The Beznau interim storage pool was also taken into consideration; it is situated on the KKB site, but, according to a decision of the Swiss Federal Council of May 23{sup rd}, 1991, it has an independent operational license. The evaluation of ageing surveillance takes the whole operational period of the facility into account, i.e. the ageing mechanisms acting as from the beginning of the operation. Moreover, important developments that occurred after the surveillance time interval have been taken into account, especially the status of the examination of the defects discovered during the revision shutdown in 2015 concerning the material of the reactor pressure vessel of block 1. As far as the NOK’s request for an unlimited operational license is concerned, NOK has to prove in time, before the 40-year license limit is up, that the design boundaries of safety-relevant components will not be reached during the duration of extended operation. Otherwise, the necessary refit works have to be performed in time. KKB has produced the requested proof for the long-term operation of both blocks. The results of the supervisory work carried out by the Swiss Federal Nuclear Safety Inspectorate (ENSI) were published in the safety technical review for KKB1 and KKB2. ENSI concludes that there are no safety technical objections against the operation of both blocks beyond the limit of 40 years. On the basis of the state of knowledge when the considerations were made, the criteria for shutting down will not be reached in the 10 following operational years, neither by KKB1 nor by KKB2.

  11. EU-Grünbuchüberlegung zur Trennung von Prüfung und Beratung. Pro: Beratungsleistungen beeinträchtigen die Unabhängigkeit des Abschlussprüfers

    DEFF Research Database (Denmark)

    Quick, Reiner

    2010-01-01

    In its Green Paper, the European Commission considers the prohibition of non-audit services by audit firms. This article discusses the advantages of such a prohibition......In its Green Paper, the European Commission considers the prohibition of non-audit services by audit firms. This article discusses the advantages of such a prohibition...

  12. Formation et initiation à la tâche : éléments de ritualisation favorisant le développement d’une culture de santé et sécurité au travail auprès des travailleurs immigrants Training and initiation to the task: ritual elements promoting the development of a culture of health and safety at work for immigrant workers Formación e iniciación a la tarea : elementos de ritualización que favorecen el desarrollo de una cultura de salud y seguridad en los trabajadores inmigrantes

    Directory of Open Access Journals (Sweden)

    Sylvie Gravel

    2011-11-01

    Full Text Available Le présent article traite une partie des résultats d’une étude portant sur les stratégies favorables à la prise en charge des mesures de santé et sécurité au travail (SST dans les petites entreprises montréalaises (PE embauchant une main-d’œuvre immigrante. Dans cet article est abordée entre autres l’influence de l’immigration sur la capacité et la motivation des superviseurs et des travailleurs à participer à la gestion des mesures de SST dont celles de la formation et de l’initiation à la tâche.. L’échantillon comprend 28 PE de Montréal ayant entre 10 et 50 travailleurs répartis en deux groupes : a PE d’observation ayant 25 % et plus de travailleurs immigrants (n=19; b PE de comparaison ayant 75 % et plus de travailleurs nés au Canada (n=9. Les résultats indiquent que les compétences des dirigeants et la formation acquise dans leur pays d’origine orientent l’adoption de rituels de prévention dès l’embauche des nouveaux travailleurs. Enfin, malgré l’importance de la présence de travailleurs immigrants dans les PE, seulement deux entreprises de notre échantillon ont adapté leur formation aux nouveaux employés immigrants.This study examines the influence of immigration on motivation and ability of supervisors and workers in small business (SB to participate in health and safety measures (OSH management. The sample consists of 28 Montreal’s SB between 10 and 50 workers divided into two groups: a SB observation with 25 % or more immigrant workers (n=19; b SB compared with 75 % and more Canadian-born workers (n=9. The results indicate that managers’ competencies and training developed in their country of origin condition their approach concerning hiring and training rituals. Despite the importance of immigrant workers’ presence, only two companies in our sample have adapted their training for new immigrant employees.El presente artículo trata una parte de los resultados de un estudio sobre

  13. La langue qui fâche : quand la norme qui lâche suscite l’insulte When norms loosen, abuse pops up and language offends

    Directory of Open Access Journals (Sweden)

    Laurence Rosier

    2012-04-01

    Full Text Available Dans cet article nous proposons d’étudier les titres de groupes facebook dont les dénominations visent à dévaloriser les locuteurs qui ne maîtrisent pas la norme linguistique. On verra que lorsqu’il s’agit de la maîtrise de la langue, les internautes stigmatisent les accrocs à la norme et peuvent adopter des attitudes d’une extrême violence : les fautes sont considérées comme insultantes pour ceux qui maîtrisent la langue. La violence verbale observée trouverait sa légitimité dans le fait qu’il y a « outrage à la langue » : les locuteurs « censeurs » seraient dès lors autorisés à produire un discours violent « outrageant » vis-à-vis des faiseurs de fautes. Nos analyses montreront que l’appel au regroupement contre les « locuteurs-fauteurs » repose sur une doxa commune (l’importance de la maîtrise de la langue plutôt que sur une argumentation explicite. Nous verrons comment se manifeste linguistiquement la violence verbale dans notre corpus (phénomènes énonciatifs, processus interactionnel,… et où se situent les dénominations facebookiennes sur une échelle graduée de violence.In this article, we study the names of facebook groups which aim at reducing the value of the speakers who do not control linguistic norms. The internet users stigmatize tears in norm and can adopt attitudes of an extreme violence: errors are considered as insulting for those who master the language. The “offense to the language” is supposed to legitimize verbal violence: the speakers “censors” would since then be authorized to produce a violent speech "offending" in relation to the miracle-workers of errors. Our analyses will show that the call to grouping against the “speakers-troublemakers” rests on a common doxa (the importance of the workmanship of the language rather than on a definite argumentation. We will examine the various manifestations of verbal violence (on the level on enunciation, interaction, etc., and check where the names of the Facebook groups stand on a gradual scale of violence.

  14. Stringhe alla prova dei fatti In arrivo il primo esperimento che vaglierà la teoria delle stringhe

    CERN Multimedia

    Pisani, Stefano

    2007-01-01

    The first experiment that will test the string theory validity will be done with the Large Hadron Collider, the particle accelerator of CERN, that will come into force at the end of this year. (1/2 page)

  15. A Modular Approach to Integrating Biofuels Education into ChE Curriculum Part I--Learning Materials

    Science.gov (United States)

    He, Q. Peter; Wang, Jin; Zhang, Rong; Johnson, Donald; Knight, Andrew; Polala, Ravali

    2016-01-01

    In view of potential demand for skilled engineers and competent researchers in the biofuels field, we have identified a significant gap between advanced biofuels research and undergraduate biofuels education in chemical engineering. To help bridge this gap, we created educational materials that systematically integrate biofuels technologies into…

  16. Da invisibile a visibile ecco la materia oscura Prima mappa in 3D della sostanza che regge l'universo

    CERN Multimedia

    Bianucci, Piero

    2007-01-01

    It's the first view of the black matter, mysterious matter that constitute a third of the mass of the universe. It has the structure of a big sponge and with its garvitational force, it is at the origin of the birth of galaxies and stars (3/4 page)

  17. Un rilievo sotto sopra Modelli digitali 3D ad alta definizione sia dei fondali che delle coste

    Directory of Open Access Journals (Sweden)

    Codevintec Italiana Srl Codevintec Italiana Srl

    2009-03-01

    Full Text Available An upside down survey: shores and sea bed hi-res 3D digital models Laser scanning and interferometric bathymetry represent the cutting edge of coastal survey technology and can be very beneficial for mapping complicated waterside areas. The similarity of the data provided by the two systems (point cloud and intensity value make it easy to integrate the two surveys using PolyWorks commercial software. The final product is a single 3D model made up of bathymetry and topography. Since 2004 Codevintec tested the integration of these two methodologies, carrying out a number of high resolution surveys, generating a complete and accurate digital model of areas both above and below water level, a result inimitable by any other topographical survey method. The 3D-laser scanner was an Optech ILRIS-ER that allows scanning in dynamic from the boat while a SEA SWATHplus-H wide swathsonar system was used to collect underwater topography. A combined GPS and inertial platform (Applanix POS/MV 320 is used to measure position and 3D attitude of the two sensors during the survey.

  18. Kartei unveroffentlichter linguistischer Arbeiten zur Deutschen Spra che der Gegenwart (KULA) (Bibliography of Unpublished Linguistic W orks on Contemporary German)

    Science.gov (United States)

    Toman, Jindrich

    1974-01-01

    This bibliography includes titles of unpublished works in various fields of linguistics such as grammar (morphology, phonology and syntax), socioli nguistics, psycholinguistics, foreign language instruction, language acquisit ion, discourse analysis, poetics, etc. (Text is in German.) (DS)

  19. Caractérisation de la Biomasse sèche des mosaïques forêt-savane ...

    African Journals Online (AJOL)

    SARAH

    2 sept. 2013 ... statistique réalisée sur ces données a montré que la productivité moyenne de biomasse ... impact économique notamment dans le cadre du programme REDD. .... notamment Hyparrhenia diplandra, Loudetia demeusii les.

  20. Faire crédit : de la noble tâche à la corvée

    OpenAIRE

    Lazarus, Jeanne

    2012-01-01

    Malgré le « tournant commercial » des banques de détail françaises, de multiples registres de relations subsistent dans les interactions entre employés de banque et clients. Nous en distinguons quatre : le commerçant, le conseiller, le juge et le sauveur. L’analyse du crédit permet de voir à l’œuvre ces différents registres et montrer que la banque ne peut se définir comme un lieu de commerce pur. En effet, les crédits ne sont pas des produits à vendre comme les autres, et leur commercialisat...

  1. La carriera di un economista. che cosa? Perchè? Come? (An economist’s career: what? why? how?

    Directory of Open Access Journals (Sweden)

    R. TRIFFIN

    2013-12-01

    Full Text Available Il documento è un contributo ad una serie di ricordi e riflessioni sulle esperienze professionali di illustrieconomisti con Banca Nazionale del Lavoro Quarterly Review iniziate nel 1979. In esso Robert Triffin fornisce riflessioni personali sulla sua carriera, il suo marchio personale di economia pratici, e la sua filosofia di vita.The paper is a contribution to a series of recollections and reflections on the professional experiences of distinguished economists which the Banca Nazionale del Lavoro Quarterly Review started in 1979. In it Robert Triffin provides personal reflections on his career, his personal brand of practical economics, and his life philosophy.JEL: B31

  2. Interruzione del trattamento nei pazienti con schizofrenia che ricevono olanzapina o aripiprazolo: metanalisi degli studi clinici controllati

    Directory of Open Access Journals (Sweden)

    Benedetta Santarlasci

    2005-03-01

    Full Text Available BACKGROUND: In schizophrenia the drop-out rate can be used as proxy of effectiveness. The drop-out evaluation is also important considering the relevant economic impact for NHS of an antipsychotic therapy discontinuation in terms of patient hospitalization and other related healthcare resources consumption. OBJECTIVE: To analyze the differences in the rates of drop-out from clinical trials between olanzapine and aripiprazole. METHODS: Literature search was based on MEDLINE, on Iowa-IDIS and Drugdex databases (1966-Dec 2004. Analysis included 12 randomized controlled trials (3.778 patients, 8 for olanzapine (2.559 patients and 4 for aripiprazole (1.219 patients. RCT inclusion criteria were: a Patients affected by schizophrenia; b Randomized assignment to olanzapine or aripiprazole treatment group; c Number of patients included in the treatment group higher than 100; d Drop-out frequency evaluation between 4th and 26th weeks of follow-up. RESULTS: The rate of treatment discontinuation was greater for aripiprazole than for olanzapine (42,2% vs. 31,6% respectively. The comparison between drop-out percentages is statistically significant (p<0,001. CONCLUSIONS: The incidence of drop-outs was better controlled in the olanzapine group of studies than in the aripiprazole group of studies.

  3. Il protonio nasce dall'antimateria Assomiglia sia ad un atomo di idrogeno che a uno di anti-idrogeno

    CERN Multimedia

    2006-01-01

    For the fist time in the history, a chemical reaction has been realized between matter and antimatter; from this reaction is born the "new born" protonio, made of one ion of hydrogen and one of anti-hydrogen

  4. Dal parco-spiaggia al paesaggio che in-segna: significati sovrapposti della natura intorno alla metropoli

    Directory of Open Access Journals (Sweden)

    Tomaso Colombo

    2013-03-01

    Full Text Available The author, cultural manager of Parco Nord (Milano, points out the key elements of this periurbanpark that since the Seventies has been managing to turn out an outskirts in a new attractive point ofthe town.A park has not only an environmental meaning but also a cultural one: its identity may influencepeople’s behaviours, uses and expectations as well. Thus territorial and hystorical features becomeopportunities for cultural planning, and they are taken in account when devicing opportunities forfruition and animation, always aiming at reinforcing the parks’s own identity.Colombo articulates the three guiding principles that steer the park’s cultural planning, then he recallsseveral site-specific events, from Biodiversity festival, that takes place every year, to the theaterperformances in nature such as The third Step, a visionary walk through the park at night and at dawn,taken as a symbol of a certain way of doing culture strictly connected to a way of living in nature.

  5. Recombinant butyryl-cholinesterase (RBuChe) therapy following VX poisoning by the percutaneous route: preliminary studies

    International Nuclear Information System (INIS)

    Speakman, P.; Armstrong, S.

    2009-01-01

    Medical countermeasures to prevent or mitigate the effects of nerve agent poisoning are part of the UK MoD's integrated approach to CBRN defence. Protexia is currently in advanced development as a pretreatment for nerve agent poisoning by PharmAthene in collaboration with US DoD. The principle of its use in this context has been demonstrated in a model of inhalation exposure. Nerve agent poisoning by the percutaneous route poses additional challenges for medical countermeasures. The present study investigates the effects of non-pegylated rBuChE administered following poisoning by VX in an animal model of percutaneous exposure. This investigation is part of an ongoing programme of work assessing the potential of candidate medical interventions. Male guinea pigs implanted with dermal and blood microdialysis probes were maintained under anaesthesia. VX (296 micro g/kg or 740 micro g/kg) was applied to the dorsal skin and non-pegylated rBuChE or placebo was administered (i.v.) 30 minutes later. Dialysate fractions were collected for 8 hours and VX was analysed by LC-MS-MS. Cholinesterase levels were measured in selected tissues post mortem. Following VX (296 micro g/kg), non-pegylated rBuChE significantly reduced the concentration of VX in the blood but had no effect on dermal concentrations; additionally following VX (740 micro g/kg), non-pegylated rBuChE prevented lethality. Tissue cholinesterase activity was inhibited following VX exposure but in those animals treated with rhBuChE, activities were similar to control values. To our knowledge these results provide the first evidence of the mechanism of therapeutic intervention with rBuChE. Further work is necessary to increase confidence in these preliminary observations by conducting confirmatory studies. Crown Copyright 2008. This work was carried out as part of the UK MoD NBC Research Programme. Non-pegylated rBuChE was supplied by PharmAthene under a materials transfer and non-disclosure agreement. (author)

  6. Studio dei fattori che influenzano la digeribilità della fibra nella bovina da latte: approcci dinamici

    OpenAIRE

    Bonfante, Elena

    2017-01-01

    I ruminanti sono altamente specializzati nella digestione della fibra. In condizioni di ottima funzionalità digestiva, sono le particelle di foraggio ad essere trattenute per lungo tempo nel rumine dove possono essere degradate dai batteri cellulosolitici. Nonostante queste conoscenze, la stima della degradabilità ruminale delle porzioni potenzialmente degradabili delle fibre è stata notevolmente sottostimata da taluni modelli dinamici di razionamento. Studi più recenti realizzati da Kriz...

  7. 專論/分類不一致之自動偵測:以農資中心資料為例/曾元顯;王峻禧 | Automatic Inconsistency Detection for the ASIC Categorization Collection / Yuen-Hsien Tseng; Chun-Shi Wang

    Directory of Open Access Journals (Sweden)

    曾元顯、王峻禧

    2007-10-01

    Full Text Available

    文件分類是根據文件內容的主題給定類別的知識加值工作,傳統上由人工進行。然而受分類架構設計、類別定義以及分類者學識 背景等影響,主題內容類似的文件,不見得都會被分類到相同的類別,因而造成分類不一致的情況,降低分類文件的應用價值。本文以案例的形式,根據農資中心的 人工分類資料, 進行分類一致性的自動驗證,呈現及探討其結果,並說明其可能潛在的應用,以展示此項工作的可行性及實際效益。綜合而言,分類不一致之自動偵測,可作為資料 清理、知識盤點等知識管理實務上的應用,或是後續分類槃構修正、分類策略擬定、人工分類訓練,以及引進自動分類機制之參考與前置作業。

    Text categorization is a process of assigning labels to documents according to the contents or topics of the documents. Traditionally text categorization is carried out by human experts. However, due to factors such as blurred category boundaries, background bias, and personal judgment, label inconsistency is often found in human classified collections, thus reducing their values in various applications. This article described an automatic process to detect such inconsistency based on the Agricultural Science Information Center (ASIC collection. In the article, important examples and results are presented. Potential benefits and applications are discussed.

    頁次:19-32

  8. Acute parietal lobe infarction presenting as Gerstmann’s syndrome and cognitive decline mimicking senile dementia

    Directory of Open Access Journals (Sweden)

    Chen TY

    2013-07-01

    Full Text Available Tien-Yu Chen,1 Chun-Yen Chen,1,3 Che-Hung Yen,2,3 Shin-Chang Kuo,1,3 Yi-Wei Yeh,1,3 Serena Chang,1 San-Yuan Huang1,31Department of Psychiatry, 2Department of Neurology, Tri-Service General Hospital, School of Medicine, National Defense Medical Center, 3Graduate Institute of Medical Sciences, National Defense Medical Center, Taipei, Taiwan, Republic of ChinaAbstract: Gerstmann’s syndrome encompasses the tetrad of finger agnosia, agraphia, acalculia, and right-left confusion. An elderly man with a history of several cardiovascular diseases was initially brought to the psychiatric outpatient department by his family because of worsening of recent memory, executive function, and mixed anxious-depressive mood. Gerstmann’s syndrome without obvious motor function impairment and dementia-like features could be observed at first. Emergent brain computed tomography scan revealed new left-middle cerebral artery infarction over the left posterior parietal lobe. This case reminds us that acute cerebral infarction involving the parietal lobe may present as Gerstmann’s syndrome accompanied by cognitive decline mimicking dementia. As a result, emergent organic workups should be arranged, especially for elderly patients at high risk for cerebral vascular accident.Keywords: Gerstmann’s syndrome, dementia, parietal lobe infarction

  9. Are psychiatric comorbidities and associated cognitive functions related to treatment response to methylphenidate in boys with attention-deficit/hyperactivity disorder?

    Directory of Open Access Journals (Sweden)

    Chan MH

    2017-04-01

    Full Text Available Mandy H Chan,1 Patrick WL Leung,2 Ting-pong Ho,3 Se-fong Hung,4 Chi-chiu Lee,5 Chun-pan Tang,5 Ka-chai Cheung,2 Fung-yee Ching,2 Fefe HK Chan,6 Lu-hua Chen,2 Merce Garcia-Barcelo,7 Pak-chung Sham3 1Department of Clinical Psychology, Kowloon Hospital, Hospital Authority, 2Department of Psychology, The Chinese University of Hong Kong, 3Department of Psychiatry, University of Hong Kong, 4Department of Psychiatry, The Chinese University of Hong Kong, 5Department of Psychiatry, Kwai Chung Hospital, Hospital Authority, 6Department of Clinical Psychology, Alice Ho Mui Ling Nethersole Hospital, Hospital Authority, 7Department of Surgery, University of Hong Kong, Hong Kong, People’s Republic of China Background: Methylphenidate (MPH has been found to be an effective medication for attention-deficit/hyperactivity disorder (ADHD. However, there are neither consistent nor sufficient findings on whether psychiatric comorbidities and associated cognitive functions of ADHD are related to treatment response to MPH in ADHD children.Objectives: This study investigated whether psychiatric comorbidities, IQ, and neurocognitive deficits are related to treatment response to MPH in ADHD children. In some ways, it is preferable to have a drug that the effectiveness of which to a disorder is not affected by its associated cognitive functions and psychiatric comorbidities. On the other hand, it is likely that the baseline symptom severity of ADHD is associated with the effectiveness of MPH treatment on the symptoms post treatment.Methods: A total of 149 Chinese boys (aged 6–12 years with ADHD, combined type, and normal IQ participated in this study. Assessment of ADHD symptom severity was conducted pre and post MPH treatment, while assessment of psychiatric comorbidities, IQ, and neurocognitive deficits was performed in a non-medicated condition. Treatment response was defined as the ADHD symptom severity post MPH treatment.Results: Results indicated that MPH

  10. Sedimentation Effects of Adding Flocculants to Leached Slurries at Lab Scale in the “Comandante Ernesto Che Guevara” plant in Cuba

    Directory of Open Access Journals (Sweden)

    Eluberto Espinosa-Espinosa

    2016-10-01

    Full Text Available The objective of this investigation was to evaluate the effects of adding PICIZ 7010, AN 910SH and Quimifloc N-30 flocculants to leached and magnetized slurries at lab scale. The evaluation was completed through the comparative method in accordance to the NRBI-579 Standard: Sedimentation Tests which use Talmage and Fitch method. The addition of Quimifloc N-30 flocculants to 6 g/t of reduced ore increased slurry density by 5,9 %, improved liquor clarification as result of a reduction of up to 75 % in suspended solids and slightly reduced the required unit area.

  11. L’ITALIANO CHE INCLUDE: LA LINGUA PER NON ESSERE STRANIERI. ATTENZIONI E PROPOSTE PER UN PROGETTO DI FORMAZIONE LINGUISTICA NEL TEMPO DELLA PLURALITÀ

    Directory of Open Access Journals (Sweden)

    Graziella Favaro

    2016-09-01

    Thoughts and proposals for language training in a plural world We present a document created by Group 1 of the National Observatory for the integration of foreign students and inter-culture “Teaching Italian as a second language and an enhancement of multilingualism”. The paper explores the aspects of Italian L2 in multicultural contexts and situations, the type of learners and their individual needs. Based on this analysis, thoughts and proposals on language training for adults and children, on the enhancement of multilingualism and on teacher training are formulated.

  12. Aux origines de la guillotine sèche. La déportation dans les Assemblées révolutionnaires

    Directory of Open Access Journals (Sweden)

    Louis-José Barbançon

    2007-01-01

    Full Text Available À la veille de la Révolution, une révision des lois pénales est déjà en cours. Par lettres patentes datées du 6 janvier 1789 , Louis XVI avait désigné une commission chargée de purger de l’ancienne législation, les « odieuses prescriptions qui y avaient trouvé une trop large place. »  . Dans le même ordre d’idées, il faut aussi signaler la déclaration du 1er mai 1788, sur la révision des lois criminelles.En Europe, la décennie précédente a vu l’Anglais John Howard entreprendre plusieurs voyag...

  13. Che Challenges of Real and Subjective Poverty and the Growth of Inequality in the Economies of South Eastern Europe in Transition

    Directory of Open Access Journals (Sweden)

    Ivo Bićanić

    2005-03-01

    Full Text Available From the beginning it was clear that during the transformation, all aspects of economic inequality were likely to be exacerbated and that poverty was likely to emerge. This paper discusses the size and consequences of transformation-generated changes in economic inequality and poverty, both “real” and “subjective”, for future economic growth and the legitimacy of continued transformation in the Mediterranean economies in transformation (Bosnia and Herzegovina, Croatia, Macedonia, Serbia and Montenegro and Slovenia, which have been expanded to include Romania and Bulgaria. This area is referred to as the “region”.

  14. l tornado che colpì la laguna di Venezia I ' l l Settembre 1970 Qualche considerazione intorno alla teoria elettrica dei tornado

    Directory of Open Access Journals (Sweden)

    R. JANESELLI

    1972-06-01

    Full Text Available After a short description of the disastrous effects of the
    tornado which struck the Venice lagoon on September 11, 1970, the principal
    theories which in the centuries tried to account for the origin of such
    terrible vortexes, are reviewed. In particular, some remarks are given about
    the electrical theory of the tornadoes. It seems to the author that some features
    would be explained in a simple way by considering the tornado as a
    convectivo cell with electric currents of high intensity. Finally, after recalling
    the meteorological conditions preceding the tornado of September 11,
    its chief features are described.

  15. Il computer per il compositore: slave o master? Su alcune risorse, e le conseguenti problematiche, che pongono le nuove tecnologie applicate alla composizione musicale

    Directory of Open Access Journals (Sweden)

    Mauro Cardi

    2010-12-01

    Full Text Available Mauro Cardi addresses the implications of the development of technologies and networking on the ‘work’ of the composer and the influence they exert on the modalities of ‘generation’, reception and fruition of musical texts, both in terms of social impact, and of mechanisms and practices they produce. Where the greater availability of resources proves to offer opportunities hard to imagine before, the problems that are created extend their range. It therefore remains the inescapable need for the composer to design his own instruments, in order to maintain a fully active role in the choices required by his work.

  16. Effets de la saison sur les qualités microbiologiques de Kilishi, une viande sèche traditionnelle du Cameroun

    Directory of Open Access Journals (Sweden)

    Fonkem, DN.

    2010-01-01

    Full Text Available Effects of Season on the Microbiological Quality of Kilishi, a Traditional Cameroonian Dried Beef Product. The microbiological quality of Kilishi, a traditional Cameroonian dried meat, produced in the Northern part of the country, was studied over one-year period. 79 Kilishi samples collected at various selling points were used for microbiological evaluation. The results on the microbiological analyses were then subjected to a statistical analysis using the General Linear Model (GLM approach to assess environmental factors that affect quality. Final results indicated that the quality of Kilishi was greatly affected (P< 0.001 by the season and location of production though the total bacterial, mould and yeast counts (cfu/g were lower than the recommended acceptability limit for the total viable bacterial counts of micro-organisms in meat at the point of consumption.

  17. Sei così bella quando piangi. Lana Del Rey, voce e fenomeno della fragilità che è in noi

    Directory of Open Access Journals (Sweden)

    Federico Zannoni

    2015-07-01

    Full Text Available Frailty is an ontological part of human experience and characterizes our times. Instability, insecurity, addictions, loneliness, difficulty in finding meaning and perspectives, desire to escape and nostalgia for an unknown and unreal past are predominant in the life of many young people and teenagers. In this context it is possible to consider the global success of the singer Lana Del Rey and of her melancholy and languid lyrics, but also of her videos and photographs, that are expression and celebration of an alleged existential frailty that allows her supporters, especially if adolescents or young women, to identify with her. The study of the phenomenon Lana Del Rey allow to move closer to those feelings of weakness and discomfort that are often hidden, unspoken, confined in the shadows for lack of courage or for shame, but that are, at the same time,  full of grace and of vital energy.  This is one of the tasks of pedagogy.

  18. Merci esotiche che viaggiano verso occidente: la cornice e la figura del narratore popolare a partire da una lettura del Cunto de li cunti di Basile

    Directory of Open Access Journals (Sweden)

    Elena Massi

    2011-11-01

    Full Text Available One of the most precious goods we have gained from the East is the literary frame. Certain of its functions are observable from its early history, in the Middle Ages. In Eastern countries, ”the frame” was a communicative tool to express judgement and opinions in public according to different social conditions. In Western countries, it is still used as an   to express judgement, but only in the literary world. Eric Auerbach in Zur Technik der Fruhrenaissancenovelle in Italien und Frankreich says that from Dante to Boccaccio, the literary frame becomes the story's atmosphere and its barycentre because it offers writers the possibility to organize the relationship between text and context. In my hypothesis, Auerbach's words can work to introduce a narratological function to the literary frame. We notice other two functions: an anthropological one explained by Tzvetan Todorov in La conquête de l'Amérique and a psychological one showed by Andrè Jolles in De Decameron van Boccaccio. According to Tzvetan Todorov, in the seventeenth century, missionaries used literary frames to communicate with native Americans: in Historia general de las cosas de la Nueva España by Bernardino de Sahagún, a literary frame is used to organize different cultural knowledges. Andrè Jolles metaphorically says that thanks to literary frames, we are still able to listen to the voices of popular narrators because the literary frame reproduces cognitive structures typical of children. I propose to show these functions in the Cunto de li cunti by Basile. In this way, we can observe the modernity of Basile. The Neapolitan author not only founded the fairytale genre in Europe. He also contributed to spread a universal communicative form we can observe from three points of view: narratological, anthropological, and psychological.

