7 CFR 2.70 - Deputy Chief Economist.

Science.gov (United States)

2010-01-01

... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Chief Economist. 2.70 Section 2.70 Agriculture... GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Economist § 2.70 Deputy Chief Economist. Pursuant to § 2.29, the following delegation of authority is made by the Chief Economist to the...

50 CFR 270.21 - Petition of objection.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Petition of objection. 270.21 Section 270... § 270.21 Petition of objection. (a) Filing a petition. Any person issued a notice of assessment under... promotion plan by filing a written petition of objection with NMFS. Petitions of objection may be filed: (1...

32 CFR 270.19 - Reports to Congress.

Science.gov (United States)

2010-07-01

... 32 National Defense 2 2010-07-01 2010-07-01 false Reports to Congress. 270.19 Section 270.19... Reports to Congress § 270.19 Reports to Congress. Not later than September 23, 1998, the Commission will prepare and the Secretary will submit to Congress a report on the payment of claims under this part...

Infection by a Giant Virus (AaV Induces Widespread Physiological Reprogramming in Aureococcus anophagefferens CCMP1984 – A Harmful Bloom Algae

Directory of Open Access Journals (Sweden)

Mohammad Moniruzzaman

2018-04-01

Full Text Available While viruses with distinct phylogenetic origins and different nucleic acid types can infect and lyse eukaryotic phytoplankton, “giant” dsDNA viruses have been found to be associated with important ecological processes, including the collapse of algal blooms. However, the molecular aspects of giant virus–host interactions remain largely unknown. Aureococcus anophagefferens virus (AaV, a giant virus in the Mimiviridae clade, is known to play a critical role in regulating the fate of brown tide blooms caused by the pelagophyte Aureococcus anophagefferens. To understand the physiological response of A. anophagefferens CCMP1984 upon AaV infection, we studied the transcriptomic landscape of this host–virus pair over an entire infection cycle using a RNA-sequencing approach. A massive transcriptional response of the host was evident as early as 5 min post-infection, with modulation of specific processes likely related to both host defense mechanism(s and viral takeover of the cell. Infected Aureococcus showed a relative suppression of host-cell transcripts associated with photosynthesis, cytoskeleton formation, fatty acid, and carbohydrate biosynthesis. In contrast, host cell processes related to protein synthesis, polyamine biosynthesis, cellular respiration, transcription, and RNA processing were overrepresented compared to the healthy cultures at different stages of the infection cycle. A large number of redox active host-selenoproteins were overexpressed, which suggested that viral replication and assembly progresses in a highly oxidative environment. The majority (99.2% of annotated AaV genes were expressed at some point during the infection cycle and demonstrated a clear temporal–expression pattern and an increasing relative expression for the majority of the genes through the time course. We detected a putative early promoter motif for AaV, which was highly similar to the early promoter elements of two other Mimiviridae members

50 CFR 270.13 - Books, records and reports.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Books, records and reports. 270.13 Section 270.13 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... § 270.13 Books, records and reports. (a) The Council must submit to NMFS the following documents...

24 CFR 990.270 - Asset management.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Asset management. 990.270 Section... THE PUBLIC HOUSING OPERATING FUND PROGRAM Asset Management § 990.270 Asset management. As owners, PHAs have asset management responsibilities that are above and beyond property management activities. These...

15 CFR 270.105 - Duties of a Team.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Duties of a Team. 270.105 Section 270... OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE NATIONAL CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.105 Duties of a Team. (a) A Team's Lead...

12 CFR 270.3 - Governing principles.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Governing principles. 270.3 Section 270.3 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE OPEN MARKET OPERATIONS OF... Governing principles. As required by section 12A of the Federal Reserve Act, the time, character, and volume...

48 CFR 1336.270 - Special requirements for ship construction

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Special requirements for ship construction 1336.270 Section 1336.270 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 1336.270 Special...

48 CFR 209.270 - Aviation and ship critical safety items.

Science.gov (United States)

2010-10-01

... Requirements 209.270 Aviation and ship critical safety items. ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Aviation and ship critical safety items. 209.270 Section 209.270 Federal Acquisition Regulations System DEFENSE ACQUISITION...

17 CFR 270.8b-2 - Definitions.

Science.gov (United States)

2010-04-01

... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 270.8b-2 Section 270.8b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND...

Complete Sequence and Analysis of the Mitochondrial Genome of Hemiselmis andersenii CCMP644 (Cryptophyceae

Directory of Open Access Journals (Sweden)

Bowman Sharen

2008-05-01

Full Text Available Abstract Background Cryptophytes are an enigmatic group of unicellular eukaryotes with plastids derived by secondary (i.e., eukaryote-eukaryote endosymbiosis. Cryptophytes are unusual in that they possess four genomes–a host cell-derived nuclear and mitochondrial genome and an endosymbiont-derived plastid and 'nucleomorph' genome. The evolutionary origins of the host and endosymbiont components of cryptophyte algae are at present poorly understood. Thus far, a single complete mitochondrial genome sequence has been determined for the cryptophyte Rhodomonas salina. Here, the second complete mitochondrial genome of the cryptophyte alga Hemiselmis andersenii CCMP644 is presented. Results The H. andersenii mtDNA is 60,553 bp in size and encodes 30 structural RNAs and 36 protein-coding genes, all located on the same strand. A prominent feature of the genome is the presence of a ~20 Kbp long intergenic region comprised of numerous tandem and dispersed repeat units of between 22–336 bp. Adjacent to these repeats are 27 copies of palindromic sequences predicted to form stable DNA stem-loop structures. One such stem-loop is located near a GC-rich and GC-poor region and may have a regulatory function in replication or transcription. The H. andersenii mtDNA shares a number of features in common with the genome of the cryptophyte Rhodomonas salina, including general architecture, gene content, and the presence of a large repeat region. However, the H. andersenii mtDNA is devoid of inverted repeats and introns, which are present in R. salina. Comparative analyses of the suite of tRNAs encoded in the two genomes reveal that the H. andersenii mtDNA has lost or converted its original trnK(uuu gene and possesses a trnS-derived 'trnK(uuu', which appears unable to produce a functional tRNA. Mitochondrial protein coding gene phylogenies strongly support a variety of previously established eukaryotic groups, but fail to resolve the relationships among higher

18 CFR 270.501 - Publication of notice from jurisdictional agency.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Publication of notice from jurisdictional agency. 270.501 Section 270.501 Conservation of Power and Water Resources FEDERAL... to the extent the material is treated as confidential under § 270.506, at the offices of the...

PROPER MOTIONS OF THE HH 110/270 SYSTEM

International Nuclear Information System (INIS)

Kajdič, P.; Reipurth, B.; Walawender, J.; Raga, A. C.; Bally, J.

2012-01-01

We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the Hα and [S II] emission lines and the HST observations are made in the Hα line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.

PROPER MOTIONS OF THE HH 110/270 SYSTEM

Energy Technology Data Exchange (ETDEWEB)

Kajdic, P. [Instituto de Astronomia, UNAM, Mexico D.F. (Mexico); Reipurth, B.; Walawender, J. [Institute for Astronomy, University of Hawaii at Manoa, 640 N. A' ohoku Place, Hilo, HI 96720 (United States); Raga, A. C. [Instituto de Ciencias Nucleares, UNAM, Mexico D.F. (Mexico); Bally, J., E-mail: primoz@geofisica.unam.mx, E-mail: reipurth@IfA.Hawaii.Edu, E-mail: raga@nucleares.unam.mx, E-mail: John.Bally@casa.colorado.edu, E-mail: joshw@ifa.hawaii.edu [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States)

2012-05-15

We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the H{alpha} and [S II] emission lines and the HST observations are made in the H{alpha} line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.

48 CFR 809.270 - Qualified products for convenience/labor-saving foods.

Science.gov (United States)

2010-10-01

... convenience/labor-saving foods. 809.270 Section 809.270 Federal Acquisition Regulations System DEPARTMENT OF... 809.270 Qualified products for convenience/labor-saving foods. (a) Each VISN Nutrition and Food Service representative is authorized to establish a common VISN QPL for convenience and labor-saving foods...

17 CFR 270.3a-1 - Certain prima facie investment companies.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain prima facie investment companies. 270.3a-1 Section 270.3a-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-1 Certain prima facie investment...

A270 Demo Schokgolfdemping

NARCIS (Netherlands)

Netten, B.D.; Broek, T.H.A. van den; Blom, G.

2010-01-01

In februari 2010 zijn een aantal grootschalige experimenten uitgevoerd op de A270 tussen Helmond en Eindhoven. Het doel van deze experimenten is om de potentie van coöperatieve systemen te demonstreren voor het dempen van schokgolven en daarmee de mobiliteit op de Nederlandse snelwegen te kunnen

40 CFR 52.270 - Significant deterioration of air quality.

Science.gov (United States)

2010-07-01

... quality. 52.270 Section 52.270 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) With the exception of the areas listed in paragraph (b) of this section: (1... plan does not include approvable procedures for preventing the significant deterioration of air quality...

38 CFR 3.270 - Applicability of various dependency, income and estate regulations.

Science.gov (United States)

2010-07-01

... dependency, income and estate regulations. 3.270 Section 3.270 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation Dependency, Income and Estate § 3.270 Applicability of various dependency, income and estate regulations. (a...

15 CFR 270.2 - Definitions used in this part.

Science.gov (United States)

2010-01-01

... members, other NIST employees participating in the investigation, private sector experts, university... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions used in this part. 270.2... CONSTRUCTION SAFETY TEAMS General § 270.2 Definitions used in this part. The following definitions are...

15 CFR 270.102 - Conditions for establishment and deployment of a Team.

Science.gov (United States)

2010-01-01

... deployment of a Team. 270.102 Section 270.102 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.102 Conditions for establishment and deployment of a Team. (a) The Director may establish a Team for deployment...

21 CFR 137.270 - Self-rising white corn meal.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Self-rising white corn meal. 137.270 Section 137... Cereal Flours and Related Products § 137.270 Self-rising white corn meal. (a) Self-rising white corn meal is an intimate mixture of white corn meal, sodium bicarbonate, and one or both of the acid-reacting...

15 CFR 270.104 - Size and composition of a Team.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Size and composition of a Team. 270... NATIONAL INSTITUTE OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE NATIONAL CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.104 Size and composition of...

Symptomatic type 1 protein C deficiency caused by a de novo Ser270Leu mutation in the catalytic domain

DEFF Research Database (Denmark)

Lind, B; Koefoed, P; Thorsen, S

2001-01-01

the intracellular content of mutant and wild-type protein was similar. Northern blot analysis of total mRNA from transfected cells showed no reduction of the mutant protein C mRNA compared with wild-type protein C mRNA. Collectively, these results indicate that the Ser270Leu mutation in the affected family caused......Heterozygosity for a C8524T transition in the protein C gene converting Ser270(TCG) to Leu(TTG) in the protease domain was identified in a family with venous thrombosis. The mutation was associated with parallel reduction in plasma levels of protein C anticoagulant activity and protein C antigen......, which is consistent with a type 1 deficiency. Transient expression of mutant protein C cDNA in human kidney 293 cells and analysis of protein C antigen in culture media and cell lysates showed that the secretion of mutant protein compared with wild-type protein was reduced by at least 97% while...

Introduction and feasibility study of the HD-270 MLC

International Nuclear Information System (INIS)

Kim, Dae Young; Kim Won Taek; Lee, Hwa Jung; Lee, Kang Hyeok

2003-01-01

The multileaf collimator(MLC) has many advantages, but use of the MLC increased effective penumbra and isodose undulation in dose distribution compared with that of an alloy block. In this work, we introduced the HD-270 MLC, which can improve the above disadvantages of MLC, and reported its feasibility study. The HD-270 MLC is a technique which combines the use of the existing Siemens multileaf collimator(3D MLC) with patient translation perpendicular to the leaf plane. The technique produces a smoothed isodose distribution with the reduced isodose undulation and effective penumbra. To assess the efficacy of the HD-270 technique and determine the appropriate resolution, a polygonal shaped MLC field was made to produce field edge angles from 0 degree to 75 degree with a step of 15 degree. Each HD-270 group was generated according to the allowed resolution, i. e., 5, 3, and 2 mm. The experiment was carried out on Primus, a Siemens linear accelerator configured with HD-270 MLC. The total 60 MU of 6 MV photon beam was delivered to X-Omat film (Kodak, USA) at a SAD of 100 cm and 1.5 cm depth in solid water phantom. Exposed films were scanned by Lumiscan75(LUMISYS) and analyzed using RIT113 software (Radiological Imaging Technology Inc., USA). To test the mechanical accuracy of table movement, the transverse, longitudinal, and vertical positions were controlled by a consol with ±5 mm, ±4 mm, ±3 mm, and ±2 mm steps, and then measured using a dial gauge with an accuracy of 0.001 inch. During the experiments, the table loaded with about 50 Kg human phantom to simulate the real treatment situation. The effective penumbra and isodose undulation became larger with increase the resolution and field edge angle. The accuracy of the table movement on each direction is good within the ±1 mm. Clinical use of the MLC can be increased by using of the HD-270 MLC which complements to the disadvantages of the MLC.

12 CFR 270.2 - Definitions.

Science.gov (United States)

2010-01-01

... Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE OPEN MARKET OPERATIONS OF FEDERAL RESERVE BANKS Regulations Relating to Open Market Operations of Federal Reserve Banks § 270.2 Definitions... as to principal and interest by, any agency of the United States. (d) The term System Open Market...

15 CFR 270.106 - Conflicts of interest related to service on a Team.

Science.gov (United States)

2010-01-01

... service on a Team. 270.106 Section 270.106 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.106 Conflicts of interest related to service on a Team. (a) Team members who are not Federal employees will be...

Effects of irradiance and prey deprivation on growth, cell carbon and photosynthetic activity of the freshwater kleptoplastidic dinoflagellate Nusuttodinium (= Gymnodinium) aeruginosum (Dinophyceae)

DEFF Research Database (Denmark)

Drumm, Kirstine; Liebst-Olsen, Mette; Daugbjerg, Niels

2017-01-01

not explain the observed growth rates at high irradiances. Cultures of N. aeruginosum subjected to prey starvation were able to survive for at least 27 days in the light. The sequestered chloroplasts maintained their photosynthetic activity during the entire period of starvation, during which the population......The freshwater dinoflagellate Nusuttodinium aeruginosum lacks permanent chloroplasts. Rather it sequesters chloroplasts as well as other cell organelles, like mitochondria and nuclei, from ingested cryptophyte prey. In the present study, growth rates, cell production and photosynthesis were...... measured at seven irradiances, ranging from 10 to 140 µmol photons m-2s-1, when fed the cryptophyte Chroomonas sp. Growth rates were positively influenced by irradiance and increased from 0.025 d-1 at 10 µmol photons m-2s-1 to maximum growth rates of ~0.3 d-1 at irradiances ≥ 40 µmol photons m-2s-1...

17 CFR 270.22e-3 - Exemption for liquidation of money market funds.

Science.gov (United States)

2010-04-01

... money market funds. 270.22e-3 Section 270.22e-3 Commodity and Securities Exchanges SECURITIES AND... for liquidation of money market funds. (a) Exemption. A registered open-end management investment company or series thereof (“fund”) that is regulated as a money market fund under § 270.2a-7 is exempt...

18 CFR 284.270 - Reporting requirements.

Science.gov (United States)

2010-04-01

... AUTHORITIES Emergency Natural Gas Sale, Transportation, and Exchange Transactions § 284.270 Reporting... transportation (excluding exchanges). Within 48 hours after deliveries commence in an emergency natural gas... natural gas commences, the initial recipient of the exchange volumes must notify the Commission by...

18 CFR 270.302 - Occluded natural gas produced from coal seams.

Science.gov (United States)

2010-04-01

... produced from coal seams. 270.302 Section 270.302 Conservation of Power and Water Resources FEDERAL ENERGY... produced from coal seams. A person seeking a determination that natural gas is occluded natural gas produced from coal seams must file an application with the jurisdictional agency which contains the...

17 CFR 270.24b-2 - Filing copies of sales literature.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Filing copies of sales literature. 270.24b-2 Section 270.24b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. Copies of material filed with the Commission for the sole purpose of complying with section 24(b...

48 CFR 552.270-27 - Integrated Agreement.

Science.gov (United States)

2010-10-01

... agreement, express or implied, shall be admissible to contradict the provisions of the Lease. (End of clause) ... CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.270-27...

8 CFR 270.2 - Enforcement procedures.

Science.gov (United States)

2010-01-01

... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT FRAUD § 270.2 Enforcement procedures. (a) Procedures for the filing of complaints. Any person or entity... charges for document fraud committed by refugees at the time of entry. The Service shall not issue a...

Reflux and Belching After 270 Degree Versus 360 Degree Laparoscopic Posterior Fundoplication

NARCIS (Netherlands)

Broeders, Joris A.; Bredenoord, Albert J.; Hazebroek, Eric J.; Broeders, Ivo A.; Gooszen, Hein G.; Smout, André J.

2012-01-01

Objective: To investigate differences in effects of 270 degrees (270 degrees LPF) and 360 degrees laparoscopic posterior fundoplication (360 degrees LPF) on reflux characteristics and belching. Background: Three hundred sixty degrees LPF greatly reduces the ability of the stomach to vent ingested

40 CFR 158.270 - Experimental use permit data requirements for residue chemistry.

Science.gov (United States)

2010-07-01

... requirements for residue chemistry. 158.270 Section 158.270 Protection of Environment ENVIRONMENTAL PROTECTION... Experimental use permit data requirements for residue chemistry. All residue chemistry data, as described in... section 408(r) is sought. Residue chemistry data are not required for an experimental use permit issued on...

17 CFR 270.22c-1 - Pricing of redeemable securities for distribution, redemption and repurchase.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redeemable securities for distribution, redemption and repurchase. 270.22c-1 Section 270.22c-1 Commodity and Securities... 1940 § 270.22c-1 Pricing of redeemable securities for distribution, redemption and repurchase. (a) No...

17 CFR 270.3c-2 - Definition of beneficial ownership in small business investment companies.

Science.gov (United States)

2010-04-01

... 1940 § 270.3c-2 Definition of beneficial ownership in small business investment companies. For the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial ownership in small business investment companies. 270.3c-2 Section 270.3c-2 Commodity and Securities...

17 CFR 270.6b-1 - Exemption of employees' securities company pending determination of application.

Science.gov (United States)

2010-04-01

...' securities company pending determination of application. 270.6b-1 Section 270.6b-1 Commodity and Securities... 1940 § 270.6b-1 Exemption of employees' securities company pending determination of application. Any... Act (54 Stat. 801; 15 U.S.C. 80a-6) shall be exempt, pending final determination of such application...

48 CFR 514.270-7 - Guidelines for using the price list method.

Science.gov (United States)

2010-10-01

... on knowledge of the supplies or services and previous contract prices. (d) First time use for an item... price list method. 514.270-7 Section 514.270-7 Federal Acquisition Regulations System GENERAL SERVICES... for using the price list method. (a) General. The price list method helps avoid unbalanced bidding...

48 CFR 352.270-2 - Indian preference.

Science.gov (United States)

2010-10-01

...-2 Section 352.270-2 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CLAUSES AND... regulations), sex, religion, or Tribal affiliation. To the extent feasible and consistent with the efficient... to existing laws and regulations), sex, religion, or Tribal affiliation. The Contractor also agrees...

17 CFR 270.17g-1 - Bonding of officers and employees of registered management investment companies.

Science.gov (United States)

2010-04-01

... employees of registered management investment companies. 270.17g-1 Section 270.17g-1 Commodity and... ACT OF 1940 § 270.17g-1 Bonding of officers and employees of registered management investment companies. (a) Each registered management investment company shall provide and maintain a bond which shall...

Event-related potential N270 as an index of social information conflict in explicit processing.

Science.gov (United States)

Wang, Pei; Tan, Chen-Hao; Li, Yu; Zhang, Qin; Wang, Yi-Bo; Luo, Jun-Long

2018-01-01

As N270 has been widely shown to be sensitive to nonsocial information conflict, the present study investigated whether social information conflict can elicit increased N270 in either explicit or implicit processing conditions. Gender stereotype-related picture-word pairs and picture-word pairs in specific colors were used as social and nonsocial information, respectively. Participants performed an explicit task based on the S1-S2 paradigm in Study 1, and both social and nonsocial information conditions elicited larger N270 than the no-conflict condition. In Study 2, participants performed a word judgment task that was modified from the S1-S2 paradigm of Study 1. However, neither social information nor nonsocial information elicited larger N270 within the conflict condition. Social trials generally elicited a more negative ERP waveform than nonsocial trials overall. These findings suggest that N270 may reflect the processing of social information conflict only in explicit conditions and also that the cognitive basis of N270 is thus a general but explicit processing of working memory representation conflict. Copyright © 2017. Published by Elsevier B.V.

20 CFR 404.270 - Cost-of-living increases.

Science.gov (United States)

2010-04-01

... INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.270 Cost-of-living... rises in the cost of living. These automatic increases also apply to other benefit amounts, as described...

17 CFR 270.12b-1 - Distribution of shares by registered open-end management investment company.

Science.gov (United States)

2010-04-01

... registered open-end management investment company. 270.12b-1 Section 270.12b-1 Commodity and Securities... 1940 § 270.12b-1 Distribution of shares by registered open-end management investment company. (a)(1... the printing and mailing of sales literature; (b) A registered, open-end management investment company...

50 CFR 270.11 - Responsibilities of NMFS.

Science.gov (United States)

2010-10-01

... ADMINISTRATION, DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS... part 270 and other applicable law, and approve or disapprove, marketing and promotion plans and budgets... disapproval of a marketing and promotion plan or budget, together with reasons for such disapproval; (3) Issue...

48 CFR 719.270 - Small business policies.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business policies... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.270 Small business policies. (a) In keeping with... United States small business to participate equitably in the furnishing of supplies and services for...

Distinctive Architecture of the Chloroplast Genome in the Chlorodendrophycean Green Algae Scherffelia dubia and Tetraselmis sp. CCMP 881.

Science.gov (United States)

Turmel, Monique; de Cambiaire, Jean-Charles; Otis, Christian; Lemieux, Claude

2016-01-01

The Chlorodendrophyceae is a small class of green algae belonging to the core Chlorophyta, an assemblage that also comprises the Pedinophyceae, Trebouxiophyceae, Ulvophyceae and Chlorophyceae. Here we describe for the first time the chloroplast genomes of chlorodendrophycean algae (Scherffelia dubia, 137,161 bp; Tetraselmis sp. CCMP 881, 100,264 bp). Characterized by a very small single-copy (SSC) region devoid of any gene and an unusually large inverted repeat (IR), the quadripartite structures of the Scherffelia and Tetraselmis genomes are unique among all core chlorophytes examined thus far. The lack of genes in the SSC region is offset by the rich and atypical gene complement of the IR, which includes genes from the SSC and large single-copy regions of prasinophyte and streptophyte chloroplast genomes having retained an ancestral quadripartite structure. Remarkably, seven of the atypical IR-encoded genes have also been observed in the IRs of pedinophycean and trebouxiophycean chloroplast genomes, suggesting that they were already present in the IR of the common ancestor of all core chlorophytes. Considering that the relationships among the main lineages of the core Chlorophyta are still unresolved, we evaluated the impact of including the Chlorodendrophyceae in chloroplast phylogenomic analyses. The trees we inferred using data sets of 79 and 108 genes from 71 chlorophytes indicate that the Chlorodendrophyceae is a deep-diverging lineage of the core Chlorophyta, although the placement of this class relative to the Pedinophyceae remains ambiguous. Interestingly, some of our phylogenomic trees together with our comparative analysis of gene order data support the monophyly of the Trebouxiophyceae, thus offering further evidence that the previously observed affiliation between the Chlorellales and Pedinophyceae is the result of systematic errors in phylogenetic reconstruction.

48 CFR 536.270 - Exercise of options.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Exercise of options. 536... Construction 536.270 Exercise of options. (a) If exercising an option, notify the contractor, in writing, within the time period specified in the contract. (b) Exercise options only after determining that all...

50 CFR 270.16 - Deposit of funds.

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS § 270.16... approved marketing plan and budget, funds collected through assessments authorized by the Act must be deposited in any interest-bearing account or certificate of deposit of a bank that is a member of the...

48 CFR 552.270-26 - No Waiver.

Science.gov (United States)

2010-10-01

... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.270-26 No Waiver... remedy consequent upon a breach thereof, and no acceptance of full or partial rent or other performance by either party during the continuance of any such breach shall constitute a waiver of any such...

Phenotype abnormality: 270 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 270 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u775i elongated hypocotyl in environment... of light regimen in environment of light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u34i hypocotyl ... elongated ...

17 CFR 270.17f-2 - Custody of investments by registered management investment company.

Science.gov (United States)

2010-04-01

... registered management investment company. 270.17f-2 Section 270.17f-2 Commodity and Securities Exchanges....17f-2 Custody of investments by registered management investment company. (a) The securities and similar investments of a registered management investment company may be maintained in the custody of such...

17 CFR 270.0-11 - Customer identification programs.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer identification... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.0-11 Customer identification programs... implementing regulation at 31 CFR 103.131, which requires a customer identification program to be implemented...

40 CFR 270.62 - Hazardous waste incinerator permits.

Science.gov (United States)

2010-07-01

... WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM Special Forms of Permits § 270.62 Hazardous waste incinerator permits. When an owner or operator of a hazardous waste... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Hazardous waste incinerator permits...

48 CFR 2852.102-270 - Incorporation in full text.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Incorporation in full text... 2852.102-270 Incorporation in full text. JAR provisions or clauses shall be incorporated in solicitations and contracts in full text. ...

40 CFR 270.3 - Considerations under Federal law.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Considerations under Federal law. 270... Considerations under Federal law. The following is a list of Federal laws that may apply to the issuance of... applicable law requires consideration or adoption of particular permit conditions or requires the denial of a...

17 CFR 270.30b1-1 - Semi-annual report for registered management investment companies.

Science.gov (United States)

2010-04-01

... registered management investment companies. 270.30b1-1 Section 270.30b1-1 Commodity and Securities Exchanges....30b1-1 Semi-annual report for registered management investment companies. Every registered management... management investment company that has filed a registration statement with the Commission registering its...

17 CFR 270.6c-10 - Exemption for certain open-end management investment companies to impose deferred sales loads.

Science.gov (United States)

2010-04-01

... management investment companies to impose deferred sales loads. 270.6c-10 Section 270.6c-10 Commodity and... ACT OF 1940 § 270.6c-10 Exemption for certain open-end management investment companies to impose... purposes of this section: (1) Company means a registered open-end management investment company, other than...

40 CFR 270.65 - Research, development, and demonstration permits.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Research, development, and... Special Forms of Permits § 270.65 Research, development, and demonstration permits. (a) The Administrator may issue a research, development, and demonstration permit for any hazardous waste treatment facility...

48 CFR 218.270 - Head of contracting activity determinations.

Science.gov (United States)

2010-10-01

... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 218.270 Head of contracting activity determinations. For contract... contracting activity,” as defined in FAR 2.101, in the following locations: (a) FAR 2.101: (1) Definition of...

17 CFR 270.19a-1 - Written statement to accompany dividend payments by management companies.

Science.gov (United States)

2010-04-01

... that an open-end company may treat as a separate source its net profits from such sales during its... specify the sources from which the remainder was paid. Every company which in any fiscal year elects to... dividend payments by management companies. 270.19a-1 Section 270.19a-1 Commodity and Securities Exchanges...

40 CFR 270.22 - Specific part B information requirements for boilers and industrial furnaces burning hazardous...

Science.gov (United States)

2010-07-01

... requirements for boilers and industrial furnaces burning hazardous waste. 270.22 Section 270.22 Protection of... requirements for boilers and industrial furnaces burning hazardous waste. When an owner or operator of a cement kiln, lightweight aggregate kiln, solid fuel boiler, liquid fuel boiler, or hydrochloric acid...

Automatic whole core depletion and criticality calculations by MCNPX 2.7.0

International Nuclear Information System (INIS)

Kalcheva, S.; Koonen, E.

2012-01-01

Different approaches to perform automatic whole core criticality and depletion calculations in a research reactor using MCNPX 2.7.0 are presented. An approximate method is to use the existing symmetries of the burned fuel material distribution in the core, i.e., the axial, radial and azimuth symmetries around the core center, in order to significantly reduce the computation time. In this case it is not necessary to give a unique material number to each burn up cell. Cells having similar burn up and power, achieved during similar irradiation history at same initial fuel composition, will experience similar composition evolution and can therefore be given the same material number. To study the impact of the number of unique burn up materials on the computation time and utilized RAM memory, several MCNPX models have been developed. The paper discusses the accuracy of the model on comparison with measurements of BR2 operation cycles in function of the number of unique burn up materials and the impact of the used Q-value (MeV/fission) of the recoverable fission energy. (authors)

17 CFR 270.3a-2 - Transient investment companies.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Transient investment companies... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-2 Transient investment companies... which an issuer owns or proposes to acquire investment securities (as defined in section 3(a) of the Act...

40 CFR 270.21 - Specific part B information requirements for landfills.

Science.gov (United States)

2010-07-01

... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... and post-closure plans submitted under § 270.14(b)(13). (f) If ignitable or reactive wastes will be...

A tale of two mixotrophic chrysophytes: Insights into the metabolisms of two Ochromonas species (Chrysophyceae through a comparison of gene expression.

Directory of Open Access Journals (Sweden)

Alle A Y Lie

Full Text Available Ochromonas spp. strains CCMP1393 and BG-1 are phagotrophic phytoflagellates with different nutritional strategies. Strain CCMP1393 is an obligate phototroph while strain BG-1 readily grows in continuous darkness in the presence of bacterial prey. Growth and gene expression of strain CCMP1393 were investigated under conditions allowing phagotrophic, mixotrophic, or phototrophic nutrition. The availability of light and bacterial prey led to the differential expression of 42% or 45-59% of all genes, respectively. Data from strain CCMP1393 were compared to those from a study conducted previously on strain BG-1, and revealed notable differences in carbon and nitrogen metabolism between the 2 congeners under similar environmental conditions. Strain BG-1 utilized bacterial carbon and amino acids through glycolysis and the tricarboxylic acid cycle, while downregulating light harvesting and carbon fixation in the Calvin cycle when both light and bacteria were available. In contrast, the upregulation of genes related to photosynthesis, light harvesting, chlorophyll synthesis, and carbon fixation in the presence of light and prey for strain CCMP1393 implied that this species is more phototrophic than strain BG-1, and that phagotrophy may have enhanced phototrophy. Cellular chlorophyll a content was also significantly higher in strain CCMP1393 supplied with bacteria compared to those without prey. Our results thus point to very different physiological strategies for mixotrophic nutrition in these closely related chrysophyte species.

Raising the profile of Gender and Generation: The role of Climate Change Media Partnership

Energy Technology Data Exchange (ETDEWEB)

Herzhoff, Natalie; Shanahan, Mike

2010-07-01

The paper details the initiatives taken by the Climate Change Media Partnership to strengthen journalists' understanding of the importance of gender and generation when reporting on climate change. Journalists from the world's wealthiest countries were well represented at the December 2007 UN Framework Convention on Climate change in Bali. In contrast only 9 percent of the journalists at the conference were from non-industrialised countries and there was zero media representation for nearly the entire UN list of 50 Least Developed Countries. To address this gap IIED Panos and Internews formed the Climate Change Media Partnership (CCMP). This initiative brought 37 journalists from developing countries to Bali and provided them with a 10 day programme of support. Since 2007, the CCMP has run three programmes each supporting nearly 40 journalists from developing nations to attend the UN climate change negotiations in Bali, Poznan and Copenhagen. Among the many refinements that the CCMP team has made to its programme over the years, is a greater focus on gender and generation. CCMP research has shown that although most male and female CCMP fellows were likely to acknowledge a need to include women's views in their reports, they lacked the resources, tools and knowledge to do so. In addition there is a disparate level of awareness amongst the CCMP journalists about how men and women of all ages are affected by climate change in different ways and about the need to report these differences. Through its work the CCMP identified several key areas that can improve the way that climate change, gender and generation are covered by the media.

Raising the profile of Gender and Generation: The role of Climate Change Media Partnership

Energy Technology Data Exchange (ETDEWEB)

Herzhoff, Natalie; Shanahan, Mike

2010-07-01

The paper details the initiatives taken by the Climate Change Media Partnership to strengthen journalists' understanding of the importance of gender and generation when reporting on climate change. Journalists from the world's wealthiest countries were well represented at the December 2007 UN Framework Convention on Climate change in Bali. In contrast only 9 percent of the journalists at the conference were from non-industrialised countries and there was zero media representation for nearly the entire UN list of 50 Least Developed Countries. To address this gap IIED Panos and Internews formed the Climate Change Media Partnership (CCMP). This initiative brought 37 journalists from developing countries to Bali and provided them with a 10 day programme of support. Since 2007, the CCMP has run three programmes each supporting nearly 40 journalists from developing nations to attend the UN climate change negotiations in Bali, Poznan and Copenhagen. Among the many refinements that the CCMP team has made to its programme over the years, is a greater focus on gender and generation. CCMP research has shown that although most male and female CCMP fellows were likely to acknowledge a need to include women's views in their reports, they lacked the resources, tools and knowledge to do so. In addition there is a disparate level of awareness amongst the CCMP journalists about how men and women of all ages are affected by climate change in different ways and about the need to report these differences. Through its work the CCMP identified several key areas that can improve the way that climate change, gender and generation are covered by the media.

48 CFR 538.270 - Evaluation of multiple award schedule (MAS) offers.

Science.gov (United States)

2010-10-01

... SERVICES ADMINISTRATION SPECIAL CATEGORIES OF CONTRACTING FEDERAL SUPPLY SCHEDULE CONTRACTING Establishing and Administering Federal Supply Schedules 538.270 Evaluation of multiple award schedule (MAS) offers... determining the Government's price negotiation objectives, consider the following factors: (1) Aggregate...

18 CFR 270.303 - Natural gas produced from Devonian shale.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Natural gas produced... DETERMINATION PROCEDURES Requirements for Filings With Jurisdictional Agencies § 270.303 Natural gas produced from Devonian shale. A person seeking a determination that natural gas is produced from Devonian shale...

17 CFR 270.24b-3 - Sales literature deemed filed.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed filed... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.24b-3 Sales literature deemed filed. Any advertisement, pamphlet, circular, form letter or other sales literature addressed to or intended...

N270 sensitivity to conflict strength and working memory: A combined ERP and sLORETA study.

Science.gov (United States)

Scannella, Sébastien; Pariente, Jérémie; De Boissezon, Xavier; Castel-Lacanal, Evelyne; Chauveau, Nicolas; Causse, Mickaël; Dehais, Frédéric; Pastor, Josette

2016-01-15

The event-related potential N270 component is known to be an electrophysiological marker of the supramodal conflict processing. However little is know about the factors that may modulate its amplitude. In particular, among all studies that have investigated the N270, little or no control of the conflict strength and of the load in working memory have been done leaving a lack in the understanding of this component. We designed a spatial audiovisual conflict task with simultaneous target and cross-modal distractor to evaluate the N270 sensitivity to the conflict strength (i.e., visual target with auditory distractor or auditory target with visual distractor) and the load in working memory (goal task maintenance with frequent change in the target modality). In a first session, participants had to focus on one modality for the target position to be considered (left-hand or right-hand) while the distractor could be at the same side (compatible) or at opposite side (incompatible). In a second session, we used the same set of stimuli as in the first session with an additional distinct auditory signal that clued the participants to frequently switch between the auditory and the visual targets. We found that (1) reaction times and N270 amplitudes for conflicting situations were larger within the auditory target condition compared to the visual one, (2) the increase in target maintenance effort led to equivalent increase of both reaction times and N270 amplitudes within all conditions and (3) the right dorsolateral prefrontal cortex current density was higher for both conflicting and active maintenance of the target situations. These results provide new evidence that the N270 component is an electrophysiological marker of the supramodal conflict processing that is sensitive to the conflict strength and that conflict processing and active maintenance of the task goal are two functions of a common executive attention system. Copyright © 2015 Elsevier B.V. All rights reserved.

20 CFR 645.270 - What procedures are there to ensure that currently employed workers may file grievances regarding...

Science.gov (United States)

2010-04-01

... gender discrimination? 645.270 Section 645.270 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION... regarding displacement, health and safety standards and gender discrimination? (a) The State shall establish...) Participants alleging gender discrimination by WtW programs that are not part of the One-Stop system may file a...

17 CFR 270.17a-8 - Mergers of affiliated companies.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Mergers of affiliated... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.17a-8 Mergers of affiliated companies. (a) Exemption of affiliated mergers. A Merger of a registered investment company (or a series thereof...

17 CFR 270.8b-16 - Amendments to registration statement.

Science.gov (United States)

2010-04-01

... company's investment objectives or policies (described in Item 8.2 of Form N-2) that have not been... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.8b-16 Amendments to registration statement. (a) Every registered management investment company which is required to file a semi-annual report...

17 CFR 270.3a-3 - Certain investment companies owned by companies which are not investment companies.

Science.gov (United States)

2010-04-01

... the definition of the term “investment company” by section 3(b)(1) or 3(b)(2) of the Act (15 U.S.C... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain investment companies owned by companies which are not investment companies. 270.3a-3 Section 270.3a-3 Commodity and...

17 CFR 270.22e-2 - Pricing of redemption requests in accordance with Rule 22c-1.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redemption requests in accordance with Rule 22c-1. 270.22e-2 Section 270.22e-2 Commodity and Securities Exchanges....22e-2 Pricing of redemption requests in accordance with Rule 22c-1. An investment company shall not be...

MODELING SUPERSONIC-JET DEFLECTION IN THE HERBIG–HARO 110-270 SYSTEM WITH HIGH-POWER LASERS

International Nuclear Information System (INIS)

Yuan, Dawei; Li, Yutong; Lu, Xin; Yin, Chuanlei; Su, Luning; Liao, Guoqian; Zhang, Jie; Wu, Junfeng; Wang, Lifeng; He, Xiantu; Zhong, Jiayong; Wei, Huigang; Zhang, Kai; Han, Bo; Zhao, Gang; Jiang, Shaoen; Du, Kai; Ding, Yongkun; Zhu, Jianqiang

2015-01-01

Herbig–Haro (HH) objects associated with newly born stars are typically characterized by two high Mach number jets ejected in opposite directions. However, HH 110 appears to only have a single jet instead of two. Recently, Kajdi et al. measured the proper motions of knots in the whole system and noted that HH 110 is a continuation of the nearby HH 270. It has been proved that the HH 270 collides with the surrounding mediums and is deflected by 58°, reshaping itself as HH 110. Although the scales of the astrophysical objects are very different from the plasmas created in the laboratory, similarity criteria of physical processes allow us to simulate the jet deflection in the HH 110/270 system in the laboratory with high power lasers. A controllable and repeatable laboratory experiment could give us insight into the deflection behavior. Here we show a well downscaled experiment in which a laser-produced supersonic-jet is deflected by 55° when colliding with a nearby orthogonal side-flow. We also present a two-dimensional hydrodynamic simulation with the Euler program, LARED-S, to reproduce the deflection. Both are in good agreement. Our results show that the large deflection angle formed in the HH 110/270 system is probably due to the ram pressure from a flow–flow collision model

Effects of irradiance and prey deprivation on growth, cell carbon and photosynthetic activity of the freshwater kleptoplastidic dinoflagellate Nusuttodinium (= Gymnodinium) aeruginosum (Dinophyceae).

Science.gov (United States)

Drumm, Kirstine; Liebst-Olsen, Mette; Daugbjerg, Niels; Moestrup, Øjvind; Hansen, Per Juel

2017-01-01

The freshwater dinoflagellate Nusuttodinium aeruginosum lacks permanent chloroplasts. Rather it sequesters chloroplasts as well as other cell organelles, like mitochondria and nuclei, from ingested cryptophyte prey. In the present study, growth rates, cell production and photosynthesis were measured at seven irradiances, ranging from 10 to 140 μmol photons m-2s-1, when fed the cryptophyte Chroomonas sp. Growth rates were positively influenced by irradiance and increased from 0.025 d-1 at 10 μmol photons m-2s-1 to maximum growth rates of ~0.3 d-1 at irradiances ≥ 40 μmol photons m-2s-1. Similarly, photosynthesis ranged from 1.84 to 36.9 pg C cell-1 h-1 at 10 and 140 μmol photons m-2s-1, respectively. The highest rates of photosynthesis in N. aeruginosum only corresponded to ~25% of its own cell carbon content and estimated biomass production. The measured rates of photosynthesis could not explain the observed growth rates at high irradiances. Cultures of N. aeruginosum subjected to prey starvation were able to survive for at least 27 days in the light. The sequestered chloroplasts maintained their photosynthetic activity during the entire period of starvation, during which the population underwent 4 cell divisions. This indicates that N. aeruginosum has some control of the chloroplasts, which may be able to replicate. In conclusion, N. aeruginosum seems to be in an early stage of chloroplast acquisition with some control of its ingested chloroplasts.

17 CFR 270.18f-2 - Fair and equitable treatment for holders of each class or series of stock of series investment...

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fair and equitable treatment for holders of each class or series of stock of series investment companies. 270.18f-2 Section 270.18f... or series of stock of series investment companies. (a) For purposes of this § 270.18f-2 a series...

43 CFR 30.270 - How will the hearing be conducted?

Science.gov (United States)

2010-10-01

... PROCEDURES Tribal Purchase of Interests Under Special Statutes § 30.270 How will the hearing be conducted? (a) At the hearing, each party challenging the tribe's claim to purchase the interests in question or the...) On conclusion of the hearing, the judge will issue a decision that determines all of the issues...

40 CFR 415.270 - Applicability; description of the borax production subcategory.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the borax... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS INORGANIC CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Borax Production Subcategory § 415.270 Applicability; description of the borax production subcategory. The...

Radiation effects on the species-specific cell sorting-out of the cellular slime molds

International Nuclear Information System (INIS)

Satow, Takashi

1976-01-01

The effects of gamma-rays irradiation on the development and the species-specific cell sorting-out of the cellular slime mold, Dictyostelium discoideum, were investigated. The interphase amoebae of the organism showed extremely resistant to 60 Co gamma-rays. The percentage of non-stained cells estimated by dye staining method was more than 90% at the dose of 270 kR. The amoebae irradiated at 270 kR performed the development similar in the most respects to that of the un-irradiated amoebae except that a little portion of the fruiting bodies were abnormal and that the appearance of aggregates and slugs delayed 3 hrs. The ability of the species-specific cell sorting-out was not affected by gamma-rays irradiation at 270 kR. (auth.)

Stigmastadiene and specific extitntion (270 nm) to evaluate the presence of refined oils in virgin olive oil commercialized in Brazil

OpenAIRE

Aued-Pimentel,Sabria; Silva,Simone Alves Da; Takemoto,Emy; Cano,Cristiane Bonaldi

2013-01-01

The increased marketing of olive oil in Brazil has intensified legal requirements to ensure regulation of this product. The measurement of the specific extinction at 270 nm (E 270) and content of stigmastadiene can be used to assess the presence of refined oils in virgin olive oil. During the vegetable oil refining process, compounds with conjugated double bonds are generated from unsaturated fatty acids that absorb at 270 nm and sterols, such as stigmasta-3,5-diene. To compare these paramete...

The Road Side Unit for the A270 Test Site

NARCIS (Netherlands)

Passchier, I.; Driessen, B.J.F.; Heijligers, B.M.R.; Netten, B.D.; Schackmann, P.P.M.

2011-01-01

The design and implementation of the Road Side Unit for the A270 Test Site is presented. It consists of a sensor platform and V2I communication platform with full coverage of the test site. A service platform enables applications to make use of these facilities. The RSU will be used both for the

Grazing-Activated Production of Dimethyl Sulfide (DMS) by two clones of Emiliania huxleyi

Science.gov (United States)

Wolfe, Gordon V.; Steinke, Michael

1996-01-01

Emiliania huxleyi clones CCMP 370 and CCMP 373 produced similar amounts of dimethylsulfoniopropionate (DMSP) during axenic exponential growth, averaging 109 mM internal DMSP. Both clones had detectable DMSP lyase activity, as measured by production of dimethyl sulfide (DMS) during in vitro assays of crude cell preparations, but activities and conditions differed considerably between clones. Clone 373 had high activity; clone 370 had low activity and required chloride. For both strains, enzyme activity per cell was constant during exponential growth, but little DMS was produced by healthy cells. Rather, DMS production was activated when cells were subjected to physical or chemical stresses that caused cell lysis. We propose that DMSP lyase and DMSP are segregated within these cells and re-action only under conditions that result in cell stress or damage. Such activation occurs during microzooplankton grazing. When these clones were grazed by the dinoflagellate Oxyrrhis marina, DMS was produced; ungrazed cells, as well as those exposed to grazer exudates and associated bacteria, generated no DMS. Grazing of clone 373 produced much more DMS than grazing of clone 370, consistent with their relative in vitro DMSP lyase activities. DMS was only generated when cells were actually being grazed, indicating that ingested cells were responsible for the DMS formation. We suggest that even low levels of grazing can greatly accelerate DMS production.

Periovulatory follicular fluid levels of estradiol trigger inflammatory and DNA damage responses in oviduct epithelial cells.

Directory of Open Access Journals (Sweden)

Sergio E Palma-Vera

Full Text Available Ovarian steroid hormones (mainly E2 and P4 regulate oviduct physiology. Serum-E2 acts on the oviduct epithelium from the basolateral cell compartment. Upon ovulation, the apical compartment of the oviduct epithelium is temporarily exposed to follicular fluid, which contains much higher levels of E2 than serum. The aim of this study was to evaluate the effects of human periovulatory follicular fluid levels of E2 on oviduct epithelial cells using two porcine in vitro models.A cell line derived from the porcine oviductal epithelium (CCLV-RIE270 was characterized (lineage markers, proliferation characteristics and transformation status. Primary porcine oviduct epithelial cells (POEC were cultured in air-liquid interface and differentiation was assessed histologically. Both cultures were exposed to E2 (10 ng/ml and 200 ng/ml. Proliferation of CCLV-RIE270 and POEC was determined by real-time impedance monitoring and immunohistochemical detection of Ki67. Furthermore, marker gene expression for DNA damage response (DDR and inflammation was quantified.CCLV-RIE270 was not transformed and exhibited properties of secretory oviduct epithelial cells. Periovulatory follicular fluid levels of E2 (200 ng/ml upregulated the expression of inflammatory genes in CCLV-RIE270 but not in POEC (except for IL8. Expression of DDR genes was elevated in both models. A significant increase in cell proliferation could not be detected in response to E2.CCLV-RIE270 and POEC are complementary models to evaluate the consequences of oviduct exposure to follicular fluid components. Single administration of periovulatory follicular fluid E2 levels trigger inflammatory and DNA damage responses, but not proliferation in oviduct epithelial cells.

Performance of Jatropha Oil Blends in RD270 Two Cylinders Four ...

African Journals Online (AJOL)

The performance characteristics of RD270 two cylinder, four stroke diesel engine fuelled with jatropha oil and its blend with diesel are presented in this paper. The jatropha biodiesel was obtained from National Research Institutes for Chemical Technology, Zaria, Nigeria. The produced biodiesel was blended with neat ...

Functional and genetic epidemiological characterisation of the FFAR4 (GPR120) p.R270H variant in the Danish population

DEFF Research Database (Denmark)

Vestmar, Marie Aare; Andersson, Ehm A; Christensen, Charlotte Riis

2016-01-01

. Association with quantitative metabolic traits comprised 8720 non-diabetic individuals. RESULTS: p.R270H showed reduced surface expression of FFAR4. Ligand-independent activity was eliminated and strongly impaired through the Gq and Gi signalling pathways, respectively. The ligand-induced maximal signalling...... reactive protein; hs-CRP) and liver function (alanine aminotransferase) in the Danish population (p>0.05). CONCLUSIONS: We demonstrate that p.R270H of FFAR4 impairs Gq and Gi signalling of FFAR4 in vitro; however, this impaired signalling for p.R270H does not translate into associations with human...

Stigmastadiene and specific extitntion (270 nm to evaluate the presence of refined oils in virgin olive oil commercialized in Brazil

Directory of Open Access Journals (Sweden)

Sabria Aued-Pimentel

2013-09-01

Full Text Available The increased marketing of olive oil in Brazil has intensified legal requirements to ensure regulation of this product. The measurement of the specific extinction at 270 nm (E 270 and content of stigmastadiene can be used to assess the presence of refined oils in virgin olive oil. During the vegetable oil refining process, compounds with conjugated double bonds are generated from unsaturated fatty acids that absorb at 270 nm and sterols, such as stigmasta-3,5-diene. To compare these parameters, seven samples of extra virgin olive oil and three samples of olive oil (blend of virgin and refined were analyzed. Among the samples analyzed, four extra virgin samples had levels of stigmastadiene and E 270 higher than expected, among which two were adulterated with seed oil (rich in linoleic acid and the other two with olive pomace oil. The results demonstrate the higher sensitivity of stigmastadiene to determine the presence of the refined oil in virgin olive oil and good agreement with determining E 270. The latter technique is a simple, quick, and low cost method of determination that can be easily implemented in laboratories to assist in the screening and regulation of olive oils sold in Brazil.

45 CFR 270.7 - What data will we use to measure performance on the work support and other measures?

Science.gov (United States)

2010-10-01

... measure performance on the work support and other measures? (a) We will use Census Bureau data to rank... 45 Public Welfare 2 2010-10-01 2010-10-01 false What data will we use to measure performance on the work support and other measures? 270.7 Section 270.7 Public Welfare Regulations Relating to Public...

200 and 270 GHz SIS receivers development for atmospheric observation

International Nuclear Information System (INIS)

Ochiai, S.; Masuko, H.

1993-01-01

Superconducting mixers have been developed for observations of atmospheric minor constituents such as ClO and ozone at Communications Research Laboratory. This paper describes the work at development of 200 and 270 GHz SIS mixers. Nb/AlOx/Nb junctions were fabricated at Nobeyama Radio Observatory. The base Nb layer 200 nm, the Al (AlOx) insulation layer, and the counter Nb electrode 150 nm are sputtered. The area outside of a junction defined by etching of the counter electrode is insulated by anodized Nb layer and sputtered SiO 2 . After sputtering thick SiO 2 layer on the whole wafer, a contact hole is made by etching. The thickness of the wiring Nb layer is 500 nm. The junctions are formed on the 250 μm thick fused quartz substrate. After the process of the junction fabrication, the quartz substrate is shaved from the back side until 150 μm thickness. Each junction for 270 GHz mixer has an area of about 1 μm 2 . The normal resistance of the six junctions series array is around 70 Ω. The mixer block has a reduced waveguide (1.2 x 0.1 mm for 200 GHz and 0.98 x 0. 1 mm for 270 GHz). The waveguide has two tuners in addition to a fixed backshort cavity. This configuration can allow to realize the lower embedding impedance, and less sensitive to the position of the tuners. The SIS mixers are cooled in a closed cycle He refrigerator. The LO is optically injected through a Fabry Perot interferometer. The 5--7 GHz IF is fed to a HEMT amplifier cooled at 15 K. The authors have started a preliminary measurement of the noise temperature of the SIS receivers, and comparing with calculated DSB receiver noise temperature assuming 3-port model. They continue to improve the performance of the SIS mixers now. They intend that the receivers shall be utilized for atmospheric monitor from next winter

Effects of irradiance and prey deprivation on growth, cell carbon and photosynthetic activity of the freshwater kleptoplastidic dinoflagellate Nusuttodinium (= Gymnodinium aeruginosum (Dinophyceae.

Directory of Open Access Journals (Sweden)

Kirstine Drumm

Full Text Available The freshwater dinoflagellate Nusuttodinium aeruginosum lacks permanent chloroplasts. Rather it sequesters chloroplasts as well as other cell organelles, like mitochondria and nuclei, from ingested cryptophyte prey. In the present study, growth rates, cell production and photosynthesis were measured at seven irradiances, ranging from 10 to 140 μmol photons m-2s-1, when fed the cryptophyte Chroomonas sp. Growth rates were positively influenced by irradiance and increased from 0.025 d-1 at 10 μmol photons m-2s-1 to maximum growth rates of ~0.3 d-1 at irradiances ≥ 40 μmol photons m-2s-1. Similarly, photosynthesis ranged from 1.84 to 36.9 pg C cell-1 h-1 at 10 and 140 μmol photons m-2s-1, respectively. The highest rates of photosynthesis in N. aeruginosum only corresponded to ~25% of its own cell carbon content and estimated biomass production. The measured rates of photosynthesis could not explain the observed growth rates at high irradiances. Cultures of N. aeruginosum subjected to prey starvation were able to survive for at least 27 days in the light. The sequestered chloroplasts maintained their photosynthetic activity during the entire period of starvation, during which the population underwent 4 cell divisions. This indicates that N. aeruginosum has some control of the chloroplasts, which may be able to replicate. In conclusion, N. aeruginosum seems to be in an early stage of chloroplast acquisition with some control of its ingested chloroplasts.

17 CFR 270.12d3-1 - Exemption of acquisitions of securities issued by persons engaged in securities related businesses.

Science.gov (United States)

2010-04-01

... securities issued by persons engaged in securities related businesses. 270.12d3-1 Section 270.12d3-1... in securities related businesses. (a) Notwithstanding section 12(d)(3) of the Act, a registered... securities related business, the determination required by paragraph (b) of this section shall be made as...

17 CFR 270.12d2-1 - Definition of insurance company for purposes of sections 12(d)(2) and 12(g) of the Act.

Science.gov (United States)

2010-04-01

..., INVESTMENT COMPANY ACT OF 1940 § 270.12d2-1 Definition of insurance company for purposes of sections 12(d)(2... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of insurance company for purposes of sections 12(d)(2) and 12(g) of the Act. 270.12d2-1 Section 270.12d2-1 Commodity...

17 CFR 270.26a-2 - Exemptions from certain provisions of sections 26 and 27 for registered separate accounts and...

Science.gov (United States)

2010-04-01

... deduction of certain fees and charges from the assets of such accounts. 270.26a-2 Section 270.26a-2... registered separate accounts and others regarding custodianship of and deduction of certain fees and charges... by any State or other governmental entity and, if the separate account is registered under the Act as...

Evaluation of variable speed limits on I-270/I-255 in St. Louis.

Science.gov (United States)

2010-10-01

In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I270/I255 corridor in St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the transportation users. The technical system ...