  19. Un singolare caso di rifrazione letteraria. A proposito di una generazione di autori di origine russa che scrive nella lingua del paese di adozione

    Directory of Open Access Journals (Sweden)

    Giulia Gigante

    2016-01-01

    From the investigation of some examples of narrative contexts and stylistic processes typical of various contemporary Russian authors who have chosen to write in the language of the country where they emigrated, a common tendency emerges concerning the representation of Russia. Despite the differences of the works considered, these authors represents the culture of their roots in a ‘kaleidoscopic’ way, reconsidering the historical, literary and artistic references through memories, dreams and reflections, filtering them through the language and culture of their chosen country.

  20. A high-precision chronological model for the decorated Upper Paleolithic cave of Chauvet-Pont d'Arc, Ardèche, France

    NARCIS (Netherlands)

    Quiles, Anita; Valladas, Hélène; Bocherens, Hervé; Delqué-Količ, Emmanuelle; Kaltnecker, Evelyne; van der Plicht, Johannes; Delannoy, Jean-Jacques; Feruglio, Valérie; Fritz, Carole; Monney, Julien; Philippe, Michel; Tosello, Gilles; Clottes, Jean; Geneste, Jean-Michel

    2016-01-01

    Radiocarbon dates for the ancient drawings in the Chauvet-Pont d'Arc Cave revealed ages much older than expected. These early ages and nature of this Paleolithic art make this United Nations Educational, Scientific and Cultural Organization (UNESCO) site indisputably unique. A large,

  1. Burner flow regulators with mechanisms performing two variable function. Meccanismi che generano una funzione di due variabili applicati alla regolazione dei bruciatori

    Energy Technology Data Exchange (ETDEWEB)

    Borelli, L.; Tagliaferro, B. (R.B.L. Riello Bruciatori, Legnago Spa, Legnago (Italy)); Cossalter, V.; Da Lio, M. (Padua Univ. (Italy). Dip. di Ingegneria Meccanica)

    1993-08-01

    A new class of fuel oil burners has recently been developed by an Italian firm with the aim of obtaining high performances in terms of both energy efficiency and air pollution abatement. The innovative feature of these burners is that they are equipped with a device which permits the automatic and optimum regulation of the air fuel mixture independent of ambient and operating conditions. To reduce costs, the regulation system is a mechanical one instead of electronic which would require an expensive lambda probe. The mechanical regulating system controls air intake by simply taking into account two main combustion factors - ambient temperature and the nominal fuel flow rate. The special cam mechanism is thus classified as one which performs a single function with two degrees of freedom, i.e., the independent variables of ambient temperature and nominal fuel flow. One of the air intake valve's movements is governed by a temperature transducer, the other (primary), by a screw which allows the registering of the air flow during burner installation or upon completion of periodic maintenance checks. In addition to optimizing combustion control, this control technique affords the possibility to adapt the air flow to the different fuel flows obtained by changing the type of nozzle or supply pressure.

  2. Sich (nicht geschlagen geben. Unabdingbare Ansprüche, Kompromisse und das Interesse an einer agonistischen Lebensform: Zu Chantal Mouffes Begriff des Politischen

    Directory of Open Access Journals (Sweden)

    Burkhard Liebsch

    2010-08-01

    Full Text Available This article discusses Chantal Mouffe’s concept of the political that allegedly departs fun-damentally from the so called “cosmopolitical illusion”, i. e. the illusion that liberal-democratic forms of life could overcome antagonistic conflicts once and for all. Mouffe’s diametrically opposed idea of a “conflictual consensus” is critically examined particularly for the claim that it promises to sublate contradictory claims in agonistic forms of conflict. A critical evaluation of this thesis refers to the question whether such a consensus unconditionally requires the renunciation of any unalienable claim.

  3. Crisi identitaria e speculazione panarabista nella Tunisia post-rivoluzionaria: che ne facciamo della tunisianità e della lingua tunisina?

    Directory of Open Access Journals (Sweden)

    Alfonso Campisi

    2015-08-01

    Full Text Available This text speaks about two very important problems existing in Tunisia, after revolution: identity and language. The problem about Tunisian identity is very present in Tunisia, because the article 38 of constitution speaks about Arabic-Muslim identity, but that, it is not correspond to the reality, because we have to talk about  a specific identity character of the country. “Tunisianity”, it’s the wright answer to the article 38.Second important question is the language. Always the article 38 of the constitution voted by the Islamic party at that time at the power, says that the national language is Arabic. Even that not correspond to the linguistic reality of the country, because classical Arabic is not spoken in Tunisia. People speaks Tunisian Arabic. So the text analyses the dangers of the article 38 about the real Tunisian identity and Tunisian language.

  4. European analytical column no. 37 (January 2009) Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Grasserbauer, Manfred; Andersen, Jens Enevold Thaulov

    2009-01-01

    This issue of the European Analytical Column has again a somewhat different format: once more DAC invited a guest columnist to give his views on various matters related to Analytical Chemistry in Europe. This year, Professor Manfred Grasserbauer of the Vienna University of Technology focuses...... representing a major branch of chemistry, namely analytical chemistry. The global financial crisis is affecting all branches of chemistry, especially analytical chemistry since our discipline by tradition has many close links to industry. Already now a decrease of industrial commitment with respect to new...... research projects and sponsoring of conferences can be observed. It is therefore important to strengthen all efforts and to keep the presence of analytical chemists at meetings and conferences unchanged. Recent activities of DAC and details regarding the major analytical-chemistry event this year in Europe...

  5. European analytical column No. 37 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Grasserbauer, Manfred; Andersen, Jens Enevold Thaulov

    2009-01-01

    The European Analytical Column again has a somewhat different format. We have once more invited a guest columnist to give his views on various matters related to analytical chemistry in Europe. This year we have invited Prof. Manfred Grasserbauer of Vienna University of Technology to present some...... representing a major branch of chemistry, namely, analytical chemistry. The global financial crisis is affecting all branches of chemistry, but analytical chemistry in particular since our discipline by tradition has many close links to industry. We are already noticing a decreased industrial commitment...... with respect to new research projects and sponsoring of conferences. It is therefore important that we strengthen our efforts and that we keep our presence at analytical chemistry meetings and conferences unchanged. Recent activities of the Division of Analytical Chemistry (DAC) and details regarding the major...

  6. New Fractures, Old Wounds: Africa and the Renewal of South Agency Neue Brüche, alte Wunden: Afrika und die Erneuerung der South agency

    Directory of Open Access Journals (Sweden)

    Carlos Lopes

    2010-01-01

    Full Text Available Africa has recently come to the forefront of world politics as part of the emerging South. Its increased prominence in the global discourse as a “new frontier of development” signals the recognition of its economic potential. Indeed, the continent has registered an average 5 per cent annual GDP growth rate over the past decade. However, there is more to the story than that: The rising profile of the African continent also reveals the growing role of a number of its countries in the emergence of a new South agency. It is argued that South–South cooperation is an opportunity. The discussion of the current situation in Africa understood as a continent in all its diversity including sub-Saharan Africa, but also the Maghreb and Egypt, will therefore be placed into this wider context. The renewal of a South agency witnessed over the past decade is somewhat different from the trilateral alliance of Asia–Africa–Latin America formed in the wake of decolonization. Current mega-trends demonstrate that the global South, driven by a number of regional powers, will play a vital role in shaping the twenty-first century. Understanding the complexities of this renewed agency is vital for addressing old wounds that marked the emergence of a South voice in the not-so-distant past. In jüngster Zeit ist Afrika als Teil des emerging South in den Vordergrund der Weltpolitik gerückt. Seine zunehmende Prominenz im globalen Diskurs als new frontier of development signalisiert die Anerkennung des ökonomischen Potenzials des Kontinents. Tatsächlich konnte Afrika im vergangenen Jahrzehnt eine durchschnittliche jährliche BIP-Wachstumsrate in Höhe von 5 Prozent verzeichnen. Aber es geht um mehr: Die wachsende Wahrnehmung des afrikanischen Kontinents ist Ausdruck der immer wichtigeren Rolle einiger afrikanischer Länder bei der Entstehung einer neuen South agency. Die Süd-Süd-Kooperation wird wieder als Möglichkeit erkannt. Die Diskussion der aktuellen Lage Afrikas – in all seiner Vielfalt zwischen subsaharischem Afrika, Maghreb und Ägypten – muss in diesem umfassenderen Kontext geführt werden. Die Erneuerung der South agency, die im vergangenen Jahrzehnt zu beobachten war, ist nicht gleichzusetzen mit der trilateralen Allianz Asien-Afrika-Lateinamerika in der Phase der Dekolonisation. Jüngste Megatrends signalisieren, dass der “globale Süden”, vorangetrieben von einigen Regionalmächten, bei der Gestaltung des 21. Jahrhunderts eine ganz wesentliche Rolle spielen wird. Ein Verständnis für die Komplexität dieser neuen Akteursrolle zu entwickeln, ist die Voraussetzung, wenn man alte Wunden ansprechen will, die in nicht allzu ferner Vergangenheit die Herausbildung einer Stimme des Südens begleiteten.

  7. 78 FR 60844 - Wooden Bedroom Furniture From the People's Republic of China: Partial Rescission of Antidumping...

    Science.gov (United States)

    2013-10-02

    ... Furniture Co., Ltd. Dorbest Ltd., Rui Feng Woodwork Co., Ltd. Aka Rui Feng Woodwork (Dongguan) Co., Ltd., Rui Feng Lumber Development Co., Ltd. Aka Rui Feng Lumber Development (Shenzhen) Co., Ltd., Fine... Fung Wooden Factory, Sun Fung Co., Shin Feng Furniture Co., Ltd., Stupendous International Co., Ltd...

  8. ESTRATEGIA ANESTÉSICA PARA LA CIRUGÍA CON EL CORAZÓN LATIENDO. CINCO AÑOS DE EXPERIENCIA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA / Anesthesia strategy for surgery with beating heart. Five years of experience at the “Ernesto Che Guevara” Cardiology Hospital

    Directory of Open Access Journals (Sweden)

    Ignacio R. Fajardo Egozcue

    2009-06-01

    Full Text Available Introduction and Objectives: The anesthesia in coronary surgery, using high sustained doses of fentanyl, leads to protracted postoperative extubation and stay. The assessment of an anesthesiastrategy for coronary surgery without extracorporeal circulation, in order to reduce the use of opioids and make possible an early extubation and a shorter post-surgical stay, was the objective of thiswork. Methods: 732 patients who underwent surgical myocardial revascularization without heartlung machine, from February 2003 to December 2007, using general anesthesia with intermittent boluses of fentanyl, with or without associated epidural anesthesia, were studied. Results: 625 surgical operations with general anesthesia in boluses and 107 adding peridural anesthesia were carried out. The average amount of fentanyl was 34.7 ml per patient in the first group and 24.9 ml when adding peridural anesthesia. Twenty seven patients were extubated in the operating room. The total average time was 8.6 hours (8.8 hours in the group where the anesthesia in boluses wasused and 6.7 hours for those with peridural anesthesia associated. The total average stay at the Intensive Care Unit was 40.1 hours. Conclusions: The intermittent anesthesia reduced the amount of fentanyl used in 86.6 percent when compared to the high sustained doses reported in a previous study. This made possible the early extubation of the patients, which increased due to the use of peridural anesthesia, and a decrease in average stay of the patient at the Intensive Care Unit.

  9. baat as bio-etiek sonder grense: 'n gereformeerd- etiese ...

    African Journals Online (AJOL)

    the universal moral obligations to do good for, and avoid harm to, other humans. .... one among a number of prima facie principles, and it does not determine the overall ...... Jersey: Presbyterian and Reformed Publishing Company. Fung. r.y.K..

  10. The Application of First‑Trimester Volumetry in Predicting Pregnancy ...

    African Journals Online (AJOL)

    Rawal MY, Malhotra N. Ultrasonography in Early Intrauterine pregnancy. ... Leung KY, Ma Teresa, Lau BY, Chen M. First trimester ultrasound volumetry: .... Ghosh A, Tang MH, Lam YH, Fung E, Chan V. Ultrasound measurement of placental ...

  11. Lumelinnad Kemis ja Rovaniemis / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2004-01-01

    Veebruari algul avati Soomes Rovaniemis ja Kemis lume- ja jääskulptuuri park "The Snow Show". Kuraator New Yorgi galerist Lance Fung. Osalenud kunstnikud ja arhitektid (Zaha Hadid, Juhani Pallasmaa, Anish Kapoor, Tadao Ando jt.)

  12. Snow Show Lapimaal / Karin Hallas-Murula

    Index Scriptorium Estoniae

    Hallas-Murula, Karin, 1957-

    2003-01-01

    2004. a. Rovaniemis läbiviidavast rahvusvahelisest jää- ja lumearhitektuuri üritusest, kuraator Lance Fung. Steven Holli jääplokkidest kuup - projekti pilootehitis. Osalevate arhitektide ja kunstnike osaline loetelu

  13. ONLINE RESOURCES Characterization of 108 novel expressed ...

    Indian Academy of Sciences (India)

    User

    significant contribution to the ongoing development of conservation and .... Seed Science and Technology Innovation Project of Wenzhou City (N20120017). ... Funge-Smith S., Briggs M. and Miao W. M. 2012 Regional overview of fisheries ...

  14. Comparisons of some scattering theories with recent scatterometer measurements. [sea roughness radar model

    Science.gov (United States)

    Fung, A. K.; Dome, G.; Moore, R. K.

    1977-01-01

    The paper compares the predictions of two different types of sea scatter theories with recent scatterometer measurements which indicate the variations of the backscattering coefficient with polarization, incident angle, wind speed, and azimuth angle. Wright's theory (1968) differs from that of Chan and Fung (1977) in two major aspects: (1) Wright uses Phillips' sea spectrum (1966) while Chan and Fung use that of Mitsuyasu and Honda, and (2) Wright uses a modified slick sea slope distribution by Cox and Munk (1954) while Chan and Fung use the slick sea slope distribution of Cox and Munk defined with respect to the plane perpendicular to the look direction. Satisfactory agreements between theory and experimental data are obtained when Chan and Fung's model is used to explain the wind and azimuthal dependence of the scattering coefficient.

  15. 75 FR 47810 - Granting of Request for Early Termination of the Waiting Period Under the Premerger Notification...

    Science.gov (United States)

    2010-08-09

    ...-Scott Rodino Antitrust Improvements Act of 1976, requires persons contemplating certain mergers or... status Party name 30-JUN-10 20100840 G Li & Fung Limited. G Steven Kahn. G The Max Leather Group, Inc. G...

  16. 75 FR 69158 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2010-11-10

    ... Lenore Louit Nicolas Paul Low Elizabeth Lowrie Marcia Lu Chun Ching Luntz Reagan Mather Lusser Christoph... Chi Tan Yenny Jacques G. Yenny Monique Y. Yokokawa Jun Yu Pearl Zang Wenyi Zedan Mohamed F. Zeinalzade...

  17. 76 FR 66361 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2011-10-26

    ... BARBIER CARINE AYMONE BORTHEN JUST CHRISTPHER WESTCOTT BOTNAR RENE M BRIDGES STEPHEN JACK BRONIMANN ANDREA... ROBERT LING PHYLLIS T LO ALEXANDER CHUN HIM LOWENHARDT SANNE LUKAC SAVA R LUTHI MAJA CHRISTINA MA YUWEI...

  18. Investigation of the Antiasthmatic Properties of Ethanol Extract of ...

    African Journals Online (AJOL)

    Investigation of the Antiasthmatic Properties of Ethanol Extract of Callophyllis japonica in Mice. WS Park, KS Lee, JH Chun, SH Urm, DS Lee, DY Lee, SG Park, SK Seo, SJ Heo, ZJ Qian, WK Jung, IW Choi ...

  19. The Significance of the Level Tone in Ghanaian English: Evidence ...

    African Journals Online (AJOL)

    2016-05-29

    May 29, 2016 ... act functions, and perform interactive functions (Chun, 2002). Apart from these functions, ... that the use of falling tones can communicate deliberate rudeness he ..... phonetic features for the segmentation of tone units. In the ...

  20. A high space-time resolution dataset linking meteorological forcing and hydro-sedimentary response in a mesoscale Mediterranean catchment (Auzon) of the Ardèche region, France

    NARCIS (Netherlands)

    Nord, Guillaume; Boudevillain, Brice; Berne, Alexis; Branger, Flora; Braud, Isabelle; Dramais, Guillaume; Gérard, Simon; Coz, Le Jérôme; Legoût, Cédric; Molinié, Gilles; Teuling, Ryan

    2017-01-01

    A comprehensive hydrometeorological dataset is presented spanning the period 1 January 2011-31 December 2014 to improve the understanding of the hydrological processes leading to flash floods and the relation between rainfall, runoff, erosion and sediment transport in a mesoscale catchment

  1. A high space-time resolution dataset linking meteorological forcing and hydro-sedimentary response in a mesoscale Mediterranean catchment (Auzon) of the Ardèche region, France

    OpenAIRE

    Nord, Guillaume; Boudevillain, Brice; Berne, Alexis; Branger, Flora; Braud, Isabelle; Dramais, Guillaume; Gérard, Simon; Coz, Le, Jérôme; Legoût, Cédric; Molinié, Gilles; Teuling, Ryan

    2017-01-01

    A comprehensive hydrometeorological dataset is presented spanning the period 1 January 2011-31 December 2014 to improve the understanding of the hydrological processes leading to flash floods and the relation between rainfall, runoff, erosion and sediment transport in a mesoscale catchment (Auzon, 116km2) of the Mediterranean region. Badlands are present in the Auzon catchment and well connected to high-gradient channels of bedrock rivers which promotes the transfer of suspended solids downst...

  2. Radioactive investigation in an industrial plant of Ascoli Piceno which makes use of graphite scraps; Indagine radiometrica in un insediamento produttivo di Ascoli Piceno che utilizza rottami di grafite

    Energy Technology Data Exchange (ETDEWEB)

    Di Ciaccio, P.; Grisanti, F.; Sabatini, F. [Istituto Superiore di Sanita' , Working Group on Radioactive Contamination of Graphite Samples, Rome (Italy)

    2001-07-01

    In 1997 a radiological alarm originated in an Italian industrial plant in Ascoli Piceno. This fact required to investigate a peculiar case of a possible radioactive contamination in a working environment up to its solution. A working group made of experts of various Institutes and Organisations, after an analysis of the situation, carried out an experimental study and drew some scientific and radiation protection conclusions. This report contains a review of the work performed by the working group and a summary of the radiation protection intervention at the plant. [Italian] L'allarme radiologico creatosi nel 1997 in un insediamento produttivo di Ascoli Piceno ha portato all'esame ed alla soluzione di un singolare evento di possibile contaminazione di un ambiente di lavoro industriale. Il rapporto riporta il resoconto degli interventi di radioprotezione operativa eseguiti presso l'insediamento, l'analisi del problema e lo studio sperimentale eseguiti da un gruppo di lavoro creato fra varie istituzioni e alcune conclusioni scientifiche e radioprotezionistiche del gruppo stesso.

  3. «…la fatica di ricostruire la naturale unità fra parola e immagine». Warburg, Benjamin e ciò che la storia non può dire

    Directory of Open Access Journals (Sweden)

    Silvia Ferretti

    2012-05-01

    Full Text Available The paper intends to draw some topics about relationship between word and image in works and thinking of Aby Warburg and Walter Benjamin. In recent history of ideas, word and image are frequently interpreted as alternative ways to express reality. In both, Warburg and Benjamin, and in spite of  their very different methods of approaching history of art and history of culture, we can find a similar idea of the connection between word and image. The two authors deem that this relationship is necessary to understand historical facts and legacy.

  4. Origini Concettuali di Errori che si Riscontrano Nel Confrontare Numeri Decimali e Frazioni=Conceptual Sources of Difficulties Concerning the Ordering of Decimal Numbers and the Comparison of Fractions.

    Science.gov (United States)

    Bonotto, C.

    1993-01-01

    Examined fifth-grade students' survey responses to investigate incorrect rules that derive from children's efforts to interpret decimals as integers or as fractions. Regarding fractions, difficulties arise because only the whole-part approach to fractions is presented in elementary school. (Author/MDH)

  5. [Exploring life-experience of the staff and volunteers assisting pediatric patients in end-of-life situations] [Article in Italian] • I vissuti dello staff e dei volontari che assistono pazienti pediatrici terminali

    Directory of Open Access Journals (Sweden)

    Rosapia Lauro Grotto

    2014-06-01

    Full Text Available The development of guidelines for palliative care in the paediatric settings is judged to be still incomplete and characterized by many controversial issues; in order to explore the life-experience of individual health care professionals, we proposed a semi-structured questionnaire with open questions on end-of-life procedures to the staff members of the Paediatric Onco-hematology Ward of the University of Padua, of the Oncology Ward and in the Home Assistance Module of the Giannetta Gaslini Hospital, Genoa, both in Italy. This paper will focus on the responses provided to the third question: “In your opinion, can inducing the suspension of the state of consciousness be counted among end-of-life procedures? If so, how and when?”. Staff members were found to face challenging interactions at at least three levels: within the professional team, with respect to the parents and with respect to the adolescent patients. Among the most complex issues raised by the participants we found the moral distress sometimes experienced by nurses with respect to the decisions assumed by doctors, as stated by a nurse: “Everything is subjective in those 24 hours  (… and you are to do or not do certain things and it makes you feel distressed”. Second, it emerged that the relationship with the parents becomes very challenging when the two are not in agreement: “The father wants to give the morphine, but the mother secretly closes the drip”. Finally, the relationship of trust with the adolescent patients is under threat when they ‘want to know’ while parents seem to be unable to tolerate this degree of painful but essential self-consciousness in their ‘child’: “He locked me in the room and asked, ‘Am I dying?’, and I wanted to die at that point…”. Our study shows that health care professionals require not just guidelines but a tailor-made training and support which integrate much deeply the therapeutic as well as the moral and philosophical approaches to the issues raised by palliative care in paediatric settings.Articoli Selezionati del Congresso “Medicina Narrativa e Comunicazione nella Pratica Clinica” ·  Cagliari · 14 Aprile 2014 Guest Editors: Massimiliano Zonza, Vassilios Fanos, Gian Paolo Donzelli

  6. LA SITUATION DES ÉCREVISSES EN FRANCE RÉSULTATS DES ENQUÊTES NATIONALES RÉALISÉES ENTRE 1977 ET 2006 PAR LE CONSEIL SUPÉRIEUR DE LA PÊCHE

    Directory of Open Access Journals (Sweden)

    COLLAS M.

    2007-07-01

    Full Text Available Depuis la fin du XIX° siècle, la distribution des écrevisses en France a connu de profonds bouleversements, et l’introduction d’écrevisses allochtones en provenance essentiellement du continent nord-américain, a irrémédiablement modifié le paysage astacologique français et européen. Les quatre enquêtes réalisées en France par le Conseil Supérieur de la Pêche depuis 1977, ont permis de suivre l’évolution des différentes espèces d’écrevisses recensées sur le territoire national, mettant à chaque fois en évidence la forte expansion des espèces exotiques et le recul des espèces natives. L’enquête de 2006 n’échappe pas à cette tendance et la situation de nos trois espèces d’écrevisses doit désormais être considérée comme alarmante. Deux de ces espèces se caractérisent par un statut de conservation proche de l’extinction (Austropotamobius torrentium et Astacus astacus alors que la troisième, Austropotamobius pallipes est « réfugiée » sur les secteurs apicaux des bassins versants, confinée sur des zones soumises aux premières manifestations du changement climatique et isolées par les espèces exotiques qui progressent de plus en plus vers l’amont. En effet, l’écrevisse du Pacifique (Pacifastacus leniusculus, mais aussi l’écrevisse rouge de Louisiane (Procamabrus clarkii, sont les espèces qui montrent la plus forte expansion géographique durant la période 2001-2006. Partout elles apparaissent comme des concurrents redoutables, plus agressifs, résistants aux pathologies, capables de coloniser des habitats variés…. Ces deux espèces en particulier étendent leur aire de répartition et colonisent chaque année de nouveaux départements, de nouveaux cours d’eau, éliminant par là même, les espèces autochtones. L’expansion des écrevisses introduites, l’arrivée récente en France d’une nouvelle espèce (Orconectes juvenilis et les modifications de la Loi autorisant dorénavant le transport à l’état vivant des « espèces susceptibles de provoquer des déséquilibres biologiques » pourraient sceller définitivement le sort des écrevisses endémiques, si aucune mesure n’est prise rapidement par les autorités, dans le cadre d’un plan d’action national « écrevisse ».

  7. Le site d'Orgnac 3 (Ardèche, France). Étude sédimentologique et géochimique. Cadre chronologique et évolution paléoclimatique

    OpenAIRE

    Khatib , Samir

    1989-01-01

    Les études développées dans cette thèse ont permis de proposer de nouvelles données stratigraphiques, chronologiques et géochimiques. L'étude sédimentologique a mis en évidence quatre ensembles sédimentaires bien distincts, comprenant 12 niveaux stratigraphiques. Les ensembles inférieur I et supérieur IV, se sont déposés sous un climat froid et sec accompagné d'actions éoliennes intenses. L'origine des sédiments de l'ensemble inférieur se situe dans le Massif Central (abondance des minéraux m...

  8. A high space-time resolution dataset linking meteorological forcing and hydro-sedimentary response in a mesoscale Mediterranean catchment (Auzon) of the Ardèche region, France

    Science.gov (United States)

    Nord, Guillaume; Boudevillain, Brice; Berne, Alexis; Branger, Flora; Braud, Isabelle; Dramais, Guillaume; Gérard, Simon; Le Coz, Jérôme; Legoût, Cédric; Molinié, Gilles; Van Baelen, Joel; Vandervaere, Jean-Pierre; Andrieu, Julien; Aubert, Coralie; Calianno, Martin; Delrieu, Guy; Grazioli, Jacopo; Hachani, Sahar; Horner, Ivan; Huza, Jessica; Le Boursicaud, Raphaël; Raupach, Timothy H.; Teuling, Adriaan J.; Uber, Magdalena; Vincendon, Béatrice; Wijbrans, Annette

    2017-03-01

    A comprehensive hydrometeorological dataset is presented spanning the period 1 January 2011-31 December 2014 to improve the understanding of the hydrological processes leading to flash floods and the relation between rainfall, runoff, erosion and sediment transport in a mesoscale catchment (Auzon, 116 km2) of the Mediterranean region. Badlands are present in the Auzon catchment and well connected to high-gradient channels of bedrock rivers which promotes the transfer of suspended solids downstream. The number of observed variables, the various sensors involved (both in situ and remote) and the space-time resolution ( ˜ km2, ˜ min) of this comprehensive dataset make it a unique contribution to research communities focused on hydrometeorology, surface hydrology and erosion. Given that rainfall is highly variable in space and time in this region, the observation system enables assessment of the hydrological response to rainfall fields. Indeed, (i) rainfall data are provided by rain gauges (both a research network of 21 rain gauges with a 5 min time step and an operational network of 10 rain gauges with a 5 min or 1 h time step), S-band Doppler dual-polarization radars (1 km2, 5 min resolution), disdrometers (16 sensors working at 30 s or 1 min time step) and Micro Rain Radars (5 sensors, 100 m height resolution). Additionally, during the special observation period (SOP-1) of the HyMeX (Hydrological Cycle in the Mediterranean Experiment) project, two X-band radars provided precipitation measurements at very fine spatial and temporal scales (1 ha, 5 min). (ii) Other meteorological data are taken from the operational surface weather observation stations of Météo-France (including 2 m air temperature, atmospheric pressure, 2 m relative humidity, 10 m wind speed and direction, global radiation) at the hourly time resolution (six stations in the region of interest). (iii) The monitoring of surface hydrology and suspended sediment is multi-scale and based on nested catchments. Three hydrometric stations estimate water discharge at a 2-10 min time resolution. Two of these stations also measure additional physico-chemical variables (turbidity, temperature, conductivity) and water samples are collected automatically during floods, allowing further geochemical characterization of water and suspended solids. Two experimental plots monitor overland flow and erosion at 1 min time resolution on a hillslope with vineyard. A network of 11 sensors installed in the intermittent hydrographic network continuously measures water level and water temperature in headwater subcatchments (from 0.17 to 116 km2) at a time resolution of 2-5 min. A network of soil moisture sensors enables the continuous measurement of soil volumetric water content at 20 min time resolution at 9 sites. Additionally, concomitant observations (soil moisture measurements and stream gauging) were performed during floods between 2012 and 2014. Finally, this dataset is considered appropriate for understanding the rainfall variability in time and space at fine scales, improving areal rainfall estimations and progressing in distributed hydrological and erosion modelling. DOI of the referenced dataset: doi:10.6096/MISTRALS-HyMeX.1438.

  9. Frontières, traduction et politiques de la différence : la tâche herméneutique de l'éducation comparée

    Science.gov (United States)

    Malet, Régis

    2011-08-01

    Borders, translation and politics of difference: the hermeneutic task of comparative education - Governments are making increasing use of international comparisons as a tool to run and reform education systems, through the establishment of competency norms and assessment standards. In light of this trend, this paper wishes not only to reiterate the crucial distinction, made by Max Weber as early as 1922, between scientific research and political action, but also to recall the principles of separation and mediation from which the comparative approach in education derives. The concepts that comprise a language, that are disseminated and become established in a social world, are borne of history, of dynamic uses, and are culturally rooted. By neglecting this social and cultural provenance of words there is a danger that one can end up with a comparability based on functional equivalencies alone; although there are strong pressures in this direction, it is probably the surest way, in the words of Marcel Détienne, of "comparing the incomparable". The purely instrumental rationality that favours the spread of such frameworks or interpretative models appears indifferent to questions of meaning and culture, apart from being irrational on an axiological level, if we follow Weber. Strangeness or even `otherness' tends to be erased. One wonders therefore what issues are raised for the comparativist when the illusion of spontaneity in translation is reduced to a functional equivalence. In keeping with the researcher's responsibility to mediate, he/she must promote clarification and mutual understanding (inspired by C. Taylor), replacing the standardisation of words with a critical illumination of the semiotic variations generated by their use.

  10. High resolution analysis of uranium and thorium concentration as well as U-series isotope distributions in a Neanderthal tooth from Payre (Ardèche, France) using laser ablation ICP-MS

    Science.gov (United States)

    Grün, Rainer; Aubert, Maxime; Joannes-Boyau, Renaud; Moncel, Marie-Hélène

    2008-11-01

    We have mapped U ( 238U) and Th ( 232Th) elemental concentrations as well as U-series isotope distributions in a Neanderthal tooth from the Middle Palaeolithic site of Payre using laser ablation ICP-MS. The U-concentrations in an enamel section varied between 1 and 1500 ppb. The U-concentration maps show that U-migration through the external enamel surface is minute, the bulk of the uranium having migrated internally via the dentine into the enamel. The uranium migration and uptake is critically dependent on the mineralogical structure of the enamel. Increased U-concentrations are observed along lineaments, some of which are associated with cracks, and others may be related to intra-prismatic zones or structural weaknesses reaching from the dentine into the enamel. The uranium concentrations in the dentine vary between about 25,000 and 45,000 ppb. Our systematic mapping of U-concentration and U-series isotopes provides insight into the time domain of U-accumulation. Most of the uranium was accumulated in an early stage of burial, with some much later overprints. None of the uranium concentration and U-series profiles across the root of the tooth complied with a single stage diffusion-adsorption (D-A) model that is used for quality control in U-series dating of bones and teeth. Nevertheless, in the domains that yielded the oldest apparent U-series age estimates, U-leaching could be excluded. This means that the oldest apparent U-series ages of around 200 ka represent a minimum age for this Neanderthal specimen. This is in good agreement with independent age assessments (200-230 ka) for the archaeological layer, in which it was found. The Th elemental concentrations in the dental tissues were generally low (between about 1 and 20 ppb), and show little relationship with the nature of the tissue.

  11. Palaeolithic Timekeepers Looking At The Golden Gate Of The Ecliptic; The Lunar Cycle And The Pleiades In The Cave Of La-TETe-Du-Lion (Ardéche, France) - 21,000 BP

    Science.gov (United States)

    Rappenglück, Michael A.

    Decades of research work done by several scientists all over the world since the beginning of the 20th century confirmed the idea, that Palaeolithic man looked up to the starry sky and recognized prominent patterns of stars as well as the course of the celestial bodies. Though sometimes highly speculative, the investigations made clear, that time-factored notations played an important role in the archaic cultures of Palaeolithic epochs (from 33,000 to 10,000 BP). There are some distinct and detailed examples of lunar-, solar- and lunisolar-calendars sometimes combined with pictures of seasonality, mostly discovered on transportable bones and stones, but also on the fixed walls of certain caves. The investigations showed that in Palaeolithic epochs time-reckoning, in particular the lunar cycle, had been related to the pregnancy of women too (Figure 2a-d). Recently I showed, that in the Magdalenian time (16,000-12,000 BP) man also recognized single and very complex star patterns, including the Milky Way: the Northern Crown in the cave of El Castillo (Spain), the Pleiades in the cave of Lascaux (France) and the main constellations of the sky at the same location. They were used by the Palaeolithic hunter-gatherers for orientation in space and for time-reckoning. These star patterns also played an important role in the cosmovisions of archaic cultures. Together with the depictions of the course of the moon and the sun, they helped to organize the spatiotemporal structure of daily and spiritual life of Palaeolithic man. Now I present a rock panel in the cave of La-T^ete-du-Lion (France) that shows the combination of a star pattern - Aldebaran in the Bull and the Pleiades - with a drawing of the moons cycle above. This picture comes from the Solutrean epoch ca 21,000-22,000 BP. It shows not only a remarkable similarity with the representation in the Lascaux cave, but clearly connects the star pattern with a part of the lunar cycle.

  12. Organisation de l'activité neuronale cérébelleuse lors de d'une tâche de préhension et reste dans des rats déplaçant librement

    OpenAIRE

    Gao , Hongying

    2012-01-01

    The cerebellum is a brain structure involved in coordination complex motor actions such as voluntary movements. To achieve this function, the precise temporal control of a large population of neurons is required. While a large number of patterned population activity has been characterized in many major brain structures (thalamo-cortical system, basal ganglia, hippocampal formation, etc...), very little is currently known in the cerebellum. Therefore, I investigated the presence and characteri...

  13. RETRACTION (G' / G)-expansion method equivalent to the extended tanh-function method

    Science.gov (United States)

    El-Wakil, S. A.; Abdou, M. A.; El-Shewy, E. K.; Hendi, A.; Abdelwahed, H. G.

    2010-10-01

    This paper has been formally retracted on ethical grounds due to the similarity in content, presentation and style to another article published by Liu Chun-Ping in the journal Communications in Theoretical Physics (Chun-Ping 2009 Commun. Theor. Phys. 51 985). It is unfortunate that this was not detected before going to press. Our thanks go to the original author for bringing this fact to our attention. Corrections were made to this article on 22 October 2010.

  14. Evaluation of Neurophysiologic and Systematic Changes during Aeromedical Evacuation and en Route Care of Combat Casualties in a Swine Polytrauma

    Science.gov (United States)

    2017-02-01

    long range aero-medical evacuation in hypobaric environments on the physiology and organ function of injured warfighters, thus potentially and...currently ongoing. REPORTABLE OUTCOMES: Steve Chun, MD; Ashraful Haque, MD; Brittany Hazzard, BS; Saha Biswajit, MD, Martin Harssema, MD, Charles Auker...Scultetus MD; Ashraful Haque, MD; Brittany Hazzard, BS; Saha Biswajit, MD; Steve Chun, MD; Martin Harssema, MD; Charles Auker, MD, PhD; Debra Malone

  15. In vivo toxicologic study of larger silica nanoparticles in mice

    Directory of Open Access Journals (Sweden)

    Chan WT

    2017-04-01

    Full Text Available Wai-Tao Chan,1–3 Cheng-Che Liu,4 Jen-Shiu Chiang Chiau,5 Shang-Ting Tsai,6 Chih-Kai Liang,6 Mei-Lien Cheng,5 Hung-Chang Lee,7,8 Chun-Yun Yeung,1,3,9 Shao-Yi Hou2,6 1Department of Pediatric Gastroenterology, Hepatology and Nutrition, MacKay Children’s Hospital, 2Graduate Institute of Engineering Technology, National Taipei University of Technology, 3Mackay Medicine, Nursing, and Management College, 4Institute of Preventive Medicine, National Defense Medical Center, Taipei, 5Department of Medical Research, MacKay Memorial Hospital, Hsinchu, 6Graduate Institute of Biochemical and Biomedical Engineering, National Taipei University of Technology, Taipei, 7Department of Pediatrics, MacKay Memorial Hospital, Hsinchu, 8Department of Pediatrics, Taipei Medical University, Taipei, 9Department of Medicine, Mackay Medical College, New Taipei, Taiwan, Republic of China Abstract: Silica nanoparticles (SiNPs are being studied and used for medical purposes. As nanotechnology grows rapidly, its biosafety and toxicity have frequently raised concerns. However, diverse results have been reported about the safety of SiNPs; several studies reported that smaller particles might exhibit toxic effects to some cell lines, and larger particles of 100 nm were reported to be genotoxic to the cocultured cells. Here, we investigated the in vivo toxicity of SiNPs of 150 nm in various dosages via intravenous administration in mice. The mice were observed for 14 days before blood examination and histopathological assay. All the mice survived and behaved normally after the administration of nanoparticles. No significant weight change was noted. Blood examinations showed no definite systemic dysfunction of organ systems. Histopathological studies of vital organs confirmed no SiNP-related adverse effects. We concluded that 150 nm SiNPs were biocompatible and safe for in vivo use in mice. Keywords: in vivo, mice, silica nanoparticle, nanotoxicity

  16. UNPUBLISHED TEXTS / INEDITI

    African Journals Online (AJOL)

    User

    È come una fetta di luna. L'nguria che assaggi e che sputi non ti puoi saziare come del mare e dell'aria e dei pini marittimi e di questa quercia alberi dal tronco di sughero che è facile strappare, corteccia che ricresce. Non ti puoi saziare di questo mare verde e profondo luminosa acqua pietre pesci coralli gusci di perle.

  17. Il potere di Prometeo e il dovere di Kant

    Directory of Open Access Journals (Sweden)

    Stefano Picchetti

    2006-10-01

    Full Text Available Kant ci suggerisce qualcosa che Prometeo e il mito greco avevano già accennato. L'imperativo che pone freno al fare, è già in sé nel soggetto ed è per questo che egli che egli è responsabile delle proprie azioni, indipendentemente dalla legge scritta.

  18. Voyage in Italy : Roberto Rossellini's Non–Dualistic View of the ...

    African Journals Online (AJOL)

    Sostengo inoltre che Viaggio in Italia è il primo passo nella creazione di un cinema inteso come attività che aiuta gli spettatori a liberare se stessi da stereotipi e preconcetti. Concludo affermando che Viaggio in Italia anticipa la caratteristiche estetiche e filosofiche del cinema storico e didattico di Rossellini, che culmina ...

  19. A Multi-Institution Study of Student Demographics and Outcomes in Chemical Engineering

    Science.gov (United States)

    Lord, Susan M.; Layton, Richard A.; Ohland, Matthew W.; Brawner, Catherine E.; Long, Russell A.

    2014-01-01

    Using a large multi-institutional dataset, we describe demographics and outcomes for students starting in and transferring into chemical engineering (ChE). In this dataset, men outnumber women in ChE except among black students. While ChE starters graduate in ChE at rates comparable to or above their racial/ethnic population average for…

  20. BOOK REVIEWS / RECENSIONI

    African Journals Online (AJOL)

    User

    colei che trascorre il tempo accompagnandolo ai giovanotti, dando prova della sua peccaminosità sia sul piano individuale che su quello sociale”. (191). Secondo Bernardino le donne che cercavano di abbellirsi con i cosmetici in realtà finivano per imbruttirsi e compromettere la loro bellezza naturale, oltre che annullare “la ...

  1. La fisica del Novecento per un bilancio critico

    CERN Document Server

    Selleri, Franco

    1999-01-01

    Ma chi ha detto che la fine della fisica è vicina? Che tutto quello che c'era da scoprire è già stato scoperto? E che le generazioni future potranno solo precisare e raffinare, e mai negare o arricchire le attuali teorie? Questo libro si contrappone a pensatori come Heisenberg, Feyman e Hawking che hanno predetto la morte della fisica. L'autore sostiene che grandi progressi sono possibili, ma che il prezzo da pagare per realizzarli è una modifica radicale delle basi della fisica moderna, in particolare abbandonando l'indeterminismo, la non località (paradosso di Einstein, Podolsky e Rosen) e lo stesso principio di relatività.

  2. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    che intellettuali o analfabeti, fortunati o disgraziati, poveri o ricchi, alla fine il bilancio è sempre lo stesso. [...] È la vita, e basta, e se riesco a dirla in modo che altri la riconosca in fraternità leggendomi, questo è il solo dovere che conti, la sola estetica che sia anche un'etica. Che sollievo! Infine l'ho detto, e in prima persona”.

  3. Deciphering chemotaxis pathways using cross species comparisons

    Directory of Open Access Journals (Sweden)

    Armitage Judith P

    2010-01-01

    Full Text Available Abstract Background Chemotaxis is the process by which motile bacteria sense their chemical environment and move towards more favourable conditions. Escherichia coli utilises a single sensory pathway, but little is known about signalling pathways in species with more complex systems. Results To investigate whether chemotaxis pathways in other bacteria follow the E. coli paradigm, we analysed 206 species encoding at least 1 homologue of each of the 5 core chemotaxis proteins (CheA, CheB, CheR, CheW and CheY. 61 species encode more than one of all of these 5 proteins, suggesting they have multiple chemotaxis pathways. Operon information is not available for most bacteria, so we developed a novel statistical approach to cluster che genes into putative operons. Using operon-based models, we reconstructed putative chemotaxis pathways for all 206 species. We show that cheA-cheW and cheR-cheB have strong preferences to occur in the same operon as two-gene blocks, which may reflect a functional requirement for co-transcription. However, other che genes, most notably cheY, are more dispersed on the genome. Comparison of our operons with shuffled equivalents demonstrates that specific patterns of genomic location may be a determining factor for the observed in vivo chemotaxis pathways. We then examined the chemotaxis pathways of Rhodobacter sphaeroides. Here, the PpfA protein is known to be critical for correct partitioning of proteins in the cytoplasmically-localised pathway. We found ppfA in che operons of many species, suggesting that partitioning of cytoplasmic Che protein clusters is common. We also examined the apparently non-typical chemotaxis components, CheA3, CheA4 and CheY6. We found that though variants of CheA proteins are rare, the CheY6 variant may be a common type of CheY, with a significantly disordered C-terminal region which may be functionally significant. Conclusions We find that many bacterial species potentially have multiple

  4. Wing Chun’s Chum Kiu Form. A Study in Stability and Mobility

    Directory of Open Access Journals (Sweden)

    Joyotpaul Chaudhuri

    2012-07-01

    Full Text Available This article analyzes the keys to motion in the second empty-hand form of Wing Chun gongfu: Chum Kiu. The focus is on the proper maintenance of the body’s central axis and its motions, which helps with the development of Wing Chun power and the foundations of delivering that power. The form includes short bridges, stepping, turning, and kicking. The motions are built on the structural foundations created by regular practice of the first form, Siu Lim Tau.

  5. Drug-resistant colon cancer cells produce high carcinoembryonic antigen and might not be cancer-initiating cells

    OpenAIRE

    Lee HC; Ling QD; Yu WC; Hung CM; Kao TC; Huang YW; Higuchi A

    2013-01-01

    Hsin-chung Lee,1,2 Qing-Dong Ling,1,3 Wan-Chun Yu,4 Chunh-Ming Hung,4 Ta-Chun Kao,4 Yi-Wei Huang,4 Akon Higuchi3–51Graduate Institute of Systems Biology and Bioinformatics, National Central University, Jhongli, Taoyuan, 2Department of Surgery, Cathay General Hospital, Da'an District, Taipei, 3Cathay Medical Research Institute, Cathay General Hospital, Hsi-Chi City, Taipei, 4Department of Chemical and Materials Engineering, National Central University, Jhongli, Taoyuan, Taiwa...

  6. Disturbi mentali come complex network : Un’ introduzione e una panoramica all’ approccio network in psicopatologia

    NARCIS (Netherlands)

    Nuijten, M.B.; Deserno, Marie K.; Cramer, A.O.J.; Costantini, Giulio; Borsboom, Denny

    2016-01-01

    I disturbi mentali sono stati tradizionalmente concepiti come variabili latenti, che hanno un impatto sulla sintomatologia osservabile. Approcci alternativi proposti più recentemente invece concepiscono i disturbi mentali come sistemi di sintomi che si rinforzano vicendevolmente. Tali approcci

  7. Cronache dell'universo fisica moderna e cosmologia

    CERN Document Server

    Regge, Tullio

    1981-01-01

    Dall'infinitamente piccolo all'infinitamente grande: è il viaggio che ci propone Tullio Regge, che oltre ad essere uno dei massimi fisici contemporanei, ha rivelato un talento eccezionale per la divulgazione.

  8. Filosofia della fisica

    CERN Document Server

    1997-01-01

    Un libro che mancava : attraverso i contributi dei maggiori specialisti italiani, la definizione rigorosa di una disciplina, la filosofia della fisica, che si pone nel punto d'incontro tra la cultura scientifica e quella umanistica.

  9. Physiologic Waveform Analysis for Early Detection of Hemorrhage during Transport and Higher Echelon Medical Care of Combat Casualties

    Science.gov (United States)

    2011-11-01

    National Center for Health Workforce Analysis. Projected supply, demand and short- ages of registered nurses : 2000–2020, 2002. 41Urzua, J., et al... paediatric crural and brachial blood pressure index. J 278 Hum Hypertens 21: 415-417, 2007. 279 7. Fung P, Dumont G, Ries C, Mott C, Ansermino M

  10. Invasive Asian Fusarium – Euwallacea ambrosia beetle mutualists pose a serious threat to forests, urban landscapes and the avocado industry

    Science.gov (United States)

    Several species of the ambrosia beetle Euwallacea (Coleoptera: Curculionidae: Scolytinae) cultivate Ambrosia Fusarium Clade (AFC) species in their galleries as a source of food. Like all other scolytine beetles in the tribe Xyleborini, Euwallacea are thought to be obligate mutualists with their fung...

  11. Dependence of Radar Backscatter on the Energetics of the Air-Sea Interface

    Science.gov (United States)

    1990-07-01

    et al., 1977; Moore and Fung, 1979; Schroeder, et al., 1982). However, Daley, et al., (1984) identify the deficiencies in this simple type of...between wind input and dissipation then yields the high wavenumber spectrum: T.)= [-40. 194 p,,{ k)- -..]. 4vk) (100) where a=fl(Tk 2/pwg) and n=f2( Tk2

  12. 76 FR 7907 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2011-02-11

    ... PATRICK COYLE BRENDAN H D'ALVIELLA EUGENIE AIMEE GOBLET DARWIN ANGELA MARY BRUCE DAVID CARY RICHARD DAVID... ELIZABETH U FUNG PASCALE N GIBSON MATTHEW CHARLES GIBSON SARAH CLAIRE GIDRON GILLA MEZZAN GINDIN DMITRY... LINDA ANETTE HANSEN PAUL ROBERT HARDWICK III CHARLES CHEEVER HARRIS JANE VELDA HARSONO SUDARGO HARTLEY...

  13. The carbon budget of South Asia

    Digital Repository Service at National Institute of Oceanography (India)

    Patra, P.K.; Canadell, J.G.; Houghton, R.A.; Piao, S.L.; Oh, N.-H.; Ciais, P.; Manjunath, K.R.; Chhabra, A.; Wang, T.; Bhattacharya, T.; Bousquet, P.; Hartman, J.; Ito, A.; Mayorga, E.; Niwa, Y.; Raymond, P.; Sarma, V.V.S.S.; Lasco, R.

    distribution and terrestrial ecosystem models (e.g. Math- ews and Fung, 1987; Olivier and Berdowski, 2001; Ito and Inatomi, 2012). Components of these bottom-up estimations are scaled and used as an input to chemistry-transport models and compared...

  14. Hydrodynamic blood plasma separation in microfluidic channels

    DEFF Research Database (Denmark)

    Jouvet, Lionel

    2010-01-01

    The separation of red blood cells from plasma flowing in microchannels is possible by biophysical effects such as the Zweifach–Fung bifurcation law. In the present study, daughter channels are placed alongside a main channel such that cells and plasma are collected separately. The device is aimed...

  15. A Randomized Placebo-Controlled Trial of D-Cycloserine for the Enhancement of Social Skills Training in Pervasive Development Disorders

    Science.gov (United States)

    2015-03-01

    hyperactivity disorder, oppositional defiant disorder, schizophrenia, ASD, social anxiety disorder, and major depression ). The child’s appropriateness for...4):958-964. 31. Hardan AY, Fung LK, Libove RA, et al. A randomized controlled pilot trial of oral N- acetylcysteine in children with autism. Biological

  16. Post-CHF heat transfer during steady-state and transient conditions

    International Nuclear Information System (INIS)

    Fung, K.K.

    1978-06-01

    This review extends previous reviews of steady-state post-CHF literature by Groeneveld, Gardiner, and Fung by including more recent data. A review of the literature on transient post-CHF data is also included by extending the work of Yadigaroglu

  17. C‑reactive Protein and Disease Outcome in Nigerian Sickle Cell ...

    African Journals Online (AJOL)

    Sillesen H, Nordestgaard BG. Genetically elevated C‑reactive protein and ischemic vascular disease. N Engl J Med. 2008;359:1897‑908. 18. Walter PB, Fung EB, Killilea DW, Jiang Q, Hudes M, Madden J, et al. Oxidative stress and inflammation in iron‑overloaded patients with beta‑thalassaemia or sickle cell disease. Br J.

  18. 78 FR 38679 - Medicare Program; Hospital Inpatient Prospective Payment Systems for Acute Care Hospitals and the...

    Science.gov (United States)

    2013-06-27

    ... Systems for Acute Care Hospitals and the Long Term Care Hospital Prospective Payment System and Proposed... Payment Systems for Acute Care Hospitals and the Long Term Care Hospital Prospective Payment System and... regarding MS-DRG classifications and new technology add-on payments. Eva Fung (410) 786-7539, for...

  19. Download this PDF file

    African Journals Online (AJOL)

    ability of a pesticide mixture by soil micro organisms. Lienou C. ... fung and pH7.2 for bacteria. According to statistical analysis using Student t-test of the three parameters ..... and 9 on the pH scale was suitable for bioremediation of xenobiotics.

  20. Real-time PCR quantification of arbuscular mycorrhizal fungi: does the use of nuclear or mitochondrial markers make a difference?

    Czech Academy of Sciences Publication Activity Database

    Voříšková, A.; Jansa, Jan; Püschel, David; Krüger, M.; Cajthaml, Tomáš; Vosátka, M.; Janoušková, M.

    2017-01-01

    Roč. 27, č. 6 (2017), s. 577-585 ISSN 0940-6360 R&D Projects: GA ČR GA15-05466S Institutional support: RVO:61388971 Keywords : Arbuscular mycorrhizal fung * Real-time PCR * PLFA Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.047, year: 2016

  1. 77 FR 13604 - Ocean Transportation Intermediary License; Applicants

    Science.gov (United States)

    2012-03-07

    ... A. Rincon, Manager (Qualifying Individuals), Application Type: Business Structure Change. De Well... Type: New NVO License. King Solomon Logistics Inc. (NVO), 135-14 Liberty Avenue, South [[Page 13605... Logistics Inc. (NVO), 167-16 146th Avenue, Suite 203, Jamaica, NY 11434, Officer: Yau Fung Ling, President...

  2. Reply to Ira Rabin’s Comment on our paper Rasmussen et al.

    NARCIS (Netherlands)

    Rasmussen, Kaare Lund; Tenorio, Anna Lluveras; Bonaduce, Ilaria; Colombini, Maria Perla; Birolo, Leila; Galano, Eugenio; Amoresano, Angela; Doudna, Greg; Bond, Andrew D.; Palleschi, Vincenzo; Lorenzetti, Giulia; Legnaioli, Stefano; van der Plicht, Johannes; Gunneweg, Jan

    2012-01-01

    In the Comment by Dr. I. Rabin from Bundesanstalt für Materialforschung und -prüfung in Berlin are stated many conjectures and apparent guesses contradicting several of our interpretations. Most of Rabin’s ‘guesses’ and interpretations are unwarranted. Below we rebut some of the misinterpretations

  3. Author Details

    African Journals Online (AJOL)

    Fung Ming Liu, Christy. Vol 31, No 4 (2013) - Articles The translator status, the translation market and developing economies: A preliminary study of ASEAN countries. Abstract. ISSN: 1607-3614. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

  4. Geologia, misura e posizionamento spaziale

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-04-01

    Full Text Available Le Scienze della Terra sono poi date dall’insieme delle discipline che studiano la struttura interna, la morfologia superficiale e tutta l’atmosfera che circonda il pianeta Terra e la sua evoluzione nel tempo. Potremmo anche dire ormai che lo studio della Terra costituisce un caso particolare delle Scienze Planetarie, che si occupano dello studio dei pianeti presenti nel nostro sistema solare.

  5. Il marketing del nuovo millennio

    OpenAIRE

    M. Addis

    2007-01-01

    Con la consueta maestria, Kolter, supportato da Keller, mette a disposizione dei suoi numerosi lettori uno strumento di grande efficacia, dalla struttura estremamente agile, che potrà essere apprezzato da coloro che il marketing lo insegnano e dai professionisti che cercano un'opera di riferimento autorevole e aggiornata ma al contempo di facile consultazione, che possa accompagnarli nello svolgimento delle attività quotidiane. Il testo è una guida essenziale alla disciplina del marketing,...

  6. Gregory Crane e i cittadini della repubblica delle lettere

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2012-05-01

    Full Text Available Chi studia l’antichità conosce Gregory Crane anche quando non ne rammenta il nome, non per quello che ha scritto ma per quello che ha reso possibile scrivere. Crane è il direttore del Perseus Project, una biblioteca digitale che libera gli studiosi dal microcosmo chiuso e inaccessibile della monografia accademica, permettendo loro di lavorare sui classici [...

  7. LIFE-WRITING / NARRARSI

    African Journals Online (AJOL)

    User

    12 nov 2004 ... pochi minuti, prima che il vecchio scendesse dall'autobus, una sorta di intimità fra di noi che ricordo mi infastidiva. Una vicinanza eccessiva che mi faceva percepire chiaramente quanto incolmabile fosse la nostra distanza. Prima di scendere dall'autobus quel vecchio mi diede altri consigli su argomenti ...

  8. NOTES AND GLEANINGS / NOTE E CURIOSITÀ

    African Journals Online (AJOL)

    Principe D. Sigismondo Chigi ed altri” con il numero di catalogo. 1815/IV. .... ricorre a formula del tipo “un certo Pietro che non so dei quali”. Frequente l'uso di 'con' ...... catene di Sant'Antonio; che sono convinte che ficcando uno spillone in ...

  9. L’estetica dell’ebreo e del cristiano nei racconti de Lo scialle andaluso di Elsa Morante

    NARCIS (Netherlands)

    Cascio, G.

    2007-01-01

    Quest’articolo indaga alcuni elementi fisiognomici ricorrenti nelle figure che popolano le novelle de Lo scialle andaluso di Elsa Morante. Cioè, qui suggeriamo l’ipotesi che nel piano narrativo ci sia una categorizzazione estetica che si riversa nel progetto dei contenuti e si proponga di dedurre i

  10. Prefazione

    NARCIS (Netherlands)

    Gobbo, F.; Caligaris, I.