17 CFR 270.10b-1 - Definition of regular broker or dealer.

Science.gov (United States)

2010-04-01

... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.10b-1 Definition of regular broker or dealer. The term regular broker or dealer of an investment company shall mean: (a) One... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of regular broker...

Nature of the 153 and 270 keV transitions in /sup 119/Sb from sup(119m)Te

Energy Technology Data Exchange (ETDEWEB)

Sahota, H S [Punjabi Univ., Patiala (India). Dept. of Physics

1982-08-01

The 153 and 270 keV transitions in /sup 119/Sb have been investigated for the presence of any anomalous conversion through conversion electron intensity and conversion-electron gamma and gamma-gamma directional correlation measurements. The resulting subshell ratios and particle rarameters have been analysed for the accurate determination of mixing ratios for the transitions. The results are delta/sub 153/ = +-0.0025 and delta/sub 270/ = 0.10 sub(-0.20)sup(+0.03). The conversion process has been found to be normal in both cases.

17 CFR 270.5b-1 - Definition of “total assets.”

Science.gov (United States)

2010-04-01

... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.5b-1 Definition of “total assets... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of âtotal assets.â..., shall mean the gross assets of the company with respect to which the computation is made, taken as of...

Melitrast in coronary angiography; Roentgenkontrastmittel Melitrast-300 und Melitrast-270 in der kardiologischen Diagnostik

Energy Technology Data Exchange (ETDEWEB)

Geisler, T.; Funke, B.; Wild, P.; Zotz, R. [Medizinische Klinik, Klinikum Schwalmstadt, Schwalmstadt (Germany); Dietz, G.; Petrov, R. [Dr. F. Koehler Chemie, Alsbach-Haehnlein (Germany); Stefenelli, U. [Fachinstitut fuer Statistik, Wuerzburg (Germany)

2004-07-01

The aim of this study was the evaluation of safety and cardiologic efficacy of the non-ionic contrast agent Iosarcol (Melitrast), a contrast agent with low protein affinity in two different iodine concentrations. One hundred patients were prospectively randomized to receive either Melitrast-270 or Melitrast-300 for left heart ventriculography and coronary angiography. Clinical evaluation, blood pressure and pulse measurement were performed and an electrocardiogram was recorded before and after contrast application and the diagnostic efficacy using a score was evaluated. In three patients side effects could be observed 2 hours after the application (vertigo, sickness, sweating). Melitrast in both concentrations led to a good contrast during ventriculography and coronary angiography which could not be differentiated by two experienced observers. Thus a lower iodine concentration and by this a lower viscosity seems to favour Melitrast-270 for invasive cardiologic diagnosis. (orig.)

17 CFR 270.32a-3 - Exemption from provision of section 32(a)(1) regarding the time period during which a registered...

Science.gov (United States)

2010-04-01

... select an independent public accountant. 270.32a-3 Section 270.32a-3 Commodity and Securities Exchanges... management investment company must select an independent public accountant. (a) A registered management... U.S.C. 80a-31(a)(1)) that the independent public accountant (“accountant”) be selected at a board of...

Appendices : evaluation of variable speed limits on I-270/I-255 in St. Louis.

Science.gov (United States)

2010-10-01

In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I-270/I-255 corridor in : St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the : transportation users. The technical system ...

17 CFR 270.30b1-7 - Monthly report for money market funds.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Monthly report for money... money market funds. (a) Report. Every registered open-end management investment company, or series thereof, that is regulated as a money market fund under § 270.2a-7 must file with the Commission a monthly...

Schrödinger's Cheshire Cat: Are Haploid Emiliania huxleyi Cells Resistant to Viral Infection or Not?

Science.gov (United States)

Mordecai, Gideon J; Verret, Frederic; Highfield, Andrea; Schroeder, Declan C

2017-03-18

Emiliania huxleyi is the main calcite producer on Earth and is routinely infected by a virus (EhV); a double stranded DNA (dsDNA) virus belonging to the family Phycodnaviridae . E. huxleyi exhibits a haplodiploid life cycle; the calcified diploid stage is non-motile and forms extensive blooms. The haploid phase is a non-calcified biflagellated cell bearing organic scales. Haploid cells are thought to resist infection, through a process deemed the "Cheshire Cat" escape strategy; however, a recent study detected the presence of viral lipids in the same haploid strain. Here we report on the application of an E. huxleyi CCMP1516 EhV-86 combined tiling array (TA) that further confirms an EhV infection in the RCC1217 haploid strain, which grew without any signs of cell lysis. Reverse transcription polymerase chain reaction (RT-PCR) and PCR verified the presence of viral RNA in the haploid cells, yet indicated an absence of viral DNA, respectively. These infected cells are an alternative stage of the virus life cycle deemed the haplococcolithovirocell. In this instance, the host is both resistant to and infected by EhV, i.e., the viral transcriptome is present in haploid cells whilst there is no evidence of viral lysis. This superimposed state is reminiscent of Schrödinger's cat; of being simultaneously both dead and alive.

The 270 MeV deuteron beam polarimeter at the Nuclotron Internal Target Station

Energy Technology Data Exchange (ETDEWEB)

Kurilkin, P.K. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow State Institute of Radio-engineering Electronics and Automation (Technical University), Moscow (Russian Federation); Ladygin, V.P., E-mail: vladygin@jinr.ru [Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow State Institute of Radio-engineering Electronics and Automation (Technical University), Moscow (Russian Federation); Uesaka, T. [Center for Nuclear Study, University of Tokyo, Tokyo 113-0033 (Japan); Suda, K. [RIKEN Nishina Center, Saitama (Japan); Gurchin, Yu.V.; Isupov, A.Yu. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Itoh, K. [Department of Physics, Saitama University, Saitama (Japan); Janek, M. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Physics Department, University of Zilina, 010 26 Zilina (Slovakia); Karachuk, J.-T. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Advanced Research Institute for Electrical Engineering, Bucharest (Romania); Kawabata, T. [Center for Nuclear Study, University of Tokyo, Tokyo 113-0033 (Japan); Khrenov, A.N.; Kiselev, A.S.; Kizka, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Kliman, J. [Institute of Physics of Slovak Academy of Sciences, Bratislava (Slovakia); Krasnov, V.A.; Livanov, A.N. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Institute for Nuclear Research, Moscow (Russian Federation); Maeda, Y. [Kyushi University, Hakozaki (Japan); Malakhov, A.I. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Matousek, V.; Morhach, M. [Institute of Physics of Slovak Academy of Sciences, Bratislava (Slovakia)

2011-06-21

A deuteron beam polarimeter has been constructed at the Internal Target Station at the Nuclotron of JINR. The polarimeter is based on spin-asymmetry measurements in the d-p elastic scattering at large angles and the deuteron kinetic energy of 270 MeV. It allows to measure vector and tensor components of the deuteron beam polarization simultaneously.

26 CFR 1.270-1 - Limitation on deductions allowable to individuals in certain cases.

Science.gov (United States)

2010-04-01

... cultivates, operates, or manages a farm for gain or profit, either as owner or tenant. An individual who... provisions relating to activities not engaged in for profit applicable to taxable years beginning after... THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.270-1 Limitation...

Schrödinger’s Cheshire Cat: Are Haploid Emiliania huxleyi Cells Resistant to Viral Infection or Not?

Directory of Open Access Journals (Sweden)

Gideon J. Mordecai

2017-03-01

Full Text Available Emiliania huxleyi is the main calcite producer on Earth and is routinely infected by a virus (EhV; a double stranded DNA (dsDNA virus belonging to the family Phycodnaviridae. E. huxleyi exhibits a haplodiploid life cycle; the calcified diploid stage is non-motile and forms extensive blooms. The haploid phase is a non-calcified biflagellated cell bearing organic scales. Haploid cells are thought to resist infection, through a process deemed the “Cheshire Cat” escape strategy; however, a recent study detected the presence of viral lipids in the same haploid strain. Here we report on the application of an E. huxleyi CCMP1516 EhV-86 combined tiling array (TA that further confirms an EhV infection in the RCC1217 haploid strain, which grew without any signs of cell lysis. Reverse transcription polymerase chain reaction (RT-PCR and PCR verified the presence of viral RNA in the haploid cells, yet indicated an absence of viral DNA, respectively. These infected cells are an alternative stage of the virus life cycle deemed the haplococcolithovirocell. In this instance, the host is both resistant to and infected by EhV, i.e., the viral transcriptome is present in haploid cells whilst there is no evidence of viral lysis. This superimposed state is reminiscent of Schrödinger’s cat; of being simultaneously both dead and alive.

Schrödinger’s Cheshire Cat: Are Haploid Emiliania huxleyi Cells Resistant to Viral Infection or Not?

Science.gov (United States)

Mordecai, Gideon J.; Verret, Frederic; Highfield, Andrea; Schroeder, Declan C.

2017-01-01

Emiliania huxleyi is the main calcite producer on Earth and is routinely infected by a virus (EhV); a double stranded DNA (dsDNA) virus belonging to the family Phycodnaviridae. E. huxleyi exhibits a haplodiploid life cycle; the calcified diploid stage is non-motile and forms extensive blooms. The haploid phase is a non-calcified biflagellated cell bearing organic scales. Haploid cells are thought to resist infection, through a process deemed the “Cheshire Cat” escape strategy; however, a recent study detected the presence of viral lipids in the same haploid strain. Here we report on the application of an E. huxleyi CCMP1516 EhV-86 combined tiling array (TA) that further confirms an EhV infection in the RCC1217 haploid strain, which grew without any signs of cell lysis. Reverse transcription polymerase chain reaction (RT-PCR) and PCR verified the presence of viral RNA in the haploid cells, yet indicated an absence of viral DNA, respectively. These infected cells are an alternative stage of the virus life cycle deemed the haplococcolithovirocell. In this instance, the host is both resistant to and infected by EhV, i.e., the viral transcriptome is present in haploid cells whilst there is no evidence of viral lysis. This superimposed state is reminiscent of Schrödinger’s cat; of being simultaneously both dead and alive. PMID:28335465

Nanoplankton protists from the western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Crptomonadea

Directory of Open Access Journals (Sweden)

Gianfranco Novarino

2005-03-01

Full Text Available This paper is an electron microscopical account of cryptomonad flagellates (Cryptophyceae = Cryptomonadea in the plankton of the western Mediterranean Sea. Bottle samples collected during the spring-summer of 1998 in the Sea of Alboran and Barcelona coastal waters contained a total of eleven photosynthetic species: Chroomonas (sensu auctorum sp., Cryptochloris sp., 3 species of Hemiselmis, 3 species of Plagioselmis including Plagioselmis nordica stat. nov/sp. nov., Rhinomonas reticulata (Lucas Novarino, Teleaulax acuta (Butcher Hill, and Teleaulax amphioxeia (Conrad Hill. Identification was based largely on cell surface features, as revealed by scanning electron microscopy (SEM. Cells were either dispersed in the water-column or associated with suspended particulate matter (SPM. Plagioselmis prolonga was the most common species both in the water-column and in association with SPM, suggesting that it might be a key primary producer of carbon. Taxonomic keys are given based on SEM.

41 CFR 102-75.270 - Must antitrust laws be considered when disposing of property?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must antitrust laws be...-REAL PROPERTY DISPOSAL Surplus Real Property Disposal Applicability of Antitrust Laws § 102-75.270 Must antitrust laws be considered when disposing of property? Yes, antitrust laws must be considered in any case...

38 CFR 21.270 - Payment of subsistence allowance during leave and between periods of instruction.

Science.gov (United States)

2010-07-01

... Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31 Monetary Assistance Services § 21.270... veteran jointly determine that such payment is not in the veteran's interest: (1) A period between...

Dose-rate effects on the cell cycle and survival of S3 HeLa and V79 cells

International Nuclear Information System (INIS)

Mitchell, J.B.; Bedford, J.S.; Bailey, S.M.

1979-01-01

The effects of continuous irradiation at different dose rates on the cell cycle and on cell survival were studied using synchronized S3 HeLa and V79 cells. The minimum dose rate necessary to stop cell division was found to be approximately 23 rad/hr for HeLa cells and 270 rad/hr for V79 cells. For dose rates that stop cell division, cells progress through G 1 and S, with a small delay in the S phase, and are blocked in G 2 . Appreciable mitotic accumulation was observed for HeLa cells at dose rates which stopped cell division. By comparison, much less mitotic accumulation was observed for V79 cells over a range of dose rates from 37 to 270 rad/hr. Minimum mitotic delays for a variety of dose rates were determined for both cell lines. S3 HeLa cells are much more sensitive in this respect than V79 cells; however, it appeared that for higher dose rates the minimum mitotic delay in HeLa cells asymptotically approached a value of about 35 hr. In addition to the qualitative differences observed for the two cell lines in regard to mitotic accumulation, HeLa cells accumulated for prolonged periods in the presence of colcemid while V79 cells were blocked for only a few hours, HeLa cells show a dramatic effect of redistribution of cells into sensitive phases of the cell cycle during exposure, which was reflected in the survival curves at low dose rate. More cell killing per unit dose was observed at 37 than at 74 rad/hr

238U and 237Np nuclear fission by 90-270 MeV electrons

International Nuclear Information System (INIS)

Kuznetsov, V.L.; Nedorezov, V.G.; Nikitina, N.V.; Noga, V.I.; Ranyuk, Yu.N.; Telegin, Yu.N.; Smirnov, A.N.; Ehjsmont, V.P.

1981-01-01

A technique for measuring cross sections of 238 U and 237 Np nuclei fission caused by 90-270 MeV electrons is described. Measurement results are given. The results obtained are discussed on the basis of the virtual photon method. It is shown that the difference in cross sections of 238 U and 237 Np electrofission is due to the different contribution of the giant resonance [ru

32 CFR 270.13 - No right to judicial review or legal cause of action.

Science.gov (United States)

2010-07-01

... DEMOCRATIC REPUBLIC OF VIETNAM Payment § 270.13 No right to judicial review or legal cause of action. Subject... 32 National Defense 2 2010-07-01 2010-07-01 false No right to judicial review or legal cause of..., and such review is specifically precluded. This part does not create or acknowledge any legal right or...

17 CFR 270.12d1-1 - Exemptions for investments in money market funds.

Science.gov (United States)

2010-04-01

...)(3) and 270.17e-1(d)(2), the payment of a commission, fee, or other remuneration to a broker shall be...) of the Act if: (1) The commission, fee, or other remuneration is paid in connection with the sale of... directors, the company's investment adviser performs the duties of the board of directors. [71 FR 36655...

Temporal acclimation of Microchloropsis gaditana CCMP526 in response to hypersalinity.

Science.gov (United States)

Karthikaichamy, Anbarasu; Deore, Pranali; Srivastava, Sanjeeva; Coppel, Ross; Bulach, Dieter; Beardall, John; Noronha, Santosh

2018-04-01

Evaporation from culture ponds and raceways can subject algae to hypersalinity stress, and this is exacerbated by global warming. We investigated the effect of salinity on a marine microalga, Microchloropsis gaditana, which is of industrial significance because of its high lipid-accumulating capability. Both short-term (hours) and medium-term (days) effects of salinity were studied across various salinities (37.5, 55, 70 and 100 PSU). Salinity above 55 PSU suppressed cell growth and specific growth rate was significantly reduced at 100 PSU. Photosynthesis (F v /F m , rETR max and I k ) was severely affected at high salinity conditions. Total carbohydrate per cell increased ∼1.7-fold after 24 h, which is consistent with previous findings that salinity induces osmolyte production to counter osmotic shock. In addition, accumulation of lipid increased by ∼4.6-fold in response to salinity. Our findings indicate a possible mechanism of acclimation to salinity, opening up new frontiers for osmolytes in pharmacological and cosmetics applications. Copyright © 2018 Elsevier Ltd. All rights reserved.

17 CFR 270.6c-6 - Exemption for certain registered separate accounts and other persons.

Science.gov (United States)

2010-04-01

... portfolio company has the same: (i) Investment objectives, (ii) Fundamental policies, and (iii) Voting... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.6c... which is, or is a part of, a unit investment trust registered under the Act, engaged in a continuous...

Polycyclic aromatic hydrocarbons stimulate cell proliferation of human breast cancer MCF-7 cells

Czech Academy of Sciences Publication Activity Database

Vondráček, Jan; Plíšková, M.; Vojtěšek, B.; Kozubík, Alois; Machala, M.

2003-01-01

Roč. 270, Suppl. 1 (2003), s. 127 ISSN 0014-2956. [FEBS Special Meeting 2003 on Signal Transduction. 03.07.2003-08.07.2003, Brussels] R&D Projects: GA ČR GP525/01/D076; GA ČR GA525/03/1527 Institutional research plan: CEZ:AV0Z5004920 Keywords : cell proliferation * estrogen receptor * p53 Subject RIV: BO - Biophysics

Isolation and partial characterization of gypsy moth BTR-270, an anionic brush border membrane glycoconjugate that binds Bacillus thuringiensis Cry1A toxins with high affinity

Science.gov (United States)

Algimantas P. Valaitis; Jeremy L. Jenkins; Mi Kyong Lee; Donald H. Dean; Karen J. Garner

2001-01-01

BTR-270, a gypsy moth (Lymantria dispar) brush border membrane molecule that binds Bacillus thuringiensis (Bt) Cry1A toxins with high affinity, was purified by preparative gel electrophoresis. Rabbit antibodies specific for the Bt toxin-binding molecule were raised. Attempts to label BTR-270 by protein-directed techniques were...

40 CFR 270.235 - Options for incinerators, cement kilns, lightweight aggregate kilns, solid fuel boilers, liquid...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Options for incinerators, cement kilns... Technology (MACT) Standards § 270.235 Options for incinerators, cement kilns, lightweight aggregate kilns... incinerator, cement kiln, lightweight aggregate kiln, solid fuel boiler, liquid fuel boiler, or hydrochloric...

40 CFR 270.315 - What air emissions control information must I keep at my facility?

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What air emissions control information... Facility § 270.315 What air emissions control information must I keep at my facility? If you have air emission control equipment subject to 40 CFR part 264, subpart CC, you must keep the following information...

Comparison of mouse, guinea pig and rabbit models for evaluation of plague subunit vaccine F1+rV270.

Science.gov (United States)

Qi, Zhizhen; Zhou, Lei; Zhang, Qingwen; Ren, Lingling; Dai, Ruixia; Wu, Benchuan; Wang, Tang; Zhu, Ziwen; Yang, Yonghai; Cui, Baizhong; Wang, Zuyun; Wang, Hu; Qiu, Yefeng; Guo, Zhaobiao; Yang, Ruifu; Wang, Xiaoyi

2010-02-10

In this study, a new subunit vaccine that comprised native F1 and recombinant rV270 was evaluated for protective efficacy using mouse, guinea pig and rabbit models in comparison with the live attenuated vaccine EV76. Complete protection against challenging with 10(6) colony-forming units (CFU) of virulent Yersinia pestis strain 141 was observed for mice immunized with the subunit vaccines and EV76 vaccine. In contrast, the subunit vaccine recipes VII (F1-20 microg+rV270-10 microg) and IX (F1-40 microg+rV270-20 microg) and EV76 vaccine provided 86%, 79% and 93% protection against the same level of challenge in guinea pigs and 100%, 83% and 100% protection in rabbits, respectively. The immunized mice with the vaccines had significantly higher IgG titres than the guinea pigs and rabbits, and the immunized guinea pigs developed significantly higher IgG titres than the rabbits, but the anti-F1 response in guinea pigs was more variable than in the mice and rabbits, indicating that guinea pig is not an ideal model for evaluating protective efficacy of plague subunit vaccine, instead the rabbits could be used as an alternative model. All the immunized animals with EV76 developed a negligible IgG titre to rV270 antigen. Furthermore, analysis of IgG subclasses in the immunized animals showed a strong response for IgG1, whereas those receiving EV76 immunization demonstrated predominant production of IgG1 and IgG2a isotypes. The subunit vaccine and EV76 vaccine are able to provide protection for animals against Y. pestis challenge, but the subunit vaccines have obvious advantages over EV76 in terms of safety of use. Copyright (c) 2009 Elsevier Ltd. All rights reserved.

17 CFR 270.3c-5 - Beneficial ownership by knowledgeable employees and certain other persons.

Science.gov (United States)

2010-04-01

... Company. For purposes of this definition, the term “investment company” as used in section 2(a)(3) of the Act includes a Covered Company. (2) The term Covered Company means a Section 3(c)(1) Company or a... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c...

Results of Remediation and Verification Sampling for the 600-270 Horseshoe Landfill

Energy Technology Data Exchange (ETDEWEB)

W. S. Thompson

2005-12-14

This report presents the results of the 2005 remedial action and verification soil sampling conducted at the 600-270 waste site after removal of soil containing residual concentrations of dichlorodiphenyl trichloroethane and its breakdown products dichlorodiphenyl dichloroethylene and dichlorodiphenyl dichloroethane. The remediation was performed in response to post-closure surface soil sampling performed between 1998 and 2003 that indicated the presence of residual DDT contamination exceeding the Record of Decision for the 1100 Area National Priorities List site cleanup criteria of 1 mg/kg that was established for the original 1994 cleanup activities.

Results of Remediation and Verification Sampling for the 600-270 Horseshoe Landfill

International Nuclear Information System (INIS)

Thompson, W.S.

2005-01-01

This report presents the results of the 2005 remedial action and verification soil sampling conducted at the 600-270 waste site after removal of soil containing residual concentrations of dichlorodiphenyl trichloroethane and its breakdown products dichlorodiphenyl dichloroethylene and dichlorodiphenyl dichloroethane. The remediation was performed in response to post-closure surface soil sampling performed between 1998 and 2003 that indicated the presence of residual DDT contamination exceeding the Record of Decision for the 1100 Area National Priorities List site cleanup criteria of 1 mg/kg that was established for the original 1994 cleanup activities.

17 CFR 270.3c-1 - Definition of beneficial ownership for certain 3(c)(1) funds.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial... AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-1 Definition of beneficial ownership for certain 3(c)(1) funds. (a) As used in this section: (1) The term...

Measurement of turbulent flows in a square sectioned 270 .deg. bend

Energy Technology Data Exchange (ETDEWEB)

Cho, Sok Hyu; Lee, Gun Hyee [Wonkwang Univ., Iksan (Korea, Republic of); Chun, Kun Ho [Korea Univ., Seoul (Korea, Republic of)

2000-07-01

Most of the past experimental or analytical studies were performed for the curved bend with a square cross-section. Velocity profiles and Reynolds stresses of the turbulence flow in the 270 degree bend with circular cross-section were measured by a hot-wire anemometer. The mean velocity of primary flowing direction effected by the downstream of bend in the entry region of the bend. The flow in the inner part of the bend slowed the distribution velocity relatively large and unsymmetric phenomenon. In the strong secondary flow occurred when the flow passed in the region of 45 degree to 90 degree. The secondary flow appeared very large value in the neighbor region inner wall.

Measurement of turbulent flows in a square sectioned 270 .deg. bend

International Nuclear Information System (INIS)

Cho, Sok Hyu; Lee, Gun Hyee; Chun, Kun Ho

2000-01-01

Most of the past experimental or analytical studies were performed for the curved bend with a square cross-section. Velocity profiles and Reynolds stresses of the turbulence flow in the 270 degree bend with circular cross-section were measured by a hot-wire anemometer. The mean velocity of primary flowing direction effected by the downstream of bend in the entry region of the bend. The flow in the inner part of the bend slowed the distribution velocity relatively large and unsymmetric phenomenon. In the strong secondary flow occurred when the flow passed in the region of 45 degree to 90 degree. The secondary flow appeared very large value in the neighbor region inner wall

Protein (Cyanobacteria): 470019 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available hypothetical protein Pro1185 Prochlorococcus marinus subsp. marinus str. CCMP1375 MLNGLNLCTLLEKYCYSKKISDKEVEFLERCWLDSLNSLHYNRYPGIAPAIVCDEAGVARGSYWISCNAAILDKLKPLGTTRSRSARIFDVLFQSGLIAA ...

Intraspecific Differences in Biogeochemical Responses to Thermal Change in the Coccolithophore Emiliania huxleyi.

Directory of Open Access Journals (Sweden)

Paul G Matson

Full Text Available The species concept in marine phytoplankton is defined based on genomic, morphological, and functional properties. Reports of intraspecific diversity are widespread across major phytoplankton groups but the impacts of this variation on ecological and biogeochemical processes are often overlooked. Intraspecific diversity is well known within coccolithophores, which play an important role in the marine carbon cycle via production of particulate inorganic carbon. In this study, we investigated strain-specific responses to temperature in terms of morphology, carbon production, and carbonate mineralogy using a combination of microscopy, elemental analysis, flow cytometry, and nuclear magnetic resonance. Two strains of the cosmopolitan coccolithophore E. huxleyi isolated from different regions (subtropical, CCMP371; temperate, CCMP3266 were cultured under a range of temperature conditions (10°C, 15°C, and 20°C using batch cultures and sampled during both exponential and stationary growth. Results for both strains showed that growth rates decreased at lower temperatures while coccosphere size increased. Between 15°C and 20°C, both strains produced similar amounts of total carbon, but differed in allocation of that carbon between particulate inorganic carbon (PIC and particulate organic carbon (POC, though temperature effects were not detected. Between 10°C and 20°C, temperature effects on daily production of PIC and POC, as well as the cellular quota of POC were detected in CCMP3266. Strain-specific differences in coccolith shedding rates were found during exponential growth. In addition, daily shedding rates were negatively related to temperature in CCMP371 but not in CCMP3266. Despite differences in rates of particulate inorganic carbon production, both strains were found to produce coccoliths composed entirely of pure calcite, as established by solid-state 13C and 43Ca NMR and X-ray diffraction measurements. These results highlight the

Technological aspects at continuous casting of semi-finished products with ϕ270mm

International Nuclear Information System (INIS)

Ardelean, E; Ardelean, M; Hepuţ, T; Lăscuţoni, A

2015-01-01

Continuous casting installation especially appreciated because steel can be poured in a more varied assortment. The flexibility of the system is not sufficient if the casting parameters are not properly adopted and adapted to the specific brand of steel. This paper presents some technical aspects relative to continuous casting of semi-finished products with ϕ270mm section. Graphical dependencies obtained in Excel and analytical equations of this allows to specialists from industry to adopt values for the addicted parameters according to the independent ones, already known. (paper)

Roles of Asp179 and Glu270 in ADP-Ribosylation of Actin by Clostridium perfringens Iota Toxin.

Directory of Open Access Journals (Sweden)

Alexander Belyy

Full Text Available Clostridium perfringens iota toxin is a binary toxin composed of the enzymatically active component Ia and receptor binding component Ib. Ia is an ADP-ribosyltransferase, which modifies Arg177 of actin. The previously determined crystal structure of the actin-Ia complex suggested involvement of Asp179 of actin in the ADP-ribosylation reaction. To gain more insights into the structural requirements of actin to serve as a substrate for toxin-catalyzed ADP-ribosylation, we engineered Saccharomyces cerevisiae strains, in which wild type actin was replaced by actin variants with substitutions in residues located on the Ia-actin interface. Expression of the actin mutant Arg177Lys resulted in complete resistance towards Ia. Actin mutation of Asp179 did not change Ia-induced ADP-ribosylation and growth inhibition of S. cerevisiae. By contrast, substitution of Glu270 of actin inhibited the toxic action of Ia and the ADP-ribosylation of actin. In vitro transcribed/translated human β-actin confirmed the crucial role of Glu270 in ADP-ribosylation of actin by Ia.