    2016-01-01

    Chi sono gli esperantisti? Perché scelgono di studiare l’esperanto? Per quali ragioni si accostano al movimento? Che cosa rappresenta per loro questa lingua? Quali valori veicola? Che posizione occupa nel loro repertorio linguistico? Ma soprattutto: l’esperanto è solo una lingua? E in che modo è

  11. Subversion and reconstruction of the detective novel: a reading of ...

    African Journals Online (AJOL)

    Nella lettura che si fa del terzo romanzo poliziesco di Sciascia, lo si scompone per dimostrare come l'autore intenzionalmente sovverte, manipola e rielabora la tecnica e gli elementi che costituiscono il 'giallo' come genere. Nel contempo si cerca di decifrare la pletora di citazioni pittoriche e letterarie che s'intrecciano nella ...

  12. Family Planning - A Priority Social and Health Action Programme for ...

    African Journals Online (AJOL)

    personal identity and value, make connections wich ancestors and descendants" ... which promote che use of safe and effective modern mechods of contraception which ... ety as a whole. FP services, on the other hand, are motivated ... you cannot fail to have noticed che almost total collapse of che economies of many ...

  13. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    tardi, nel V libro dei Discorsi del poema eroico. 5, il Tasso, dopo aver affermato che non solo Dante ha innalzato il livello di reputazione dell'allegoria, ma che tutta la Commedia poggia su basi allegoriche (“non è parte che non sia allegorica”)6 ribadisca il concetto della medesima postilla: “Ma egli non dechiara se stesso ...

  14. Il narratore algoritmico

    Directory of Open Access Journals (Sweden)

    Paolo Sordi

    2017-06-01

    Ciò che resta dell’ipertesto è una “rete televisiva”, una piattaforma di broadcasting che privilegia oralità, video e slideshow in modo che con le loro performance dai palchi di TED e YouTube i guru dell’epica digitale e dell’innovazione possano affermarsi come le vere pop star di questa epoca neoliberista.

  15. QING YING LIU

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. QING YING LIU. Articles written in Bulletin of Materials Science. Volume 40 Issue 7 December 2017 pp 1329-1333. Synthesis and enhanced photocatalytic activity of g-C 3 N 4 hybridized CdS nanoparticles · QING YING LIU YI LING QI YI FAN ZHENG XU CHUN SONG.

  16. YI LING QI

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. YI LING QI. Articles written in Bulletin of Materials Science. Volume 40 Issue 7 December 2017 pp 1329-1333. Synthesis and enhanced photocatalytic activity of g-C 3 N 4 hybridized CdS nanoparticles · QING YING LIU YI LING QI YI FAN ZHENG XU CHUN SONG · More Details ...

  17. Evaluating "Cat Country": The Humor within Satire

    Science.gov (United States)

    Chang, Chung-chien Karen

    2010-01-01

    Satire, as a mode, is not frequently employed in Chinese narratives. "Cat Country," or "Mao Cheng Ji," written by Lao She (pen name of Shu Qing Chun, 1898--1966) has come under much attack of its literary values. Whereas most critics have no doubt that this work sets out to satirize China through the portrayal of a society of…

  18. Biisofraxidin on Apoptosis of Human Gastric Cancer BGC-823 Cells

    African Journals Online (AJOL)

    Wu et al. Trop J Pharm Res, October 2015; 14(10): 1803. Tropical Journal of Pharmaceutical Research ... Jian-Tao Wu1,2*, She-Min Lv1, Chun-Hui Lu1, Jun Gong1 and Jian-Bo An3 ..... Zhu AK, Zhou H, Xia JZ, Jin HC, Wang K, Yan J, Zuo JB,.

  19. African Journal of Biotechnology - Vol 12, No 41 (2013)

    African Journals Online (AJOL)

    Expression of an engineered tandem-repeat starch-binding domain in sweet potato plants · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Yunfeng Zhang, Qin Ji, Yujun Xing, Qiang Li, Xin Wang, Chun Xu, Cuixiang Huang. http://dx.doi.org/10.5897/AJB11.3321 ...

  20. During the British Antarctic Survey's Offshore Biological Programme ...

    African Journals Online (AJOL)

    spamer

    high wingfold thickened to form a ridge, long wing, short crest; hood long relative to crest and broadly notched in the midline; thickened fold running to lower part ... soma (Goodrich, 1896), C. imperator Chun, 1910, C. atlantica (MacDonald & Clench, 1934), C. joubini. Voss, 1967, C. capensis Voss, 1967 and C. calyx. Young ...

  1. Studies in Intelligence. Volume 54, Number 4, December 2010

    Science.gov (United States)

    2010-12-01

    of Monte Cristo . In its description of Japan, including its intelligence organs, Hong’s story is far more detailed and accurate than that of, say...Chun-hyang, the author makes references to the poetry of Pushkin, the fiction of Stendhal, Shakespeare’s play Twelfth Night, and Dumas’ novel The Count

  2. VeriML: A Dependently-Typed, User-Extensible and Language-Centric Approach to Proof Assistants

    Science.gov (United States)

    2013-01-01

    newly-arrived members of the FLINT group, especially Xinyu Feng, Alex Vaynberg, Rodrigo Ferreira, David Costanzo, Shu-Chun Weng, Jan Hoffmann and Mike...Constable, S.F. Allen, H.M. Bromley, W.R. Cleaveland, J.F. Cremer , R.W. Harper, D.J. Howe, T.B. Knoblock, N.P. Mendler, P. Panangaden, et al. Implementing

  3. Upregulation of miR-222 in both Helicobacter pylori-infected and ...

    Indian Academy of Sciences (India)

    MINA NOORMOHAMMAD

    of this study was to analyse the expression level of miR-222 in gastric cancer tissues, evaluating the relationship between. miR-222 ... using RT-qPCR and compared with 88 healthy samples. ... observed in some diseases; for instance, hepatocellular carci- noma .... cellular matrix proteins in stomach cells (Chun-Zhi et al.

  4. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Chi-Fang Chin1 Arthur Chun-Chieh Shih2 Kuo-Chin Fan1 3. Department of Computer Science and Information Engineering, National Central University, Chung-Li, Taiwan; Institute of Information Science, Academia Sinica, Taipei, Taiwan; Department of Informatics, Fo Guang Univeristy, Ilan, Taiwan ...

  5. Leveraging communities of practice for strategic advantage

    National Research Council Canada - National Science Library

    Saint-Onge, Hubert; Wallace, Debra

    2003-01-01

    ... by sharing knowledge through its online communities. Hubert Saint-Onge, Canada's best known KM strategist, and Deb Wallace, community builder par excellence, have written an engaging practitioner's guide on how to develop communities of practice as forums for learning and knowledge sharing." -Chun Wei Choo, Ph.D., Associate Professor, Fac...

  6. Kaks uut näitust 24 tunni galeriis

    Index Scriptorium Estoniae

    2003-01-01

    Aadressil www.kunstikeskus.ee väljapanekud "Suur Hiina naeratus" hiina kunstnike - Song Haizeng, Du Xinjian, Xue Jiye, Wang Jing, Wu Meng Chun, Zhong Biao - töödest ja "Raffa oma galerii" kunstilehekülge külastanud inimeste online-joonistusmasina abiga joonistatud piltidest

  7. Advanced Curvature Deformable Mirrors

    Science.gov (United States)

    2010-09-01

    ORGANIZATION NAME(S) AND ADDRESS(ES) University of Hawaii ,Institute for Astronomy,640 North A‘ohoku Place, #209 , Hilo ,HI,96720-2700 8. PERFORMING...Advanced Curvature Deformable Mirrors Christ Ftaclas1,2, Aglae Kellerer2 and Mark Chun2 Institute for Astronomy, University of Hawaii

  8. Contextual Cueing in Multiconjunction Visual Search Is Dependent on Color- and Configuration-Based Intertrial Contingencies

    Science.gov (United States)

    Geyer, Thomas; Shi, Zhuanghua; Muller, Hermann J.

    2010-01-01

    Three experiments examined memory-based guidance of visual search using a modified version of the contextual-cueing paradigm (Jiang & Chun, 2001). The target, if present, was a conjunction of color and orientation, with target (and distractor) features randomly varying across trials (multiconjunction search). Under these conditions, reaction times…

  9. A Comparison of HAART Outcomes between the US Military HIV Natural History Study (NHS) and HIV Atlanta Veterans Affairs Cohort Study (HAVACS)

    Science.gov (United States)

    2013-05-01

    Acknowledgments The IDCRP HIV Working Group includes: Susan Banks, RN, CAPT Mary Bavaro, MD, Ionut Bebu, PhD, Helen Chun, MD, Nancy Crum- Cianflone, MD, MPH...Cathy Decker, MD, Conner Eggleston, LTC Tomas Ferguson, MD, COL Susan Fraser, MD, MAJ Joshua Hartzell, MD, MAJ Joshua Hawley, MD, LTC Gunther Hsue, MD

  10. The online Self

    NARCIS (Netherlands)

    Gloerich, I.; van Dipten, L.; Rasch, M.D.

    2017-01-01

    Following the conference Fear and Loathing of the Online Self and the publication of Culture of the Selfie: Self-Representation in Contemporary Visual Culture in May 2017, this episode of INC’s Zero Infinite podcast zooms in on the online self and selfies, with Ana Peraica, Wendy Chun and Rebecca

  11. DsRed gene expression by doxycycline in porcine fibroblasts and ...

    African Journals Online (AJOL)

    DsRed gene expression by doxycycline in porcine fibroblasts and cloned embryos using transposon. SuJin Kim, JoonHo Moon, BegoRoibas da Torre, Islam M Saadeldin, JungTaek Kang, JiYei Choi, SolJi Park, Byeong-Chun Lee, Goo Jang Goo Jang ...

  12. SEM-EDX

    African Journals Online (AJOL)

    aghomotsegin

    2015-03-11

    Mar 11, 2015 ... Chun-Yen Liu1, Chao-Jen Wang1, Wen-Chuan Chung2, Chien Chu3, Wan-Yu Lin1 and ..... We sincerely thank Dr. C. J. Chang, Plant Pathologist, .... Wasser SP, Didukh MY, de A. Amazonas MAL, Nevo E, Stamets P, da.

  13. Meaning-Based Scoring: A Systemic Functional Linguistics Model for Automated Test Tasks

    Science.gov (United States)

    Gleason, Jesse

    2014-01-01

    Communicative approaches to language teaching that emphasize the importance of speaking (e.g., task-based language teaching) require innovative and evidence-based means of assessing oral language. Nonetheless, research has yet to produce an adequate assessment model for oral language (Chun 2006; Downey et al. 2008). Limited by automatic speech…

  14. DMPD: Lysophospholipid receptors: signaling and biology. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 15189145 Lysophospholipid receptors: signaling and biology. Ishii I, Fukushima N, Y...e X, Chun J. Annu Rev Biochem. 2004;73:321-54. (.png) (.svg) (.html) (.csml) Show Lysophospholipid receptors...: signaling and biology. PubmedID 15189145 Title Lysophospholipid receptors: signaling and biology. Authors

  15. Single-particle characterization of urban aerosol particles collected in three Korean cites using low-Z electron probe X-ray microanalysis.

    Science.gov (United States)

    Ro, Chul-Un; Kim, HyeKyeong; Oh, Keun-Young; Yea, Sun Kyung; Lee, Chong Bum; Jang, Meongdo; Van Grieken, René

    2002-11-15

    A recently developed single-particle analytical technique, called low-Z electron probe X-ray microanalysis (low-Z EPMA), was applied to characterize urban aerosol particles collected in three cities of Korea (Seoul, CheongJu, and ChunCheon) on single days in the winter of 1999. In this study, it is clearly demonstrated that the low-Z EPMA technique can provide detailed and quantitative information on the chemical composition of particles in the urban atmosphere. The collected aerosol particles were analyzed and classified on the basis of their chemical species. Various types of particles were identified, such as soil-derived, carbonaceous, marine-originated, and anthropogenic particles. In the sample collected in Seoul, carbonaceous, aluminosilicates, silicon dioxide, and calcium carbonate aerosol particles were abundantly encountered. In the CheongJu and ChunCheon samples, carbonaceous, aluminosilicates, reacted sea salts, and ammonium sulfate aerosol particles were often seen. However, in the CheongJu sample, ammonium sulfate particles were the most abundant in the fine fraction. Also, calcium sulfate and nitrate particles were significantly observed. In the ChunCheon sample, organic particles were the most abundant in the fine fraction. Also, sodium nitrate particles were seen at high levels. The ChunCheon sample seemed to be strongly influenced by sea-salt aerosols originating from the Yellow Sea, which is located about 115 km away from the city.

  16. Mohammed Ashraf

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Mohammed Ashraf. Articles written in Sadhana. Volume 34 Issue 4 August 2009 pp 607-613. Fabrication of polymer-based reflowed microlenses on optical fibre with control of focal length using differential coating technique · Mohammed Ashraf Franck Chollet Murukeshan Matham Chun Yang.

  17. Expression of porcine myosin heavy chain 1 gene in Berkshire loins ...

    African Journals Online (AJOL)

    Expression of porcine myosin heavy chain 1 gene in Berkshire loins with a high pH24 value. Jin Hun Kang, Woo Young Bang, Eun Jung Kwon, Yong Hwa Lee, Da Hye Park, Eun Seok Cho, Min Ji Kim, Jong-Soon Choi, Hwa Chun Park, Beom Young Park, Chul Wook Kim ...

  18. yi fan zheng

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. YI FAN ZHENG. Articles written in Bulletin of Materials Science. Volume 40 Issue 7 December 2017 pp 1329-1333. Synthesis and enhanced photocatalytic activity of g-C 3 N 4 hybridized CdS nanoparticles · QING YING LIU YI LING QI YI FAN ZHENG XU CHUN SONG.

  19. Arabidopsis CPR5 is a senescence-regulatory gene with pleiotropic functions as predicted by the evolutionary theory of senescence

    NARCIS (Netherlands)

    Jing, Hai-Chun; Anderson, Lisa; Sturre, Marcel J. G.; Hille, Jacques; Dijkwel, Paul P.

    2007-01-01

    Arabidopsis CPR5 is a senescence-regulatory gene with pleiotropic functions as predicted by the evolutionary theory of senescence Hai-Chun Jing1,2, Lisa Anderson3, Marcel J.G. Sturre1, Jacques Hille1 and Paul P. Dijkwel1,* 1Molecular Biology of Plants, Groningen Biomolecular Sciences and

  20. Corpi abit(uati: relazioni di relazioni e unità sistemica

    Directory of Open Access Journals (Sweden)

    Sergio Straface

    2014-11-01

    Full Text Available Consacrare uno spazio, allora, un’abitazione, un corpo, il corpo persona e personificato potrebbe generare quella connessione sistemica che disabit(ua… Questo è forse uno dei motivi per cui è spesso così difficile imparare le lingue. E allora, l’unità sistemica, quella nuova, che genera significati vivi, potrebbe essere possibile con-sé-crandosi all’unità stessa ricordando quella lingua connettiva e correttiva, sistemica, che riconnette il sé al proprio corpo, lo stesso corpo che non dimentica e che si esprime in gesti e toni di voce. Forse. Per una antropologia degli spazi… persona.

  1. Il passato nell’epoca della sua (ri)producibilità digitale. Torino 1943 - 45. Metodologia della ricerca con tecnologie informatiche. Sistema storico-territoriale di informazione multimediale

    OpenAIRE

    Tosatto, Claudio

    2008-01-01

    Se il lavoro dello storico è capire il passato come è stato compreso dalla gente che lo ha vissuto, allora forse non è azzardato pensare che sia anche necessario comunicare i risultati delle ricerche con strumenti propri che appartengono a un'epoca e che influenzano la mentalità di chi in quell'epoca vive. Emergenti tecnologie, specialmente nell’area della multimedialità come la realtà virtuale, permettono agli storici di comunicare l’esperienza del passato in più sensi. In che...

  2. Individuazione degli errori di scheggiatura nei diversi metodi di débitage del Paleolitico inferiore e medio. Gli esempi di Cà Belvedere di Monte Poggiolo (FC), Guado San Nicola 1 (IS), Riparo Tagliente (VR), Payre e Abri du Maras (Ardéche, Francia).

    OpenAIRE

    Buonsanto, Cecilia

    2012-01-01

    The understanding of the management of natural resources by prehistoric man through an analysis of stone tools is useful to create parameters for the study of the level of manual dexterity and subsistence strategies in the Paleolithic. The study of knapping errors in experimental and archaeological lithic collections can reveal the presence of beginners or of experienced knappers and offers a comprehensive overview on the various errors associated with different methods of knapping débitage. ...

  3. ÉVOLUTION DE LA RÉPARTITION DES ÉCREVISSES EN FRANCE MÉTROPOLITAINE SELON LES ENQUÊTES NATIONALES MENÉES PAR LE CONSEIL SUPÉRIEUR DE LA PÊCHE DE 1977 À 2001

    Directory of Open Access Journals (Sweden)

    CHANGEUX T.

    2003-04-01

    Full Text Available Selon les enquêtes nationales menées par le Conseil supérieur de la pêche depuis 1977 en France métropolitaine, la répartition des espèces d’écrevisses montre que les espèces autochtones (Austropotamobius pallipes, Astacus astacus, Austropotamobius torrentium sont soit rares, soit en forte régression, alors que les espèces introduites (Orconectes limosus, Pacifastacus leniusculus, Procambarus clarkii, Astacus leptodactylus progressent. L’interdiction de transport vivant des espèces introduites, à l’exception d’A. leptodactylus, n’a pas enrayé le phénomène avec une accélération particulière de la progression de P. leniusculus ces cinq dernières années, certainement responsable de la recrudescence des cas de peste (Aphanomyces astaci. Les autres mesures favorisant les espèces autochtones, comme la limitation des prélèvements par pêche et les programmes de réintroduction, n’inversent pas la tendance. Il semble donc nécessaire de développer une politique de conservation centrée sur la préservation de l’habitat et le respect de certaines règles de prophylaxie à déterminer. Cela ne peut s’envisager que sur des bassins versants de petite surface facilement contrôlables s’il existe un fort engagement des autorités locales. Les 55 arrêtés de biotope, et surtout les 154 sites Natura 2000 avec leurs plans de gestion associés, apparaissent comme des voies prometteuses pour mettre en œuvre ce type d’actions en France. Le cas de l’île Corse, récemment colonisée par O. limosus, mériterait des mesures réglementaires particulières pour éviter que P. leniusculus et P. clarkii, ne la suivent dans l’avenir.

  4. Overpotential for CO2 electroreduction lowered on strained penta-twinned Cu nanowires? ?Electronic supplementary information (ESI) available: Details of DFT and MD calculations, CHE model and reaction pathways for C2H4 production. See DOI: 10.1039/c5sc02667a Click here for additional data file.

    OpenAIRE

    Chen, Zhengzheng; Zhang, Xu; Lu, Gang

    2015-01-01

    Based on first-principles calculations, we predict that penta-twinned Cu nanowires (NWs) are superior to conventional Cu catalysts for CO2 electroreduction. The penta-twinned NWs possess a combination of ultrahigh mechanical strength, large surface-to-volume ratios and an abundance of undercoordinated adsorption sites, all desirable for CO2 electroreduction. In particular, we show that the penta-twinned Cu NWs can withstand elastic strains orders of magnitude higher than their conventional co...

  5. Overpotential for CO2 electroreduction lowered on strained penta-twinned Cu nanowires† †Electronic supplementary information (ESI) available: Details of DFT and MD calculations, CHE model and reaction pathways for C2H4 production. See DOI: 10.1039/c5sc02667a Click here for additional data file.

    Science.gov (United States)

    Chen, Zhengzheng; Zhang, Xu

    2015-01-01

    Based on first-principles calculations, we predict that penta-twinned Cu nanowires (NWs) are superior to conventional Cu catalysts for CO2 electroreduction. The penta-twinned NWs possess a combination of ultrahigh mechanical strength, large surface-to-volume ratios and an abundance of undercoordinated adsorption sites, all desirable for CO2 electroreduction. In particular, we show that the penta-twinned Cu NWs can withstand elastic strains orders of magnitude higher than their conventional counterpart, and as a result their CO2 electroreduction activities can be significantly enhanced by elastic tensile strains. With a moderate tensile strain, the bias potential for methane production at a decent current density (2 mA cm–2) can be reduced by 50%. On the other hand, the competing hydrogen evolution reaction can be suppressed by the tensile strains. The presence of H at the NW surface is found to have a minor effect on CO2 electroreduction. Finally, we propose to use graphene as a substrate to stretch deposited Cu NWs. PMID:28757974

  6. Étude de l’impact de la matrice d’un fruit sur la libération et la perception des composés d’arôme en condition in vivo : application à la mangue fraîche ou transformée

    OpenAIRE

    Bonneau , Adeline

    2016-01-01

    Retro-nasal perception of flavor during chewing food in mouth is a complex process. The physico-chemical and aromatic compositions of food, its physical properties, the interactions and reactions involved in oral cavity are the main parameters which can influence flavor perception. In this study, mango is used as model fruit. The study will be focused in better understanding of food disintegration effect, its texture and inter-individual variability on the flavor perception. Liberation of vol...

  7. Reconstruction of the Chemotaxis Receptor-Kinase Assembly

    International Nuclear Information System (INIS)

    Park, S.; Borbat, P.; Gonzalez-Bonet, G.; Bhatnagar, J.; Pollard, A.; Freed, J.; Bilwes, A.; Crane, B.

    2006-01-01

    In bacterial chemotaxis, an assembly of transmembrane receptors, the CheA histidine kinase and the adaptor protein CheW processes environmental stimuli to regulate motility. The structure of a Thermotoga maritima receptor cytoplasmic domain defines CheA interaction regions and metal ion-coordinating charge centers that undergo chemical modification to tune receptor response. Dimeric CheA-CheW, defined by crystallography and pulsed ESR, positions two CheWs to form a cleft that is lined with residues important for receptor interactions and sized to clamp one receptor dimer. CheW residues involved in kinase activation map to interfaces that orient the CheW clamps. CheA regulatory domains associate in crystals through conserved hydrophobic surfaces. Such CheA self-contacts align the CheW receptor clamps for binding receptor tips. Linking layers of ternary complexes with close-packed receptors generates a lattice with reasonable component ratios, cooperative interactions among receptors and accessible sites for modification enzymes

  8. La mente incarnata e le prospettive morali della Fenomenologia della Percezione

    Directory of Open Access Journals (Sweden)

    Francesco Consiglio

    2015-03-01

    Full Text Available In contrasto con quella che era stata la tradizione dell’empirismo classico di matrice hobbesiana e lockiana da un lato, e la tradizione razionalista a erente al nucleo loso co cartesiano, Merleau-Ponty elabora una “terza via” che si propone di riportare la conoscenza nell’ambito dello stretto rapporto tra il corpo e i fenomeni che esso esperisce in quanto corpo vivente e non mero oggetto tra gli oggetti. Il mio corpo non è, come credeva convintamente Cartesio, mera res extensa, separata dalla mia più pura e vera essenza di res cogitans; anzi è proprio col mio essere corpo vivente che conosco pienamente il mondo. Noi non costruiamo il mondo naturale, ma lo viviamo. È in esso che avviene l’incontro con l’Altro, l’incontro di prospettive che ci mette alla prova nell’agire morale; è in questo incontro che nasce il senso che esso assume per noi. È in questo rapporto d’intersoggettività che si genera il nodo di signi cati che costituisce il mondo culturale e più ancora quello morale. In questo contesto l’ottica del corpo vissuto costituisce un presupposto radicale che modi ca n dal principio il rapporto tra soggetto e mondo, tra soggetto singolo e altri individui.

  9. Divergent effects of postmortem ambient temperature on organophosphorus- and carbamate-inhibited brain cholinesterase activity in birds

    Science.gov (United States)

    Hill, E.F.

    1989-01-01

    Time- and temperature-dependent postmortem changes in inhibited brain cholinesterase (ChE) activity may confound diagnosis of field poisoning of wildlife by anticholinesterase pesticide. Carbamate-inhibited ChE activity may return to normal within 1 to 2 days of exposure of intact carcass to moderate ambient temperature (18-32C). Organophosphorus-inhibited ChE activity becomes more depressed over the same time. Uninhibited ChE activity was resilient to above freezing temperature to 32C for 1 day and 25C for 3 days. Carbamate- and organophosphorus-inhibited ChE can be separated by incubation of homogenate for 1 hour at physiological temperatures; carbamylated ChE can be readily reactivated while phosphorylated ChE cannot.

  10. La strana storia della luce e del colore

    CERN Document Server

    Guzzi, Rodolfo

    2011-01-01

    Sino al 1600 la luce era oggetto di studio degli scienziati ed il colore dei filosofi. Questa dicotomia fu superata dall’Esperimentum Crucis di Newton che spiego’ come la luce contenesse il colore. Il libro analizza le teorie che furono sviluppate dai greci, per evolversi successivamente nelle teorie degli scienziati arabi e approdare al medio evo. Con l’Esperimentum Crucis Newton dimostro’ che la luce conteneva i colori primari. Tra gli esperimenti che egli fece ci furono anche quelli sulla percezione che risultarono sbagliati; solo Goethe capi’ quale era la vera portata di quegli esperimenti e li rifece dando una interpretazione che, oggi, sappiamo essere vera, ma che a quel tempo fu alquanto osteggiata. Nel frattempo la comunita’ scientifica progrediva sul concetto di visione e di sensazione, poiche’ gli strumenti di indagine si raffinavano. Bisogna pero’ arrivare ai giorni nostri per avere una spiegazione sul comportamento della luce e del colore e come questa viene percepita da noi. Solo ...

  11. Il mondo dentro il mondo

    CERN Document Server

    Barrow, John D

    1991-01-01

    Davvero esistono “lì fuori” leggi di natura, che stanno in attesa di essere scoperte, indipendenti dal nostro modo di pensare, o esse rappresentano soltanto la descrizione più conveniente di ciò che abbiamo visto? Come è nata l’idea stessa di “leggi di natura”? Queste costituiscono la realtà profonda o sono soltanto pezzi di un regolamento che ci siamo dati per organizzare meglio la nostra conoscenza del mondo? o semplici paletti che piantiamo e ci lasciamo alle spalle come segnali via via che procediamo nella giungla dell’esperienza? È possibile che non esistano affatto leggi di natura? Forse esse, e anche l’universo che da esse sembra regolato, sono del tutto creazioni della nostra mente: un’illusione che scompare appena cessiamo di pensarvi. Ma allora, che cosa accadrebbe, se non ci fossero osservatori dell’universo?». Interrogativi di questo genere, che incontriamo sulla soglia del Mondo dentro il mondo, sarebbero suonati eccentrici fino a qualche anno fa. Oggi, al contrario, circ...

  12. Disturbi dello spettro autistico tra filosofia della medicina e delle neuroscienze

    Directory of Open Access Journals (Sweden)

    Carlo Maria Cirino

    2012-05-01

    Full Text Available L’autismo è un disturbo pervasivo dello sviluppo neuropsicologico che interessa all’incirca un bambino su mille. Purtroppo, si tratta di un dato destinato ad aumentare, anche per via dell’interesse mediatico e scientifico che questa patologia è stata capace di richiamare intorno a sé. Da un lato, infatti, sono aumentate le richieste di screening presso i numerosi centri che monitorano questa complessa patologia neurologica e dall’altro sono migliorate le tecniche di diagnosi che sempre più spesso si avvalgono di esami genetici all’avanguardia in aggiunta alle ormai classiche interviste psicologiche. L’autismo pone, dunque, serie questioni all’attenzione della ricerca scientifica sia nel vasto campo delle neuroscienze che in quello della neuropsichiatria e della psicologia clinica. Ebbene: quel settore della filosofia che guarda alla scienza con interesse particolare, non può che seguire con partecipazione i progressi nella spiegazione di questa misteriosa patologia che, attualmente, resta un vero e proprio rompicapo per tutti coloro che hanno a che fare con la complessità dell’organizzazione cerebrale dell’essere umano.

  13. Induction of reactive oxygen species-stimulated distinctive autophagy by chelerythrine in non-small cell lung cancer cells.

    Science.gov (United States)

    Tang, Zheng-Hai; Cao, Wen-Xiang; Wang, Zhao-Yu; Lu, Jia-Hong; Liu, Bo; Chen, Xiuping; Lu, Jin-Jian

    2017-08-01

    Chelerythrine (CHE), a natural benzo[c]phenanthridine alkaloid, shows anti-cancer effect through a number of mechanisms. Herein, the effect and mechanism of the CHE-induced autophagy, a type II programmed cell death, in non-small cell lung cancer (NSCLC) cells were studied for the first time. CHE induced cell viability decrease, colony formation inhibition, and apoptosis in a concentration-dependent manner in NSCLC A549 and NCI-H1299 cells. In addition, CHE triggered the expression of phosphatidylethanolamine-modified microtubule-associated protein light-chain 3 (LC3-II). The CHE-induced expression of LC3-II was further increased in the combination treatment with chloroquine (CQ), an autophagy inhibitor, and large amounts of red-puncta were observed in the CHE-treated A549 cells with stable expression of mRFP-EGFP-LC3, indicating that CHE induces autophagy flux. Silence of beclin 1 reversed the CHE-induced expression of LC3-II. Inhibition of autophagy remarkably reversed the CHE-induced cell viability decrease and apoptosis in NCI-H1299 cells but not in A549 cells. Furthermore, CHE triggered reactive oxygen species (ROS) generation in both cell lines. A decreased level of ROS through pretreatment with N-acetyl-L-cysteine reversed the CHE-induced cell viability decrease, apoptosis, and autophagy. Taken together, CHE induced distinctive autophagy in A549 (accompanied autophagy) and NCI-H1299 (pro-death autophagy) cells and a decreased level of ROS reversed the effect of CHE in NSCLC cells in terms of cell viability, apoptosis, and autophagy. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  14. Sicherung mathematischer Grundkompetenzen am Beispiel des österreichischen Zentralabiturs

    Science.gov (United States)

    Peschek, Werner

    Der österreichische Nationalrat (Parlament) hat im Sommer 2009 eine Neugestaltung der Reifeprüfung (Abitur) beschlossen; die wesentlichste Änderung besteht darin, dass die Aufgabenstellungen der für alle Schülerinnen und Schüler verbindlichen schriftlichen Reifeprüfung (sRP) in den Fächern Deutsch, Mathematik und einer lebenden Fremdsprache zentral und nicht wie bisher durch die jeweilige Klassenlehrerin bzw. den Klassenlehrer erfolgen. Für die Allgemeinbildenden Höheren Schulen ("Gymnasien") soll diese neue Regelung ab dem Schuljahr 2013/14 gelten, für die Berufsbildenden Höheren Schulen (u. a. höhere technische oder kaufmännische Schulen mit Abitur) ab dem Schuljahr 2014/15.

  15. Tabellenanhang

    Science.gov (United States)

    Krieger, Hanno

    Wichtiger Hinweis: Die Korrektur- und Umrechnungsfaktoren für die verschiedenen Dosimetrieaufgaben in diesem Tabellenanhang sind vom Autor mit Sorgfalt recherchiert und zusammengestellt. Der Anwender wird darauf hingewiesen, dass er für die Beschaffung und Überprüfung der Richtigkeit der Dosimetriefaktoren selbst die Verantwortung trägt, zumal je nach Normung und internationaler Festlegung von Zeit zu Zeit mit Änderungen zu rechnen ist.

  16. Antecedents dari Brand Equity pada Hotel Santika di Bsd Tangerang

    OpenAIRE

    Susiati, Asriani

    2013-01-01

    This study refers to previous studies, by kevin kam Fung So and Ceridwyn King (2009). The background of this research was to prove the management approaches that brand equity as the key assets for hotel industries and provide brand manger hotel to evaluate brand equity as an outcome brand strategies. The objectives of this research was : (a) the positive effect of company's presented brand to brand awareness, (b) the positive effect of company's presented brand to brand meaning, (c) the posit...

  17. Untersuchungen zum Riechvermögen bei Patienten mit schizophrenen Störungen

    OpenAIRE

    Minovi, A; Dombrowski, T; Brüne, M; Dazert, S; Juckel, G

    2014-01-01

    Einleitung: Riechstörungen werden bei Patienten mit einer Schizophrenie in vielen Studien beschrieben. Im Rahmen einer prospektiv angelegten Studie untersuchten wir das Riechvermögen von 18 Patienten mit einer Schizophrenie im Vergleich zu einer Kontrollgruppe (n=13). Weiterhin erfolgte eine immunhistochemische Untersuchung der Riechschleimhaut bei 8 Patienten mit einer Schizophrenie.Methoden: Die Riechprüfung erfolgte mit Hilfe der erweiterten Sniffin' Sticks-Testbatterie. Nach Biopsie der...

  18. Zur Standardisierung der DSH-Prüfungen: Bestandsaufnahme und Perspektiven des Online-Angebotes

    OpenAIRE

    Schneider, Agnieszka

    2010-01-01

    Das Internet ist im 21. Jahrhundert zum wichtigsten Informations- und Kommunikationsmedium geworden und hat auch in der Hochschullandschaft einen festen Platz eingenommen. Das Lernen mit und auf Internetplattformen hat sich im universitären Bereich stark etabliert. Auch die Bedeutung von Online-Prüfungen ist infolge der unter dem Schlagwort "Bologna-Prozess" bekannten Umstrukturierungen stark angestiegen. Da im Bereich der deutschen Sprachprüfung für den Hochschulzugang (DSH) bisher nur wenig...

  19. A PERFORMANCE COMPARISON OF HEDGE FUNDS, HEDGED MUTUAL FUNDS AND HEDGE FUND ETFS

    OpenAIRE

    Shenyan Gu; Tina Zhang

    2015-01-01

    Hedged mutual funds and hedge fund ETFs are new entrants to the market thatallow individual investors to invest in funds using hedge fund strategies.   In this paper, we study the performance of these two funds relative to the traditional hedge funds to see if the three asset classes are comparable investments. We use four performance measurement models, including CAPM, Fama French three factor model, Carhart four factor model and Fung and Hsieh eight factor model, to test the fund...

  20. Ergebnissse nach arthroskopisch assistiert durchgeführter vorderer Kreuzbandplastik mit Semitendinosussehne als Triple-Implantat in Single-Incision-Technik und femoraler Endobutton-Fixation : Nachuntersuchungen über einen Zeitraum von 1 Jahr

    OpenAIRE

    Seel, Matthias

    2004-01-01

    Das Ziel dieser Arbeit ist die Überprüfung des Stabilitätsgewinnes infolge einer operativen Therapie des rupturierten vorderen Kreuzbandes mit einer ipsilateralen autogenen, femoral mit einem Endobutton fixierten, Semitendinosussehne als Dreifachschlinge bei 103 Patienten, die in der Zeit vom Juli 1993 bis zum Januar 1995 an der Orthopädischen Klinik der Justus-Liebig-Universität in Gießen operiert wurden. Des weiteren sollten im Rahmen dieser Arbeit geschlechtsspezifische Unterschiede, Unter...

  1. The challenge of reforming the WTO dispute settlement understanding

    OpenAIRE

    Hauser, Heinz; Zimmermann, Thomas A.

    2003-01-01

    Die im Mai 2003 abgelaufene Frist für den Abschluss der Verhandlungen über Verbesserungen und Klarstellungen zum WTO-Übereinkommen über dei Streitschlichtung (Dispute Settlement Understanding; DSU) unter dem Doha-Mandat wurde verfehlt. Die WTO-Mitglieder einigten sich jedoch im Juli 2003 auf eine Verlängerung des Verhandlungsmandates bis Ende Mai 2004. Der vorliegende Beitrag fasst die Verhandlungen zur Überprüfung des Streitschlichtungsverfahrens ("DSU review") kurz zusammen. Die Hauptstreit...

  2. Further Evidence on Hedge Funds Performance

    DEFF Research Database (Denmark)

    Christiansen, Claus Bang; Madsen, Peter Brink; Christensen, Michael

    2003-01-01

    In this analysis we identify dynamic hedge fund strategies quantitatively pursuing a Principal Component Analysis following Fung and Hsieh (1997). We extract five dominant hedge fund strategies each representing similar investment styles and analyse the performance of each strategy by employing...... a multi-factor model comprising both market indices and passive option strategies among the lines of Agerwal and Naik (2000). We find that the majority of five homogenous strategies show superior performance. However, correcting for survivorship bias this superior performance disappears....

  3. Effects of Radiation on the Microbiota and Intestinal Inflammatory Disease

    Science.gov (United States)

    2017-09-01

    for immune cells associated with the intestine and their interactions with the normal microbial contents of the gut . 2. KEYWORDS Radiation, microbiome ...focal RT on bact/fung microbiota (COMPLETED) ☑Analysis: microbiome changes in irradiated guts + DSS (COMPLETED) CY17 Goal – RT-induced changes in gut ...sensitivity qAnalysis of microbiome changes in irradiated guts in other colitis models and infectious organisms (In Progress) qAnalysis of effects of

  4. Funzioni identitarie dell'alternanza linguistica in apprendenti di italiano durante lo svolgimento di attività in gruppo

    Directory of Open Access Journals (Sweden)

    Roberta Ferroni

    2013-12-01

    Full Text Available Questo articolo indaga, servendosi degli strumenti teorici messi a disposizione dall’analisi della conversazione, coadiuvata da una serie di nozioni e riferimenti tratti dagli studi che esaminano la struttura dell’interazione nella classe di lingua, i diversi usi che gli apprendenti di italiano LS fanno delle lingue presenti nella classe, specialmente della loro LM, durante lo svolgimento di attività di gruppo per dare voce alle multiple identità che costituiscono ciascun individuo. Dallo studio emerge che l’identità degli apprendenti è in continua trasformazione. Infatti, per potersi affermare, gli apprendenti dovranno “interpretare” un insieme di ruoli che cambiano e che dovranno negoziare in base al contesto d’interazione

  5. Featured Image: Simulating Planetary Gaps

    Science.gov (United States)

    Kohler, Susanna

    2017-03-01

    The authors model of howthe above disk would look as we observe it in a scattered-light image. The morphology of the gap can be used to estimate the mass of the planet that caused it. [Dong Fung 2017]The above image from a computer simulation reveals the dust structure of a protoplanetary disk (with the star obscured in the center) as a newly formed planet orbits within it. A recent study by Ruobing Dong (Steward Observatory, University of Arizona) and Jeffrey Fung (University of California, Berkeley) examines how we can determine mass of such a planet based on our observations of the gap that the planet opens in the disk as it orbits. The authors models help us to better understand how our observations of gaps might change if the disk is inclined relative to our line of sight, and how we can still constrain the mass of the gap-opening planet and the viscosity of the disk from the scattered-light images we have recently begun to obtain of distant protoplanetary disks. For more information, check out the paper below!CitationRuobing Dong () and Jeffrey Fung () 2017 ApJ 835 146. doi:10.3847/1538-4357/835/2/146

  6. Unità di conto di bilancio.

    Directory of Open Access Journals (Sweden)

    R. VALCAMONICI

    2014-09-01

    Full Text Available La principale conclusione che si ricava dall’articolo mostra che l’aggravio che deriverebbe ai paesi a moneta debole dalla introduzione dell’UCE e, alternativamente, il vantaggio in favore dei paesi a moneta forte, sono destinati a livellarsi a partire dal 1978 in conseguenza dell’applicazione integrale del sistema delle risorse proprie e della maggiore partecipazione dei nuovi Stati menbri.

  7. Role of motility and chemotaxis in the pathogenesis of Dickeya dadantii 3937 (ex Erwinia chrysanthemi 3937).

    Science.gov (United States)

    Antúnez-Lamas, María; Cabrera-Ordóñez, Ezequiel; López-Solanilla, Emilia; Raposo, Rosa; Trelles-Salazar, Oswaldo; Rodríguez-Moreno, Andrés; Rodríguez-Palenzuela, Pablo

    2009-02-01

    Dickeya dadantii 3937 (ex Erwinia chrysanthemi), a member of the Enterobacteriaceae, causes soft rot in many economically important crops. A successful pathogen has to reach the interior of the plant in order to cause disease. To study the role of motility and chemotaxis in the pathogenicity of D. dadantii 3937, genes involved in the chemotactic signal transduction system (cheW, cheB, cheY and cheZ) and in the structure of the flagellar motor (motA) were mutagenized. All the mutant strains grew like the wild-type in culture media, and the production and secretion of pectolytic enzymes was not affected. As expected, the swimming ability of the mutant strains was reduced with respect to the wild-type: motA (94%), cheY (80%), cheW (74%), cheB (54%) and cheZ (48%). The virulence of the mutant strains was analysed in chicory, Saintpaulia and potato. The mutant strains were also tested for their capability to enter into Arabidopsis leaves. All the mutants showed a significant decrease of virulence in certain hosts; however, the degree of virulence reduction varied depending on the virulence assay. The ability to penetrate Arabidopsis leaves was impaired in all the mutants, whereas the capacity to colonize potato tubers after artificial inoculation was affected in only two mutant strains. In general, the virulence of the mutants could be ranked as motA<cheYZ, which correlated with the degree to which swimming was affected. These results clearly indicate that motility plays an important role in the pathogenicity of this bacterium.

  8. DALL’«ARTICOLO EPR» AGLI ESPERIMENTI DI ALAIN ASPECT: IL LUNGO CAMMINO DEL PROBLEMA DELLA NONLOCALITÀ IN MECCANICA QUANTISTICA

    OpenAIRE

    Matarese, Vera

    2014-01-01

    Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molt...

  9. La certezza della pena tra lavoro nero e problematiche di integrazione / La certitude de la sanction entre travail au noir et problèmes d'intégration / Sanction Certainty between Illegal Work and Immigration Problems

    Directory of Open Access Journals (Sweden)

    Bisi Roberta

    2010-07-01

    Full Text Available L’immissione di nuove popolazioni in una società provoca inevitabilmente sfide a carattere sociale. Affrontare i problemi che la popolazione immigrata pone significa, tra l’altro, considerare che si tratta di un attore sociale che, con i propri comportamenti, le proprie scelte, i propri orientamenti mette in continua discussione i meccanismi logici e le politiche presenti nelle società.

  10. Emozione, discorso e politiche della vita quotidiana

    Directory of Open Access Journals (Sweden)

    Lila Abu-Lughod

    2013-07-01

    Full Text Available Le emozioni sono una di quelle nozioni considerate scontate sia dalla conoscenza specialistica che dal discorso quotidiano, che stanno ora diventando parte del dominio della ricerca antropologica. Nonostante che siano ancora principalmente appannaggio della filosofia e della psicologia all’interno delle discipline accademiche, le emozioni sono anche questioni ordinarie del discorso culturale popolare americano,la cui relazione con questi discorsi professionali è complessa e solo parzialmente indagata.

  11. T. A. Sebeok e i congegni di modellazione del mondo: strumenti teorici al servizio delle pratiche professionali

    Directory of Open Access Journals (Sweden)

    Giorgio Maggi

    2005-06-01

    Full Text Available L'elaborato si compone di una parte che comprende l'illustrazione delle linee generali del pensiero teorico di T. A. Sebeok e nello specif ico della sua teoria dei "sistemi di modellazione", e l'altra che include le riflessioni circa la possibilità di adoperare l'approccio biosemiotico alla realtà sociale e costruire, in tale direzione, un professionalismo ideal-tipico che sia capace di rispondere alle esigenze pratiche della vita quotidiana.

  12. Immigrants and the US Army: A Study in Readiness and the American Dream

    Science.gov (United States)

    2016-05-26

    Immigrants and the US Army: A Study in Readiness and the American Dream A Monograph by LTC Che T. Arosemena...Approval Page Name of Candidate: LTC Che T. Arosemena Monograph Title: Immigrants and the US Army: A Study in Readiness and the American Dream Approved by...Abstract Immigrants and the US Army: A Study in Readiness and the American Dream , by LTC Che T. Arosemena, USA, 71

  13. La figura di Maria Maddalena nella tradizione agostiniana del XII secolo e l'allegoria nuziale in Bernardo di ClairvauxUn'ipotesi di interpretazione alla luce di categorie di ordine psicoanalitico

    Directory of Open Access Journals (Sweden)

    Elena Cartotto

    2008-07-01

    La lettura viene condotta sulla base di categorie concettuali di carattere psicoanalitico, in quanto tali categorie trovano la propria origine, prima ancora che nel pensiero, nella più concreta e profonda esperienza umana. Ed è proprio il collocarsi all'interno di questa viva esperienza umana che consente di cogliere in modo più diretto la dimensione antropologica che pare emergere dagli scrittori monastici di questo periodo.

  14. Mondi possibili

    CERN Document Server

    Dyson, Freeman

    1998-01-01

    Scienza, fantascienza, storia. Freeman Dyson percorre con sicurezza, acume e spirito critico i sentieri che conducono al futuro del nostro mondo ; ci fa scorgere i pericoli e le insidie del progresso scientifico e tecnologico, ci narra le vicende che hanno caratterizzato la scienza e la cultura del nostro secolo e si misura con le grandi questioni che gli scienziati e l'umanita dovranno affrontare agli inizi di un nuovo millenio.

  15. Questo bizzarro universo

    CERN Document Server

    Sciama, Dennis William

    1998-01-01

    La moderna astronomia ha posto una serie di problemi bizzarri, per la varietà e per la stravaganza dei fenomeni e dei problemi studiati. Per esempio : esiste un solo universo o infiniti universi ? "Naturalmente non avrei mai posto una tale domanda - dice l'Autore - se non pensassi che ci sono valide ragioni per credere che esistano molti universi" ; e il Lettore si accorgerà che le argomentazioni di Sciama sono fondamentali, per ragioni scientifiche e anche filosofiche.

  16. Il fuoco della fusione termonucleare controllata

    CERN Document Server

    Caldirola, Piero; Sindoni, Elio

    1984-01-01

    Per realizzare la fusione termonucleare controllata, cioè catturare e dominare il fuoco che accende gli astri, e ottenere così una nuova fonte di energia praticamente illimitata e a basso costo, si richiede uno sforzo collettivo e unitario globale: non esiste infatti nazione al mondo che sia in grado, singolarmente presa, di affrontare il problema, sia per le risorse finanziarie necessarie all'impresa sia per il numero dei ricercatori che dovranno dedicarvisi.

  17. La mente nuova dell'imperatore

    CERN Document Server

    Penrose, Roger

    1992-01-01

    Mente umana e intelligenza artificiale: si tratta di due realtà comparabili? A quali leggi della fisica (classica o quantistica) obbedisce la nostra mente? Un giorno i computer potranno ragionare esattamente come noi? In questo libro di divulgazione scientifica, che al suo apparire ha provocato vivaci polemiche, l'autore afferma che la "mente nuova", che l'intelligenza artificiale sostiene di poterci dare, è qualcosa di profondamente diverso dalla mente dell'uomo.

  18. Pencil and mouse. Drawing in the digital era

    Directory of Open Access Journals (Sweden)

    Giovanni Federle

    2010-12-01

    Full Text Available In questo contributo si considera il ruolo che ha oggi, nella scuola secondaria dopo la riforma, l’insegnamento del disegno a mano libera e con strumenti e i problemi che si pongono nel passaggio dal disegno analogico al disegno digitale. Dalla sintesi delle ricerche sviluppate nell’ultimo decennio si possono cogliere alcune indicazioni per la didattica del disegno. Rimane aperta la questione di un insegnamento laboratoriale che non sia istruzionale.

  19. L'Epitafio inedito di Nicasia scolastica rinvenuto a Rihana

    OpenAIRE

    Ibba, Antonio

    1997-01-01

    L'epitafio inedito di Nicasia scolastica è verosimilmente una nuova testimonianza epigrafica perlomeno del basso impero, con grande probabilità di ambito cristiano, un dato che concorda con la circostanza che ad Uchi Maius abbiamo testimonianza sia di iscrizioni che di una basilica paleocristiana; viene qui ricordata uan donna morta ad appena venti anni, Nicasia, secondo l'uso allora corrnte del nome unico al posto dei tria nomina.

  20. The Study of Productivity Measurement and Incentive Methodology (Phase III - Paper Test). Volume 1

    Science.gov (United States)

    1986-03-14

    8). Readily available measuremencs are used Co monicor Che performance of modernizacion projects (Table 3). Shared savings for any given year are...UUP is Co be pursued. That buying office becomes Che IMIP focal point for Che contractor Co accommodate modernizacion projeces chac cue across...coordinacing group - ehe Induscrial ModernizaCion Group, is responsible for assuring uniformicy of sysCem applicacion and on-going system

  1. Sadomasochism in the filmic element: Eros melancholy and versification

    Directory of Open Access Journals (Sweden)

    Chiara Bille

    2011-06-01

    Full Text Available Le perversioni che albergano nell’animo umano sono insidiate lì comodamente nel profondo e inconsciamente si manifestano con una veste di crudeltà seducente nel reale, seguendo la trama di un sottile e raffinato ricamo che mai nessuno osa ri- conoscere, bensì solo confondere in un lussurioso giuoco di dominio morboso che con l’ausilio di un agire anancastico è proteso verso la ricerca del paradiso perduto.

  2. Le forze della natura il nuovo orizzonte della fisica

    CERN Document Server

    Davies, Paul C W

    1990-01-01

    Vero "cavallo di razza" della divulgazione scientifica, Paul Davies è uno dei rari fisici che sanno farsi seguire dal lettore comune anche quando affrontano argomenti difficili. Ne è una prova il presente volume, una delle migliori illustrazioni disponibili del microcosmo atomico e dell'incredibile fauna che lo abita : non solo la familiare triade protone-elettrone-neutrone, ma le ben più intriganti realtà che vanno sotto il nome di "colore", "incanto", stranezza".

  3. O stilu i kulturnom značenju Marulićeve Poslanice papi Adrijanu VI.

    OpenAIRE

    Cattaneo, Ruggero

    2008-01-01

    Nella comunicazione quotidiana assistiamo oggi a un singolare rinnovamento del genere epistolografico, tutte le volte che scriviamo (digitiamo) e scambiamo messaggi di posta elettronica (e-mail) privati o ufficiali, o anche, a un più basso ma non meno vitale livello stilistico, messaggi SMS, che somigliano talora a mini-lettere, o più spesso a epigrammi. Sono le nuove, ma ormai onnipresenti forme della comunicazione elettronica, che danno spazio anche a una parola più intima e confidenziale, ...

  4. Legami 2.0. Il genere alla prova della contemporaneità

    Directory of Open Access Journals (Sweden)

    Redazione Camera blu

    2016-12-01

    Full Text Available Numero a cura di Anna Gargiulo. Il numero guarda alle trasformazioni che attengono al genere femminile che vanno oggi configurandosi nel virtuale, nei media, nelle sfide della società contemporanea rivolte ai corpi, alle famiglie, ai sistemi accademici. Si parte dai legami, dai link, che tanto possono connettere paesi e generazioni quanto legare oppressivamente l’altro a sé.

  5. Un anello per domarli tutti

    CERN Document Server

    Merlini, Antonio

    2014-01-01

    Questa tesina tratta degli acceleratori di particelle. I motivi della loro nascita, la loro evoluzione, il loro presente e il loro futuro. Particolare attenzione sarà data al Large Hadron Collider, il più grande di essi e la più incredibile macchina mai realizzata dall’uomo. Inoltre si parlerà dei rilevatori, che permettono lo studio di particelle invisibili all’uomo; del fatto che gli scienziati non escludono che gli strumenti che utilizzano possano potenzialmente distruggere il pianeta; e di come gli acceleratori hanno cambiato la nostra vita.

  6. Income related inequality and influencing factors: a study for the incidence of catastrophic health expenditure in rural China.

    Science.gov (United States)

    Gu, Hai; Kou, Yun; Yan, Zhiwen; Ding, Yilei; Shieh, Jusheng; Sun, Jun; Cui, Nan; Wang, Qianjing; You, Hua

    2017-09-20

    Catastrophic health expenditure (CHE) puts a heavy disease burden on patients' families, aggravating income-related inequality. In an attempt to reduce the financial risks of rural families incurring CHE, China began the New Rural Cooperative Medical System (NCMS) on a trial basis in 2003 and has raised the reimbursement rates continuously since then. Based on statistical data about rural families in sample area of Jiangsu province, this study measures the incidence of CHE, analyzes socioeconomic inequality related to CHE, and explores the influences of the NCMS on the incidence of CHE. Statistical data were acquired from two surveys about rural health care, one conducted in 2009 and one conducted in 2010. In 2009, 1424 rural families were analyzed; in 2010, 1796 rural families were analyzed. An index of CHE is created to enable the evaluation of the associated financial risks. The concentration index and concentration curve are used to measure the income-related inequality involved in CHE. Multiple logistic regression is utilized to explore the factors that influence the incidence of CHE. The incidence of CHE decreased from 13.62% in 2009 to 7.74% in 2010. The concentration index of CHE was changed from -0.298 (2009) to -0.323 (2010). Compared with rural families in which all members were covered by the NCMS, rural families in which some members were not covered by the NCMS had a lower incidence of CHE: The odds ratio is 0.65 with a 95% confidence interval of 0.43 to 1.00. For rural families in which all members were covered by the NCMS, the increase in reimbursement rates is correlated to the decline in the incidence of CHE if other influencing factors were controlled: The odds ratio is 0.48 with a 95% confidence interval of 0.36 to 0.64. Between 2009 and 2010, the incidence rate of CHE in the sampled area decreased sharply, CHE was more concentrated among least wealthy and inequality increased during study period. As of 2010, the poorest rural families still had

  7. Genealogy of the body and genealogical body

    Directory of Open Access Journals (Sweden)

    Paola Cecchetti

    2011-06-01

    Full Text Available A partire da un quadro di Frida Kahlo intitolato I miei nonni, i miei genitori e io le due autrici indagano quel testo-immagine che sta all'origine dello stile di lettura del soggetto. Posto dinanzi alla stessa immagine, ciascuno ne fa una rappresentazione estremamente personale, un quadro delle proprie vicissitudini interne e dei legami transgenerazionali che lo hanno segnato. I momenti nei quali si articola la ricerca sono tre: la scrittura dell’occhio, il ricalco e il percorso della mano, il negativo e l’assenza.A essi segue poi lo psicodramma. Tale successione temporale abitua a vedere nell'immagine disegnata l'immagine negata, assente. L'esperienza sembra aver creato un nuovo metodo di indagine della psiche rispetto al transgenerazionale, metodo che intreccia il genogramma (di origini sistemico-relazionale e lo psicodramma analitico, e che viene chiamato “genodramma psicoanalitico”. Partendo da un dato clinico – l'esilità del legame che le nuove generazioni intrattengono con quelle che le precedono, sembra vogliano rinegoziare il contratto narcisistico che assegna al passato il posto dell'assenza. Il contributo si chiude con un interrogativo: “Alla ricerca di che cosa? Della presenza o, meglio, delle tracce lasciate nel soggetto dall'Altro che precede l'insediamento dell'Io”.

  8. 10 volti per la Liberazione. Una mostra per le strade della città

    Directory of Open Access Journals (Sweden)

    Margherita Becchetti

    2013-09-01

    Full Text Available Nel saggio si dà conto delle vicende che hanno segnato “10 volti per la Liberazione”, mostra diffusa nelle strade di Parma, allestita in occasione del 25 aprile 2013 dal Centro studi movimenti con sagome a grandezza naturale di alcuni protagonisti della lotta partigiana. L’autrice affronta i problemi incontrati nel corso dell’allestimento e le reazioni che l’iniziativa ha suscitato, elementi che investono direttamente la riflessione storiografica avendo a che vedere con l’uso pubblico della storia, con il rapporto tra memoria pubblica e privata e con il ruolo rivestito dagli storici nella costruzione della memoria collettiva.

  9. Il corpo, lo sport, le immagini

    Directory of Open Access Journals (Sweden)

    Nicola Porro

    2009-07-01

    Full Text Available E’ stato per primo Norbert Elias, nella sua critica al riduzionismo sociologico, a lamentare la difficoltà delle scienze sociali a misurarsi con le problematiche dello sport, così come delle emozioni, della sessualità, del gioco e della guerra. Attività umane che convergono in quell’autentico luogo sociale che è il corpo. Nel caso che ci interessa, si tratta di connettere il corpo, nella sua dimensione biologica, psichica e sociale, con quell’aspetto cruciale della civilizzazione che Elias definisce sportivizzazione.