Protein (Viridiplantae): 203761 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 017 ... 38832:3226 ... 38833:3539 ... 564608:3539 predicted protein Micromonas pusilla CCMP1545 MHPPLTLENHPLCKDVVIALKRCHRDNPWARAWGACNEQKWALDDCLKKQKLFKFRANHAKAKAQQDRLRRRVEKYGHATTNGQFKG

Protein (Viridiplantae): 746637 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 218 ... 38832:274 ... 38833:414 ... 564608:414 predicted protein Micromonas pusilla CCMP1545 MAQLPSYEVDDGEDSMPGAPGEGPMTDSMQGPPVEVPTSDSM...PGAPGEVPTMDSMHGPPVEVPTMDSMHGAPVEVPMMDSMPGAPVEVPTMDSMQGPPVEVPTMDSMQGAPGEGPMTDSMHGAPGEGPTMDSMNSGNPTKCVVPDWCSTYPPEMQKSKPECQCPDDSHP

Effect of food on the pharmacokinetics of oral MMI270B (CGS 27023A), a novel matrix metalloproteinase inhibitor

NARCIS (Netherlands)

F.A.L.M. Eskens (Ferry); N.C. Levitt; A. Sparreboom (Alex); L. Choi; R. Mather; J. Verweij (Jaap); A.L. Harris

2000-01-01

textabstractMMI270B is a matrix metalloproteinase inhibitor (MMPI) with in vitro and in vivo activity. To exert optimal target inhibition, MMPI must be given chronically, and therefore, oral bioavailability is important. We analyzed the effect of food intake on AUC0-8

Protein (Viridiplantae): 780231 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 401 ... 38832:1362 ... 38833:877 ... 564608:877 predicted protein Micromonas pusilla CCMP1545 MQDSMHDTMHDSIQDSMHDSIQDSMQDSM...AKEEEEPAEPPAKEEEAHAEPPAKEEEAHAEPPAKEEDYAEPPAKEEDYAEPPAKEEAHSMDSMDSMDSMDSMDSMDSMHSMDSMDSMDSMDSMHSMDSMDSMDSM...DSMHSMDSMDSMDSMDSMDSMDSMHSMDTSIDAVDAAANVTDAADTAGAAANVTDAADTAGAAAEEKPPENASVDSLDSLLDG

Sinking towards destiny: High throughput measurement of phytoplankton sinking rates through time-resolved fluorescence plate spectroscopy.

Science.gov (United States)

Bannon, Catherine C; Campbell, Douglas A

2017-01-01

Diatoms are marine primary producers that sink in part due to the density of their silica frustules. Sinking of these phytoplankters is crucial for both the biological pump that sequesters carbon to the deep ocean and for the life strategy of the organism. Sinking rates have been previously measured through settling columns, or with fluorimeters or video microscopy arranged perpendicularly to the direction of sinking. These side-view techniques require large volumes of culture, specialized equipment and are difficult to scale up to multiple simultaneous measures for screening. We established a method for parallel, large scale analysis of multiple phytoplankton sinking rates through top-view monitoring of chlorophyll a fluorescence in microtitre well plates. We verified the method through experimental analysis of known factors that influence sinking rates, including exponential versus stationary growth phase in species of different cell sizes; Thalassiosira pseudonana CCMP1335, chain-forming Skeletonema marinoi RO5A and Coscinodiscus radiatus CCMP312. We fit decay curves to an algebraic transform of the decrease in fluorescence signal as cells sank away from the fluorometer detector, and then used minimal mechanistic assumptions to extract a sinking rate (m d-1) using an RStudio script, SinkWORX. We thereby detected significant differences in sinking rates as larger diatom cells sank faster than smaller cells, and cultures in stationary phase sank faster than those in exponential phase. Our sinking rate estimates accord well with literature values from previously established methods. This well plate-based method can operate as a high throughput integrative phenotypic screen for factors that influence sinking rates including macromolecular allocations, nutrient availability or uptake rates, chain-length or cell size, degree of silification and progression through growth stages. Alternately the approach can be used to phenomically screen libraries of mutants.

THE COMPLETE, TEMPERATURE-RESOLVED EXPERIMENTAL SPECTRUM OF VINYL CYANIDE (H2CCHCN) BETWEEN 210 AND 270 GHz

International Nuclear Information System (INIS)

Fortman, Sarah M.; Neese, Christopher F.; De Lucia, Frank C.; Medvedev, Ivan R.

2011-01-01

The results of an experimental approach to the identification and characterization of the astrophysical weed vinyl cyanide in the 210-270 GHz region are reported. This approach is based on spectrally complete, intensity-calibrated spectra taken at more than 400 different temperatures in the 210-270 GHz region and is used to produce catalogs in the usual astrophysical format: line frequency, line strength, and lower state energy. As in our earlier study of ethyl cyanide, we also include the results of a frequency point-by-point analysis, which is especially well suited for characterizing weak lines and blended lines in crowded spectra. This study shows substantial incompleteness in the quantum-mechanical (QM) models used to calculate astrophysical catalogs, primarily due to their omission of many low-lying vibrational states of vinyl cyanide, but also due to the exclusion of perturbed rotational transitions. Unlike ethyl cyanide, the QM catalogs for vinyl cyanide include analyses of perturbed excited vibrational states, whose modeling is more challenging. Accordingly, we include an empirical study of the frequency accuracy of these QM models. We observe modest frequency differences for some vibrationally excited lines.

ORF Alignment: NC_005042 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available str. CCMP1375] ... Length = 255 ... Query: 1 ... MGVINVTPDSFSDGGEYLEPLEAYKKASECI...AAGVDVIDVGGQSTRPGAKTISPEKELQR 60 ... MGVINVTPDSFSDGGEYLEPLEAYKKASECIAAGVDVIDVGGQSTRPGAKTISPEKELQR Sb...jct: 1 ... MGVINVTPDSFSDGGEYLEPLEAYKKASECIAAGVDVIDVGGQSTRPGAKTISPEKELQR 60 ... Query: 121 YVITHSRGNSFDMNNYAFYNDVV

Spin Flipping and Polarization Lifetimes of a 270 MeV Deuteron Beam

International Nuclear Information System (INIS)

Morozov, V.S.; Crawford, M.Q.; Etienne, Z.B.; Kandes, M.C.; Krisch, A.D.; Leonova, M.A.; Sivers, D.W.; Wong, V.K.; Yonehara, K.; Anferov, V.A.; Meyer, H.O.; Schwandt, P.; Stephenson, E.J.; Przewoski, B. von

2003-01-01

We recently studied the spin flipping of a 270 MeV vertically polarized deuteron beam stored in the IUCF Cooler Ring. We swept an rf solenoid's frequency through an rf-induced spin resonance and observed the effect on the beam's vector and tensor polarizations. After optimizing the resonance crossing rate and setting the solenoid's voltage to its maximum value, we obtained a spin-flip efficiency of about 94 ± 1% for the vector polarization; we also observed a partial spin-flip of the tensor polarization. We then used the rf-induced resonance to measure the vector and tensor polarizations' lifetimes at different distances from the resonance; the polarization lifetime ratio τvector/τtensor was about 1.9 ± 0.4

The electrical characteristics of copper slags in a 270 kVA DC arc furnace

International Nuclear Information System (INIS)

Derin, Bora; Sahin, Filiz Cinar; Yucel, Onuralp

2003-01-01

The electrical resistance of slags is the main criteria to determine the design and the operation conditions of slag resistance furnace (SRF) depending on temperature and composition. In this study, a 270 kVA DC electric arc furnace were used to determine the electrical characteristic of molten ancient copper slags. The specific conductivity of the slag was estimated by using furnace geometric factor given in the literature as an empirical formula and by using furnace resistance measured during smelting of the copper slag with or without different additives such as coke, CaO and Al 2 O 3 . (Original)

ORF Alignment: NC_005042 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ator ... [Prochlorococcus marinus subsp. marinus str. CCMP1375] ... Length = 85 ... Query: 9 ... KAIDS...LKALAEPIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS 68 ... KAIDSLKALAE...PIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS Sbjct: 1 ... KAIDSLKALAEPIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS 60 ...

Cobalt and molybdenum activated electrodes in foam based alkaline electrolysis cells at 150-250 °C and 40 bar

DEFF Research Database (Denmark)

Allebrod, Frank; Chatzichristodoulou, Christodoulos; Mogensen, Mogens Bjerg

2014-01-01

A new type of alkaline electrolysis cells with nickel foam based gas diffusion electrodes and KOH (aq) immobilized in mesoporous SrTiO3 has been developed and tested at temperatures of 150 C, 200 C and 250 C at a pressure of 40 bar. Two cells have been characterized during the 270 h long test...

ORF Alignment: NC_005072 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tein S8 ... [Prochlorococcus marinus subsp. pastoris str. CCMP1986] ... Length = 128 ... Query: 5 ... DPISDMLTRIRNASQKKHTST...AIPASKMSLSIAKVLQKEGFITDINEEGEGYKSQIVLGL 64 ... DPISDMLTRIRNASQKKHTST...AIPASKMSLSIAKVLQKEGFITDINEEGEGYKSQIVLGL Sbjct: 1 ... DPISDMLTRIRNASQKKHTSTAIPASKMSLSIAKVLQKE

20 CFR 662.270 - How are the costs of providing services through the One-Stop delivery system and the operating...

Science.gov (United States)

2010-04-01

... through the One-Stop delivery system and the operating costs of the system to be funded? 662.270 Section... and the operating costs of the system to be funded? The MOU must describe the particular funding arrangements for services and operating costs of the One-Stop delivery system. Each partner must contribute a...

Tumor Cell Anaplasia and Multinucleation Are Predictors of Disease Recurrence in Oropharyngeal Squamous Cell Carcinoma, Including Among Just the Human Papillomavirus-Related Cancers

OpenAIRE

Lewis, James S.; Scantlebury, Juliette B.; Luo, Jingqin; Thorstad, Wade L.

2012-01-01

Oropharyngeal squamous cell carcinoma (SCC) is frequently related to high risk human papillomavirus. This tumor expresses p16, frequently has a nonkeratinizing morphology, and has improved outcomes. Despite having a good prognosis, tumors can have focal or diffuse nuclear anaplasia or multinucleation, the significance of which is unknown. From a database of 270 oropharyngeal SCCs with known histologic typing (using our established system) and p16 immunohistochemistry, all su...

EGFRvIII-specific chimeric antigen receptor T cells migrate to and kill tumor deposits infiltrating the brain parenchyma in an invasive xenograft model of glioblastoma.

Science.gov (United States)

Miao, Hongsheng; Choi, Bryan D; Suryadevara, Carter M; Sanchez-Perez, Luis; Yang, Shicheng; De Leon, Gabriel; Sayour, Elias J; McLendon, Roger; Herndon, James E; Healy, Patrick; Archer, Gary E; Bigner, Darell D; Johnson, Laura A; Sampson, John H

2014-01-01

Glioblastoma (GBM) is the most common primary malignant brain tumor in adults and is uniformly lethal. T-cell-based immunotherapy offers a promising platform for treatment given its potential to specifically target tumor tissue while sparing the normal brain. However, the diffuse and infiltrative nature of these tumors in the brain parenchyma may pose an exceptional hurdle to successful immunotherapy in patients. Areas of invasive tumor are thought to reside behind an intact blood brain barrier, isolating them from effective immunosurveillance and thereby predisposing the development of "immunologically silent" tumor peninsulas. Therefore, it remains unclear if adoptively transferred T cells can migrate to and mediate regression in areas of invasive GBM. One barrier has been the lack of a preclinical mouse model that accurately recapitulates the growth patterns of human GBM in vivo. Here, we demonstrate that D-270 MG xenografts exhibit the classical features of GBM and produce the diffuse and invasive tumors seen in patients. Using this model, we designed experiments to assess whether T cells expressing third-generation chimeric antigen receptors (CARs) targeting the tumor-specific mutation of the epidermal growth factor receptor, EGFRvIII, would localize to and treat invasive intracerebral GBM. EGFRvIII-targeted CAR (EGFRvIII+ CAR) T cells demonstrated in vitro EGFRvIII antigen-specific recognition and reactivity to the D-270 MG cell line, which naturally expresses EGFRvIII. Moreover, when administered systemically, EGFRvIII+ CAR T cells localized to areas of invasive tumor, suppressed tumor growth, and enhanced survival of mice with established intracranial D-270 MG tumors. Together, these data demonstrate that systemically administered T cells are capable of migrating to the invasive edges of GBM to mediate antitumor efficacy and tumor regression.

EGFRvIII-specific chimeric antigen receptor T cells migrate to and kill tumor deposits infiltrating the brain parenchyma in an invasive xenograft model of glioblastoma.

Directory of Open Access Journals (Sweden)

Hongsheng Miao

Full Text Available Glioblastoma (GBM is the most common primary malignant brain tumor in adults and is uniformly lethal. T-cell-based immunotherapy offers a promising platform for treatment given its potential to specifically target tumor tissue while sparing the normal brain. However, the diffuse and infiltrative nature of these tumors in the brain parenchyma may pose an exceptional hurdle to successful immunotherapy in patients. Areas of invasive tumor are thought to reside behind an intact blood brain barrier, isolating them from effective immunosurveillance and thereby predisposing the development of "immunologically silent" tumor peninsulas. Therefore, it remains unclear if adoptively transferred T cells can migrate to and mediate regression in areas of invasive GBM. One barrier has been the lack of a preclinical mouse model that accurately recapitulates the growth patterns of human GBM in vivo. Here, we demonstrate that D-270 MG xenografts exhibit the classical features of GBM and produce the diffuse and invasive tumors seen in patients. Using this model, we designed experiments to assess whether T cells expressing third-generation chimeric antigen receptors (CARs targeting the tumor-specific mutation of the epidermal growth factor receptor, EGFRvIII, would localize to and treat invasive intracerebral GBM. EGFRvIII-targeted CAR (EGFRvIII+ CAR T cells demonstrated in vitro EGFRvIII antigen-specific recognition and reactivity to the D-270 MG cell line, which naturally expresses EGFRvIII. Moreover, when administered systemically, EGFRvIII+ CAR T cells localized to areas of invasive tumor, suppressed tumor growth, and enhanced survival of mice with established intracranial D-270 MG tumors. Together, these data demonstrate that systemically administered T cells are capable of migrating to the invasive edges of GBM to mediate antitumor efficacy and tumor regression.

Systematics of a kleptoplastidal dinoflagellate, Gymnodinium eucyaneum Hu (Dinophyceae), and its cryptomonad endosymbiont.

Science.gov (United States)

Xia, Shuang; Zhang, Qi; Zhu, Huan; Cheng, Yingyin; Liu, Guoxiang; Hu, Zhengyu

2013-01-01

New specimens of the kleptoplastidal dinoflagellate Gymnodinium eucyaneum Hu were collected in China. We investigated the systematics of the dinoflagellate and the origin of its endosymbiont based on light morphology and phylogenetic analyses using multiple DNA sequences. Cells were dorsoventrally flattened with a sharply acute hypocone and a hemispherical epicone. The confusion between G. eucyaneum and G. acidotum Nygaard still needs to be resolved. We found that the hypocone was conspicuously larger than the epicone in most G. eucyaneum cells, which differed from G. acidotum, but there were a few cells whose hypocone and epicone were of nearly the same size. In addition, there was only one site difference in the partial nuclear LSU rDNA sequences of a sample from Japan given the name G. acidotum and G. eucyaneum in the present study, which suggest that G. eucyaneum may be a synonym of G. acidotum. Spectroscopic analyses and phylogenetic analyses based on nucleomorph SSU rDNA sequences and chloroplast 23 s rDNA sequences suggested that the endosymbiont of G. eucyaneum was derived from Chroomonas (Cryptophyta), and that it was most closely related to C. coerulea Skuja. Moreover, the newly reported kleptoplastidal dinoflagellates G. myriopyrenoides and G. eucyaneum in our study were very similar, and the taxonomy of kleptoplastidal dinoflagellates was discussed.

48Ca+249Bk fusion reaction leading to element Z = 117: long-lived α-decaying 270Db and discovery of 266Lr.

Science.gov (United States)

Khuyagbaatar, J; Yakushev, A; Düllmann, Ch E; Ackermann, D; Andersson, L-L; Asai, M; Block, M; Boll, R A; Brand, H; Cox, D M; Dasgupta, M; Derkx, X; Di Nitto, A; Eberhardt, K; Even, J; Evers, M; Fahlander, C; Forsberg, U; Gates, J M; Gharibyan, N; Golubev, P; Gregorich, K E; Hamilton, J H; Hartmann, W; Herzberg, R-D; Heßberger, F P; Hinde, D J; Hoffmann, J; Hollinger, R; Hübner, A; Jäger, E; Kindler, B; Kratz, J V; Krier, J; Kurz, N; Laatiaoui, M; Lahiri, S; Lang, R; Lommel, B; Maiti, M; Miernik, K; Minami, S; Mistry, A; Mokry, C; Nitsche, H; Omtvedt, J P; Pang, G K; Papadakis, P; Renisch, D; Roberto, J; Rudolph, D; Runke, J; Rykaczewski, K P; Sarmiento, L G; Schädel, M; Schausten, B; Semchenkov, A; Shaughnessy, D A; Steinegger, P; Steiner, J; Tereshatov, E E; Thörle-Pospiech, P; Tinschert, K; Torres De Heidenreich, T; Trautmann, N; Türler, A; Uusitalo, J; Ward, D E; Wegrzecki, M; Wiehl, N; Van Cleve, S M; Yakusheva, V

2014-05-02

The superheavy element with atomic number Z=117 was produced as an evaporation residue in the (48)Ca+(249)Bk fusion reaction at the gas-filled recoil separator TASCA at GSI Darmstadt, Germany. The radioactive decay of evaporation residues and their α-decay products was studied using a detection setup that allowed measuring decays of single atomic nuclei with half-lives between sub-μs and a few days. Two decay chains comprising seven α decays and a spontaneous fission each were identified and are assigned to the isotope (294)117 and its decay products. A hitherto unknown α-decay branch in (270)Db (Z = 105) was observed, which populated the new isotope (266)Lr (Z = 103). The identification of the long-lived (T(1/2) = 1.0(-0.4)(+1.9) h) α-emitter (270)Db marks an important step towards the observation of even more long-lived nuclei of superheavy elements located on an "island of stability."

Serum microRNAs in clear cell carcinoma of the ovary.

Science.gov (United States)

Chao, Angel; Lai, Chyong-Huey; Chen, Hua-Chien; Lin, Chiao-Yun; Tsai, Chia-Lung; Tang, Yun-Hsin; Huang, Huei-Jean; Lin, Chen-Tao; Chen, Min-Yu; Huang, Kuang-Gen; Chou, Hung-Hsueh; Chang, Ting-Chang; Chen, Shu-Jen; Wang, Tzu-Hao

2014-12-01

To identify candidate microRNAs (miRNAs) in the serum of patients with clear cell carcinomas in monitoring disease progression. The sera of patients with diagnosed ovarian clear cell carcinoma were collected from 2009 to 2012. Real-time quantitative polymerase chain reaction (PCR) analysis for 270 miRNAs was performed. To offset the potential extraction bias, an equal amount of Caenorhabditis elegans cel-miR-238 was added to each serum specimen before miRNA isolation. miRNA expression was analyzed using the ΔCt method, with cel-miR-238 as controls. Twenty-one patients with clear cell carcinoma were included. In the discovery phase on four pairs of pre- and postoperative sera, 18 differentially expressed miRNAs were selected from 270 miRNAs. In the validation phase on an independent set of 11 pairs of pre- and postoperative sera, 4 miRNAs (hsa-miR-130a, hsa-miR-138, hsa-miR-187, and hsa-miR-202) were confirmed to be higher in the preoperative sera. In the application phase, hsa-miR-130a remained consistent with the different time points in seven of the 10 patients during clinical follow-up periods. More importantly, in three patients, hsa-miR-130a levels were elevated in early disease recurrences before CA125 was found to be elevated. Hsa-miR-130a may be a useful serum biomarker for detecting recurrence of ovarian clear cell cancer, and warrants further studies. Copyright © 2014. Published by Elsevier B.V.

17 CFR 270.2a-4 - Definition of “current net asset value” for use in computing periodically the current price of...

Science.gov (United States)

2010-04-01

... value between calculations made as of the close of the New York Stock Exchange on the preceding business... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of âcurrent net... Section 270.2a-4 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES...

Comparison in myelography between iodixanol 270 and 320 mgI/ml and iotrolan 300 mgI/ml: a multicentre, randomised, parallel-group, double-blind, phase III trial

International Nuclear Information System (INIS)

Palmers, Yvan; Kuhn, Fritz-Peter; Petersen, Dirk; De Greef, Danielle

2002-01-01

The objective of the trial was to compare the safety and efficacy of the non-ionic, dimeric, isotonic contrast medium iodixanol (Visipaque 270 and 320 mgI/ml) with those of iotrolan (Isovist 300 mgI/ml) in myelography. After lumbar or cervical puncture, 315 patients were examined in a multicentre, double-blind, randomised, comparative myelography study. Image quality, changes in vital signs, immediate and delayed adverse events were registered. There was a tendency for better images with iodixanol 320 than with iodixanol 270 and iotrolan 300, but the overall quality was good or excellent with all products. The frequency of patients reporting adverse events and headache varied much across centres, but there was no statistically significant difference between the contrast media. The incidence of events was higher after lumbar puncture than after cervical puncture, in women rather than in men, and after puncture with a 22-gauge (G) bevel-tipped needle compared with a 24 G Sprotte needle. The frequency of headache did not correlate with the absence of pathology. The higher iodine concentration in iodixanol 320 could be an advantage for film quality. When compared with iotrolan 300, iodixanol 320 and 270 give similar incidences of adverse events, including headache. (orig.)

PODAAC-CCF35-01AM1

Data.gov (United States)

National Aeronautics and Space Administration — This dataset is derived under the Cross-Calibrated Multi-Platform (CCMP) project and contains a value-added monthly mean ocean surface wind and pseudostress to...

Vastatins have a distinct effect on sterol synthesis and progesterone secretion in human granulosa cells in vitro

NARCIS (Netherlands)

Vliet, A.K. van; Thiel, G.C.F. van; Naaktgeboren, N.; Cohen, L.H.

1996-01-01

Lovastatin and simvastatin are strong inhibitors of cholesterol synthesis in cultured human granulosa cells, as measured within 6 days after isolation, with IC50-values of respectively 27.0 and 18.2 nM obtained after 3.5 hours of incubation with the drugs. Pravastatin is a much weaker inhibitor of

PODAAC-CCF30-01XXX

Data.gov (United States)

National Aeronautics and Space Administration — This dataset is derived under the Cross-Calibrated Multi-Platform (CCMP) project and contains a value-added 6-hourly gridded analysis of ocean surface winds. The...

PODAAC-CCF35-01AD5

Data.gov (United States)

National Aeronautics and Space Administration — This dataset is derived under the Cross-Calibrated Multi-Platform (CCMP) project and contains a value-added 5-day mean ocean surface wind and pseudostress to...

Antiproliferative Effects of Selected Chemotherapeutics in Human Ovarian Cancer Cell Line A2780

Directory of Open Access Journals (Sweden)

Kateřina Caltová

2012-01-01

Full Text Available The aim of our study was to determine the effect of selected cytostatics on a human ovarian cancer cell line A2780 as a model system for ovarian cancer treatment. This cell line is considered cisplatin-sensitive. Panel of tested cytostatics included cisplatin, paclitaxel, carboplatin, gemcitabine, topotecan and etoposide. These cytostatics have a different mechanism of action. To evaluate cytotoxic potential of the tested compounds, the methods measuring various toxicological endpoints were employed including morphological studies, MTT assay, dynamic monitoring of cell proliferation with xCELLigence, cell cycle analysis, caspase 3 activity and expression of proteins involved in cell cycle regulation and cell death. The A270 cell line showed different sensitivity towards the selected cytostatics, the highest cytotoxic effect was associated with paclitaxel and topotecan.

MCSE Core Elective Exams in a Nutshell Covers exams 70-270, 70-297, and 70-298

CERN Document Server

Bhardwaj, Pawan

2006-01-01

For Windows XP and Windows Server 2003 administrators preparing forMicrosoft Certified Systems Engineer (MCSE) core exam 70-270, and core exams 70-297, and 70-298, this book is invaluable. Not only does it provide the resources you need to succeed on the exams, but to succeed in the real world as well. Think of this book as the notes you would have taken if you were to capture every essential nugget of information related to the skills measured in the core elective exams. To begin with, MCSE Core Elective Exams in a Nutshell allows you to see all of the topics expected for mastery in each

Unraveling the chemical identity of meat pigments.

Science.gov (United States)

Pegg, R B; Shahidi, F

1997-10-01

This review examines the chemistry of nitrite curing of meat and meat products as it relates to the development of cured meat color and provides a detailed account of how nitrite-free processed meats could be prepared using the preformed cooked cured-meat pigment (CCMP). Thus, a chemical description of meat color, both raw and cooked, and characterization of nitrosylheme pigments follows. Based on electron paramagnetic resonance (EPR), visible and infrared spectroscopic studies, evidence has been provided to support the hypothesis that the chemical structure of the preformed CCMP is identical to that of the pigment prepared in situ after thermal processing of nitrite-cured meat and is in fact a mononitrosylheme complex. An appendix, which describes the basic principles of EPR spectroscopy used in the context of this review, is attached.

Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

Directory of Open Access Journals (Sweden)

Bekir Can LÜTFÜOĞLU

2017-04-01

Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

17 CFR 270.2a51-2 - Definitions of beneficial owner for certain purposes under sections 2(a)(51) and 3(c)(7) and...

Science.gov (United States)

2010-04-01

... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.2a51-2 Definitions of... exception set forth in this subparagraph, be excluded from the definition of investment company solely by... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions of beneficial...

SHORTER, Aylward. African recruits and missionary conscripts: the White Fathers and the Great War (1914 – 1922. London: Missionaries of Africa History Project, 2007. 270 p. ISBN: 9780955523502

Directory of Open Access Journals (Sweden)

Jefferson Olivatto da Silva

2011-09-01

Full Text Available Resenha do livroSHORTER, Aylward. African recruits and missionary conscripts: the White Fathers and the Great War (1914 – 1922. London: Missionaries of Africa History Project, 2007. 270 p. ISBN: 9780955523502

Systematics of a kleptoplastidal dinoflagellate, Gymnodinium eucyaneum Hu (Dinophyceae, and its cryptomonad endosymbiont.

Directory of Open Access Journals (Sweden)

Shuang Xia

Full Text Available New specimens of the kleptoplastidal dinoflagellate Gymnodinium eucyaneum Hu were collected in China. We investigated the systematics of the dinoflagellate and the origin of its endosymbiont based on light morphology and phylogenetic analyses using multiple DNA sequences. Cells were dorsoventrally flattened with a sharply acute hypocone and a hemispherical epicone. The confusion between G. eucyaneum and G. acidotum Nygaard still needs to be resolved. We found that the hypocone was conspicuously larger than the epicone in most G. eucyaneum cells, which differed from G. acidotum, but there were a few cells whose hypocone and epicone were of nearly the same size. In addition, there was only one site difference in the partial nuclear LSU rDNA sequences of a sample from Japan given the name G. acidotum and G. eucyaneum in the present study, which suggest that G. eucyaneum may be a synonym of G. acidotum. Spectroscopic analyses and phylogenetic analyses based on nucleomorph SSU rDNA sequences and chloroplast 23 s rDNA sequences suggested that the endosymbiont of G. eucyaneum was derived from Chroomonas (Cryptophyta, and that it was most closely related to C. coerulea Skuja. Moreover, the newly reported kleptoplastidal dinoflagellates G. myriopyrenoides and G. eucyaneum in our study were very similar, and the taxonomy of kleptoplastidal dinoflagellates was discussed.