  10. Il corpo narratore

    Directory of Open Access Journals (Sweden)

    Ivano Gamelli

    2005-09-01

    Full Text Available Sapere cosa provo attraverso il mio corpo di fronte all’altro mi permette non solo di capire cosa l'altro prova, soprattutto di generare naturalmente un’effettiva sintonizzazione, di evidenziare e nominare emozioni e sentimenti che in-formano la relazione con quel particolare bambino, adolescente o adulto che sia. Il rapporto con il linguaggio del corpo, prima ancora di divenire pratica psicopedagogica, è una 'pedagogia dell'esistenza'. Una pratica della nostra quotidianità che possiamo affinare oltre e prima che essa diventi pratica psicopedagogica.

  11. Emozione e somatizzazione

    Directory of Open Access Journals (Sweden)

    Sabine Parmentelot

    2004-09-01

    Full Text Available Consacreremo la prima parte di quest'articolo alle manifestazioni corporee dell'emozione. La psicologia sperimentale, insieme alla neuro-biologia, hanno evidenziato le differenti risposte corporee più o meno percettibili. Ma al di là di queste manifestazioni puramente oggettive le cui percentuali e oscillazioni possono essere valutate, misurate ... E' l'aspetto soggettivo e le loro ripercussioni che c'interessa. Quali significati possono avere le emozioni per la persona che le prova? Questi temi saranno l'oggetto della seconda parte. Ci situiamo in quanto ricercatori che interrogano altri soggetti, ma è evidente che non possiamo fare astrazione delle nostre passioni.

  12. Il razzismo: il riconoscimento negato (Renate Siebert

    Directory of Open Access Journals (Sweden)

    Francesco Bachis

    2004-12-01

    Full Text Available Consacreremo la prima parte di quest'articolo alle manifestazioni corporee dell'emozione. La psicologia sperimentale, insieme alla neuro-biologia, hanno evidenziato le differenti risposte corporee più o meno percettibili. Ma al di là di queste manifestazioni puramente oggettive le cui percentuali e oscillazioni possono essere valutate, misurate ... E' l'aspetto soggettivo e le loro ripercussioni che c'interessa. Quali significati possono avere le emozioni per la persona che le prova? Questi temi saranno l'oggetto della seconda parte. Ci situiamo in quanto ricercatori che interrogano altri soggetti, ma è evidente che non possiamo fare astrazione delle nostre passioni.

  13. L'evoluzione del WEB GIS la filiera postgis-mapserver-geoext- openlayers per sviluppare piattaforme GIS complete, agili ed economiche

    Directory of Open Access Journals (Sweden)

    Francesco Mariucci

    2012-04-01

    Full Text Available Spesso, nel nostro ambito, ci si sente dire che il GIS è un bene di lusso, dal quale, soprattutto in epoca di crisi economica, le piccole entità (sia in ambito pubblico che privato possono facilmente prescindere. Questo articolo vuole segnalare la presenzadi tecnologie non nuove ma consolidate che unite insieme possono costituire una base informatica flessibile e di costi ridotti per l'implementazione di piattaforme GIS dedicate che siano di supporto anche per le piccole realtà nella gestione di dati ed attività territoriali, con notevoli vantaggi sulla produttività e sull'immagine

  14. Il cielo sopra Roma I luoghi dell’astronomia

    CERN Document Server

    Buonanno, Roberto

    2008-01-01

    L’astronomia a Roma c’è sempre stata, ma un po’ nascosta: era nei palazzi, nelle chiese o, meglio, sopra le chiese, specole disseminate lungo un percorso che oramai conoscono in pochi. I romani hanno assistito, incuriositi ed impauriti, al rogo di Giordano Bruno in un angolo di Campo de' Fiori a loro familiare, ma probabilmente non capirono bene di quale colpa fosse accusato. Non pensarono certo che si trattasse di un filosofo e di uno scienziato che aveva cercato di immaginare in che modo era fatto il mondo. Chi era questo Galileo, di cui si celebrava il processo a S. Maria sopra Minerva? Era un uomo che voleva cambiare la prospettiva del mondo e che, per questo, era stato ammonito da Roberto Bellarmino. E chi era questo gesuita, Secchi, che nel 1870 costringeva gli Italiani a privare Roma del suo Osservatorio Astronomico, visto che il Direttore non riconosceva lo Stato Italiano? Come è possibile che dopo la visita di Hitler a Mussolini alla vigilia della Guerra, la Germania decise di regalare all’...

  15. Cornice epistemologica e metodologica del modello sistemico pluralista

    Directory of Open Access Journals (Sweden)

    Cecilia Edelstein

    2013-12-01

    Full Text Available L’articolo illustra il modello di lavoro che si è sviluppato negli ultimi trent’anni, attraverso l’intreccio tra ricerca, formazione, clinica e lavori di comunità, e che ha dato spazio all’approccio sistemico pluralista in ambito interculturale. Quest’ultimo ha sviluppato una cornice che comprende lo sviluppo di nuovi concetti, metodologie di lavoro e tecniche specifiche che attingono a teorie diverse. L’articolo, quindi, offre un quadro epistemologico, ma anche metodologico e concettuale.

  16. Discourse Intonation - Making It Work

    Directory of Open Access Journals (Sweden)

    Tatjana Paunović

    2008-06-01

    Full Text Available Discourse Intonation (DI (Brazil 1997; Chun 2002 seems to be particularly well suited for use in the EFL classroom, much more so than the rather complex traditional models (e.g. O’Connor and Arnold 1973 or some recent phonological theories. Yet if L2 teachers are to be provided with clear guidelines on how to incorporate DI into communicative language teaching, much more empirical research is needed with L2 students of different L1 backgrounds to uncover the specific problems they face. The small-scale study presented here examines how 15 second-year students of the English Department in Niš manage intonation in a reading task. The analysis focuses on the components singled out by Chun (2002 as crucial for language learners: sentence stress (nuclear tone placement, terminal contour (direction of pitch change and key (pitch range at transition points.

  17. Mass Communication, Advertising, and Marketing Research at the Strategic and Operational Levels of War

    Science.gov (United States)

    2013-05-05

    EBSCOhost (accessed November 4, 2012): 157. 43 Ibid., 156. 44 Ibid., 163. 45 Chang, Chun-Tuan. 2011. “Guilt appeals in cause-related marketing ...Mass Communication, Advertising, and Marketing Research at the Strategic and Operational Levels of War by Colonel Ralph...Education of the Middle States Association of Colleges and Schools, 3624 Market Street, Philadelphia, PA 19104, (215) 662-5606. The Commission on

  18. Contextual cueing based on the semantic-category membership of the environment

    OpenAIRE

    GOUJON, A

    2005-01-01

    During the analysis of a visual scene, top-down processing is constantly directing the subject's attention to the zones of interest in the scene. The contextual cueing paradigm developed by Chun and Jiang (1998) shows how contextual regularities can facilitate the search for a particular element via implicit learning mechanisms. In the proposed study, contextual cueing task with lexical displays was used. The semantic-category membership of the contextual words predicted the location of the t...

  19. Two (or three) is one too many : testing the flexibility of contextual cueing with multiple target locations

    OpenAIRE

    Zellin, Martina; Conci, Markus; von Mühlenen, Adrian; Müller, Hermann J.

    2011-01-01

    Visual search for a target object is facilitated when the object is repeatedly presented within an invariant context of surrounding items ("contextual cueing"; Chun & Jiang, Cognitive Psychology, 36, 28-71, 1998). The present study investigated whether such invariant contexts can cue more than one target location. In a series of three experiments, we showed that contextual cueing is significantly reduced when invariant contexts are paired with two rather than one possible target location, whe...

  20. Contextual cueing based on specific and categorical properties of the environment

    OpenAIRE

    Goujon , A.; Didierjean , A.; Marmeche , E.

    2007-01-01

    During the analysis of a visual scene, top-down processing is constantly directing the subject's attention to the zones of interest in the scene. The contextual cueing paradigm developed by Chun and Jiang (1998) shows how contextual regularities can facilitate the search for a particular element via implicit learning mechanisms. The study presented here reports three experiments that used this paradigm. Experiment 1 showed that regularities in the specific elements of the context can act as c...

  1. The Balancer Policy Reviewed from the Perspective of the ROK-U.S. Alliance: Toward a Mature ROK-U.S. Alliance

    Science.gov (United States)

    2006-12-01

    one of Korea’s ancient three kingdoms, existed for 700 years ruled by 26 wise kings ) in the papers of the Northeast Project, a government-funded...Relations,” in Korea-U.S. Relations in Transition, ed. Baek Jong-chun and Lee Sang-hyun (Sungnam: Sejong Institute, 2002). 51 military alliance it was...President, President’s Roh’s Inauguration Announcement, Vol. 1, Secretary Office, 2003. 62 Sejong Laboratory, National strategy for 21st century

  2. Integrated bioinformatic analysis unveils significant genes and pathways in the pathogenesis of supratentorial primitive neuroectodermal tumor

    OpenAIRE

    Wang,Guang-Yu; Li,Ling; Liu,Bo; Han,Xiao; Wang,Chunhua; Wang,Jiwen

    2018-01-01

    Guang-Yu Wang,1,* Ling Li,2,* Bo Liu,1 Xiao Han,1 Chun-Hua Wang,1 Ji-Wen Wang3 1Department of Neurosurgery, 2Department of Pediatrics, Qilu Children’s Hospital of Shandong University, Jinan, Shandong, 3Department of Neurology, Shanghai Children’s Medical Center, Shanghai Jiaotong University School of Medicine, Pudong New District, Shanghai, People’s Republic of China *These authors contributed equally to this work Purpose: This study aimed to explore ...

  3. Targeting Cell Polarity Machinery to Exhaust Breast Cancer Stem Cells

    Science.gov (United States)

    2017-10-01

    AWARD NUMBER: W81XWH-15-1-0644 TITLE: Targeting Cell Polarity Machinery to Exhaust Breast Cancer Stem Cells PRINCIPAL INVESTIGATOR: Chun-Ju...Targeting Cell Polarity Machinery to Exhaust Breast Cancer Stem Cells 5a. CONTRACT NUMBER 5b. GRANT NUMBER W81XWH-15-1-0644 5c. PROGRAM ELEMENT...Unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT Cancer stem cells (CSCs), a cell population with acquired perpetuating self-renewal properties which

  4. Designing Robust and Resilient Tactical MANETs

    Science.gov (United States)

    2014-09-25

    0. doi: B. Tan , J. Ni, R. Srikant. Q-CSMA: Queue-Length-Based CSMA/CA Algorithms for Achieving Maximum Throughput and Low Delay in Wireless Networks...INFOCOM 2012 Mini-Conference. 01-JAN-12, . : , J. Katz , Y. Lindell. Aggregate Message Authentication Codes, RSA 2008 . 01-JAN-08, . : , J. Ni, Bo Tan ...Haas, Yih-Chun Hu, Nicola Laurenti. Low-Cost Mitigation of Privacy Loss due to Radiometric Identification, Eighth ACM International Workshop on

  5. Heavy metal contamination of stream water and sediment in the Taejon area

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kyoung Woong [Paichai University, Taejon (Korea, Republic of); Lee, Hyun Koo [Chungnam National University, Taejon (Korea, Republic of)

    1996-08-31

    Associated with the rapid pace of overpopulation and industrialization is the increase of municipal and industrial wastewater and heavy metal contamination from these point sources have received much attention in the Taejon area. To reduce the environmental problems, 21 stream sediments from Gap-chun, Yudeung-chun, Yusung-chun and Keum river have been analyzed for Cd, Cu, Pb and Zn. The results show that heavy metal concentrations are high in sediments from the Sintanjin and Taehwa Industrial Complex area with particular reference to 1388 {mu}g/g Cu in the stream sediment of Yusung-chun. When the geochemical map drawn from the Kriging technique of these data are compared with the industrialization and urbanization index map, high concentrations of heavy metals are found in stream sediments in industrialized areas resulting from the accumulation of heavy metals from the polluting factories. Concentrations of Cu in sediments from the Taehwa Industrial Complex area and those of Zn in sediments from the Sintanjin Complex area higher than EPA standard in the U.S.A and may be the potential sources of pollution in Keum river with possible implications to human health. For the speciation of Cu, Pb and Zn, the high proportions of exchangeable phase of Cu and Zn in stream sediments indicate that the metals originate not from parent materials but from wastewater and exist as the adsorbed phase on the surface of sediments. These metals are easily dissolved into the water by the reaction and relative amounts of easily dissolved phase of metals are in the order of Cu = Zn > Pb. (author). 17 refs., 4 tabs., 7 figs.

  6. Proof-of-principle that a decoy virus protects oncolytic measles virus against neutralizing antibodies

    OpenAIRE

    Xu C; Goß AV; Dorneburg C; Debatin KM; Wei J; Beltinger C

    2018-01-01

    Chun Xu,1,2,* Annika Verena Goß,1,* Carmen Dorneburg,1 Klaus-Michael Debatin,1 Jiwu Wei,2 Christian Beltinger1 1Department of Pediatrics and Adolescent Medicine, Section of Experimental Pediatric Oncology, University Medical Center Ulm, Ulm, Germany; 2Jiangsu Key Laboratory of Molecular Medicine, Medical School of Nanjing University, China *These authors contributed equally to this work Background: Attenuated oncolytic measles virus (OMV) is a promising antitumor agent in early-phase cl...

  7. Macroeconomic Forces and Stock Returns in Vietnam

    OpenAIRE

    Phan, Van Hang

    2008-01-01

    Capital market development, especially the appearance of Vietnamese equity market recently has a strategic importance in the economic growth and structural reform process of Vietnam (Chun et al, 2003). This dissertation focuses on the impacts of macroeconomic forces on stock market returns in Vietnamese stock market which has not been investigated in detail before, and thereby to contribute further literature on this new emerging stock market. Specifically, the research will intensively inves...

  8. Altered regional homogeneity of spontaneous brain activity in idiopathic trigeminal neuralgia

    OpenAIRE

    Wang, Yanping; Zhang, Xiaoling; Guan, Qiaobing; Wan, Lihong; Yi, Yahui; Liu, Chun-Feng

    2015-01-01

    Yanping Wang,1,2 Xiaoling Zhang,2 Qiaobing Guan,2 Lihong Wan,2 Yahui Yi,2 Chun-Feng Liu1 1Department of Neurology, The Second Affiliated Hospital of Soochow University, Suzhou, Jiangsu Province, 2Department of Neurology, The Second Hospital of Jiaxing City, Jiaxing, Zhejiang Province, People’s Republic of China Abstract: The pathophysiology of idiopathic trigeminal neuralgia (ITN) has conventionally been thought to be induced by neurovascular compression theory. Recent structural ...

  9. Submicron Structures and Various Technology

    Science.gov (United States)

    1990-06-01

    Submitted by Professor Jonathan Allen Professor Daniel Kleppner !1! Research Laboratory of Electronics Massachusetts Institute of Technology Cambridge, MA...Alberto Moel, Joyce E. Palmer, Samuel L. Park, Hui Meng Quek , John H.F. Scott-Thomas, Ghavam Shahidi, Siang-Chun The, Anthony Yen Undergraduate...substrates; and Kathleen Early, Reza A. Ghanbari, Yao-Ching Ku, periodic structures for x-ray optics, spectros- Alberto Moel, Hui Meng Quek , Dr. Mark L

  10. Restoring proximal caries lesions conservatively with tunnel restorations

    OpenAIRE

    Chu, Chun-Hung; Cheung,; Nalliah,Romesh; Mei,May L

    2013-01-01

    Chun-Hung Chu1, May L Mei,1 Chloe Cheung,1 Romesh P Nalliah2 1Faculty of Dentistry, The University of Hong Kong, Hong Kong, People's Republic of China; 2Department of Restorative Dentistry and Biomaterials Sciences, Harvard School of Dental Medicine, Boston, MA, USA Abstract: The tunnel restoration has been suggested as a conservative alternative to the conventional box preparation for treating proximal caries. The main advantage of tunnel restoration over the conventional box or slo...

  11. Effects of energetic restriction diet on butyrylcholinesterase in obese women from southern Brazil - A longitudinal study.

    Science.gov (United States)

    Santos, Willian Dos; Tureck, Luciane Viater; Saliba, Louise Farah; Schenknecht, Caroline Schovanz; Scaraboto, Débora; Souza, Ricardo Lehtonen R; Furtado-Alle, Lupe

    2017-01-01

    Butyrylcholinesterase (BChE) activity has been associated with obesity, lipid concentrations, and CHE2 locus phenotypes. This, the aim of this study was to evaluate the effects of an energetic restriction diet intervention on anthropometrical and biochemical variables and on absolute and relative BChE activity in CHE2 C5+ and CHE2 C5- individuals. One hundred eleven premenopausal obese women from Southern Brazil participated in an energetic restriction diet intervention (deficit of 2500 kJ/day) for 8 weeks. Their anthropometric and biochemical parameters were evaluated before and after the intervention. Plasma BChE activity was measured, and BChE bands in plasma and CHE2 locus phenotypes were detected by electrophoresis. The dietetic intervention decreased anthropometric and biochemical parameters as well as absolute BChE activity and relative activity of the G4 band. The CHE2 C5+ phenotype presented a different effect when compared with the CHE2 C5- phenotype. The CHE2 C5+ phenotype showed an effect in absolute BChE activity and in the relative activity of the G4 form, maintaining higher BChE activity regardless of the metabolic changes. In our study, 8 weeks was not sufficient time to lower the body mass index to normal, but it was enough to significantly reduce the absolute BChE activity, which became similar to the levels in nonobese individuals. CHE2 C5+ individuals were resistant to the decrease in BChE activity compared to CHE2 C5- individuals. This shows that the diet did not affect the CHE2 and G4 fraction complex and that the products of the CHE2 locus in association with BChE have a role in energy metabolism, maintaining high levels of enzymatic activity even after dietary intervention.

  12. Health risk assessment of lead for children in tinfoil manufacturing and e-waste recycling areas of Zhejiang Province, China

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiaofeng [Zhejiang Provincial Center for Disease Control and Prevention, 630 Xin Cheng Road, Binjiang District, Hangzhou 310051 (China); Centre for Environment and Population Health, Griffith School of Environment, Griffith University, 170 Kessels Road, Nathan, QLD 4111 (Australia); Miller, Greg [Centre for Environment and Population Health, Griffith School of Environment, Griffith University, 170 Kessels Road, Nathan, QLD 4111 (Australia); Ding, Gangqiang; Lou, Xiaoming; Cai, Delei; Chen, Zhijian; Meng, Jia; Tang, Jun [Zhejiang Provincial Center for Disease Control and Prevention, 630 Xin Cheng Road, Binjiang District, Hangzhou 310051 (China); Chu, Cordia [Centre for Environment and Population Health, Griffith School of Environment, Griffith University, 170 Kessels Road, Nathan, QLD 4111 (Australia); Mo, Zhe; Han, Jianlong [Zhejiang Provincial Center for Disease Control and Prevention, 630 Xin Cheng Road, Binjiang District, Hangzhou 310051 (China)

    2012-06-01

    Tinfoil manufacturing and electronic waste (e-waste) recycling remain rudimentary processes in Zhejing Province, China, which could account for elevated blood lead levels (BLLs) and health impacts on children. We assessed the potential health risks of lead in tinfoil manufacturing and e-waste recycling areas. 329 children in total aged 11-12 who lived in a tinfoil manufacturing area (Lanxi), an e-waste recycling area (Luqiao) and a reference area (Chun'an) were studied. Lead levels in children's blood were determined by inductively coupled plasma mass spectrometer (ICP-MS). Blood urea nitrogen (BUN), serum creatinine, serum calcium, {delta}-Aminolaevulinic acid ({delta}-ALA) and intelligence quotient (IQ) were also measured. Geometric mean of BLLs in Lanxi, Luqiao and Chun'an were 8.11 {mu}g/dL, 6.97 {mu}g/dL, and 2.78 {mu}g/dL respectively, with 35.1%, 38.9% and 0% of children who had BLLs above 10 {mu}g/dL. The BLLs in exposed areas were much higher than those in the control area. Lanxi children had higher creatinine and calcium than Chun'an children, and Luqiao children had higher {delta}-ALA and lower calcium than Chun'an children. No significant differences of IQ were observed between Lanxi, Luqiao and Chun'an, however a negative relationship between BLLs and IQ was shown for the study children. The results indicated that lead pollution from e-waste recycling and tinfoil processing appears to be a potential serious threat to children's health. - Highlights: Black-Right-Pointing-Pointer No report on tinfoil processing impact on children's health before. Black-Right-Pointing-Pointer Few studies reported health impacts of lead from e-waste processing. Black-Right-Pointing-Pointer Children with blood lead levels < 10 {mu}g/dL are associated with a decrease in IQ. Black-Right-Pointing-Pointer Threshold appears to exist at blood lead level of about 20 {mu}g/dL for urinary {delta}-ALA.

  13. Health risk assessment of lead for children in tinfoil manufacturing and e-waste recycling areas of Zhejiang Province, China

    International Nuclear Information System (INIS)

    Wang, Xiaofeng; Miller, Greg; Ding, Gangqiang; Lou, Xiaoming; Cai, Delei; Chen, Zhijian; Meng, Jia; Tang, Jun; Chu, Cordia; Mo, Zhe; Han, Jianlong

    2012-01-01

    Tinfoil manufacturing and electronic waste (e-waste) recycling remain rudimentary processes in Zhejing Province, China, which could account for elevated blood lead levels (BLLs) and health impacts on children. We assessed the potential health risks of lead in tinfoil manufacturing and e-waste recycling areas. 329 children in total aged 11–12 who lived in a tinfoil manufacturing area (Lanxi), an e-waste recycling area (Luqiao) and a reference area (Chun'an) were studied. Lead levels in children's blood were determined by inductively coupled plasma mass spectrometer (ICP-MS). Blood urea nitrogen (BUN), serum creatinine, serum calcium, δ-Aminolaevulinic acid (δ-ALA) and intelligence quotient (IQ) were also measured. Geometric mean of BLLs in Lanxi, Luqiao and Chun'an were 8.11 μg/dL, 6.97 μg/dL, and 2.78 μg/dL respectively, with 35.1%, 38.9% and 0% of children who had BLLs above 10 μg/dL. The BLLs in exposed areas were much higher than those in the control area. Lanxi children had higher creatinine and calcium than Chun'an children, and Luqiao children had higher δ-ALA and lower calcium than Chun'an children. No significant differences of IQ were observed between Lanxi, Luqiao and Chun'an, however a negative relationship between BLLs and IQ was shown for the study children. The results indicated that lead pollution from e-waste recycling and tinfoil processing appears to be a potential serious threat to children's health. - Highlights: ► No report on tinfoil processing impact on children's health before. ► Few studies reported health impacts of lead from e-waste processing. ► Children with blood lead levels < 10 μg/dL are associated with a decrease in IQ. ► Threshold appears to exist at blood lead level of about 20 μg/dL for urinary δ-ALA.

  14. Per un insegnamento moderno della relatività

    CERN Document Server

    Fabri, Elio

    1995-01-01

    Nel 1985 furono distributi al Congresso AIF gli appunti di un corso di relatività, intitolato "Il tempo relativistico"; nel 1987, sempre in occasione del Congresso AIF, usciva "Massa ed energia", che ne costituiva il completamento. Quella che presento oggi, ancora a distanza di due anni, è la versione integrata e rielaborata di quei due volumetti.

  15. Schadenfreude: il piacere per le disgrazie altrui (Virginio Sala, Trans.)

    NARCIS (Netherlands)

    van Dijk, W.; Ouwerkerk, J.W.

    2016-01-01

    Quando qualcuno è colpito da una sventura, un incidente o una disgrazia, a volte proviamo Schadenfreude: un’emozione che si definisce solitamente come “provare piacere per la sventura altrui”. Quella della Schadenfreude è un’esperienza comune: è un’emozione che sembra intrinseca all’essere sociale.

  16. La struttura degli algoritmi

    CERN Document Server

    Luccio, Fabrizio

    1982-01-01

    Protagonista di questo libro è l'algoritmo, cioè la successione dei passi in cui consiste la risoluzione di un problema. Si cercano le direttrici principali che guidano la fase dell'organizzazione e del progetto di un algoritmo, i metodi per valutarne l'efficienza, i criteri di scelta di un algoritmo fra i tanti che risolvono lo stesso problema.

  17. Teaching of language, literature and history in the information society: some reflections

    Directory of Open Access Journals (Sweden)

    Francesco Caviglia

    2001-01-01

    Full Text Available La prima associazione che viene alla mente pensando al termine tecnologia e' un oggetto fisico come un computer o un aratro. In senso piu' ampio tecnologiaf a riferimento a un'intera gamma di "modi di fare le cose" che si basano su principi o componenti prodotti dall'uomo.

  18. nel cinema italiano contemporaneo

    African Journals Online (AJOL)

    italiano come era rappresentato nel cinema italiano del passato, per esempio in Rocco e i suoi ..... parole che Michele rivolge a Ioan ad un certo punto del film, “Si può .... temporaneo equilibrio e supporto in una inusuale relazione che va.

  19. Salts of Dodecamethylcarba-closo-dodecaborate(-) Anion, CB11Me12-, and the Radical Dodecamethylcarba-closo-dodecaboranyl, CB11Me12

    Czech Academy of Sciences Publication Activity Database

    Clayton, J. R.; King, B. T.; Zharov, I.; Fete, M. G.; Volkis, V.; Douvris, C.; Valášek, Michal; Michl, Josef

    2010-01-01

    Roč. 35, - (2010), s. 56-63 ISSN 0073-8077 Grant - others:NSF(US) CHE0446688; NSF(US) CHE0848477 Institutional research plan: CEZ:AV0Z40550506 Keywords : boron clusters * methylation * stable free radical Subject RIV: CF - Physical ; Theoretical Chemistry

  20. [I direttori delle riviste vanno avanti: attenersi ai principi accademici, adottare trasparenza e rispetto e applicare le regole.

    Science.gov (United States)

    Teixeira da Silva, Jaime A; Dobránszki, Judit

    2018-05-01

    Nonostante i cambiamenti in corso nell'ambito delle pubblicazioni scientifiche (STEM - scienza, tecnologia, ingegneria e medicina), è indubbio che i direttori delle riviste restano i più importanti custodi del processo editoriale. In questo articolo vengono analizzati i motivi per cui i direttori delle riviste devono continuare ad attenersi ai principi editoriali fondamentali e a utilizzare le nuove tecnologie digitali solo per dare forza al contenuto, ma non per sostituirlo nella sua qualità. Per raggiungere questo obiettivo, in un'epoca caratterizzata da controlli ed equilibri, i direttori delle riviste devono essere attentamente sorvegliati e ritenuti responsabili tanto quanto gli autori che essi stessi valutano. Qualunque scorciatoia potrebbe avere conseguenze negative e inaspettate per quella rivista che non si attenesse a tali regole, che vedrebbe intaccata la propria reputazione e che dovrebbe faticare per recuperare la fiducia dei propri lettori. Quindi, a rischio di sembrare scontati, è meglio prevenire il danno alla reputazione piuttosto che curarlo. L'unico modo per evitarlo è che i direttori delle riviste si adattino a un crescente movimento sempre più critico, che richiede maggiore trasparenza e responsabilità da parte di chi contribuisce a costruire la base delle conoscenze scientifiche e dalla società, specialmente laddove la ricerca è finanziata pubblicamente.

  1. lo sguardo di micòl: i modi della visione nell'opera narrativa di ...

    African Journals Online (AJOL)

    User

    anime, dalla poesia delle ore vuote e dei giorni squallidi, dalle vite emarginate, sconfitte, chiuse in una loro sofferta ma orgogliosa solitudine; più che osservare obiettivamente l'ambiente e il paesaggio, l'autore lo vedeva attraverso le immagini artistiche e letterarie che la sua cultura gli proponeva, cosicché tra i suoi occhi ...