Red cell survival and sequestration in acute intermittent porphyria

International Nuclear Information System (INIS)

Nawalkha, P.L.; Soni, S.G.; Agrawal, V.K.; Misra, S.N.

1980-01-01

Life span and sequestration of red cells have been studied in twenty one proved cases of acute intermittent porphyria of different age and sex group from Bikaner District, Rajasthan State (India). Chromium-51 labelled red cells were used in the study and the excess count method of Bughe Jones and Szur was used to calculate the index of sequestration. The mean apparent half survival time of erythrocytes in the control subjects was 25.9 +- 2.9 (S.D.) days and the same in the prophyria patients was 27.0 +- 3.8 days. This shows that the life span of red cells is normal in both the patient and the control. Excess destruction of red blood cells was found to take place in either spleen or liver in the disease and no excess accumulation of erythrocytes occurred over spleen as compared to liver. (M.G.B.)

Taxonomy and phylogeny of a new kleptoplastidal dinoflagellate, Gymnodinium myriopyrenoides sp. nov. (Gymnodiniales, Dinophyceae), and its cryptophyte symbiont.

Science.gov (United States)

Yamaguchi, Haruyo; Nakayama, Takeshi; Kai, Atsushi; Inouye, Isao

2011-10-01

A new kleptoplastidal dinoflagellate, Gymnodinium myriopyrenoides sp. nov., was described using light microscopy, electron microscopy and phylogengetic analysis based on partial LSU rDNA sequences. Cells were dorsiventrally flattened, elongate-elliptical in ventral view. There was no displacement of the cingulum encircling the anterior part of the cell. The cingulum was curved posteriorly at the terminal junction with the sulcus. The sulcus was generally narrow but expanded in the posterior end. The epicone possessed an apical groove made of one and one-half counterclockwise revolutions. Phylogenetic analysis based on LSU rDNA showed that the sequence of G. myriopyrenoides was included in the Gymnodiniales sensu stricto clade and had special affinities with the species Amphidinium poecilochroum and Gymnodinium acidotum, which also harbor kleptochloroplasts. Phylogenetic analysis based on plastid-encoded SSU rDNA and ultrastructural observations suggested that the symbionts of G. myriopyrenoides were cryptophytes of the genus Chroomonas or Hemiselmis. Organelles including the nucleus, the nucleomorph, mitochondria, Golgi bodies and large chloroplasts remained in the cytoplasm of the symbionts, but not the periplast, ejectosomes or flagellar apparatus. The symbiotic level of G. myriopyrenoides was estimated to be a relatively early stage in the unarmored kleptoplastidal dinoflagellates. Copyright © 2011 Elsevier GmbH. All rights reserved.

17 CFR 270.3c-3 - Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt...

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt securities offered by small business... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-3 Definition of certain...

Spin-isospin excitation in sd-shell nuclei studied by the (d,2He) reaction at Ed=270MeV

International Nuclear Information System (INIS)

Niizeki, T.; Ohnuma, H.; Yamamoto, T.; Katoh, K.; Yamashita, T.; Hara, Y.; Okamura, H.; Sakai, H.; Ishida, S.; Sakamoto, N.; Otsu, H.; Wakasa, T.; Uesaka, T.; Satou, Y.; Fujita, T.; Ichihara, T.; Orihara, H.; Toyokawa, H.; Hatanaka, K.; Kato, S.; Kubono, S.; Yosoi, M.

1994-01-01

The (d, 2 He) reactions on 24 Mg, 26 Mg and 28 Si were studied at E d =270MeV. The 0 cross sections obtained for the 1 + states from the 24 Mg, 28 Si(d, 2 He) reactions show a good correlation with those from the mirror (p,n) reactions. Four peaks were identified in the 26 Mg(d, 2 He) 26 Ne reaction as being due to the 1 + excitation. The B(GT + ) values for these transitions were estimated and compared with the shell model prediction. ((orig.))

Analyzing powers Ayy, Axx, Axz and Ay in the dd→3Hen reaction at 270 MeV

International Nuclear Information System (INIS)

Janek, M.; Saito, T.; Hatano, M.; Kato, H.; Sakoda, S.; Uchigashima, N.; Yako, K.; Ladygin, V.P.; Isupov, A. Yu.; Ladygina, N.B.; Malakhov, A.I.; Reznikov, S.G.; Vasiliev, T.A.; Uesaka, T.; Maeda, Y.; Suda, K.; Nishikawa, J.; Ohnishi, T.; Sakamoto, N.; Sekiguchi, K.; Okamura, H.; Sakai, H.

2007-01-01

The data on the tensor A yy , A xx , A xz and vector A y analyzing powers in the dd → 3 Hen obtained at T d =270 MeV in the angular range 0 -110 in the c.m. are presented. The observed negative sign of the tensor analyzing powers A yy , A xx and A xz at small angles clearly demonstrate the sensitivity to the ratio of the D- and S-wave component of the 3 He wave function. However, the one-nucleon exchange calculations by using the standard 3 He wave functions have failed to reproduce the strong variation of the tensor analyzing powers as a function of the angle in the c.m. (orig.)

Analyzing powers Ayy, Axx, Axz and Ay in the dd→3Hen reaction at 270 MeV

International Nuclear Information System (INIS)

Janek, M.; Saito, T.; Ladygin, V.P.

2007-01-01

The data on the tensor A yy , A xx , A xz and vector A y analyzing powers in the dd→ 3 Hen reaction obtained at T d =270 MeV in the angular range 0-110 deg in the c.m. are presented. The observed negative sign of the tensor analyzing powers A yy , A xx and A xz at small angles clearly demonstrates the sensitivity to the ratio of the D- and S-wave component of the 3 He wave function. However, the one-nucleon exchange calculations by using the standard 3 He wave functions have failed to reproduce the strong variation of the tensor analyzing powers as a function of the angle in the c.m

Ressonância magnética na esclerose múltipla: análise de 270 casos

Directory of Open Access Journals (Sweden)

Minguetti Guilberto

2001-01-01

Full Text Available O autor apresenta 270 casos de pacientes com história clínica e imagens de ressonância magnética compatíveis com esclerose múltipla. São feitas considerações sobre a incidência quanto ao sexo, grupos etários e localização das lesões. Por se tratar de doença considerada rara nos países tropicais, o autor tece considerações didáticas sobre os critérios clínicos e de imagem úteis na prática radiológica e alerta os neurologistas para o significado desta doença na capital (Curitiba de um estado brasileiro (Paraná situado entre os paralelos 22º e 30º Sul.

Low-cost encapsulation materials for terrestrial solar cell modules

Science.gov (United States)

Cuddihy, E. F.; Baum, B.; Willis, P.

1979-01-01

The paper presents the findings of material surveys intended to identify low cost materials which could be functional as encapsulants (by 1986) for terrestrial solar cell modules. Economic analyses have indicated that in order to meet the low cost goal of $2.70 per sq m, some or all of the following material technologies must be developed or advanced: (1) UV screening outer covers; (2) elastomeric acrylics; (3) weatherproofing and waterproofing of structural wood and paper products; (4) transparent UV stabilizers for the UV-sensitive transparent pottants; and (5) cost-effective utilization of silicone and fluorocarbon materials.

Precombustion desulfurization using Microcel{trademark} and multi-gravity separator

Energy Technology Data Exchange (ETDEWEB)

Yoon, R.H.; Luttrell, G.H.; Venkatraman, P. [Virginia Polytechnic Institute and State Univ., Blacksburg, VA (United States)

1994-12-31

Studies conducted at the Center for Coal and Minerals Processing (CCMP) indicate that surface-based processes such as froth flotation are inefficient in removing pyrite from fine coal. This shortcoming has been attributed to the fact that pyrite can become hydrophobic under certain conditions and to the inability of flotation to reject middling particles. To overcome these deficiencies, a new processing scheme has been developed at CCMP which involved the use of the Microcel{trademark} flotation column in combination with a centrifugal flowing-film separator, called a Multi-Gravity Separator (MGS). The flotation column removes ash-forming minerals such as clay, while the MGS is effective in removing pyrite. Preliminary test data obtained with high-sulfur coals shows that this processing scheme can nearly double the pyritic sulfur rejection with little loss in clean coal yield. This article discusses the underlying principles of the new circuit and provides test results obtained using eastern U.S. coals.

270GHz SiGe BiCMOS manufacturing process platform for mmWave applications

Science.gov (United States)

Kar-Roy, Arjun; Preisler, Edward J.; Talor, George; Yan, Zhixin; Booth, Roger; Zheng, Jie; Chaudhry, Samir; Howard, David; Racanelli, Marco

2011-11-01

TowerJazz has been offering the high volume commercial SiGe BiCMOS process technology platform, SBC18, for more than a decade. In this paper, we describe the TowerJazz SBC18H3 SiGe BiCMOS process which integrates a production ready 240GHz FT / 270 GHz FMAX SiGe HBT on a 1.8V/3.3V dual gate oxide CMOS process in the SBC18 technology platform. The high-speed NPNs in SBC18H3 process have demonstrated NFMIN of ~2dB at 40GHz, a BVceo of 1.6V and a dc current gain of 1200. This state-of-the-art process also comes with P-I-N diodes with high isolation and low insertion losses, Schottky diodes capable of exceeding cut-off frequencies of 1THz, high density stacked MIM capacitors, MOS and high performance junction varactors characterized up to 50GHz, thick upper metal layers for inductors, and various resistors such as low value and high value unsilicided poly resistors, metal and nwell resistors. Applications of the SBC18H3 platform for millimeter-wave products for automotive radars, phased array radars and Wband imaging are presented.

Characterization of a Latent Virus-Like Infection of Symbiotic Zooxanthellae▿

Science.gov (United States)

Lohr, Jayme; Munn, Colin B.; Wilson, William H.

2007-01-01

A latent virus-like agent, which we designated zooxanthella filamentous virus 1 (ZFV1), was isolated from Symbiodinium sp. strain CCMP 2465 and characterized. Transmission electron microscopy and analytical flow cytometry revealed the presence of a new group of distinctive filamentous virus-like particles after exposure of the zooxanthellae to UV light. Examination of thin sections of the zooxanthellae revealed the formation and proliferation of filamentous virus-like particles in the UV-induced cells. Assessment of Symbiodinium sp. cultures was used here as a model to show the effects of UV irradiance and induction of potential latent viruses. The unique host-virus system described here provides insight into the role of latent infections in zooxanthellae through environmentally regulated viral induction mechanisms. PMID:17351090

Characterization of a latent virus-like infection of symbiotic zooxanthellae.

Science.gov (United States)

Lohr, Jayme; Munn, Colin B; Wilson, William H

2007-05-01

A latent virus-like agent, which we designated zooxanthella filamentous virus 1 (ZFV1), was isolated from Symbiodinium sp. strain CCMP 2465 and characterized. Transmission electron microscopy and analytical flow cytometry revealed the presence of a new group of distinctive filamentous virus-like particles after exposure of the zooxanthellae to UV light. Examination of thin sections of the zooxanthellae revealed the formation and proliferation of filamentous virus-like particles in the UV-induced cells. Assessment of Symbiodinium sp. cultures was used here as a model to show the effects of UV irradiance and induction of potential latent viruses. The unique host-virus system described here provides insight into the role of latent infections in zooxanthellae through environmentally regulated viral induction mechanisms.

Prevalence of and risk factors associated with cesarean section in Lebanon - A retrospective study based on a sample of 29,270 women.

Science.gov (United States)

Zgheib, Sandy M; Kacim, Mohammad; Kostev, Karel

2017-12-01

During the last decades, there has been an alarming and dramatic increase in the number of cesarean births in both developed and undeveloped countries. This increase has not been clinically justified but, nevertheless, has raised an important number of issues. The aim of this study was to determine the risk factors associated with the high cesarean section rates in Lebanon. This study is based on a sample of 29,270 Lebanese women who were pregnant between 2000 and 2015. Among these, 14,327 gave birth by cesarean section and 14,943 gave birth vaginally. To identify the risk factors of cesarean section, logistic regression was applied as a statistical method using the SPSS statistical package. Of the 29,270 pregnant women included in the study, 49% had cesarean sections while 51% gave birth vaginally. Repeat cesarean section accounted for 23% while vaginal birth after cesarean accounted for only 0.2% of deliveries. In addition, weekdays were associated with a preference of providers to carry out more cesarean sections. According to an analysis of our data using logistic regression, the risk factors associated with the increase in cesarean section rates were advanced maternal age, elective cesarean section, malpresentation of fetus, multiple birth, prolonged pregnancy, prolonged labor, and fetal distress. Based on these results, it is recommended that a new health policy be implemented to reduce the number of unnecessary cesarean deliveries in Lebanon. Copyright © 2017 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.

A common red algal origin of the apicomplexan, dinoflagellate, and heterokont plastids

Czech Academy of Sciences Publication Activity Database

Janouškovec, J.; Horák, A.; Oborník, Miroslav; Lukeš, Julius; Keeling, P. J.

2010-01-01

Roč. 107, č. 24 (2010), s. 10949-10954 ISSN 0027-8424 R&D Projects: GA AV ČR IAA601410907 Institutional research plan: CEZ:AV0Z60220518 Keywords : Apicomplexa * Chromera velia * CCMP3155 * plastid evolution * chloroplast genome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.771, year: 2010

A versatile coupled cell-free transcription-translation system based on tobacco BY-2 cell lysates.

Science.gov (United States)

Buntru, Matthias; Vogel, Simon; Stoff, Katrin; Spiegel, Holger; Schillberg, Stefan

2015-05-01

Cell-free protein synthesis is a powerful method for the high-throughput production of recombinant proteins, especially proteins that are difficult to express in living cells. Here we describe a coupled cell-free transcription-translation system based on tobacco BY-2 cell lysates (BYLs). Using a combination of fractional factorial designs and response surface models, we developed a cap-independent system that produces more than 250 μg/mL of functional enhanced yellow fluorescent protein (eYFP) and about 270 μg/mL of firefly luciferase using plasmid templates, and up to 180 μg/mL eYFP using linear templates (PCR products) in 18 h batch reactions. The BYL contains actively-translocating microsomal vesicles derived from the endoplasmic reticulum, promoting the formation of disulfide bonds, glycosylation and the cotranslational integration of membrane proteins. This was demonstrated by expressing a functional full-size antibody (∼ 150 μg/mL), the model enzyme glucose oxidase (GOx) (∼ 7.3 U/mL), and a transmembrane growth factor (∼ 25 μg/mL). Subsequent in vitro treatment of GOx with peptide-N-glycosidase F confirmed the presence of N-glycans. Our results show that the BYL can be used as a high-throughput expression and screening platform that is particularly suitable for complex and cytotoxic proteins. © 2014 Wiley Periodicals, Inc.

Prevalence of Coxsackievirus A6 and Enterovirus 71 in Hand, Foot and Mouth Disease in Nanjing, China in 2013.

Science.gov (United States)

Hu, Ya-Qian; Xie, Guang-Cheng; Li, Dan-Di; Pang, Li-Li; Xie, Jing; Wang, Peng; Chen, Ying; Yang, Jing; Cheng, Wei-Xia; Zhang, Qing; Jin, Yu; Duan, Zhao-Jun

2015-09-01

Although hand, foot and mouth disease (HFMD) has been strongly associated with enterovirus 71 (EV71), coxsackievirus A16 (CVA16) and other enteroviruses, studies regarding coxsackievirus A6 (CVA6) infection in HFMD are limited. The aim of this study was to identify the major etiological agents causing HFMD in Nanjing in 2013 and explore the clinical and genetic characteristics of the prevalent enterovirus (EV) types in HFMD. A total of 394 throat swabs were collected from hospitalized children diagnosed with HFMD from April to July 2013. EVs were detected by reverse transcription polymerase chain reaction of 5' UTR sequences. Genotyping and phylogenetic analysis were based on VP4 sequences. Demographic and clinical data were obtained. Of the specimens, 68.5% (270/394) were positive for EVs. The genotypes and detection rates were CVA6, 30.00% (81/270); EV71, 17.41% (47/270); HRV, 11.11% (30/270); CVA10, 3.33% (9/270); CVA2, 1.11% (3/270); CVA16, 0.74% (2/270); EV68, 0.37% (1/270); echovirus 6, 0.37% (1/270); echovirus 9, 0.37% (1/270), respectively. Patients infected with CVA6 displayed symptoms atypical of HFMD, including larger vesicles on their limbs and buttocks. Phylogenetic analysis revealed 2 genetically distinct CVA6 strains that circulated independently within the region. Patients infected with CVA6 were more likely to have abnormal periphery blood white blood cell and C-reactive protein levels, while EV71 was more likely to infect the central nervous system, as indicated by clinical manifestations and white blood cell analysis of cerebrospinal fluid. Multiple EV genotypes contributed to HFMD in Nanjing in 2013, and CVA6 was the dominant genotype. The clinical presentation of CVA6 infection differs from that of EV71 infection in HFMD.

An SSH library responsive to azadirachtin A constructed in Spodoptera litura Fabricius cell lines.

Science.gov (United States)

Yan, Chao; Zhang, Zhi-Xiang; Xu, Han-Hong

2012-05-31

The present study revealed differentially expressed genes responsive to azadirachtin A (Aza) in Spodoptera litura cell line through suppression subtractive hybridization. In the Aza-responsive SSH library, approximately 270 sequences represent 53 different identified genes encoding proteins with various predicted functions, and the percentages of the gene clusters were 26.09% (genetic information processing), 11.41% (cell growth and death), 7.07% (metabolism), 6.52% (signal transduction/transport) and 2.72% (immunity), respectively. Eleven clones homologous to identified genes were selected to be confirmed through quantitative real time polymerase chain reaction. Among the eleven clones validated, all but one transcript of lipase showed an increase in SL cell line collected from ETA, whereas the transcripts of other genes were lower in the SL cell line collected from ETA compared with that of UETA. These genes were considered to be related to the response of SL cell line to Aza. These will provide a new clue to uncover the molecular mechanisms of Aza acting on SL cell line. Copyright © 2012 Elsevier B.V. All rights reserved.

Na+-dependent nucleoside transport in liver: two different isoforms from the same gene family are expressed in liver cells.

OpenAIRE

Felipe, A; Valdes, R; Santo, B; Lloberas, J; Casado, J; Pastor-Anglada, M

1998-01-01

Hepatocytes show a Na+-dependent nucleoside transport activity that is kinetically heterogeneous and consistent with the expression of at least two independent concentrative Na+-coupled nucleoside transport systems (Mercader et al. Biochem. J. 317, 835-842, 1996). So far, only a single nucleoside carrier-related cDNA (SPNT) has been isolated from liver cells (Che et al. J. Biol. Chem. 270, 13596-13599, 1995). This cDNA presumably encodes a plasma membrane protein responsible for Na+-dependent...

Genome variations associated with viral susceptibility and calcification in Emiliania huxleyi.

Science.gov (United States)

Kegel, Jessica U; John, Uwe; Valentin, Klaus; Frickenhaus, Stephan

2013-01-01

Emiliania huxleyi, a key player in the global carbon cycle is one of the best studied coccolithophores with respect to biogeochemical cycles, climatology, and host-virus interactions. Strains of E. huxleyi show phenotypic plasticity regarding growth behaviour, light-response, calcification, acidification, and virus susceptibility. This phenomenon is likely a consequence of genomic differences, or transcriptomic responses, to environmental conditions or threats such as viral infections. We used an E. huxleyi genome microarray based on the sequenced strain CCMP1516 (reference strain) to perform comparative genomic hybridizations (CGH) of 16 E. huxleyi strains of different geographic origin. We investigated the genomic diversity and plasticity and focused on the identification of genes related to virus susceptibility and coccolith production (calcification). Among the tested 31940 gene models a core genome of 14628 genes was identified by hybridization among 16 E. huxleyi strains. 224 probes were characterized as specific for the reference strain CCMP1516. Compared to the sequenced E. huxleyi strain CCMP1516 variation in gene content of up to 30 percent among strains was observed. Comparison of core and non-core transcripts sets in terms of annotated functions reveals a broad, almost equal functional coverage over all KOG-categories of both transcript sets within the whole annotated genome. Within the variable (non-core) genome we identified genes associated with virus susceptibility and calcification. Genes associated with virus susceptibility include a Bax inhibitor-1 protein, three LRR receptor-like protein kinases, and mitogen-activated protein kinase. Our list of transcripts associated with coccolith production will stimulate further research, e.g. by genetic manipulation. In particular, the V-type proton ATPase 16 kDa proteolipid subunit is proposed to be a plausible target gene for further calcification studies.

[Escherichia coli heat-labile enterotoxin B subunit enhances the immune response against canine parvovirus VP2 in mice immunized by VP2 DNA vaccine].

Science.gov (United States)

Han, Dongmei; Zhong, Fei; Li, Xiujin; Wang, Wei; Wang, Xingxing; Pan, Sumin

2011-01-01

To investigate the effect of Escherichia coli heat-labile enterotoxin (LT) B subunit (LTB) gene on canine parvovirus (CPV) VP2 gene vaccine. The LTB gene was amplified by PCR from genomic DNA of E. coli 44815 strain. The VP2-70 fragment (210 bp) encoding major epitope of VP2 (70 amino acids) was amplified by PCR from a plasmid encoding VP2 gene. VP2-70 and LTB genes were inserted into the eukaryotic vector to construct VP2-70 gene,LTB gene and VP2-70-LTB fused gene vectors. The mice were immunized with VP2-70 vector, VP2-70-LTB fused vector, or VP2-70 vector plus LTB vector, respectively. The antibody titers at the different time were measured by using ELISA method. The spleen lymphocyte proliferation activity was analyzed by 3-(4, 5-Dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT) assay. The sequence of VP2-70 and LTB genes was identified. The recombinant VP2-70 and LTB proteins could be expressed in HEK293T cells in a secretory manner. The mice immunized with VP2-70 vector, VP2-70-LTB vector or VP2-70 vector plus LTB vector could generate the specific antibody against VP2 protein. The antibody titer immunized with VP2-70-LTB vector reached 1:5120 at 35 d post immunization, significantly higher than that of other two groups (P vaccine in mice.

Targeting Stromal-Cancer Cell Crosstalk Networks in Ovarian Cancer Treatment

Directory of Open Access Journals (Sweden)

Tsz-Lun Yeung

2016-01-01

Full Text Available Ovarian cancer is a histologically, clinically, and molecularly diverse disease with a five-year survival rate of less than 30%. It has been estimated that approximately 21,980 new cases of epithelial ovarian cancer will be diagnosed and 14,270 deaths will occur in the United States in 2015, making it the most lethal gynecologic malignancy. Ovarian tumor tissue is composed of cancer cells and a collection of different stromal cells. There is increasing evidence that demonstrates that stromal involvement is important in ovarian cancer pathogenesis. Therefore, stroma-specific signaling pathways, stroma-derived factors, and genetic changes in the tumor stroma present unique opportunities for improving the diagnosis and treatment of ovarian cancer. Cancer-associated fibroblasts (CAFs are one of the major components of the tumor stroma that have demonstrated supportive roles in tumor progression. In this review, we highlight various types of signaling crosstalk between ovarian cancer cells and stromal cells, particularly with CAFs. In addition to evaluating the importance of signaling crosstalk in ovarian cancer progression, we discuss approaches that can be used to target tumor-promoting signaling crosstalk and how these approaches can be translated into potential ovarian cancer treatment.

Fission of 209 Bi by 60-270 MeV tagged photons: cross section measurement and analysis of photo fissility

International Nuclear Information System (INIS)

Terranova, M.L.; Tavares, O.A.P.

1996-07-01

Tagged photons produced by the ROKK-2 facility have been used to measure the photofission cross section of 209 Bi in the energy range 60-270 MeV. Photofission events were detected by using a nuclear fragment detector designed for fission experiments, based on multiwire spark counters. Fissility values have been deduced and compared with available data obtained in other laboratories by using monochromatic photons. These data, together with early measurements obtained near photofission threshold, have been analysed in the framework of a two-step model which considers the primary photo interaction occurring via the quasi-deuteron and/or photo mesonic processes, followed by a mechanism of evaporation-fission competition for the excited residual nucleus. The model was found to reproduce the main experimental features of 209 Bi photo fissility up to 300 MeV. (author). 52 refs., 7 figs., 2 tabs

Statistical Characterization of 18650-Format Lithium-Ion Cell Thermal Runaway Energy Distributions

Science.gov (United States)

Walker, William Q.; Rickman, Steven; Darst, John; Finegan, Donal; Bayles, Gary; Darcy, Eric

2017-01-01

Effective thermal management systems, designed to handle the impacts of thermal runaway (TR) and to prevent cell-to-cell propagation, are key to safe operation of lithium-ion (Li-ion) battery assemblies. Critical factors for optimizing these systems include the total energy released during a single cell TR event and the fraction of the total energy that is released through the cell casing vs. through the ejecta material. A unique calorimeter was utilized to examine the TR behavior of a statistically significant number of 18650-format Li-ion cells with varying manufacturers, chemistries, and capacities. The calorimeter was designed to contain the TR energy in a format conducive to discerning the fractions of energy released through the cell casing vs. through the ejecta material. Other benefits of this calorimeter included the ability to rapidly test of large quantities of cells and the intentional minimization of secondary combustion effects. High energy (270 Wh/kg) and moderate energy (200 Wh/kg) 18650 cells were tested. Some of the cells had an imbedded short circuit (ISC) device installed to aid in the examination of TR mechanisms under more realistic conditions. Other variations included cells with bottom vent (BV) features and cells with thin casings (0.22 1/4m). After combining the data gathered with the calorimeter, a statistical approach was used to examine the probability of certain TR behavior, and the associated energy distributions, as a function of capacity, venting features, cell casing thickness and temperature.

Preconditioner and convergence study for the Quantum Computer Aided Design (QCAD) nonlinear poisson problem posed on the Ottawa Flat 270 design geometry.

Energy Technology Data Exchange (ETDEWEB)

Kalashnikova, Irina

2012-05-01

A numerical study aimed to evaluate different preconditioners within the Trilinos Ifpack and ML packages for the Quantum Computer Aided Design (QCAD) non-linear Poisson problem implemented within the Albany code base and posed on the Ottawa Flat 270 design geometry is performed. This study led to some new development of Albany that allows the user to select an ML preconditioner with Zoltan repartitioning based on nodal coordinates, which is summarized. Convergence of the numerical solutions computed within the QCAD computational suite with successive mesh refinement is examined in two metrics, the mean value of the solution (an L{sup 1} norm) and the field integral of the solution (L{sup 2} norm).

Methods to isolate a large amount of generative cells, sperm cells and vegetative nuclei from tomato pollen for "omics" analysis.