  2. Arylesterase Phenotype-Specific Positive Association Between Arylesterase Activity and Cholinesterase Specific Activity in Human Serum

    Directory of Open Access Journals (Sweden)

    Yutaka Aoki

    2014-01-01

    Full Text Available Context: Cholinesterase (ChE specific activity is the ratio of ChE activity to ChE mass and, as a biomarker of exposure to cholinesterase inhibitors, has a potential advantage over simple ChE activity. Objective: To examine the association of several potential correlates (serum arylesterase/paraoxonase activity, serum albumin, sex, age, month of blood collection, and smoking with plasma ChE specific activity. Methods: We analyzed data from 195 cancer-free controls from a nested case-control study, accounting for potential confounding. Results: Arylesterase activity had an independent, statistically significant positive association with ChE specific activity, and its magnitude was the greatest for the arylesterase phenotype corresponding to the QQ PON1192 genotype followed by phenotypes corresponding to QR and RR genotypes. Serum albumin was positively associated with ChE specific activity. Conclusions: Plasma arylesterase activity was positively associated with plasma ChE specific activity. This observation is consistent with protection conferred by a metabolic phenotype resulting in reduced internal dose.

  3. BOOK REVIEWS / RECENSIONI

    African Journals Online (AJOL)

    User

    Prendi avviso o lettore. Questa pagina fu scritta per amore. (“Esergo”) l poeta stabilisce un dialogo ideale con il lettore. Significativo è il passo che Maffeo pone come presentazione alla sua raccolta, tratto dal poeta inglese Gerald Manley Hopkins: “A che servono le opere d'arte? Ad educare, a essere esempi. Produrre […] ...

  4. Low Energy X-Ray and Electron Physics and Technology for High-Temperature Plasma Diagnostics

    Science.gov (United States)

    1987-10-01

    cransmission band for Che rejeccion of such background radiacions around Che 500-1000 eV region by combining as a primary monochromator a 300 ßg...X-Radiations of the Solar Corona," Technical Report No. 7, 1-413, AFOSR 66-2446 (September 1966). 30. "X-Ray Absorption in the 2 to

  5. Programmable gaming environments for four year olds

    Directory of Open Access Journals (Sweden)

    Edith K. Ackermann

    2002-01-01

    Full Text Available Apprendere a programmare alla scuola dell'infanzia? Perche'? Che cosa ci puo' essere di interessante in questo per un bambino? Che cosa si puo' imparare? Questo articolo e' rivolto ai ricercatori, ai progettisti, agli educatori e ai genitori; tutti questi hanno buone ragioni per interrogarsi.

  6. Programmable gaming environments for four year olds

    OpenAIRE

    Edith K. Ackermann

    2002-01-01

    Apprendere a programmare alla scuola dell'infanzia? Perche'? Che cosa ci puo' essere di interessante in questo per un bambino? Che cosa si puo' imparare? Questo articolo e' rivolto ai ricercatori, ai progettisti, agli educatori e ai genitori; tutti questi hanno buone ragioni per interrogarsi.

  7. Clay Shirky, Internet e il collegio invisibile

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2011-10-01

    Full Text Available Come Internet sta cambiando il nostro modo di pensare? Fra le 172 risposte presentate da Edge, Clay Shirky ne propone una particolarmente interessante per i ricercatori di professione. Internet, scrive Shirky, ha aumentato straordinariamente la capacità espressiva dell’umanità. Ma che una risorsa divenga abbondante, da scarsa che era, è una sfortuna, almeno per chi su [...

  8. Quark i mattoni del mondo

    CERN Document Server

    Fritzsch, Harald

    1983-01-01

    Quark rossi, verdi e blu ; quark dotati di stranezza e di incanto ; quark 'su' e 'giù' : sembra che i fisici delle particelle giochino a confondere la curiosità del profano, con queste denominazioni fantasiose. Che cosa significano ? e, soprattutto, i quark sono i costituenti davvero elementari della materia ?

  9. L'EPOPEA DELLA SARDEGNA IN MILLANT'ANNI DI GIULIO ANGIONI

    African Journals Online (AJOL)

    User

    mostrato dal padre in occasione della battaglia di Lepanto, da cui era tornato zoppo e .... antistoriche di attribuzioni di colpe o di valori positivi non toglie che da essa ... terrorismo islamico, che ogni tipo di azione volta a contrastarlo è diventata ...

  10. SUI CODICI UNIDIREZIONALI

    Directory of Open Access Journals (Sweden)

    Luca Tallini

    1992-04-01

    Full Text Available Oltre ad una breve descrizione della problematica sui codici Unidirezionali è qui data la dimostrazione di una congettura di S. Al-Bassan e B. Bose che interviene nella teoria dei suddetti autori, sulla costruzione di codici ottimali nella classe dei codici bilanciati che si ottengono con il metodo della complementazione di Knuth.

  11. Concentrations of persistent organochlorine compounds in human milk and placenta are higher in Denmark than in Finland

    DEFF Research Database (Denmark)

    Shen, H.; Main, K.M.; Andersson, A.M.

    2008-01-01

    , oxychlordane (OXC), cis-heptachloroepoxide (c-HE) and 1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane (p,p'-DDT) were the other main organochlorines detected. Danish samples had significantly higher concentrations of p,p'-DDE, p,p'-DDT, beta-HCH, HCB, dieldrin, c-HE and OXC than did the Finnish samples. Levels...

  12. The role of teachers on the online training platform run by INDIRE (BDP

    Directory of Open Access Journals (Sweden)

    Raffaele Mazzella

    2002-01-01

    Full Text Available Una esperienza di supporto alla formazione in rete, con caratteristiche peculiari. Si e' trattato di un intervento molto vasto, che ha riguardato tutte le scuole italiane e ha coinvolto insegnanti che non avevano scelto di utilizzare gli strumenti di rete.

  13. "A chiare lettere" Editoriale gennaio 2007

    Directory of Open Access Journals (Sweden)

    Giuseppe Casuscelli

    2011-02-01

    Full Text Available Ad onta delle crisi ricorrenti che investono il diritto ecclesiastico, nell’anno appena iniziato la nostra disciplina raccoglie il testimone inatteso della speranza. Il 2006 ci ha offerto la pubblicazione di tre manuali1 che, con un taglio ed un’impostazione nuovi, si rivolgono ad un’utenza che non è fatta soltanto degli studenti delle nostre Università; la pubblicazione del primo numero della nuova rivista semestrale “Diritto e Religioni”2, che intende trattare il fattore religioso da molteplici punti di vista aprendosi ad una molteplicità di scienze affini (antropologia, sociologia, storia, filosofia; la nascita di questa rivista telematica che non vuole avere un proprio indirizzo o orientamento, ma si prefigge lo scopo di essere strumento e manifesto della pluralità e del pluralismo delle scuole, delle sensibilità, dei metodi che alimentano il patrimonio comune del sapere teorico perché in esso trovi a sua volta alimento il concreto, quotidiano farsi dell’esperienza giuridica. Due ricorrenze di particolare rilievo segnano, ancora, questa fase: i cinquanta anni della Corte costituzionale, alla cui attività molto è legato il rinnovamento del “diritto ecclesiastico”, che ha partecipato alla celebrazione corale offrendo uno specifico contributo di analisi della sua giurisprudenza 3; i dodici lustri della Costituzione repubblicana, un’età “matura” che offre l’occasione per un bilancio della sua vitalità, delle compiute attuazioni, delle attese non ancora realizzate.

  14. dragging the history behind in brackets. intervista a ivan vladislavic1

    African Journals Online (AJOL)

    User

    Domanda (NA): Nella novella “Afritude Sauce”, tratta dal suo libro. The Exploded View, il personaggio ... D'altro canto, è anche vero che un buon libro spesso non dipende dal soggetto, quanto dal modo in cui questo ... mondo quanto a livello di alfabetizzazione e preparazione matematica, o che si trovasse ad arrancare ...

  15. La relazione empatica con i robot

    NARCIS (Netherlands)

    Marti, P.; Iacono, I.; Tittarelli, M.

    2013-01-01

    È possibile instaurare una relazione empatica tra un essere umano e un robot? Il presente studio valuta le soluzioni di design adottate nella progettazione di una maschera empatica, implementata su un tablet, che consente all’anziano di dialogare nell’ambiente domestico con un robot che lo assiste

  16. “fra questi sí e no son di parer contrario”: affermazione di sé e nome ...

    African Journals Online (AJOL)

    User

    Figurarsi! So bene che nel riparto dei doni della Provvidenza, l'intelligenza è toccata tutta a loro.13. Ricordando la "massima d'oro" che impone alle donne il silenzio. ("Mal sont les gens endoctrinés/ Quand par femme sont sermonnés"), afferma di essersela "mandata a memoria religiosamente" e di averla tenuta nella sua ...

  17. Quali interlocutori per ’inchiesta sociale?

    Directory of Open Access Journals (Sweden)

    Piano b

    2009-06-01

    Full Text Available La chiusura delle fabbriche, la scomparsa della classe operaia, la riconversione dei capannoni dismessi. La città post-industriale, dei servizi, dei centri commerciali. L’immigrazione, la città multietnica, la questione della sicurezza, l’insicurezza percepita dai cittadini italiani nei propri quartieri. Il lavoro precario, il consumismo, la speculazione edilizia, l’inquinamento, la fine delle “comunità”, la parcellizzazione dei rapporti sociali. Parole che da anni leggiamo e ascoltiamo e che ci sembra descrivano in modo appropriato i fenomeni e le trasformazioni in atto nelle città italiane. Ma anche parole di “senso comune”, che diamo per scontate. Descrizioni dei mondi in cui viviamo che è difficile mettere in discussione, che solitamente vengono evocate piuttosto che argomentate. Parole che basta nominare perché tutti bene o male capiscano di cosa si sta parlando. Che ci mostrano in maniera inequivocabile la direzione nella quale sta andando la società in cui viviamo. E, aspetto non secondario, inibiscono l’azione politica collettiva e la nascita di progetti di segno diverso.

  18. Il Simposio di Platone

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2013-01-01

    Full Text Available Pensate che i testi antichi siano semplicemente vecchi? Che l’amore platonico non vada mai  al sodo? Leggere il Simposio di Platone confrontandosi direttamente col testo, com’è possibile fare grazie al Perseus Project, vi farà cambiare idea.

  19. Gödel, Escher, Bach un'eterna ghirlanda brillante : una fuga metaforica su menti e macchine nello spirito di Lewis Carroll

    CERN Document Server

    Hofstadter, Douglas R

    1984-01-01

    Il libro che ha svelato a una immensa quantità di lettori, in tutto il mondo, gli incanti e le trappole di un’Eterna Ghirlanda Brillante i cui fili si chiamano intelligenza artificiale, macchina di Turing, teorema di Gödel. Una «fuga metaforica» nel variegato mondo che si dispiega fra la mente, il cervello e i computer

  20. Clienti e signori nell’Irlanda altomedievale (secoli VI-IX

    Directory of Open Access Journals (Sweden)

    Mario Dalle Carbonare

    2003-12-01

    Full Text Available La società irlandese nell’alto medioevo si organizza sulla base di relazioni di clientela che talvolta sono il frutto di una scelta compiuta da uomini liberi che si assoggettano ai gruppi eminenti, talaltra sono fondate su una dipendenza economica.  La ricerca utilizza prevalentemente fonti di carattere normativo ed è corredata da un glossario.

  1. Serre fotovoltaiche Attenti alle perdite; Stanghellini: il calo produttivo non è da poco

    NARCIS (Netherlands)

    Contri, L.; Stanghellini, C.

    2010-01-01

    Gli installatori di pannelli fotovoltaici hanno nel mirino gli ortoflorovivaisti che gestiscono serre. Costoro, per contro, sono alla ricerca di sistemi atti a far loro recuperare la marginalità perduta in questi anni di crisi. Un matrimonio che s'ha da fare? Meglio di no. A sconsigliarlo è Cecilia

  2. Examples of Best Practice 2. Holocaust Education as a Universal Challenge

    Science.gov (United States)

    Kalisman, Raya

    2010-01-01

    The Center for Humanistic Education (CHE) engages high-school students and teachers from the Arab and Jewish sectors in an examination of connections between the Holocaust, personal and social morals, and implications for present Israeli society. Since 1997, CHE has been working regularly with about 25 Jewish and Arab high schools, engaging about…

  3. NOTES AND GLEANINGS / NOTE E CURIOSITÀ

    African Journals Online (AJOL)

    User

    pensiero che oltrepassi le colonne d'Ercole stabilite dalla metafisica e cioè i concetti di soggetto e oggetto psichico e fisico. Questo destino della filosofia è condiviso dalla psicologia fenomenologica che con. Husserl si è distinta dalla psicologia naturalistica. La psicanalisi ha una sua episteme come le scienze umane, ma a.

  4. Conversazioni autobiografiche con Albino Sacco-Casamassima

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2004-03-01

    Full Text Available Nel 1948 venne Olivetti a Matera. Olivetti venne a Matera con un certo ambasciatore americano che praticamente aveva preparato o stava dando una mano per il piano Marschall, venne a Matera e mi vollero incontrare. Io sono stato chiamato dalla piazza, stavo nella piazza, era il mese di luglio, una cosa di questo genere, e andai in un bar, un bar ad angolo mi ricordo in Via Don Minzioni, dove questo Olivetti mi disse 'ma lei che cosa fa coi sassi?' 'Che cos'è questa storia?' Gli raccontai un po' che cosa facevo io con questi amici, avevamo fatto questo, insomma tutto quello che avevamo fatto nei sassi e che volevamo preparare ancora per presentare a qualcuno un piano di revisionamento dei sassi. Mi ricordo, era la prima volta che avevo visto Adriano Olivetti, ne avevo sentito parlare però non avevo mai visto quest'uomo con gli occhi celesti, minuto, coi capelli bianchi, riccioluto, con una cravatta bianca, cosa che mi fece impressione, una specie di angelo.

  5. The limits of postfigurative technique in Ignazio Silone's Pane e Vino ...

    African Journals Online (AJOL)

    Uno scrittore che ha usato questa tecnica è Ignazio Silone. Essa forma una parte vitale della struttura del suo romanzo del 1937, Pane e vino. Tuttavia ci sono fondamentali debolezze nell'uso di Silone della figura simbolica di Cristo, il che esemplifica la critica di tale tecnica espressa in generale, fra i tanti, da Liston Pope e ...

  6. BOOK REVIEWS / RECENSIONI

    African Journals Online (AJOL)

    User

    schiacciante presenza dell'opera paterna contribuirono a relegare in una condizione ... all'opera paterna. Mediante il reperimento di copiosi documenti inediti, fra cui un fitto epistolario che testimonia le relazioni non soltanto parentali ma anche con .... ispiratrice e oggetto di un sentimento che larvatamente si traduce in cure.

  7. Emozioni diverse per giudizi morali diversi?

    OpenAIRE

    Francesco Margoni

    2013-01-01

    Emozioni differenti amplificherebbero diversi tipi di giudizio morale. Ad affermare che la ricerca sulle emozioni supporterebbe una conclusione di questo tipo, sono gli psicologi Horberg, Oveis e Keltner, che sviluppano la loro argomentazione in una pubblicazione su Emotion Review titolata "Emotions as Moral Amplifiers: An Appraisal Tendency Approach to the Influences of Distinct Emotions upon Moral Judgment".

  8. La fotografia tra lutto, riparazione e creatività

    Directory of Open Access Journals (Sweden)

    Stefano Ferrari

    2010-12-01

    Full Text Available In questo saggio vengono analizzati i molteplici processi psichici che caratterizzano la fotografia. Essa viene considerata sia nel suo statuto fondamentale e in particolare nel rapporto con il motivo della caducità e della morte (che sancisce dunque la sua stretta relazione con il tema del lutto, sia nelle dinamiche che riguardano la psicologia di chi fotografa e di chi viene fotografato. Nel primo caso prevalgono meccanismi di difesa: la fotografia è una modalità di controllo onnipotente sulla realtà, che viene resa inoffensiva attraverso un processo di oggettivazione e di addomesticamento. Non mancano qui implicazioni di carattere aggressivo e perverso, legate soprattutto a meccanismi di identificazione introiettiva. Nel secondo caso colui che viene fotografato subisce dunque una trasformazione da soggetto a oggetto: secondo le parole di Roland Barthes, egli vive “una microesperienza della morte” che dà luogo a evidenti effetti di “perturbante”. Nel testo vengono inoltre analizzati alcuni meccanismi di fruizione che intervengono quando si osservano le fotografie; ma in particolare vengono considerati i processi psichici che si attivano nel momento in cui il soggetto è indotto a scegliere una sua propria fotografia. Quest’ultimo aspetto fa già parte della psicologia dell’autoritratto fotografico, a cui viene dedicata l’ultima parte del saggio.

  9. Giorgio Perlasca, 'Giusto tra le nazioni' e 'eroe italiano'

    NARCIS (Netherlands)

    Jansen, M.M.

    2008-01-01

    Giorgio Perlasca che, fingendosi console spagnolo, nel 1944 salvò più di cinquemila ebrei ungheresi a Budapest, è stato proclamato “Giusto tra le Nazioni” a Yad Vashem nel 1989, dopo di che è seguito il suo riconoscimento all’estero ed in Italia come “uomo giusto” e come “eroe italiano”. Dopo il

  10. Antonio Catalfamo, Frammenti di memoria. Nicola Teti Editore ...

    African Journals Online (AJOL)

    User

    altro canto, c'è da chiedersi se la stessa affermazione non trovi una sua giustificazione davanti alle deformità sociali del mondo moderno. Si pensi a ciò che significa vivere nel presente nell'ambito di un consumismo che tutto ingoia e per cui ...

  11. Andare a consumare

    Directory of Open Access Journals (Sweden)

    Andreas Fernandez

    2009-03-01

    Non si sorprende più nessuno quando si afferma che il rilievo crescente rivestito dalla cultura e dalle pratiche di consumo nella nostra vita di tutti i giorni, nelle relazioni interpersonali che ci coinvolgono e, ovviamente, nell’universo economico, ha reso la produzione sempre meno nucleo di interesse delle scienze sociali.

  12. Precarietà e spazi nella società digitale. Intervista a Carlo Formenti

    Directory of Open Access Journals (Sweden)

    Emiliana Armano

    2014-04-01

    Full Text Available Nella call supponiamo che uno degli elementi caratterizzanti la connettività sia la ridefinizione dei "confini" in termini spaziali ma anche tra produzione e consumo, identitari e relazionali, di accesso alla conoscenza e in definitiva di potere. Qual è la sua opinione e che cosa ne pensa della ridefinizione dei confini?

  13. L'ULTIMA GIANNA MANZINI

    African Journals Online (AJOL)

    User

    Manzini) la narratrice è in grado di ritrovare e riscoprire situazioni passate che potrebbero apparire banali, senonché, proprio come in Ritratto in piedi, assumono adesso una diversa consistenza, percepite cioè nel loro reale valore sentimentale e spirituale7. Non dimentichiamo, poi, che questo è l'ultimo libro di Gianna.

  14. ... E OLTRE

    African Journals Online (AJOL)

    User

    dominio sul tempo e di ritorno «allo stato di perfetto equilibrio che caratterizza la materia inerte». Il piacere del verso (metro) è infatti determinato anche dal fatto che la ripetizione (costanza) ritmica consente il minimo dispendio di energia fisica (fonazione) e psichica (previsione, in quanto anche le connesse variazioni sono ...

  15. L'ISOLA DI ARTURO DI ELSA MORANTE

    African Journals Online (AJOL)

    User

    Vi è una curiosa atmosfera di attesa negli anni '50, ed è questa temperie morale che Elsa Morante rappresenta e interpreta nell'Isola di Arturo. Nel romanzo la Morante ci dà veramente un ritratto intero di quegli anni, nel senso che dal testo sorge una attitudine complessa, contenente in sè la percezione del tempo in corso, ...

  16. In vitro Cytotoxicity and Anti-herpes Simplex Virus Type 1 Activity of Hydroethanolic Extract, Fractions, and Isolated Compounds from Stem Bark of Schinus terebinthifolius Raddi.

    Science.gov (United States)

    Nocchi, Samara Requena; de Moura-Costa, Gislaine Franco; Novello, Claudio Roberto; Rodrigues, Juliana; Longhini, Renata; de Mello, João Carlos Palazzo; Filho, Benedito Prado Dias; Nakamura, Celso Vataru; Ueda-Nakamura, Tânia

    2016-01-01

    Herpes simplex virus type 1 (HSV-1) is associated with orofacial infections and is transmitted by direct contact with infected secretions. Several efforts have been expended in the search for drugs to the treatment for herpes. Schinus terebinthifolius is used in several illnesses and among them, for the topical treatment of skin wounds, especially wounds of mucous membranes, whether infected or not. To evaluate the cytotoxicity and anti-HSV-1 activity of the crude hydroethanolic extract (CHE) from the stem bark of S. terebinthifolius, as well as its fractions and isolated compounds. The CHE was subjected to bioguided fractionation. The anti-HSV-1 activity and the cytotoxicity of the CHE, its fractions, and isolated compounds were evaluated in vitro by SRB method. A preliminar investigation of the action of CHE in the virus-host interaction was conducted by the same assay. CHE presented flavan-3-ols and showed anti-HSV-1 activity, better than its fractions and isolated compounds. The class of substances found in CHE can bind to proteins to form unstable complexes and enveloped viruses, as HSV-1 may be vulnerable to this action. Our results suggest that the CHE interfered with virion envelope structures, masking viral receptors that are necessary for adsorption or entry into host cells. The plant investigated exhibited potential for future development treatment against HSV-1, but further tests are necessary, especially to elucidate the mechanism of action of CHE, as well as preclinical and clinical studies to confirm its safety and efficacy. Crude hydroethanolic extract (CHE) presents promising activity against herpes simplex virus type 1 (HSV 1), with selectivity index (SI) = 22.50CHE has flavan-3-ols in its composition, such as catechin and gallocatechinThe fractions and isolated compounds obtained from CHE by bioguided fractionation are less active than the CHE against HSV-1CHE interferes with viral entry process in the host cell and acts directly on the viral

  17. Cumulative incidence, distribution, and determinants of catastrophic health expenditure in Nepal: results from the living standards survey.

    Science.gov (United States)

    Ghimire, Mamata; Ayer, Rakesh; Kondo, Masahide

    2018-02-14

    Nepal has committed to the global community to achieve universal health coverage by 2030. Nevertheless, Nepal still has a high proportion of out-of-pocket health payment and a limited risk-pooling mechanism. Out-of-pocket payment for the healthcare services could result in catastrophic health expenditure (CHE). Evidence is required to effectively channel the efforts to lower those expenses in order to achieve universal health coverage. However, little is known about CHE and its determinants in a broad national context in Nepal. Therefore, this study was conducted to explore the cumulative incidence, distribution, and determinants of CHE in Nepal. Data were obtained from the nationally representative survey, the Nepal Living Standards Survey-third undertaken in 2010/11. Information from 5988 households was used for the analyses. Households were classified as having CHE when their out-of-pocket health payment was greater than or equal to 40% of their capacity to pay. Remaining households were classified as not having CHE. Logistic regression analyses were used to identify determinants of CHE. Based on household-weighted sample, the cumulative incidence of CHE was 10.3% per month in Nepal. This incidence was concentrated in the far-western region and households in the poorer expenditure quartiles. Multivariable logistic regression revealed that households were more likely to face CHE if they; consisted of chronically ill member(s), have a higher burden of acute illness and injuries, have elderly (≥60 years) member(s), belonged to the poor expenditure quartile, and were located in the far-western region. In contrast, households were less likely to incur CHE when their household head was educated. Having children (≤5 years) in households did not significantly affect catastrophic health expenditure. This study identified a high cumulative incidence of CHE. CHE was disproportionately concentrated in the poor households and households located in the far

  18. Time course of cholinesterase inhibition in adult rats treated acutely with carbaryl, carbofuran, formetanate, methomyl, methiocarb, oxamyl or propoxur

    International Nuclear Information System (INIS)

    Padilla, S.; Marshall, R.S.; Hunter, D.L.; Lowit, A.

    2007-01-01

    To compare the toxicity of seven N-methyl carbamates, time course profiles for brain and red blood cell (RBC) cholinesterase (ChE) inhibition were established for each. Adult, male, Long Evans rats (n = 4-5 dose group) were dosed orally with either carbaryl (30 mg/kg in corn oil); carbofuran (0.5 mg/kg in corn oil); formetanate HCl (10 mg/kg in water); methomyl (3 mg/kg in water); methiocarb (25 mg/kg in corn oil); oxamyl (1 mg/kg in water); or propoxur (20 mg/kg in corn oil). This level of dosing produced at least 40% brain ChE inhibition. Brain and blood were taken from 0.5 to 24 h after dosing for analysis of ChE activity using two different methods: (1) a radiometric method which limits the amount of reactivation of ChE activity, and (2) a spectrophotometric method (Ellman method using traditional, unmodified conditions) which may encourage reactivation. The time of peak ChE inhibition was similar for all seven N-methyl carbamate pesticides: 0.5-1.0 h after dosing. By 24 h, brain and RBC ChE activity in all animals returned to normal. The spectrophotometric method underestimated ChE inhibition. Moreover, there was a strong, direct correlation between brain and RBC ChE activity (radiometric assay) for all seven compounds combined (r 2 = 0.73, slope 1.1), while the spectrophotometric analysis of the same samples showed a poor correlation (r 2 = 0.09). For formetanate, propoxur, methomyl, and methiocarb, brain and RBC ChE inhibitions were not different over time, but for carbaryl, carbofuran and oxamyl, the RBC ChE was slightly more inhibited than brain ChE. These data indicate (1) the radiometric method is superior for analyses of ChE activity in tissues from carbamate-treated animals (2) that animals treated with these N-methyl carbamate pesticides are affected rapidly, and recover rapidly, and (3) generally, assessment of RBC ChE is an accurate predictor of brain ChE inhibition for these seven pesticides

  19. In vitro Cytotoxicity and Anti-herpes Simplex Virus Type 1 Activity of Hydroethanolic Extract, Fractions, and Isolated Compounds from Stem Bark of Schinus terebinthifolius Raddi

    Science.gov (United States)

    Nocchi, Samara Requena; de Moura-Costa, Gislaine Franco; Novello, Claudio Roberto; Rodrigues, Juliana; Longhini, Renata; de Mello, João Carlos Palazzo; Filho, Benedito Prado Dias; Nakamura, Celso Vataru; Ueda-Nakamura, Tânia

    2016-01-01

    Background: Herpes simplex virus type 1 (HSV-1) is associated with orofacial infections and is transmitted by direct contact with infected secretions. Several efforts have been expended in the search for drugs to the treatment for herpes. Schinus terebinthifolius is used in several illnesses and among them, for the topical treatment of skin wounds, especially wounds of mucous membranes, whether infected or not. Objective: To evaluate the cytotoxicity and anti-HSV-1 activity of the crude hydroethanolic extract (CHE) from the stem bark of S. terebinthifolius, as well as its fractions and isolated compounds. Materials and Methods: The CHE was subjected to bioguided fractionation. The anti-HSV-1 activity and the cytotoxicity of the CHE, its fractions, and isolated compounds were evaluated in vitro by SRB method. A preliminar investigation of the action of CHE in the virus–host interaction was conducted by the same assay. Results: CHE presented flavan-3-ols and showed anti-HSV-1 activity, better than its fractions and isolated compounds. The class of substances found in CHE can bind to proteins to form unstable complexes and enveloped viruses, as HSV-1 may be vulnerable to this action. Our results suggest that the CHE interfered with virion envelope structures, masking viral receptors that are necessary for adsorption or entry into host cells. Conclusion: The plant investigated exhibited potential for future development treatment against HSV-1, but further tests are necessary, especially to elucidate the mechanism of action of CHE, as well as preclinical and clinical studies to confirm its safety and efficacy. SUMMARY Crude hydroethanolic extract (CHE) presents promising activity against herpes simplex virus type 1 (HSV 1), with selectivity index (SI) = 22.50CHE has flavan-3-ols in its composition, such as catechin and gallocatechinThe fractions and isolated compounds obtained from CHE by bioguided fractionation are less active than the CHE against HSV-1CHE interferes

  20. Idraulica dei sistemi fognari dalla teoria alla pratica

    CERN Document Server

    Gisonni, Corrado

    2012-01-01

    La progettazione dei sistemi fognari e dei manufatti in essi presenti richiede un’attenta conoscenza delle leggi che regolano i fenomeni idraulici, con particolare riferimento alle correnti idriche a superficie libera. Partendo dalle nozioni fondamentali dell’Idraulica, il testo intende colmare alcune importanti lacune che ancora caratterizzano la letteratura italiana nel settore e che spesso sono alla base di errori progettuali, con ovvie conseguenze sulla sicurezza dei centri abitati (come testimoniato dai frequenti fenomeni di allagamento che sono stati registrati negli ultimi anni). Il libro è rivolto agli allievi dei corsi di studio nel settore dell’ingegneria Civile ed Ambientale. Particolare interesse è rivolto ai professionisti operanti nel settore della ingegneria idraulica e della pianificazione urbana, per i quali è forte l’esigenza di testi che contengano indicazioni di carattere sia teorico sia pratico, finalizzate alla progettazione di sistemi di drenaggio nei centri abitati.