Science.gov (United States)

Lu, Yunlong; Wei, Liqin; Wang, Tai

2015-01-01

The development of sperm cells (SCs) from microspores involves a set of finely regulated molecular and cellular events and the coordination of these events. The mechanisms underlying these events and their interconnections remain a major challenge. Systems analysis of genome-wide molecular networks and functional modules with high-throughput "omics" approaches is crucial for understanding the mechanisms; however, this study is hindered because of the difficulty in isolating a large amount of cells of different types, especially generative cells (GCs), from the pollen. Here, we optimized the conditions of tomato pollen germination and pollen tube growth to allow for long-term growth of pollen tubes in vitro with SCs generated in the tube. Using this culture system, we developed methods for isolating GCs, SCs and vegetative cell nuclei (VN) from just-germinated tomato pollen grains and growing pollen tubes and their purification by Percoll density gradient centrifugation. The purity and viability of isolated GCs and SCs were confirmed by microscopy examination and fluorescein diacetate staining, respectively, and the integrity of VN was confirmed by propidium iodide staining. We could obtain about 1.5 million GCs and 2.0 million SCs each from 180 mg initiated pollen grains, and 10 million VN from 270 mg initiated pollen grains germinated in vitro in each experiment. These methods provide the necessary preconditions for systematic biology studies of SC development and differentiation in higher plants.

Decreased CXCL12 is associated with impaired alveolar epithelial cell migration and poor lung healing after lung resection.

Science.gov (United States)

Kanter, Jacob A; Sun, Haiying; Chiu, Stephen; DeCamp, Malcolm M; Sporn, Peter H S; Sznajder, Jacob I; Bharat, Ankit

2015-10-01

Prolonged air leak (PAL) is an important cause of morbidity and mortality after lung resection, but its pathogenesis has not been elucidated. Migration of alveolar type II epithelial cells is essential for lung wound repair. Here we determined the role of C-X-C motif chemokine 12 (CXCL12) on alveolar epithelial cell migration and lung wound healing. CXCL12 in the pleural fluid of patients was analyzed using enzyme-linked immunosorbent assay. Human A549 and murine MLE12 alveolar epithelial cell lines were used for wound closure, cell migration, and proliferation assays. Western blot was used to analyze Rac1 and cofilin. Pleural CXCL12 was decreased in patients with PAL (1,389 ± 192 vs 3,270 ± 247 pg/mL; P alveolar epithelial cell migration by binding to its receptor CXCR4 and may have a role in lung healing. CXCL12-mediated alveolar epithelial cell migration is associated with Rac1 and cofilin activation. Copyright © 2015 Elsevier Inc. All rights reserved.

Methods to isolate a large amount of generative cells, sperm cells and vegetative nuclei from tomato pollen for omics analysis

Directory of Open Access Journals (Sweden)

Yunlong eLu

2015-06-01

Full Text Available The development of sperm cells from microspores involves a set of finely regulated molecular and cellular events and the coordination of these events. The mechanisms underlying these events and their interconnections remain a major challenge. Systems analysis of genome-wide molecular networks and functional modules with high-throughput omics approaches is crucial for understanding the mechanisms; however, this study is hindered because of the difficulty in isolating a large amount of cells of different types, especially generative cells (GCs, from the pollen. Here, we optimized the conditions of tomato pollen germination and pollen tube growth to allow for long-term growth of pollen tubes in vitro with sperm cells (SCs generated in the tube. Using this culture system, we developed methods for isolating GCs, SCs and vegetative-cell nuclei (VN from just-germinated tomato pollen grains and growing pollen tubes and their purification by Percoll density gradient centrifugation. The purity and viability of isolated GCs and SCs were confirmed by microscopy examination and fluorescein diacetate staining, respectively, and the integrity of VN was confirmed by propidium iodide staining. We could obtain about 1.5 million GCs and 2.0 million SCs each from 180 mg initiated pollen grains, and 10 million VN from 270 mg initiated pollen grains germinated in vitro in each experiment. These methods provide the necessary preconditions for systematic biology studies of SC development and differentiation in higher plants.

Consenso brasileiro em transplante de células-tronco hematopoéticas: comitê de hemoglobinopatias Brazilian consensus meeting on stem cell transplantation: hemoglobinopathies comittee

Directory of Open Access Journals (Sweden)

Belinda P. Simões

2010-05-01

Full Text Available Os distúrbios hereditários das hemoglobinas são as doenças genéticas mais frequentes do homem e mais difundidas no mundo, abrangendo sobretudo continentes como África, Américas, Europa e extensas regiões da Ásia. Estima-se que haja 270 milhões de portadores de hemoglobinopatias no mundo, dos quais 80 milhões são portadores de talassemia. Aproximadamente 60 mil crianças nascem anualmente no mundo com talassemia e 250 mil com anemia falciforme, dando uma frequência de 2,4 crianças afetadas para cada 1.000 nascimentos. No Brasil, a doenca falciforme é a doença hereditária monogênica mais comum, estimando-se que haja entre 20 a 30 mil pacientes portadores desta doenca. O transplante de células-tronco hematopoéticas alogênico (TCTH alo é atualmente a única modalidade terapêutica capaz de curar pacientes com hemoglobinopatias. Neste artigo discutiremos os dados disponíveis na literatura e sugerimos os critérios para a indicação do TCTH nas hemoglobinopatias.Hemoglobinopathies are the most prevalent genetic diseases in man. Most cases are described in Europe, Africa and in the Americas. About 270 million hemoglobinopathy carriers are alive today with 80 million being carriers of thalassemia. We estimate that, throughout the world, about 60,000 children are born annually with thalassemia and 250,000 with sickle cell disease with an estimated frequency of 2.4 children in every 1000 births. Sickle cell disease is the most common monogenic hereditary disease in Brazil with a total of from 20,000 to 30,000 patients. Allogeneic stem cell transplantation is the only curative approach. Here we describe published data and propose criteria to indicate stem cell transplantation in thalassemia and sickle cell disease patients.

Effect of UV C irradiation on P53 in FADD+/+ and FADD-/- cells

International Nuclear Information System (INIS)

Matic, Igor; Radnic, Maja; Marijanovic, Inga; Furcic, Ivana; Nagy, Biserka

2008-01-01

The dominant paradigm of tumor biology is that evasion from apoptosis is one of the crucial features of malignant diseases and that the efficiency of cancer therapy depends on P53-dependent apoptosis. Because of the importance of apoptotic pathways in protecting cells against malignant transformation, disruption of apoptosis is extremely common in cancer cells, and is frequently due to mutations in the P53 tumor suppressor gene. Fas-associated death domain (FADD) is an adapter protein that is required for apoptosis induced by all known death receptors. FADD is implicated in death receptor-independent apoptotic response, such as DNA damage. We used embryonic fibroblasts derived from FADD knockout mice and their genetic counterparts. We predicted that UV exposure induces a loss of FADD function and leads to mutations in P53. Loss of FADD expression causes deregulation of apoptosis and expansion of mutated cells and initiation of cancer. We predicted that FADD dysfunction may be potentially advantageous for tumor growth and that FADD can act as a tumor suppressor. Cells were irradiated with UV C light (254 nm) using a germicidal lamp (Upland, CA). The culture media was drained before the irradiation and fresh media was added after. In the first experiment we irradiated cells with a dose of 25 J/m 2 and after 5 days we isolated genomic DNA but part of the cells were irradiated again with the same dose. After 5 days DNA were isolated so the cumulative irradiation dose was 50 J/m 2 . In the second experiment cells were irradiated ones with the dose of 40 J/m 2 and DNA was isolated after 18 days. Lethal dosage for each cell line is 50 J/m 2 . Genomic DNA was analyzed by allele-specific polymerase chain reaction (AS-PCR) for CC to TT mutation at codons 154-155 and 175-176 in exon 5 and for C to T mutations at codons 270 and 275 in exon 8 of the P53 gene. The mutant-specific forward primer was used for each mutation. The reverse primers for amplification of mutations were

Improvement of wind field hindcasts for tropical cyclones

Directory of Open Access Journals (Sweden)

Yi Pan

2016-01-01

Full Text Available This paper presents a study on the improvement of wind field hindcasts for two typical tropical cyclones, i.e., Fanapi and Meranti, which occurred in 2010. The performance of the three existing models for the hindcasting of cyclone wind fields is first examined, and then two modification methods are proposed to improve the hindcasted results. The first one is the superposition method, which superposes the wind field calculated from the parametric cyclone model on that obtained from the Cross-Calibrated Multi-Platform (CCMP reanalysis data. The radius used for the superposition is based on an analysis of the minimum difference between the two wind fields. The other one is the direct modification method, which directly modifies the CCMP reanalysis data according to the ratio of the measured maximum wind speed to the reanalyzed value as well as the distance from the cyclone center. Using these two methods, the problem of underestimation of strong winds in reanalysis data can be overcome. Both methods show considerable improvements in the hindcasting of tropical cyclone wind fields, compared with the cyclone wind model and the reanalysis data.

Improvement of wind field hindcasts for tropical cyclones

Directory of Open Access Journals (Sweden)

Yi Pan

2016-01-01

Full Text Available This paper presents a study on the improvement of wind field hindcasts for two typical tropical cyclones, i.e., Fanapi and Meranti, which occurred in 2010. The performance of the three existing models for the hindcasting of cyclone wind fields is first examined, and then two modification methods are proposed to improve the hindcasted results. The first one is the superposition method, which superposes the wind field calculated from the parametric cyclone model on that obtained from the cross-calibrated multi-platform (CCMP reanalysis data. The radius used for the superposition is based on an analysis of the minimum difference between the two wind fields. The other one is the direct modification method, which directly modifies the CCMP reanalysis data according to the ratio of the measured maximum wind speed to the reanalyzed value as well as the distance from the cyclone center. Using these two methods, the problem of underestimation of strong winds in reanalysis data can be overcome. Both methods show considerable improvements in the hindcasting of tropical cyclone wind fields, compared with the cyclone wind model and the reanalysis data.

Rising CO2 interacts with growth light and growth rate to alter photosystem II photoinactivation of the coastal diatom Thalassiosira pseudonana.

Directory of Open Access Journals (Sweden)

Gang Li

Full Text Available We studied the interactive effects of pCO(2 and growth light on the coastal marine diatom Thalassiosira pseudonana CCMP 1335 growing under ambient and expected end-of-the-century pCO(2 (750 ppmv, and a range of growth light from 30 to 380 µmol photons·m(-2·s(-1. Elevated pCO(2 significantly stimulated the growth of T. pseudonana under sub-saturating growth light, but not under saturating to super-saturating growth light. Under ambient pCO(2 susceptibility to photoinactivation of photosystem II (σ(i increased with increasing growth rate, but cells growing under elevated pCO(2 showed no dependence between growth rate and σ(i, so under high growth light cells under elevated pCO(2 were less susceptible to photoinactivation of photosystem II, and thus incurred a lower running cost to maintain photosystem II function. Growth light altered the contents of RbcL (RUBISCO and PsaC (PSI protein subunits, and the ratios among the subunits, but there were only limited effects on these and other protein pools between cells grown under ambient and elevated pCO(2.

Efficacy and connectivity of intracolumnar pairs of layer 2/3 pyramidal cells in the barrel cortex of juvenile rats

Science.gov (United States)

Feldmeyer, Dirk; Lübke, Joachim; Sakmann, Bert

2006-01-01

Synaptically coupled layer 2/3 (L2/3) pyramidal neurones located above the same layer 4 barrel (‘barrel-related’) were investigated using dual whole-cell voltage recordings in acute slices of rat somatosensory cortex. Recordings were followed by reconstructions of biocytin-filled neurones. The onset latency of unitary EPSPs was 1.1 ± 0.4 ms, the 20–80% rise time was 0.7 ± 0.2 ms, the average amplitude was 1.0 ± 0.7 mV and the decay time constant was 15.7 ± 4.5 ms. The coefficient of variation (c.v.) of unitary EPSP amplitudes decreased with increasing EPSP peak and was 0.33 ± 0.18. Bursts of APs in the presynaptic pyramidal cell resulted in EPSPs that, over a wide range of frequencies (5–100 Hz), displayed amplitude depression. Anatomically the barrel-related pyramidal cells in the lower half of layer 2/3 have a long apical dendrite with a small terminal tuft, while pyramidal cells in the upper half of layer 2/3 have shorter and often more ‘irregularly’ shaped apical dendrites that branch profusely in layer 1. The number of putative excitatory synaptic contacts established by the axonal collaterals of a L2/3 pyramidal cell with a postsynaptic pyramidal cell in the same column varied between 2 and 4, with an average of 2.8 ± 0.7 (n = 8 pairs). Synaptic contacts were established predominantly on the basal dendrites at a mean geometric distance of 91 ± 47 μm from the pyramidal cell soma. L2/3-to-L2/3 connections formed a blob-like innervation domain containing 2.8 mm of the presynaptic axon collaterals with a bouton density of 0.3 boutons per μm axon. Within the supragranular layers of its home column a single L2/3 pyramidal cell established about 900 boutons suggesting that 270 pyramidal cells in layer 2/3 are innervated by an individual pyramidal cell. In turn, a single pyramidal cell received synaptic inputs from 270 other L2/3 pyramidal cells. The innervation domain of L2/3-to-L2/3 connections superimposes almost exactly with that of L4-to-L2

Effect of Ocean Acidification on the Food Quality of the Coccolithophore Emiliania huxleyi

Science.gov (United States)

Maine, J. E.; White, M. M.; Balch, W. M.; Milke, L. M.

2016-02-01

The anthropogenic burning of fossil fuels has doubled atmospheric carbon dioxide (CO2) levels over the last 200 years. Atmospheric CO2 diffuses into the ocean, changing the chemistry and decreasing the pH of seawater in a process called Ocean Acidification (OA). Calcifying marine phytoplankton, coccolithophores, are vulnerable to OA. Emiliania huxleyi is a lipid-dense and globally-abundant species of coccolithophore, therefore it is a vital food source for higher marine trophic levels. The objective of this project was to determine how OA affects the lipid profile and calcification of E. huxleyi CCMP #371. Gas chromatography was used to determine how the proportions of saturated (SFA), monounsaturated (MUFA), and polyunsaturated fatty acids (PUFA) in E. huxleyi varied with increasing pCO2. Flow cytometry was used to measure how the distribution of highly calcified cells, partially calcified cells, and un-calcified cells changed with increasing pCO2. The proportion of MUFA increased with pCO2. The proportion of un-calcified and partially calcified cells increased with increasing pCO2, however, the results varied across two experimental runs. In conclusion, the lipid-profile and calcification properties of E. huxleyi, and likely its food quality to predators, are affected by OA.

Tumor cell anaplasia and multinucleation are predictors of disease recurrence in oropharyngeal squamous cell carcinoma, including among just the human papillomavirus-related cancers.

Science.gov (United States)

Lewis, James S; Scantlebury, Juliette B; Luo, Jingqin; Thorstad, Wade L

2012-07-01

Oropharyngeal squamous cell carcinoma (SCC) is frequently related to high risk human papillomavirus. This tumor expresses p16, frequently has a nonkeratinizing morphology, and has improved outcomes. Despite having a good prognosis, tumors can have focal or diffuse nuclear anaplasia or multinucleation, the significance of which is unknown. From a database of 270 oropharyngeal SCCs with known histologic typing (using our established system) and p16 immunohistochemistry, all surgically resected cases (149) were reviewed. Anaplasia was defined as any × 40 field with ≥ 3 tumor nuclei with diameters ≥ 5 lymphocyte nuclei (~25 μm), and multinucleation was defined as any × 40 field with ≥ 3 tumor cells with multiple nuclei. p16 was positive in 128 cases (85.9%), 64 cases (43.0%) showed anaplasia, and 71 (47.7%) showed multinucleation. Anaplasia and multinucleation were highly related (Panaplasia or multinucleation had worse overall, disease-specific, and disease-free survival (Panaplasia and multinucleation both predicted worse disease-specific survival (hazard ratio 9.9, P=0.04; and hazard ratio 11.9, P=0.02, respectively) independent of the other variables. In summary, among surgically resectable oropharyngeal SCC (including among just the p16-positive cohort), tumor cell anaplasia and multinucleation independently correlated with disease recurrence and poorer survival.

Dicty_cDB: Contig-U16435-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available tkiflilglfafllvafapsssvatvnlesdgyteaeaklie ekgekftfqtevnklmniiinslyskkeiflrelisnasdaldkirflaltnad..........................done Score E Sequences producing significant alignments: (bits) Value JC7352( JC7352 )glucose-regulated...Q228115 |pid:none) Proteomonas sulcata strain CCMP704... 288 e-121 FM992694_186( FM992694 |pid:none) Candida dubliniensi..............done Score E Sequences producing significant alignments: (bits) Value N ( AB040814 ) Dictyostelium disc...is isolate JS854 ... 296 e-144 AY942619_1( AY942619 |pid:none) Leishmania braziliensi

Algicidal Effects of a Novel Marine Pseudoalteromonas Isolate (Class Proteobacteria, Gamma Subdivision) on Harmful Algal Bloom Species of the Genera Chattonella, Gymnodinium, and Heterosigma

Science.gov (United States)

Lovejoy, Connie; Bowman, John P.; Hallegraeff, Gustaaf M.

1998-01-01

During a bacterial survey of the Huon Estuary in southern Tasmania, Australia, we isolated a yellow-pigmented Pseudoalteromonas strain (class Proteobacteria, gamma subdivision), designated strain Y, that had potent algicidal effects on harmful algal bloom species. This organism was identified by 16S rRNA sequencing as a strain with close affinities to Pseudoalteromonas peptidysin. This bacterium caused rapid cell lysis and death (within 3 h) of gymnodinoids (including Gymnodinium catenatum) and raphidophytes (Chattonella marina and Heterosigma akashiwo). It caused ecdysis of armored dinoflagellates (e.g., Alexandrium catenella, Alexandrium minutum, and Prorocentrum mexicanum), but the algal cultures then recovered over the subsequent 24 h. Strain Y had no effect on a cryptomonad (Chroomonas sp.), a diatom (Skeletonema sp.), a cyanobacterium (Oscillatoria sp.), and two aplastidic protozoans. The algicidal principle of strain Y was excreted into the seawater medium and lost its efficacy after heating. Another common bacterial species, Pseudoalteromonas carrageenovora, was isolated at the same time and did not have these algicidal effects. The minimum concentrations of strain Y required to kill G. catenatum were higher than the mean concentrations found in nature under nonbloom conditions. However, the new bacterium showed a chemotactic, swarming behavior that resulted in localized high concentrations around target organisms. These observations imply that certain bacteria could play an important role in regulating the onset and development of harmful algal blooms. PMID:9687434

FRET imaging of hemoglobin concentration in Plasmodium falciparum-infected red cells.

Directory of Open Access Journals (Sweden)

Alessandro Esposito

Full Text Available During its intraerythrocytic asexual reproduction cycle Plasmodium falciparum consumes up to 80% of the host cell hemoglobin, in large excess over its metabolic needs. A model of the homeostasis of falciparum-infected red blood cells suggested an explanation based on the need to reduce the colloid-osmotic pressure within the host cell to prevent its premature lysis. Critical for this hypothesis was that the hemoglobin concentration within the host cell be progressively reduced from the trophozoite stage onwards.The experiments reported here were designed to test this hypothesis by direct measurements of the hemoglobin concentration in live, infected red cells. We developed a novel, non-invasive method to quantify the hemoglobin concentration in single cells, based on Förster resonance energy transfer between hemoglobin molecules and the fluorophore calcein. Fluorescence lifetime imaging allowed the quantitative mapping of the hemoglobin concentration within the cells. The average fluorescence lifetimes of uninfected cohorts was 270+/-30 ps (mean+/-SD; N = 45. In the cytoplasm of infected cells the fluorescence lifetime of calcein ranged from 290+/-20 ps for cells with ring stage parasites to 590+/-13 ps and 1050+/-60 ps for cells with young trophozoites and late stage trophozoite/early schizonts, respectively. This was equivalent to reductions in hemoglobin concentration spanning the range from 7.3 to 2.3 mM, in line with the model predictions. An unexpected ancillary finding was the existence of a microdomain under the host cell membrane with reduced calcein quenching by hemoglobin in cells with mature trophozoite stage parasites.The results support the predictions of the colloid-osmotic hypothesis and provide a better understanding of the homeostasis of malaria-infected red cells. In addition, they revealed the existence of a distinct peripheral microdomain in the host cell with limited access to hemoglobin molecules indicating the

Non-traditional CD4+CD25-CD69+ regulatory T cells are correlated to leukemia relapse after allogeneic hematopoietic stem cell transplantation.

Science.gov (United States)

Zhao, Xiao-su; Wang, Xu-hua; Zhao, Xiang-yu; Chang, Ying-jun; Xu, Lan-ping; Zhang, Xiao-hui; Huang, Xiao-jun

2014-07-01

Non-traditional CD4+CD25-CD69+ T cells were found to be involved in disease progression in tumor-bearing mouse models and cancer patients recently. We attempted to define whether this subset of T cells were related to leukemia relapse after allogeneic hematopoietic cell transplantation (allo-HSCT). The frequency of CD4+CD25-CD69+ T cells among the CD4+ T cell population from the bone marrow of relapsed patients, patients with positive minimal residual disease (MRD+) and healthy donors was examined by flow cytometry. The CD4+CD25-CD69+ T cells were also stained with the intracellular markers to determine the cytokine (TGF-β, IL-2 and IL-10) secretion. The results showed that the frequency of CD4+CD25-CD69 + T cells was markedly increased in patients in the relapsed group and the MRD + group compared to the healthy donor group. The percentage of this subset of T cells was significantly decreased after effective intervention treatment. We also analyzed the reconstitution of CD4+CD25-CD69+ T cells at various time points after allo-HSCT, and the results showed that this subset of T cells reconstituted rapidly and reached a relatively higher level at +60 d in patients compared to controls. The incidence of either MRD+ or relapse in patients with a high frequency of CD4+CD25-CD69+ T cells (>7%) was significantly higher than that of patients with a low frequency of CD4+CD25-CD69+ T cells at +60 d, +90 d and +270 d after transplant. However, our preliminary data indicated that CD4+CD25-CD69+ T cells may not exert immunoregulatory function via cytokine secretion. This study provides the first clinical evidence of a correlation between non-traditional CD4+CD25-CD69+ Tregs and leukemia relapse after allo-HSCT and suggests that exploration of new methods of adoptive immunotherapy may be beneficial. Further research related to regulatory mechanism behind this phenomenon would be necessary.

Association between morphometric variables and nocturnal desaturation in sickle-cell anemia.

Science.gov (United States)

Salles, Cristina; Bispo, Marcelo; Trindade-Ramos, Regina Terse

2014-01-01

to evaluate associations between morphometric variables, cervical circumference (CC), and abdominal circumference (AC) with the presence of nocturnal desaturation in children and adolescents with sickle-cell anemia. all patients were submitted to baseline polysomnography, oral cavity measurements (maxillary intermolar distance, mandibular intermolar distance, and overjet), and CC and AC measurements. a total of 85 patients were evaluated. A positive correlation was observed between the height/age Z-score and CC measurement (r = 0.233, p = 0.031). The presence of nocturnal desaturation was associated with CC (59.2± 9.3 vs. 67.5 ± 10.7, p = 0.006) and AC measurements (27.0 ± 2.0 vs. 29.0± 2.1, p = 0.028). There was a negative correlation between desaturation and maxillary intermolar distance (r = -0.365, p = 0.001) and mandibular intermolar distance (r = -0.233, p = 0.037). the morphometric variables of CC and AC may contribute to raise suspicion of nocturnal desaturation in children and adolescents with sickle-cell anemia. Copyright © 2014 Sociedade Brasileira de Pediatria. Published by Elsevier Editora Ltda. All rights reserved.

Association between morphometric variables and nocturnal desaturation in sickle-cell anemia

Directory of Open Access Journals (Sweden)

Cristina Salles

2014-07-01

Full Text Available OBJECTIVE: to evaluate associations between morphometric variables, cervical circumference (CC, and abdominal circumference (AC with the presence of nocturnal desaturation in children and adolescents with sickle-cell anemia. METHODS: all patients were submitted to baseline polysomnography, oral cavity measurements (maxillary intermolar distance, mandibular intermolar distance, and overjet, and CC and AC measurements. RESULTS: a total of 85 patients were evaluated. A positive correlation was observed between the height/age Z-score and CC measurement (r = 0.233, p = 0.031. The presence of nocturnal desaturation was associated with CC (59.2± 9.3 vs. 67.5 ± 10.7, p = 0.006 and AC measurements (27.0 ± 2.0 vs. 29.0± 2.1, p = 0.028. There was a negative correlation between desaturation and maxillary intermolar distance (r = -0.365, p = 0.001 and mandibular intermolar distance (r = -0.233, p = 0.037. CONCLUSIONS: the morphometric variables of CC and AC may contribute to raise suspicion of nocturnal desaturation in children and adolescents with sickle-cell anemia.

Net sea–air CO2 flux uncertainties in the Bay of Biscay based on the choice of wind speed products and gas transfer parameterizations

Directory of Open Access Journals (Sweden)

P. Otero

2013-05-01

Full Text Available The estimation of sea–air CO2 fluxes is largely dependent on wind speed through the gas transfer velocity parameterization. In this paper, we quantify uncertainties in the estimation of the CO2 uptake in the Bay of Biscay resulting from the use of different sources of wind speed such as three different global reanalysis meteorological models (NCEP/NCAR 1, NCEP/DOE 2 and ERA-Interim, one high-resolution regional forecast model (HIRLAM-AEMet, winds derived under the Cross-Calibrated Multi-Platform (CCMP project, and QuikSCAT winds in combination with some of the most widely used gas transfer velocity parameterizations. Results show that net CO2 flux estimations during an entire seasonal cycle (September 2002–September 2003 may vary by a factor of ~ 3 depending on the selected wind speed product and the gas exchange parameterization, with the highest impact due to the last one. The comparison of satellite- and model-derived winds with observations at buoys advises against the systematic overestimation of NCEP-2 and the underestimation of NCEP-1. In the coastal region, the presence of land and the time resolution are the main constraints of QuikSCAT, which turns CCMP and ERA-Interim in the preferred options.

Carbon Mineralization by Aqueous Precipitation for Beneficial Use of CO2 from Flue Gas

Energy Technology Data Exchange (ETDEWEB)

Devenney, Martin; Gilliam, Ryan; Seeker, Randy

2014-06-01

The objective of this project is to demonstrate an innovative process to mineralize CO2 from flue gas directly to reactive carbonates and maximize the value and versatility of its beneficial use products. The program scope includes the design, construction, and testing of a CO2 Conversion to Material Products (CCMP) Pilot Demonstration Plant utilizing CO2 from the flue gas of a power production facility in Moss Landing, CA as well as flue gas from coal combustion. This topical report covers Phase 2b, which is the construction phase of pilot demonstration subsystems that make up the integrated plant. The subsystems included are the mineralization subsystem, the Alkalinity Based on Low Energy (ABLE) subsystem, the waste calcium oxide processing subsystem, and the fiber cement board production subsystem. The fully integrated plant is now capable of capturing CO2 from various sources (gas and coal) and mineralizing into a reactive calcium carbonate binder and subsequently producing commercial size (4ftx8ft) fiber cement boards. The topical report provides a description of the “as built” design of these subsystems and the results of the commissioning activities that have taken place to confirm operability. At the end of Phase 2b, the CCMP pilot demonstration is fully ready for testing.

Using interactive multimedia e-Books for learning blood cell morphology in pediatric hematology.

Science.gov (United States)

Hsiao, Chih-Cheng; Tiao, Mao-Meng; Chen, Chih-Cheng

2016-11-14

This prospective study compares the use of interactive multimedia eBooks (IME) with traditional PowerPoint (TPP) for teaching cell morphology of blood and bone marrow. Fifty-one interns from three Taiwan medical schools training by a single teacher in the pediatric hematology department of Kaohsiung Chang Gung Memorial Hospital, Taiwan, participated in this study. 25 interns were allocated for training with a traditional PowerPoint atlas and 26 interns for training with an interactive multimedia eBook atlas. Learning outcomes were examined by pre-test and post-test using the CellQuiz of CellAtlas App. Attitudes and perceptions were collected by survey questions regarding interest, motivation and effectiveness. There was no difference in the pre-test scores between TPP and IME groups (mean score 27.0 versus 27.9, p = 0.807). However, the interns in the interactive multimedia eBook group achieved significantly better scores in the post-test than the ones in the PowerPoint group (mean score 103.2 versus 70.6; p < 0.001). Overall results of interest, motivation and effectiveness were strongly positive in the multimedia eBook group. Our data supports that interactive multimedia eBooks are more effective than PowerPoint to facilitate learning of cell morphology of blood and bone marrow.

Outcomes of Solo Smart valve in a single-center experience of 270 patients.

Science.gov (United States)

Liu, Hao; Khani-Hanjani, Abbas; Yang, Siyuan; Wang, Wei; Sidhu, Surita; Mullen, John; Modry, Dennis; Wang, Shaohua

2018-04-03

The Solo Smart pericardial aortic valve has been widely used in Europe as an option for aortic valve replacement (AVR). We are reporting early and midterm clinical outcomes of AVR with the Solo Smart valve in a single North America center. This is a retrospective study of 270 consecutive patients who had AVR at Mazankowski Alberta Heart Institute from February 2011 to March 2015. Follow-up and echocardiographic data were collected retrospectively from electronic and paper charts. Univariate and multivariate analysis were performed to evaluate the results. The mean age was 71.2±10.0 years, 67.4% were male, and 79.3% had combined procedures. Mean STS Score was 4.18±3.91. Early mortality was 3.7% for the entire group and 0% for isolated aortic valve replacement group. Mean cross-clamp time for isolated AVR and AVR with concomitant procedure was 70.8±12.7min and 117.0±45.0min, respectively. Permanent pacemaker implantation was necessary in 2.2% of patients. Echocardiography demonstrated a reduction in mean gradients from 40.8±17.4mmHg to 7.6±3.7 mmHg and peak gradient from 72.5 ± 48.8 mmHg to 15.5±7.5 mmHg. The 1-, 3-, and 5- year overall survival was 93.0%, 86.5% and 75.9%, respectively. At 5 years, freedom from valve-related death was 92.4%, freedom from structural valve deterioration and freedom from aortic valve reoperation were 96.4% and 98%, respectively. The Solo Smart valve is safe and has excellent hemodynamic performance. Aortic valve reoperation and rates of valve-related adverse events during midterm follow-up were low.

Tensor analyzing power T20 of the dd →3Hen and dd →3Hp reactions at zero angle for energies 140, 200, and 270 MeV

International Nuclear Information System (INIS)

Ladygin, V. P.; Uesaka, T.; Saito, T.; Hatano, M.; Isupov, A. Yu.; Kato, H.; Ladygina, N. B.; Maeda, Y.; Malakhov, A. I.; Nishikawa, J.; Ohnishi, T.; Okamura, H.; Reznikov, S. G.; Sakai, H.; Sakamoto, N.; Sakoda, S.; Satou, Y.; Sekiguchi, K.; Suda, K.; Tamii, A.

2006-01-01

RIKEN Accelerator Research Facility data on the tensor analyzing power T 20 of the dd → 3 Hen and dd → 3 Hp reactions at zero angle for deuteron kinetic energies of 140, 200, and 270 MeV are reported. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S-wave ratio in the 3 He and 3 H wave functions in the energy range of the experiment. Data on T 20 for the 3 Hen channel are in agreement with those for the 3 Hp channel within the experimental errors

The influence of light on copper-limited growth of an oceanic diatom, Thalassiosira oceanica (Coscinodiscophyceae).

Science.gov (United States)

Kim, Jun-Woo; Price, Neil M

2017-10-01

Thalassiosira oceanica (CCMP 1005) was grown over a range of copper concentrations at saturating and subsaturating irradiance to test the hypothesis that Cu and light were interacting essential resources. Growth was a hyperbolic function of irradiance in Cu-replete medium (263 fmol Cu' · L -1 ) with maximum rates achieved at 200 μmol photons · m -2  · s -1 . Lowering the Cu concentration at this irradiance to 30.8 fmol Cu' · L -1 decreased cellular Cu quota by 7-fold and reduced growth rate by 50%. Copper-deficient cells had significantly slower (P light, low-Cu concentration was no longer limiting to growth: Cu concentration and light interacted strongly to affect growth rate of T. oceanica (P light-dependent, suggesting that faster growth of T. oceanica under high light and low Cu was a result of light-stimulated Cu uptake. © 2017 Phycological Society of America.

The tensor analyzing power T20 in the dd → 3Hen and dd → 3Hp reactions at the energies 140, 200 and 270 MeV at zero angle

International Nuclear Information System (INIS)

Ladygin, V.P.; ); Uesaka, T.; Saito, T.

2006-01-01

The data on the tensor analyzing power T 20 in the dd → 3 Hen and dd → 3 Hp reactions at 140, 200 and 270 MeV of the deuteron kinetic energy and at zero angle obtained at RIKEN Accelerator Research Facility are presented. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S wave ratios in the 3 He and 3 H in the energy domain of the measurements. The T 20 data for the 3 Hen and 3 Hp channels are in agreement within experimental accuracy [ru

Enhancing Performance of Large-Area Organic Solar Cells with Thick Film via Ternary Strategy.

Science.gov (United States)

Zhang, Jianqi; Zhao, Yifan; Fang, Jin; Yuan, Liu; Xia, Benzheng; Wang, Guodong; Wang, Zaiyu; Zhang, Yajie; Ma, Wei; Yan, Wei; Su, Wenming; Wei, Zhixiang

2017-06-01

Large-scale fabrication of organic solar cells requires an active layer with high thickness tolerability and the use of environment-friendly solvents. Thick films with high-performance can be achieved via a ternary strategy studied herein. The ternary system consists of one polymer donor, one small molecule donor, and one fullerene acceptor. The small molecule enhances the crystallinity and face-on orientation of the active layer, leading to improved thickness tolerability compared with that of a polymer-fullerene binary system. An active layer with 270 nm thickness exhibits an average power conversion efficiency (PCE) of 10.78%, while the PCE is less than 8% with such thick film for binary system. Furthermore, large-area devices are successfully fabricated using polyethylene terephthalate (PET)/Silver gride or indium tin oxide (ITO)-based transparent flexible substrates. The product shows a high PCE of 8.28% with an area of 1.25 cm 2 for a single cell and 5.18% for a 20 cm 2 module. This study demonstrates that ternary organic solar cells exhibit great potential for large-scale fabrication and future applications. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Cost Study for Manufacturing of Solid Oxide Fuel Cell Power Systems

Energy Technology Data Exchange (ETDEWEB)

Weimar, Mark R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Chick, Lawrence A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gotthold, David W. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Whyatt, Greg A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2013-09-30

Solid oxide fuel cell (SOFC) power systems can be designed to produce electricity from fossil fuels at extremely high net efficiencies, approaching 70%. However, in order to penetrate commercial markets to an extent that significantly impacts world fuel consumption, their cost will need to be competitive with alternative generating systems, such as gas turbines. This report discusses a cost model developed at PNNL to estimate the manufacturing cost of SOFC power systems sized for ground-based distributed generation. The power system design was developed at PNNL in a study on the feasibility of using SOFC power systems on more electric aircraft to replace the main engine-mounted electrical generators [Whyatt and Chick, 2012]. We chose to study that design because the projected efficiency was high (70%) and the generating capacity was suitable for ground-based distributed generation (270 kW).

Experiment list: SRX1090865 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available amming || cell type=intermediate stage of somatic cell reprogramming || chip antibo...,95.9,8.5,270 GSM1816302: pre-iPS rep.H3K4me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogr

Using interactive multimedia e-Books for learning blood cell morphology in pediatric hematology

Directory of Open Access Journals (Sweden)

Chih-Cheng Hsiao

2016-11-01

Full Text Available Abstract Background This prospective study compares the use of interactive multimedia eBooks (IME with traditional PowerPoint (TPP for teaching cell morphology of blood and bone marrow. Methods Fifty-one interns from three Taiwan medical schools training by a single teacher in the pediatric hematology department of Kaohsiung Chang Gung Memorial Hospital, Taiwan, participated in this study. 25 interns were allocated for training with a traditional PowerPoint atlas and 26 interns for training with an interactive multimedia eBook atlas. Learning outcomes were examined by pre-test and post-test using the CellQuiz of CellAtlas App. Attitudes and perceptions were collected by survey questions regarding interest, motivation and effectiveness. Results There was no difference in the pre-test scores between TPP and IME groups (mean score 27.0 versus 27.9, p = 0.807. However, the interns in the interactive multimedia eBook group achieved significantly better scores in the post-test than the ones in the PowerPoint group (mean score 103.2 versus 70.6; p < 0.001. Overall results of interest, motivation and effectiveness were strongly positive in the multimedia eBook group. Conclusions Our data supports that interactive multimedia eBooks are more effective than PowerPoint to facilitate learning of cell morphology of blood and bone marrow.

Silicon photomultiplier readout of a monolithic 270 x 5 x 5 cm{sup 3} plastic scintillator bar for time of flight applications

Energy Technology Data Exchange (ETDEWEB)

Roeder, Marko; Bemmerer, Daniel; Heidel, Klaus; Stach, Daniel; Wagner, Andreas; Weinberger, David [Helmholtz-Zentrum Dresden-Rossendorf (HZDR), Dresden (Germany); Cowan, Thomas E.; Gohl, Stefan; Reinicke, Stefan [Helmholtz-Zentrum Dresden-Rossendorf (HZDR), Dresden (Germany); TU Dresden (Germany); Reinhardt, Tobias P.; Zuber, Kai [TU Dresden (Germany); Collaboration: R3B-Collaboration

2016-07-01

The detection of 200-1000 MeV neutrons requires large amounts of detector material because of the long nuclear interaction length of these particles. In the example of the NeuLAND neutron time-of-flight detector at FAIR, this is accomplished by using 3000 scintillator bars of 270 x 5 x 5 cm{sup 3} size made of the fast plastic polyvinyltoluene. In the present work, we investigated whether silicon photomultiplier (SiPM) photosensors can replace fast timing photomultiplier tubes. The response of the system consisting of scintillator, SiPM, and preamplifier was studied using 30 MeV single electrons provided by the ELBE superconducting electron linac. The results were interpreted by a simple Monte Carlo simulation, and the time resolution was found to obey an inverse-square-root scaling law with the number of fired pixels. In the electron beam tests, a time resolution of σ{sub t}=136 ps was reached with a pure SiPM readout, well within the design parameters for NeuLAND.

Phagotrophy by the picoeukaryotic green alga Micromonas: implications for Arctic Oceans.

Science.gov (United States)

McKie-Krisberg, Zaid M; Sanders, Robert W

2014-10-01

Photosynthetic picoeukaryotes (PPE) are recognized as major primary producers and contributors to phytoplankton biomass in oceanic and coastal environments. Molecular surveys indicate a large phylogenetic diversity in the picoeukaryotes, with members of the Prymnesiophyceae and Chrysophyseae tending to be more common in open ocean waters and Prasinophyceae dominating coastal and Arctic waters. In addition to their role as primary producers, PPE have been identified in several studies as mixotrophic and major predators of prokaryotes. Mixotrophy, the combination of photosynthesis and phagotrophy in a single organism, is well established for most photosynthetic lineages. However, green algae, including prasinophytes, were widely considered as a purely photosynthetic group. The prasinophyte Micromonas is perhaps the most common picoeukaryote in coastal and Arctic waters and is one of the relatively few cultured representatives of the picoeukaryotes available for physiological investigations. In this study, we demonstrate phagotrophy by a strain of Micromonas (CCMP2099) isolated from Arctic waters and show that environmental factors (light and nutrient concentration) affect ingestion rates in this mixotroph. In addition, we show size-selective feeding with a preference for smaller particles, and determine P vs I (photosynthesis vs irradiance) responses in different nutrient conditions. If other strains have mixotrophic abilities similar to Micromonas CCMP2099, the widespread distribution and frequently high abundances of Micromonas suggest that these green algae may have significant impact on prokaryote populations in several oceanic regimes.

Evaluation and adjustment of altimeter measurement and numerical hindcast in wave height trend estimation in China's coastal seas

Science.gov (United States)

Li, Shuiqing; Guan, Shoude; Hou, Yijun; Liu, Yahao; Bi, Fan

2018-05-01

A long-term trend of significant wave height (SWH) in China's coastal seas was examined based on three datasets derived from satellite measurements and numerical hindcasts. One set of altimeter data were obtained from the GlobWave, while the other two datasets of numerical hindcasts were obtained from the third-generation wind wave model, WAVEWATCH III, forced by wind fields from the Cross-Calibrated Multi-Platform (CCMP) and NCEP's Climate Forecast System Reanalysis (CFSR). The mean and extreme wave trends were estimated for the period 1992-2010 with respect to the annual mean and the 99th-percentile values of SWH, respectively. The altimeter wave trend estimates feature considerable uncertainties owing to the sparse sampling rate. Furthermore, the extreme wave trend tends to be overestimated because of the increasing sampling rate over time. Numerical wave trends strongly depend on the quality of the wind fields, as the CCMP waves significantly overestimate the wave trend, whereas the CFSR waves tend to underestimate the trend. Corresponding adjustments were applied which effectively improved the trend estimates from the altimeter and numerical data. The adjusted results show generally increasing mean wave trends, while the extreme wave trends are more spatially-varied, from decreasing trends prevailing in the South China Sea to significant increasing trends mainly in the East China Sea.

Measurement and Modeling of Ecosystem Risk and Recovery for In Situ Treatment of Contaminated Sediments. Phase 3

Science.gov (United States)

2015-08-01

TITLE AND SUBTITLE Measurement and Modeling of Ecosystem Risk and Recovery for In Sit T t t f C t i t d S di t 5a. CONTRACT NUMBER W912HQ-10-C...Choi was supported in part by a Samsung Scholarship. Collaboration with Newcastle University was facilitated by the Leverhulme Trust, grant FOO 125/AA...and nitrogen deposited on porous alumina 4.2 147.6 Weak Preliminary tests to check the recovery of the selected CCMP from sediment was

In vitro investigation of anodization and CaP deposited titanium surface using MG63 osteoblast-like cells

Energy Technology Data Exchange (ETDEWEB)

Lee, J.M. [Department of Prosthodontics and Dental Research Institute, School of Dentistry, Seoul National University, 28 Yeongeon-dong, Jongno-gu, Seoul 110-749 (Korea, Republic of); Lee, J.I. [Department of Oral Pathology and Dental Research Institute, School of Dentistry, Seoul National University, Seoul (Korea, Republic of); Lim, Y.J., E-mail: limdds@snu.ac.kr [Department of Prosthodontics and Dental Research Institute, School of Dentistry, Seoul National University, 28 Yeongeon-dong, Jongno-gu, Seoul 110-749 (Korea, Republic of)

2010-03-01

The aim of the present study was to investigate surface characteristics in four different titanium surfaces (AN: anodized at 270 V; AN-CaP: anodic oxidation and CaP deposited; SLA: sandblasted and acid etched; MA: machined) and to evaluate biological behaviors such as cell adhesion, cell proliferation, cytoskeletal organization, and osteogenic protein expression of MG63 osteoblast-like cells at the early stage. Surface analysis was performed using scanning electron microscopy, thin-film X-ray diffractometry, and a confocal laser scanning microscope. In order to evaluate cellular responses, MG63 osteoblast-like cells were used. The cell viability was evaluated by MTT assay. Immunofluorescent analyses of actin, type I collagen, osteonectin and osteocalcin were performed. The anodized and CaP deposited specimen showed homogeneously distributed CaP particles around micropores and exhibited anatase type oxides, titanium, and HA crystalline structures. This experiment suggests that CaP particles on the anodic oxidation surface affect cellular attachment and spreading. When designing an in vitro biological study for CaP coated titanium, it must be taken into account that preincubation in medium prior to cell seeding and the cell culture medium may affect the CaP coatings. All these observations illustrate the importance of the experimental conditions and the physicochemical parameters of the CaP coating. It is considered that further evaluations such as long-term in vitro cellular assays and in vivo experiments should be necessary to figure out the effect of CaP deposition to biological responses.

In vitro investigation of anodization and CaP deposited titanium surface using MG63 osteoblast-like cells

International Nuclear Information System (INIS)

Lee, J.M.; Lee, J.I.; Lim, Y.J.

2010-01-01

The aim of the present study was to investigate surface characteristics in four different titanium surfaces (AN: anodized at 270 V; AN-CaP: anodic oxidation and CaP deposited; SLA: sandblasted and acid etched; MA: machined) and to evaluate biological behaviors such as cell adhesion, cell proliferation, cytoskeletal organization, and osteogenic protein expression of MG63 osteoblast-like cells at the early stage. Surface analysis was performed using scanning electron microscopy, thin-film X-ray diffractometry, and a confocal laser scanning microscope. In order to evaluate cellular responses, MG63 osteoblast-like cells were used. The cell viability was evaluated by MTT assay. Immunofluorescent analyses of actin, type I collagen, osteonectin and osteocalcin were performed. The anodized and CaP deposited specimen showed homogeneously distributed CaP particles around micropores and exhibited anatase type oxides, titanium, and HA crystalline structures. This experiment suggests that CaP particles on the anodic oxidation surface affect cellular attachment and spreading. When designing an in vitro biological study for CaP coated titanium, it must be taken into account that preincubation in medium prior to cell seeding and the cell culture medium may affect the CaP coatings. All these observations illustrate the importance of the experimental conditions and the physicochemical parameters of the CaP coating. It is considered that further evaluations such as long-term in vitro cellular assays and in vivo experiments should be necessary to figure out the effect of CaP deposition to biological responses.

Phase Change Material Selection for Thermal Energy Storage at High Temperature Range between 210 °C and 270 °C

Directory of Open Access Journals (Sweden)

José Miguel Maldonado

2018-04-01

Full Text Available The improvement of thermal energy storage systems implemented in solar technologies increases not only their performance but also their dispatchability and competitiveness in the energy market. Latent heat thermal energy storage systems are one of those storing methods. Therefore, the need of finding the best materials for each application becomes an appealing research subject. The main goal of this paper is to find suitable and economically viable materials able to work as phase change material (PCM within the temperature range of 210–270 °C and endure daily loading and unloading processes in a system with Fresnel collector and an organic Rankine cycle (ORC. Twenty-six materials have been tested and characterized in terms of their thermophysical conditions, thermal and cycling stability, and health hazard. Two materials out of the 26 candidates achieved the last stage of the selection process. However, one of the two finalists would require an inert working atmosphere, which would highly increase the cost for the real scale application. This leads to a unique suitable material, solar salt (40 wt % KNO3/60 wt % NaNO3.

The tensor analyzing power T20 in the dd → 3Hen and dd → 3Hp reactions at the energies 140, 200 and 270 MeV and at zero degree

International Nuclear Information System (INIS)

Ladygin, V.P.; Uesaka, T.; Saito, T.

2005-01-01

The data on the tensor analyzing power T 20 in the dd → 3 Hen and dd → 3 Hp reactions at 140, 200 and 270 MeV of the deuteron kinetic energy and at zero degree obtained at RIKEN Accelerator Research Facility are presented. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S wave ratios in the 3 He and 3 H in the energy domain of the measurements. The T 20 data for the 3 He-n and 3 H-p channels are in agreement within experimental accuracy

Beam Cherenkov counter conception for in line identification of 270 GeV/c Σ- Ξ- and Ω-

International Nuclear Information System (INIS)

Touillon, R.

1991-06-01

The purpose of this thesis is to design a beam Cerenkov counter. This counter will provide an on line identification of the Σ - , Ξ - and Ω - hyperons (270 GeV/c) in the experiment WA89 at CERN. The acceptance of the detector should allow tagging these hyperons in a large momentum range (± 25%) and for a beam divergence up to 250 microrad. The first part of this report is devoted to the physical goals such as the study of charmed baryons, the search of multiquark states, and the determination of hadronic and electromagnetic hyperon radii. The experimental WA89 setup is also presented. The major part deals with the design of the Cerenkov counter. The dimension of the detector, the Cerenkov angle value, the focal length of the spherical mirror, etc... are derived from a Monte-Carlo simulation. Various methods of simple photon detection (gaz detector: TEA, TMAE; solid detectors: PM and Image Intensifier) are investigated. The most performing solution uses two conical mirrors in order to reduce the size of the Cerenkov circles and an image intensifier (which detects the single photon) followed by an optical fiber matrix transmitting the luminous signal to 160 photomultipliers. The on line procedure for calculating the radius of each circle (identification of the particle) is studied in detail. Finally, the optimization of the optical system to achromatize the Cerenkov light is discussed [fr

Primary cutaneous malignancies in the Northern Cape Province of ...

African Journals Online (AJOL)

Results. A total of 4 270 biopsies (13 cutaneous malignancies) were identified. The commonest was squamous cell carcinoma (SCC), followed by basal cell carcinoma, Kaposi's sarcoma (KS), cutaneous malignant melanoma (CMM) and basosquamous carcinoma, in descending order. The odds of a white male developing ...

Hydrostatic pressure in combination with topographical cues affects the fate of bone marrow‐derived human mesenchymal stem cells for bone tissue regeneration

Science.gov (United States)

El Haj, Alicia J.

2017-01-01

Abstract Topographical and mechanical cues are vital for cell fate, tissue development in vivo, and to mimic the native cell growth environment in vitro. To date, the combinatory effect of mechanical and topographical cues as not been thoroughly investigated. This study investigates the effect of PCL nanofiber alignment and hydrostatic pressure on stem cell differentiation for bone tissue regeneration. Bone marrow‐derived human mesenchymal stem cells were seeded onto standard tissue culture plastic and electrospun random and aligned nanofibers. These substrates were either cultured statically or subjected to intermittent hydrostatic pressure at 270 kPa, 1 Hz for 60 min daily over 21 days in osteogenic medium. Data revealed higher cell metabolic activities for all mechanically stimulated cell culture formats compared with non‐stimulated controls; and random fibers compared with aligned fibers. Fiber orientation influenced cell morphology and patterns of calcium deposition. Significant up‐regulation of Collagen‐I, ALP, and Runx‐2 were observed for random and aligned fibers following mechanical stimulation; highest levels of osteogenic markers were expressed when hydrostatic pressure was applied to random fibers. These results indicate that fiber alignment and hydrostatic pressure direct stem cell fate and are important stimulus for tissue regeneration. © 2017 The Authors Journal of Biomedical Materials Research Part A Published by Wiley Periodicals, Inc. J Biomed Mater Res Part A: A: 629–640, 2018. PMID:28984025

Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016

Data.gov (United States)

U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...

Refractive Index Sensing of Green Fluorescent Proteins in Living Cells Using Fluorescence Lifetime Imaging Microscopy

Science.gov (United States)

van Manen, Henk-Jan; Verkuijlen, Paul; Wittendorp, Paul; Subramaniam, Vinod; van den Berg, Timo K.; Roos, Dirk; Otto, Cees

2008-01-01

We show that fluorescence lifetime imaging microscopy (FLIM) of green fluorescent protein (GFP) molecules in cells can be used to report on the local refractive index of intracellular GFP. We expressed GFP fusion constructs of Rac2 and gp91phox, which are both subunits of the phagocyte NADPH oxidase enzyme, in human myeloid PLB-985 cells and showed by high-resolution confocal fluorescence microscopy that GFP-Rac2 and GFP-gp91phox are targeted to the cytosol and to membranes, respectively. Frequency-domain FLIM experiments on these PLB-985 cells resulted in average fluorescence lifetimes of 2.70 ns for cytosolic GFP-Rac2 and 2.31 ns for membrane-bound GFP-gp91phox. By comparing these lifetimes with a calibration curve obtained by measuring GFP lifetimes in PBS/glycerol mixtures of known refractive index, we found that the local refractive indices of cytosolic GFP-Rac2 and membrane-targeted GFP-gp91phox are ∼1.38 and ∼1.46, respectively, which is in good correspondence with reported values for the cytosol and plasma membrane measured by other techniques. The ability to measure the local refractive index of proteins in living cells by FLIM may be important in revealing intracellular spatial heterogeneities within organelles such as the plasma and phagosomal membrane. PMID:18223002

ORF Sequence: NC_003423 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available orphan; low similarity to glycoamylases and other cell surface proteins; contains ~250-270 copies of a 13 AA repeat, NSS...TNSISFANTTPENTSTQITSPTAVNSSTPITSSSVLNSSTPITSSSILNTSTPITSSSVLNSSTPITSSSILNSSTPITSSTVLNSS...TPITSSTALNTSTPITSSSVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSS...TPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITRYSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSSVLNSS...TPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTAITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSS

Amino acid changes within the E protein hinge region that affect dengue virus type 2 infectivity and fusion

International Nuclear Information System (INIS)

Butrapet, Siritorn; Childers, Thomas; Moss, Kelley J.; Erb, Steven M.; Luy, Betty E.; Calvert, Amanda E.; Blair, Carol D.; Roehrig, John T.; Huang, Claire Y.-H.

2011-01-01

Fifteen mutant dengue viruses were engineered and used to identify AAs in the molecular hinge of the envelope protein that are critical to viral infection. Substitutions at Q52, A54, or E133 reduced infectivity in mammalian cells and altered the pH threshold of fusion. Mutations at F193, G266, I270, or G281 affected viral replication in mammalian and mosquito cells, but only I270W had reduced fusion activity. T280Y affected the pH threshold for fusion and reduced replication in C6/36 cells. Three different mutations at L135 were lethal in mammalian cells. Among them, L135G abrogated fusion and reduced replication in C6/36 cells, but only slightly reduced the mosquito infection rate. Conversely, L135W replicated well in C6/36 cells, but had the lowest mosquito infection rate. Possible interactions between hinge residues 52 and 277, or among 53, 135, 170, 186, 265, and 276 required for hinge function were discovered by sequence analysis to identify compensatory mutations.

A critical assessment of fuel cell technology

International Nuclear Information System (INIS)

Lindstroem, O.