  1. Identità interinale: perché ne dobbiamo parlare

    Directory of Open Access Journals (Sweden)

    Augusto Debernardi

    2005-12-01

    Full Text Available Parigi e le sue banlieues stanno bruciando (... si assiste al fatto che le parole "inserimento e integrazione" sono vuote: ideologiche e rassicuranti le false coscienze all'opera. Eppure, paradossalmente, le rivolte francesi che cominciano ad estendersi ad altre città europee hanno molto a che fare con questa integrazione, con un benessere della società dei consumi e dello spettacolo (... queste operazioni danno identità a chi le fa ma anche a chi le subisce. Così l'identità di "uomo" come avversario/nemico (non di cittadino ritorna indietro a chi la lancia sia come neo-cittadino dimostrando che non c’è identità senza cittadinanza attiva, sia come neo-identità quando si definisce ad esempio "musulmano" e che non è, allora, francese! L’identità diventa interinale, provvisoria su tutta la linea di caratterizzazione, scivolando su qualsiasi crinale.

  2. Sviluppo e crisi. Per una prospettiva della compresenza

    Directory of Open Access Journals (Sweden)

    Andrea Pirni

    2011-02-01

    Full Text Available Il paradigma della modernità, adottando il concetto di sviluppo come tema chiave, ha elaborato moltissime teorie del mutamento: qui sviluppo e crisi risultano necessariamente contrapposti sia sotto il profilo teorico che empirico. La complessità crescente delle società europee contemporanee mette in discussione la capacità interpretativa del mutamento che le coinvolge attualmente e suggerisce l’elaborazione di nuove prospettive che focalizzino il processo di trasformazione in corso piuttosto che soffermarsi sul risultato. Dopo aver sinteticamente inquadrato il concetto di sviluppo nell’ambito del paradigma della modernità l’articolo intende sostenere l’utilità di una prospettiva che considera congiuntamente crisi e sviluppo per analizzare il mutamento delle democrazie contemporanee.

  3. Interaction of Chelerythrine with Keyhole Limpet Hemocyanin: a Fluorescence Spectroscopy and Molecular Docking Study

    Science.gov (United States)

    Zhong, M.; Long, R. Q.; Wang, Y. H.; Chen, C. L.

    2018-05-01

    The quenching mechanism between chelerythrine (CHE) and keyhole limpet hemocyanin (KLH) was investigated using fluorescence spectroscopy and molecular docking. The experiments were conducted at three different temperatures (293, 298, and 303 K). The results revealed that the intrinsic fluorescence of KLH was strongly quenched by CHE through a static quenching mechanism. The thermodynamic parameters (ΔG, ΔH, and ΔS) of the interaction were calculated, indicating that the interaction between CHE and KLH was spontaneous and that van der Waals forces and hydrogen bond formation played major roles in the binding process. The intrinsic fluorescence of the tyrosine and tryptophan residues in KLH was studied by synchronous fluorescence, which suggested that CHE changed the conformation of KLH. Finally, molecular docking was used to obtain detailed information on the binding sites and binding affinities between CHE and KLH.

  4. Il mondo in un giardino (e in un labirinto, in un tappeto, in un romanzo illimitato

    Directory of Open Access Journals (Sweden)

    Guido Laino

    2011-06-01

    Full Text Available Per Michel Foucault il giardino è il più antico esempio di un’eterotopia che “ha il potere di giustapporre, in un unico luogo reale, diversi spazi, diversi luoghi che sono tra loro incompatibili” (Foucault 1994, 16; è un luogo sacro di tradizione millenaria che, in Oriente, rappresenta simbolicamente un microcosmo, “la più piccola particella del mondo e […] anche la totalità del mondo” (ibid. 18. Il giardino è un’eterotopia che Foucault pone in parallelo allo spazio teatrale e al cinema, che nella propria cornice pure riproducono il mondo nella sua sostanza eterogenea: nell’opera d’arte, come nel giardino, convivono diversi luoghi, le distanze sono ridotte alla geometria della propria rappresentazione, il tempo si comprime o si espande all’interno di un ordine narrativo funzionale alla rilettura dell’artista.

  5. Aristotele, Einstein e gli altri i grandi scienziati tra pensiero e vita quotidiana

    CERN Document Server

    Fischer, Ernst Peter

    1997-01-01

    Abbiamo spesso un'idea confusa di quelle che sono state le vite degli uomini che hanno consacrato all'impresa scientifica le loro migliori energie. Eppure, non solo nell'arte e nella filosofia, ma anche nella scienza "lo stile è l'uomo" e la psicologia del singolo scienziato può rivelarsi il miglior aiuto per capire la logica della scoperta scientifica. Questa è una "storia della scienza raccontata agli amici davanti al caminetto", come l'autore stesso definisce la propria opera. Che non è soltanto una ricostruzione puntuale delle svolte principali che hanno portato alla scienza contemporanea, ma un racconto delle vicende personali di tutti quegli scienziati che sono stati divorati dalla passione del conoscere.

  6. The Use of Radioactive Marker as a Tool to Evaluate the Drug Release in Plasma and Particle Biodistribution of Block Copolymer Nanoparticles

    Directory of Open Access Journals (Sweden)

    Sharon Johnstone

    2011-01-01

    Full Text Available Diblock copolymer nanoparticles encapsulating a paclitaxel prodrug, Propac 7, have been used to demonstrate the usefulness of a nonmetabolizable radioactive marker, cholesteryl hexadecyl ether (CHE, to evaluate nanoparticle formulation variables. Since CHE did not exchange out of the nanoparticles, the rate of clearance of the CHE could be used as an indicator of nanoparticle stability in vivo. We simultaneously monitored prodrug circulation and carrier circulation in the plasma and the retention of CHE relative to the retention of prodrug in the plasma was used to distinguish prodrug release from nanoparticle plasma clearance. Nanoparticles labelled with CHE were also used to evaluate accumulation of nanoparticles in the tumour. This marker has provided relevant data which we have applied to optimise our nanoparticle formulations.

  7. DALL’«ARTICOLO EPR» AGLI ESPERIMENTI DI ALAIN ASPECT: IL LUNGO CAMMINO DEL PROBLEMA DELLA NONLOCALITÀ IN MECCANICA QUANTISTICA

    Directory of Open Access Journals (Sweden)

    Vera Matarese

    2014-03-01

    Full Text Available Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molto problematico, quello della località, che sarebbe esploso nell’esperimento prima concettuale di Bohm e poi sperimentale di Aspect. Ciò che questo articolo vuole delineare è lo sviluppo del problema della nonlocalità, dai suoi albori fino alla prova della sua effettiva esistenza nel mondo quantistico, dove, come ben ha dimostrato Bell, nulla possono fare le variabili nascoste per dissolvere la realtà nonlocale di alcuni fenomeni.

  8. Atomi, molecole e solidi esercizi risolti

    CERN Document Server

    Balzarotti, Adalberto; Fanfoni, Massimo

    2015-01-01

    Questo eserciziario nasce dalla raccolta di problemi d'esame assegnati agli studenti del corso di Struttura della Materia, che si colloca al confine fra il Corso Triennale e quello Magistrale. Alla fine di ciascun capitolo si trova un riepilogo ragionato di formule utili, e l’ultima parte del volume è dedicata alle unità di misura, alle formule di Meccanica Quantistica e alle tecniche per manipolare il momento angolare, i metodi variazionale e quello perturbativo elementare. Quasi tutti i problemi sono applicazioni della Meccanica Quantistica, anche se si utilizzano nozioni di Termodinamica, Meccanica ed Elettromagnetismo. I problemi di questo manuale differiscono rispetto a quelli che caratterizzano libri di Fisica Teorica (che possono anche essere astratti o rilevanti per l'Astrofisica o le Interazioni Deboli, soprattutto nel fatto che) soprattutto nel fatto che questi devono alla fine determinare dei valori realistici di misure standard su atomi molecole o solidi. In Fisica, la conoscenza di ogni argom...

  9. La narrazione dell’azione sociale: spunti dal Trattato di Vilfredo Pareto

    Directory of Open Access Journals (Sweden)

    Ilaria Riccioni

    2017-08-01

    Full Text Available La rilettura dei classici porta con sé sempre una duplice operazione: da una parte un ritorno a riflessioni, ritmi, storicità che spesso sembrano già superate; dall’altra la riscoperta delle origini di fenomeni contemporanei da punti di vista che ne delineano le interconnessioni profonde, non più visibili allo stato di avanzamento in cui le osserviamo oggi. Tale maggiore chiarezza è forse dovuta al fatto che ogni fenomeno nella sua fase aurorale è più chiaramente identificabile rispetto alle sue fasi successive, dove le caratteristiche primarie tendono a stemperarsi nelle cifre dominanti della contemporaneità, perdendosi nelle pratiche quotidiane che ne celano la provenienza. Se la sociologia è un processo di conoscenza della realtà dei fenomeni, il punto centrale della scienza sociale va distinto tra quelle scienze che schematizzano il reale in equazioni formali funzionali e funzionanti, il sistema economico, normativo, e le scienze sociali che si occupano della realtà e della sua complessità, che in quanto scienze si devono occupare non tanto di ciò che la realtà deve essere, bensì di ciò che la realtà è, di come si pone e di come manifesta i movimenti desideranti e profondi del vivere collettivo oltre il sistema che ne gestisce il funzionamento. Il punto che Pareto sembra scorgere, con estrema lucidità, è la necessità di ribaltare l’importanza della logica economica nell’organizzazione sociale da scienza che detta la realtà a scienza che propone uno schema di gestione di essa: da essa si cerca di dettare la realtà, ma l’economia, dal greco moderno Oikòs, Oikòsgeneia (casa e generazione, il termine utilizzato per definire l’unità famigliare non è di fatto “la realtà”, sembra dirci Pareto in più digressioni, bensì l’arte e la scienza della gestione di unità familiari e produttive. La realtà rimane in ombra e non può che essere “avvicinata” da una scienza che ne registri, ed eventualmente

  10. Una valigia caduta in mare: Jaume Serra Hunter e la "Scuola di Barcellona"

    Directory of Open Access Journals (Sweden)

    Nazzareno Fioraso

    2014-12-01

    Full Text Available Nella storiografia filosofica spagnola non esiste, probabilmente, una definizione ambigua e problematica come quella che riguarda la cosiddetta "Scuola di Barcellona". La tesi principale di questo articolo è che tale scuola non giunse mai a nascere, ma ne esistette soltanto una forma embrionale che non poté maturare perché, in conseguenza della situazione politica venutasi a creare con la guerra civile (1936-1939, i suoi componenti si dispersero nell'esilio. Ciò nonostante, è possibile riconoscere alcuni tratti comuni, seppur labili e (forse non sostanziali, nella diaspora degli intellettuali catalani che rendono possibile definirla, con le dovute cautele, "Scuola di Barcellona". Tali caratteristiche comuni si possono far risalire a colui che, in un certo senso, fu il fondatore della scuola, essendo il principale maestro delle nuove leve filosofiche della Catalogna all'inizio del XX secolo: Jaume Serra Hunter.

  11. La politica ottimale per il Mezzogiorno:un commento a Moro

    Directory of Open Access Journals (Sweden)

    Bert Jossa

    2002-09-01

    Full Text Available In uno scritto recente ho sostenuto la tesi che la politica ottimale per il Mezzogiorno non è il laissez faire, né l’intervento diretto dello stato nell’economia, ma un intervento pubblico, anche “massiccio”, realizzato mediante leggi generali e astratte, che per loro natura sono di tipo non discrezionale.La necessità di un intervento generalizzato a favore di una zona meno sviluppata si giustifica con l’esistenza delle “diseconomie esterne”, che frenano lo sviluppo di tutte le imprese che operano in quella zona. Ha destato, perciò, in me meraviglia leggere l’articolo scritto contemporaneamente da Beniamino Moro (2001 e pubblicato nel numero 215 di questa rivista, che raggiunge lo stesso risultato con argomentazioni di segno opposto.

  12. [Psychosocial factors of chronic hand eczema].

    Science.gov (United States)

    Li, Li; Liu, Panpan; Li, Ji; Xie, Hongfu; Kuang, Yehong; Li, Jie; Su, Juan; Zhu, Wu

    2017-02-28

    To study the psychosocial factors in patient with chronic hand eczema (CHE).
 Methods: Personality traits, emotional state, and quality of life of 240 patients with CHE and 221 normal control (NC) subjects were assessed by General Questionnaire, Eysenck Personality Questionnaire (EPQ), Self-Rating Depression Scale (SDS), Self-Rating Anxiety (SAS), and Eczema Quality of Life Scale (EQOLS).
 Results: In comparison, EPQ scores, scores of extraversion (E) factor in patients with CHE were significantly lower than those in NC subjects (P0.05). Patients with CHE had significantly higher scores in SDS and SAS compared with the NC subjects (Pemotional instability of introverts.Patients with CHE have a higher level of depression and anxiety, and exert a negative effect on their quality of life, which is related to severity of disease.

  13. Da Rabelais a Zola, da Erasmo a Camus: la psicologia del processo, le intuizioni dei grandi autori, la conferma delle scienze cognitive

    Directory of Open Access Journals (Sweden)

    Carlo Bona

    2012-06-01

    Full Text Available Rabelais, Zola, Camus hanno intuito che le sentenze spesso si reggono su complessi meccanismi psicologici, oltre che sulla razionalità giuridica. Ci si chiede se queste intuizioni trovino conferma nelle più recenti acquisizioni della psicologia della decisione e delle scienze cognitive. Per rispondere al quesito si analizzano passi del Gargantua e Pantagruele, di Thérèse Raquin, de Lo straniero, mettendoli a confronto con alcuni esperimenti condotti in ambito psicologico. Si dimostra come Rabelais abbia correttamente intuito quanto rilevino le euristiche nella decisione, come Zola abbia colto il ruolo delle aspettative nella percezione da parte dei testi, come Camus abbia descritto le distorsioni che si possono produrre nella fase narrativa della testimonianza. Se ne conclude che a volte la materia della giustizia si intende meglio esplorando le opere dei grandi autori che non, per dirla con Erasmo, ammucchiando glosse su glosse.

  14. La narrazione orale tra bambini ed adulti: da flusso continuo a vena carsica?

    Directory of Open Access Journals (Sweden)

    Milena Bernardi

    2010-02-01

    Full Text Available Con il segmento di ricerca che viene presentato nella sua prima fase si prende in esame l’ipotesi di un processo, in atto da tempo, di trasformazione e/o di declino della narrazione orale nel rapporto quotidiano tra adulti e bambini, inteso, in questo specifico contesto, come “spia” dei mutamenti degli stili educativi e degli interscambi tra famiglie ed operatori dei servizi in relazione all’alleanza educativa. La complessità dei filoni di studio che rimandano alla voce “narrazione” negli ambiti delle scienze umane esige la precisazione della curvatura “narrativa” scelta per la ricerca in corso: curvatura che appartiene all’epistemologia della letteratura per l’infanzia e della pedagogia della narrazione in quanto permette di imboccare la strada della ricerca pedagogica rivolta innanzi tutto ai significati che il narrare assume nella relazione educativa e poi ai modi ed alle forme della narrazione che coinvolgono l’infanzia. In un’epoca di grande vitalità e visibilità delle narrazioni, tra cui abbondano le produzioni scritte, illustrate, filmate per l’infanzia, sembra esserci una zona marginale e quasi sommersa della comunicazione narrante che rischia di sfumare in una sorta di oblio. E’ la zona della narrazione orale esperita in praesentia da bambini ed adulti insieme, tessuta con fili di parole che restituiscono senso all’intero arco delle esperienze, tentando di riordinare il disordine che spesso connota la realtà, interpretando, stabilendo connessioni, impregnando di quel senso i vissuti, i fatti, le relazioni, le cose e le parole stesse, ancora, nelle voci. Del rischio e delle conseguenze che possono derivare dalla sua mancanza si occupa questo contributo di ricerca che, dal punto di vista metodologico, si è avvalso e si avvale sia di analisi condotte sul corpus dei testi sia della raccolta di dati e informazioni tramite incontri condotti con la modalità del focus group, con educatrici e genitori.

  15. A Drosophila protein family implicated in pheromone perception is related to Tay-Sachs GM2-activator protein.

    Science.gov (United States)

    Starostina, Elena; Xu, Aiguo; Lin, Heping; Pikielny, Claudio W

    2009-01-02

    Low volatility, lipid-like cuticular hydrocarbon pheromones produced by Drosophila melanogaster females play an essential role in triggering and modulating mating behavior, but the chemosensory mechanisms involved remain poorly understood. Recently, we showed that the CheB42a protein, which is expressed in only 10 pheromone-sensing taste hairs on the front legs of males, modulates progression to late stages of male courtship behavior in response to female-specific cuticular hydrocarbons. Here we report that expression of all 12 genes in the CheB gene family is predominantly or exclusively gustatory-specific, and occurs in many different, often non-overlapping patterns. Only the Gr family of gustatory receptor genes displays a comparable variety of gustatory-specific expression patterns. Unlike Grs, however, expression of all but one CheB gene is sexually dimorphic. Like CheB42a, other CheBs may therefore function specifically in gustatory perception of pheromones. We also show that CheBs belong to the ML superfamily of lipid-binding proteins, and are most similar to human GM2-activator protein (GM2-AP). In particular, GM2-AP residues involved in ligand binding are conserved in CheBs but not in other ML proteins. Finally, CheB42a is specifically secreted into the inner lumen of pheromone-sensing taste hairs, where pheromones interact with membrane-bound receptors. We propose that CheB proteins interact directly with lipid-like Drosophila pheromones and modulate their detection by the gustatory signal transduction machinery. Furthermore, as loss of GM2-AP in Tay-Sachs disease prevents degradation of GM2 gangliosides and results in neurodegeneration, the function of CheBs in pheromone response may involve biochemical mechanisms critical for lipid metabolism in human neurons.

  16. A Drosophila Protein Family Implicated in Pheromone Perception Is Related to Tay-Sachs GM2-Activator Protein*

    Science.gov (United States)

    Starostina, Elena; Xu, Aiguo; Lin, Heping; Pikielny, Claudio W.

    2009-01-01

    Low volatility, lipid-like cuticular hydrocarbon pheromones produced by Drosophila melanogaster females play an essential role in triggering and modulating mating behavior, but the chemosensory mechanisms involved remain poorly understood. Recently, we showed that the CheB42a protein, which is expressed in only 10 pheromone-sensing taste hairs on the front legs of males, modulates progression to late stages of male courtship behavior in response to female-specific cuticular hydrocarbons. Here we report that expression of all 12 genes in the CheB gene family is predominantly or exclusively gustatory-specific, and occurs in many different, often non-overlapping patterns. Only the Gr family of gustatory receptor genes displays a comparable variety of gustatory-specific expression patterns. Unlike Grs, however, expression of all but one CheB gene is sexually dimorphic. Like CheB42a, other CheBs may therefore function specifically in gustatory perception of pheromones. We also show that CheBs belong to the ML superfamily of lipid-binding proteins, and are most similar to human GM2-activator protein (GM2-AP). In particular, GM2-AP residues involved in ligand binding are conserved in CheBs but not in other ML proteins. Finally, CheB42a is specifically secreted into the inner lumen of pheromone-sensing taste hairs, where pheromones interact with membrane-bound receptors. We propose that CheB proteins interact directly with lipid-like Drosophila pheromones and modulate their detection by the gustatory signal transduction machinery. Furthermore, as loss of GM2-AP in Tay-Sachs disease prevents degradation of GM2 gangliosides and results in neurodegeneration, the function of CheBs in pheromone response may involve biochemical mechanisms critical for lipid metabolism in human neurons. PMID:18952610

  17. Protecting patients with cardiovascular diseases from catastrophic health expenditure and impoverishment by health finance reform.

    Science.gov (United States)

    Sun, Jing; Liabsuetrakul, Tippawan; Fan, Yancun; McNeil, Edward

    2015-12-01

    To compare the incidences of catastrophic health expenditure (CHE) and impoverishment, the risk protection offered by two health financial reforms and to explore factors associated with CHE and impoverishment among patients with cardiovascular diseases (CVDs) in rural Inner Mongolia, China. Cross-sectional study conducted in 2014 in rural Inner Mongolia, China. Patients with CVDs aged over 18 years residing in the sample areas for at least one year were eligible. The definitions of CHE and impoverishment recommended by WHO were adopted. The protection of CHE and impoverishment was compared between the New Cooperative Medical Scheme (NCMS) alone and NCMS plus National Essential Medicines Scheme (NEMS) using the percentage change of incidences for CHE and impoverishment. Logistic regression was used to explore factors associated with CHE and impoverishment. The incidences of CHE and impoverishment under NCMS plus NEMS were 11.26% and 3.30%, respectively, which were lower than those under NCMS alone. The rates of protection were higher among households with patients with CVDs covered by NCMS plus NEMS (25.68% and 34.65%, respectively). NCMS plus NEMS could protect the poor households more from CHE but not impoverishment. NCMS plus NEMS protected more than one-fourth of households from CHE and more than one-third from impoverishment. NCMS plus NEMS was more effective at protecting households with patients with CVDs from CHE and impoverishment than NCMS alone. An integration of NCMS with NEMS should be expanded. However, further strategies to minimise catastrophic health expenditure after this health finance reform are still needed. © 2015 John Wiley & Sons Ltd.

  18. Kommunikationsschulung mittels "Standardisierter Eltern" im Fachbereich der Pädiatrie [Communication training using "standardised parents" in paediatrics

    Directory of Open Access Journals (Sweden)

    Hoffmann, Katja

    2007-05-01

    competence in handling difficult encounters with parents. Communication trainings should be integrated not only into the medical student education but also into post-graduate education curricula. [german] Einführung: Kommunikative Kompetenzen sind wesentlich für den ärztlichen Alltag. In der Literatur wird vielfach der Nutzen von Kommunikationsschulungen für Ärzte beschrieben, über gezielte Schulungen für den Fachbereich Pädiatrie finden sich nur vereinzelt Berichte. Die Besonderheit der pädiatrischen Versorgung besteht dabei im Wesentlichen darin, dass nicht nur die Kommunikation zum Patienten – dem Kind –, sondern auch zu dessen Eltern oder Bezugspersonen eine entscheidende Rolle spielt. Zur Überprüfung kommunikativer Fähigkeiten von Pädiatern können neben Selbsteinschätzungen auch Fremdeinschätzungen durch Eltern dienen.Methode: 28 Assistenzärzte (Interventionsgruppe n = 14; Kontrollgruppe n = 14 der Universitätsklinik für Kinder- und Jugendmedizin in Heidelberg nahmen an einer Kommunikationsschulung teil. Diese beinhaltete Übungsgespräche mit standardisierten Eltern und -Patienten (SP, Videoaufzeichnungen sowie Feedback von SPs, Peers und Supervisoren. Daten zur Selbsteinschätzung der eigenen kommunikativen Kompetenz wurden vor und nach der Schulung der Interventionsgruppe von allen Teilnehmern erhoben. Weiterhin wurde neun Wochen vor und neun Wochen nach Abschluss der Schulung eine Elternbefragung bei n = 248 Eltern durchgeführt, in der die Zufriedenheit mit dem Arztkontakt hinsichtlich der Arzt-Eltern Kommunikation erfasst wurde. Nach 6 Monaten schloss sich eine Nachbefragung bei den Teilnehmern zum Transfer in den Klinikalltag an.Ergebnis: Bei den Teilnehmern der Interventionsgruppe zeigte sich im Gegensatz zur Kontrollgruppe nach Abschluss der Schulung eine signifikante Steigerung der subjektiven Kompetenzeinschätzung in Bezug auf die kommunikativen Situationen, die speziell in der Schulung trainiert wurden. Die Fremdeinschätzung durch

  19. Comparison of 4 established DASH diet indexes: examining associations of index scores and colorectal cancer.

    Science.gov (United States)

    Miller, Paige E; Cross, Amanda J; Subar, Amy F; Krebs-Smith, Susan M; Park, Yikyung; Powell-Wiley, Tiffany; Hollenbeck, Albert; Reedy, Jill

    2013-09-01

    Multiple diet indexes have been developed to capture the Dietary Approaches to Stop Hypertension (DASH) dietary pattern and examine relations with health outcomes but have not been compared within the same study population to our knowledge. We compared 4 established DASH indexes and examined associations with colorectal cancer. Scores were generated from a food-frequency questionnaire in the NIH-AARP Diet and Health Study (n = 491,841). Separate indexes defined by Dixon (7 food groups, saturated fat, and alcohol), Mellen (9 nutrients), Fung (7 food groups and sodium), and Günther (8 food groups) were used. HRs and 95% CIs for colorectal cancer were generated by using Cox proportional hazard models. From 1995 through 2006, 6752 incident colorectal cancer cases were ascertained. In men, higher scores were associated with reduced colorectal cancer incidence by comparing highest to lowest quintiles for all indexes as follows: Dixon (HR: 0.77; 95% CI: 0.69, 0.87), Mellen (HR: 0.78; 95% CI: 0.71, 0.86), Fung (HR: 0.75; 95% CI: 0.68, 0.83), and Günther (HR: 0.81; 95% CI: 0.74, 0.90). Higher scores in women were inversely associated with colorectal cancer incidence by using methods defined by Mellen (HR: 0.79; 95% CI: 0.68, 0.91), Fung (HR: 0.84; 95% CI: 0.73, 0.96), and Günther (HR: 0.84; 95% CI: 0.73.0.97) but not Dixon (HR: 1.01; 95% CI: 0.80, 1.28). The consistency in findings, particularly in men, suggests that all indexes capture an underlying construct inherent in the DASH dietary pattern, although the specific index used can affect results.

  20. Comparison of 4 established DASH diet indexes: examining associations of index scores and colorectal cancer123

    Science.gov (United States)

    Cross, Amanda J; Subar, Amy F; Krebs-Smith, Susan M; Park, Yikyung; Powell-Wiley, Tiffany; Hollenbeck, Albert; Reedy, Jill

    2013-01-01

    Background: Multiple diet indexes have been developed to capture the Dietary Approaches to Stop Hypertension (DASH) dietary pattern and examine relations with health outcomes but have not been compared within the same study population to our knowledge. Objective: We compared 4 established DASH indexes and examined associations with colorectal cancer. Design: Scores were generated from a food-frequency questionnaire in the NIH-AARP Diet and Health Study (n = 491,841). Separate indexes defined by Dixon (7 food groups, saturated fat, and alcohol), Mellen (9 nutrients), Fung (7 food groups and sodium), and Günther (8 food groups) were used. HRs and 95% CIs for colorectal cancer were generated by using Cox proportional hazard models. Results: From 1995 through 2006, 6752 incident colorectal cancer cases were ascertained. In men, higher scores were associated with reduced colorectal cancer incidence by comparing highest to lowest quintiles for all indexes as follows: Dixon (HR: 0.77; 95% CI: 0.69, 0.87), Mellen (HR: 0.78; 95% CI: 0.71, 0.86), Fung (HR: 0.75; 95% CI: 0.68, 0.83), and Günther (HR: 0.81; 95% CI: 0.74, 0.90). Higher scores in women were inversely associated with colorectal cancer incidence by using methods defined by Mellen (HR: 0.79; 95% CI: 0.68, 0.91), Fung (HR: 0.84; 95% CI: 0.73, 0.96), and Günther (HR: 0.84; 95% CI: 0.73.0.97) but not Dixon (HR: 1.01; 95% CI: 0.80, 1.28). Conclusion: The consistency in findings, particularly in men, suggests that all indexes capture an underlying construct inherent in the DASH dietary pattern, although the specific index used can affect results. PMID:23864539