1994-01-01

Cold combustion is a promised technology to mankind since the middle of the last century. The fuel cell may at last become the energy machine of the one to come after a long journey on a road bordered with expectations, successes and disappointments. Ten billion people will need the cell for their well-being. The progress and the state-of-art is assessed by means of figures of merit for performance, normalized to standard conditions, life and variability. State-of-art current densities for multi-kW stacks operating on atmospheric pressure air at 0.74 V cell voltage (50% efficiency, HHV) are estimated to be 150 mA/cm 2 for MCFC, 160 mA/cm 2 for AFC, 239 mA/cm 2 for PEFC and 270 mA/cm 2 for SOFC. PAFC gives 260 mA/cm 2 at 0.66 V and DMFC 100 mA/cm 2 at 0.37 V. Decay rates are about 1%/1000 h for PEFC, PAFC and SOFC compared to 2%/1000 h for AFC and 3%/1000 h for MCFC. Coefficients of variation for cell voltages amount to about 1% for all options, except for MCFC with 3-4%. Improvement of cell performance after 1975 is nil to moderate, except for SOFC with a consistent annual improvement of about 10%. There is room for further development of terrestrial AFCs towards 300-400 mA/cm 2 considering the figure 800 mA/cm 2 for oxygen AFCs. Life and cost will decide the future of the fuel cell. Prospects are not as good as they could be. The fuel cell community lacks understanding of the basics of fuel processing, as demonstrated by the widespread misbelief ('the CO 2 syndrome') that CO 2 cannot be removed cost effectively from a hydrogen feed (which is practiced in every NH 3 plant around the world). The competition, read the gas turbine, has to be taken very seriously. Emphasis has to be shifted from premature demonstrations to R and D on fundamental problems, which have been around too long. 34 refs

Magnetron sputtering fabrication and photoelectric properties of WSe2 film solar cell device

Science.gov (United States)

Mao, Xu; Zou, Jianpeng; Li, Hongchao; Song, Zhengqi; He, Siru

2018-06-01

Tungsten diselenide (WSe2) films with different growing orientations exhibit diverse photoelectric properties. The WSe2 film with C-axis⊥substrate texture has been prepared and applied to thin-film solar cells. W nanofilms with a thickness of 270 nm were deposited onto the Mo bottom electrode and then heat-treated in selenium vapor to synthesize WSe2 films with a thickness of 1 μm. ZnO films were deposited onto WSe2 films to form a P-N junction and ITO films were deposited subsequently as the conductive layer. X-ray diffractometry, scanning electron microscopy and UV-vis-NIR spectro-analysis instrument were employed to analyze the phase composition, optical absorptivity and micromorphology of WSe2 films and the WSe2 solar cell device. WSe2 films exhibit excellent photoelectric performance with an optical absorption coefficient greater than 105 cm-1 across the visible spectrum. The calculated direct and indirect band gap of the WSe2 films is 1.48 eV and 1.25 eV, respectively. With the application of standard glass/Mo/WSe2/ZnO/ITO/Ag device structure, the open-circuit voltage of the battery device is 82 mV. The short-circuit current density is 2.98 mA/cm2 and the filling factor is 0.32. The photoelectric conversion efficiency of the WSe2 film solar cell device is 0.79%.

IgV(H) and bcl6 somatic mutation analysis reveals the heterogeneity of cutaneous B-cell lymphoma, and indicates the presence of undisclosed local antigens.

Science.gov (United States)

Franco, Renato; Camacho, Francisca I; Fernández-Vázquez, Amalia; Algara, Patrocinio; Rodríguez-Peralto, José L; De Rosa, Gaetano; Piris, Miguel A

2004-06-01

Our understanding of the ontology of B-cell lymphomas (BCL) has been improved by the study of mutational status of IgV(H) and bcl6 genes, but only a few cases of cutaneous BCL have been examined for this status. We analyzed IgV(H) and bcl6 somatic mutations in 10 cutaneous BCL, classified as follicular (three primary and one secondary), primary marginal zone (two cases), and diffuse large BCL (three primary and one secondary). We observed a lower rate (IgV(H) mutation in all marginal zone lymphomas, and a preferential usage of V(H)2-70 (one primary follicular and two primary diffuse large BCL). Fewer than expected replacement mutations in framework regions (FR) were observed in three primary follicular lymphomas (FLs) and in all diffuse large BCL, indicating a negative antigen selection pressure. Ongoing mutations were observed in eight of 10 cases. Only two primary FLs and two diffuse large BCL showed bcl6 somatic mutation. These data support the heterogeneous nature of the different cutaneous BCL, and specifically the distinction between cutaneous follicular and marginal zone lymphomas. The biased usage of V(H)2-70, the low rate of replacement mutation in the FR, and the presence of ongoing mutation imply that local antigens could modulate the growth of primary cutaneous BCL.

Hydrostatic pressure in combination with topographical cues affects the fate of bone marrow-derived human mesenchymal stem cells for bone tissue regeneration.

Science.gov (United States)

Reinwald, Yvonne; El Haj, Alicia J

2018-03-01

Topographical and mechanical cues are vital for cell fate, tissue development in vivo, and to mimic the native cell growth environment in vitro. To date, the combinatory effect of mechanical and topographical cues as not been thoroughly investigated. This study investigates the effect of PCL nanofiber alignment and hydrostatic pressure on stem cell differentiation for bone tissue regeneration. Bone marrow-derived human mesenchymal stem cells were seeded onto standard tissue culture plastic and electrospun random and aligned nanofibers. These substrates were either cultured statically or subjected to intermittent hydrostatic pressure at 270 kPa, 1 Hz for 60 min daily over 21 days in osteogenic medium. Data revealed higher cell metabolic activities for all mechanically stimulated cell culture formats compared with non-stimulated controls; and random fibers compared with aligned fibers. Fiber orientation influenced cell morphology and patterns of calcium deposition. Significant up-regulation of Collagen-I, ALP, and Runx-2 were observed for random and aligned fibers following mechanical stimulation; highest levels of osteogenic markers were expressed when hydrostatic pressure was applied to random fibers. These results indicate that fiber alignment and hydrostatic pressure direct stem cell fate and are important stimulus for tissue regeneration. © 2017 The Authors Journal of Biomedical Materials Research Part A Published by Wiley Periodicals, Inc. J Biomed Mater Res Part A: A: 629-640, 2018. © 2017 The Authors Journal of Biomedical Materials Research Part A Published by Wiley Periodicals, Inc.

Efficacy of In2S3 interfacial recombination barrier layer in PbS quantum-dot-sensitized solar cells

International Nuclear Information System (INIS)

Basit, Muhammad Abdul; Abbas, Muhammad Awais; Bang, Jin Ho; Park, Tae Joo

2015-01-01

In 2 S 3 interfacial recombination barrier layer (IBL) via successive ionic layer adsorption and reaction (SILAR) was successfully employed between PbS quantum dots and mesoporous TiO 2 in quantum-dot-sensitized solar cells (QDSSCs). In 2 S 3 IBL significantly increased the resistance against back electron transfer from TiO 2 , resulting an increment in the photocurrent density (J SC ) for the cell with single SILAR cycle of In 2 S 3 IBL. Further increase in the number of SILAR cycles of In 2 S 3 IBL deteriorated the J SC , whereas open-circuit voltage sustained the increasing trend. Therefore, an optimal photo-conversion efficiency of ∼2.2% was obtained for the cell with 2 SILAR cycles of In 2 S 3 IBL, which strategically reached a value of ∼2.70% after annealing (increased by 40% compared to the control cell without IBL). In 2 S 3 IBL not only improved the recombination resistance and electron life time of the cells, but it also enhanced the photostability of the cells. - Highlights: • In 2 S 3 interfacial recombination barrier layer was deposited on TiO 2 photoanode via SILAR process. • Resistance against back electron transfer from TiO 2 (recombination) increased notably. • Fabricated PbS-QDSSCs were characterized using IPCE, OCVD and EIS techniques. • In 2 S 3 IBL improved chemical capacitance, electron life time and photostability of modified cells. • 2In 2 S 3 IBL showed optimal performance, yielding 40% improvement in PCE after heat treatment.

Pre-emptive rituximab for Epstein-Barr virus reactivation after haplo-hematopoietic stem cell transplantation.

Science.gov (United States)

Kobayashi, Shogo; Sano, Hideki; Mochizuki, Kazuhiro; Ohara, Yoshihiro; Takahashi, Nobuhisa; Ohto, Hitoshi; Kikuta, Atsushi

2017-09-01

Epstein-Barr virus-related post-transplantation lymphoproliferative disease (EBV-PTLD) is a serious complication in hematopoietic stem cell transplantation (HSCT) recipients. We conducted a retrospective study to investigate the incidence and potential risk factors for EBV reactivation and to assess the efficacy of the management of EBV reactivation with pre-emptive rituximab in children who had T-cell-replete haploidentical HSCT (TCR-haplo-SCT) with low-dose anti-thymocyte globulin (ATG). EBV-DNA level in peripheral blood (PB) was measured when suspected EBV reactivation were observed. When the EBV-DNA level in PB increased to >1,000 copies/10 6 peripheral blood mononuclear cells (PBMC), patients were pre-emptively treated with rituximab (375 mg/m 2 /dose). A total of 19 (50%) of 38 patients received rituximab infusion at a median time of 56 days after HSCT (range, 17-270 days). The median viral load at initiation of therapy was 2,900 copies/10 6 PBMC (range, 1,000-650 000). Pre-emptive therapy was started after a median of 2 days (range, 0-7 days). The median number of weekly treatment cycles was 2 (range, 1-3). None of the patients developed PTLD or other EBV-associated diseases. Pre-emptive rituximab therapy could be a useful strategy for EBV-PTLD in TCR-haplo-SCT recipients with low-dose ATG. © 2017 Japan Pediatric Society.

Parasites and associated packed cell volume changes of captive ...

African Journals Online (AJOL)

The results revealed that out of the 126 captive wild birds examined during the period, 98 (77.8%) were infected with at least one parasite species. Arthropod parasites were encountered in 63 (34.1%) birds and the parasites recovered were Echidnophaga gallinacea (27.0%), Argas persicus (18.2%) and Ctnemidocoptes ...

Cyclooxygenase expression in canine platelets and Madin-Darby canine kidney cells.

Science.gov (United States)

Kay-Mugford, P A; Benn, S J; LaMarre, J; Conlon, P D

2000-12-01

To examine cyclooxygenase (COX) expression in canine platelets and Madin-Darby canine kidney (MDCK) cells in culture. Canine platelets and MDCK cells. Total RNA was recovered from isolated canine platelets and MDCK cells. Northern blot analysis and reverse transcription-polymerase chain reaction (RT-PCR), using complementary DNA probes and primers designed from the human COX sequences, were used to determine COX-1 and -2 (cyclooxygenase isoforms 1 and 2) messenger RNA (mRNA) expression. Following northern blot analysis, canine platelets were found to express only the 2.8-kb COX-1 transcript; COX-2 was not detected. Canine MDCK cells expressed the 4.5-kb COX-2 transcript, in addition to the 2.8-kb COX-1 transcript. A single DNA band of 270 base pairs was identified following gel electrophoresis of the product obtained from RT-PCR of mRNA from canine platelets. Sequencing revealed that this PCR product was 90% homologous to a portion of the human COX-1 gene (Genbank M59979). Detection of COX-1 by RT-PCR of RNA obtained from canine platelets is a novel finding. The 90% homology of the PCR product with the human sequence suggests strong conservation between the canine and human COX-1 gene. Cloning and sequencing of the canine gene will be required to fully characterize homologous regions. Because of the importance of COX in the inflammatory process and as a potential target of currently available nonsteroidal anti-inflammatory drugs (NSAID), a better understanding of canine COX may improve our ability to use NSAID appropriately, achieve efficacy, and avoid potential adverse drug effects in dogs.

Analysis of incomplete excisions of basal-cell carcinomas after breadloaf microscopy compared with 3D-microscopy: a prospective randomized and blinded study.

Science.gov (United States)

Boehringer, Alexandra; Adam, Patrick; Schnabl, Saskia; Häfner, Hans-Martin; Breuninger, Helmut

2015-08-01

Basal-cell carcinomas may show irregular, asymmetric subclinical growth. This study analyzed the efficacy of 'breadloaf' microscopy (serial sectioning) and three-dimensional (3D) microscopy in detecting positive tumor margins. Two hundred eighty-three (283) tumors (51.2%) were put into the breadloaf microscopy group; 270 tumors (48.8%) into the 3D microscopy group. The position of any detected tumor outgrowths was identified in clock face fashion. The time required for cutting and embedding the specimens and the examination of the microscopic slides was measured. Patient/tumor characteristics and surgical margins did not differ significantly. Tumor outgrowths at the excision margin were found in 62 of 283 cases (21.9%) in the breadloaf microscopy group and in 115 of 270 cases (42.6%) in the 3D microscopy group, constituting a highly significant difference (p < 0.001). This difference held true with incomplete excision of fibrosing (infiltrative/sclerosing/morpheaform) tumors [32.9% in the breadloaf microscopy group and 57.5% in the 3D microscopy group (p = 0.003)] and also with solid (nodular) tumors [16.1 and 34.2%, respectively (p < 0.001)]. The mean overall examination time required showed no important difference. In summary, for detection of tumor outgrowths, 3D microscopy has almost twice the sensitivity of breadloaf microscopy, particularly in the situation of aggressive/infiltrative carcinomas. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Cisplatin-induced caspase activation mediates PTEN cleavage in ovarian cancer cells: a potential mechanism of chemoresistance

International Nuclear Information System (INIS)

Singh, Mohan; Chaudhry, Parvesh; Fabi, Francois; Asselin, Eric

2013-01-01

The phosphatase and tensin homolog deleted on chromosome 10 (PTEN) tumor suppressor protein is a central negative regulator of the PI3K/AKT signaling cascade and suppresses cell survival as well as cell proliferation. PTEN is found to be either inactivated or mutated in various human malignancies. In the present study, we have investigated the regulation of PTEN during cisplatin induced apoptosis in A2780, A270-CP (cisplatin resistant), OVCAR-3 and SKOV3 ovarian cancer cell lines. Cells were treated with 10μM of cisplatin for 24h. Transcript and protein levels were analysed by quantitative reverse transcriptase-polymerase chain reaction (qRT-PCR) and western blotting, respectively. Immunofluorescence microscopy was used to assess the intracellular localization of PTEN. Proteasome inhibitor and various caspases inhibitors were used to find the mechanism of PTEN degradation. PTEN protein levels were found to be decreased significantly in A2780 cells; however, there was no change in PTEN protein levels in A2780-CP, OVCAR-3 and SKOV3 cells with cisplatin treatment. The decrease in PTEN protein was accompanied with an increase in the levels of AKT phosphorylation (pAKT) in A2780 cells and a decrease of BCL-2. Cisplatin treatment induced the activation/cleavage of caspase-3, -6, -7, -8, -9 in all cell lines tested in this study except the resistant variant A2780-CP cells. In A2780 cells, restoration of PTEN levels was achieved upon pre-treatment with Z-DEVD-FMK (broad range caspases inhibitor) and not with MG132 (proteasome inhibitor) and by overexpression of BCL-2, suggesting that caspases and BCL-2 are involved in the decrease of PTEN protein levels in A2780 cells. The decrease in pro-apoptotic PTEN protein levels and increase in survival factor pAKT in A2780 ovarian cancer cells suggest that cisplatin treatment could further exacerbate drug resistance in A2780 ovarian cancer cells

Cisplatin-induced caspase activation mediates PTEN cleavage in ovarian cancer cells: a potential mechanism of chemoresistance.

Science.gov (United States)

Singh, Mohan; Chaudhry, Parvesh; Fabi, Francois; Asselin, Eric

2013-05-10

The phosphatase and tensin homolog deleted on chromosome 10 (PTEN) tumor suppressor protein is a central negative regulator of the PI3K/AKT signaling cascade and suppresses cell survival as well as cell proliferation. PTEN is found to be either inactivated or mutated in various human malignancies. In the present study, we have investigated the regulation of PTEN during cisplatin induced apoptosis in A2780, A270-CP (cisplatin resistant), OVCAR-3 and SKOV3 ovarian cancer cell lines. Cells were treated with 10μM of cisplatin for 24h. Transcript and protein levels were analysed by quantitative reverse transcriptase-polymerase chain reaction (qRT-PCR) and western blotting, respectively. Immunofluorescence microscopy was used to assess the intracellular localization of PTEN. Proteasome inhibitor and various caspases inhibitors were used to find the mechanism of PTEN degradation. PTEN protein levels were found to be decreased significantly in A2780 cells; however, there was no change in PTEN protein levels in A2780-CP, OVCAR-3 and SKOV3 cells with cisplatin treatment. The decrease in PTEN protein was accompanied with an increase in the levels of AKT phosphorylation (pAKT) in A2780 cells and a decrease of BCL-2. Cisplatin treatment induced the activation/cleavage of caspase-3, -6, -7, -8, -9 in all cell lines tested in this study except the resistant variant A2780-CP cells. In A2780 cells, restoration of PTEN levels was achieved upon pre-treatment with Z-DEVD-FMK (broad range caspases inhibitor) and not with MG132 (proteasome inhibitor) and by overexpression of BCL-2, suggesting that caspases and BCL-2 are involved in the decrease of PTEN protein levels in A2780 cells. The decrease in pro-apoptotic PTEN protein levels and increase in survival factor pAKT in A2780 ovarian cancer cells suggest that cisplatin treatment could further exacerbate drug resistance in A2780 ovarian cancer cells.

The Combination of Platelet Count and Neutrophil Lymphocyte Ratio Is a Predictive Factor in Patients with Esophageal Squamous Cell Carcinoma

Directory of Open Access Journals (Sweden)

Ji-Feng Feng

2014-10-01

Full Text Available OBJECTIVE: The prognostic value of inflammation indexes in esophageal cancer was not established. In this study, therefore, both prognostic values of Glasgow prognostic score (GPS and combination of platelet count and neutrophil lymphocyte ratio (COP-NLR in patients with esophageal squamous cell carcinoma (ESCC were investigated and compared. METHODS: This retrospective study included 375 patients who underwent esophagectomy for ESCC. The cancer-specific survival (CSS was calculated by the Kaplan-Meier method, and the difference was assessed by the log-rank test. The GPS was calculated as follows: patients with elevated C-reactive protein (>10 mg/l and hypoalbuminemia (300 × 109/l and neutrophil lymphocyte ratio (>3 were assigned to COP-NLR2. Patients with one or no abnormal value were assigned to COP-NLR1 or COP-NLR0, respectively. RESULTS: The 5-year CSS in patients with GPS0, 1, and 2 was 50.0%, 27.0%, and 12.5%, respectively (P < .001. The 5-year CSS in patients with COP-NLR0, 1, and 2 was 51.8%, 27.0%, and 11.6%, respectively (P < .001. Multivariate analysis showed that both GPS (P = .003 and COP-NLR (P = .003 were significant predictors in such patients. In addition, our study demonstrated a similar hazard ratio (HR between COP-NLR and GPS (HR = 1.394 vs HR = 1.367. CONCLUSIONS: COP-NLR is an independent predictive factor in patients with ESCC. We conclude that COP-NLR predicts survival in ESCC similar to GPS.

Temperature and 8 MeV electron irradiation effects on GaAs solar cells

Indian Academy of Sciences (India)

1Department of Physics, Mangalore Institute of Technology and Engineering, ... strate were irradiated with 1 MeV electrons, they showed high radiation tolerance ... under both forward and reverse bias in the temperature range of 270–315 K ...

Development to term of cloned cattle derived from donor cells treated with valproic acid.

Directory of Open Access Journals (Sweden)

Juliano Rodrigues Sangalli

Full Text Available Cloning of mammals by somatic cell nuclear transfer (SCNT is still plagued by low efficiency. The epigenetic modifications established during cellular differentiation are a major factor determining this low efficiency as they act as epigenetic barriers restricting reprogramming of somatic nuclei. In this regard, most factors that promote chromatin decondensation, including histone deacetylase inhibitors (HDACis, have been found to increase nuclear reprogramming efficiency, making their use common to improve SCNT rates. Herein we used valproic acid (VPA in SCNT to test whether the treatment of nuclear donor cells with this HDACi improves pre- and post-implantation development of cloned cattle. We found that the treatment of fibroblasts with VPA increased histone acetylation without affecting DNA methylation. Moreover, the treatment with VPA resulted in increased expression of IGF2R and PPARGC1A, but not of POU5F1. However, when treated cells were used as nuclear donors no difference of histone acetylation was found after oocyte reconstruction compared to the use of untreated cells. Moreover, shortly after artificial activation the histone acetylation levels were decreased in the embryos produced with VPA-treated cells. With respect to developmental rates, the use of treated cells as donors resulted in no difference during pre- and post-implantation development. In total, five clones developed to term; three produced with untreated cells and two with VPA-treated cells. Among the calves from treated group, one stillborn calf was delivered at day 270 of gestation whereas the other one was delivered at term but died shortly after birth. Among the calves from the control group, one died seven days after birth whereas the other two are still alive and healthy. Altogether, these results show that in spite of the alterations in fibroblasts resulting from the treatment with VPA, their use as donor cells in SCNT did not improve pre- and post

The effect of chronic low-dose UVB radiation on Langerhans cells, sunburn cells, urocanic acid isomers, contact hypersensitivity and serum immunoglobulins in mice

International Nuclear Information System (INIS)

El-Ghorr, A.A.; Norval, M.; Lappin, M.B.

1995-01-01

C3H mice were irradiated three times a week for up to 6 weeks with either 500 J/m 2 or 1000 J/m 2 broadband UVB (270-350 nm) or 3000 J/m 2 narrowband UVB (311-312 nm; TL01 source). Each dose was suberythemal to the mouse strain used. The number of Langerhans cells (LC) in the epidermis was reduced by over 50% after 2 weeks of irradiation with the UVB source and by 20% following TL01 irradiation. Continued irradiation for up to 6 weeks resulted in no further decrease in LC numbers in the case of the UVB source but a steady decline to 40% in the case of the TL01 source. Sunburn cells were detected following irradiation with both sources but the numbers were very low in comparison with acute exposure. Ultraviolet-B exposure resulted in doubling of the thickness of the epidermis throughout the 6 weeks of irradiation while TL01 exposure did not alter epidermal thickness. Conversion of trans- to cis-urocanic acid (UCA) was observed with both UVB and TL01 sources. The percentage of cis-UCA started to return to normal after 4 weeks of TL01 exposure despite continued irradiation. As observed following a single exposure, the contact hypersensitivity (CH) response was significantly reduced following 6 weeks of UVB irradiation but was unaffected by TL01 exposure, indicating no correlation between cis-UCA levels and CH response. (author)

Comparison of the ocean surface vector winds from atmospheric reanalysis and scatterometer-based wind products over the Nordic Seas and the northern North Atlantic and their application for ocean modeling

Science.gov (United States)

Dukhovskoy, Dmitry S.; Bourassa, Mark A.; Petersen, Gudrún Nína; Steffen, John

2017-03-01

Ocean surface vector wind fields from reanalysis data sets and scatterometer-derived gridded products are analyzed over the Nordic Seas and the northern North Atlantic for the time period from 2000 to 2009. The data sets include the National Center for Environmental Prediction Reanalysis 2 (NCEPR2), Climate Forecast System Reanalysis (CFSR), Arctic System Reanalysis (ASR), Cross-Calibrated Multiplatform (CCMP) wind product version 1.1 and recently released version 2.0, and QuikSCAT. The goal of the study is to assess discrepancies across the wind vector fields in the data sets and demonstrate possible implications of these differences for ocean modeling. Large-scale and mesoscale characteristics of winds are compared at interannual, seasonal, and synoptic timescales. A cyclone tracking methodology is developed and applied to the wind fields to compare cyclone characteristics in the data sets. Additionally, the winds are evaluated against observations collected from meteorological buoys deployed in the Iceland and Irminger Seas. The agreement among the wind fields is better for longer time and larger spatial scales. The discrepancies are clearly apparent for synoptic timescales and mesoscales. CCMP, ASR, and CFSR show the closest overall agreement with each other. Substantial biases are found in the NCEPR2 winds. Numerical sensitivity experiments are conducted with a coupled ice-ocean model forced by different wind fields. The experiments demonstrate differences in the net surface heat fluxes during storms. In the experiment forced by NCEPR2 winds, there are discrepancies in the large-scale wind-driven ocean dynamics compared to the other experiments.

Evolutionary Acquisition and Loss of Saxitoxin Biosynthesis in Dinoflagellates: the Second “Core” Gene, sxtG

Science.gov (United States)

Orr, Russell J. S.; Stüken, Anke; Murray, Shauna A.

2013-01-01

Saxitoxin and its derivatives are potent neurotoxins produced by several cyanobacteria and dinoflagellate species. SxtA is the initial enzyme in the biosynthesis of saxitoxin. The dinoflagellate full mRNA and partial genomic sequences have previously been characterized, and it appears that sxtA originated in dinoflagellates through a horizontal gene transfer from a bacterium. So far, little is known about the remaining genes involved in this pathway in dinoflagellates. Here we characterize sxtG, an amidinotransferase enzyme gene that putatively encodes the second step in saxitoxin biosynthesis. In this study, the entire sxtG transcripts from Alexandrium fundyense CCMP1719 and Alexandrium minutum CCMP113 were amplified and sequenced. The transcripts contained typical dinoflagellate spliced leader sequences and eukaryotic poly(A) tails. In addition, partial sxtG transcript fragments were amplified from four additional Alexandrium species and Gymnodinium catenatum. The phylogenetic inference of dinoflagellate sxtG, congruent with sxtA, revealed a bacterial origin. However, it is not known if sxtG was acquired independently of sxtA. Amplification and sequencing of the corresponding genomic sxtG region revealed noncanonical introns. These introns show a high interspecies and low intraspecies variance, suggesting multiple independent acquisitions and losses. Unlike sxtA, sxtG was also amplified from Alexandrium species not known to synthesize saxitoxin. However, amplification was not observed for 22 non-saxitoxin-producing dinoflagellate species other than those of the genus Alexandrium or G. catenatum. This result strengthens our hypothesis that saxitoxin synthesis has been secondarily lost in conjunction with sxtA for some descendant species. PMID:23335767

Evolutionary acquisition and loss of saxitoxin biosynthesis in dinoflagellates: the second "core" gene, sxtG.

Science.gov (United States)

Orr, Russell J S; Stüken, Anke; Murray, Shauna A; Jakobsen, Kjetill S

2013-04-01

Saxitoxin and its derivatives are potent neurotoxins produced by several cyanobacteria and dinoflagellate species. SxtA is the initial enzyme in the biosynthesis of saxitoxin. The dinoflagellate full mRNA and partial genomic sequences have previously been characterized, and it appears that sxtA originated in dinoflagellates through a horizontal gene transfer from a bacterium. So far, little is known about the remaining genes involved in this pathway in dinoflagellates. Here we characterize sxtG, an amidinotransferase enzyme gene that putatively encodes the second step in saxitoxin biosynthesis. In this study, the entire sxtG transcripts from Alexandrium fundyense CCMP1719 and Alexandrium minutum CCMP113 were amplified and sequenced. The transcripts contained typical dinoflagellate spliced leader sequences and eukaryotic poly(A) tails. In addition, partial sxtG transcript fragments were amplified from four additional Alexandrium species and Gymnodinium catenatum. The phylogenetic inference of dinoflagellate sxtG, congruent with sxtA, revealed a bacterial origin. However, it is not known if sxtG was acquired independently of sxtA. Amplification and sequencing of the corresponding genomic sxtG region revealed noncanonical introns. These introns show a high interspecies and low intraspecies variance, suggesting multiple independent acquisitions and losses. Unlike sxtA, sxtG was also amplified from Alexandrium species not known to synthesize saxitoxin. However, amplification was not observed for 22 non-saxitoxin-producing dinoflagellate species other than those of the genus Alexandrium or G. catenatum. This result strengthens our hypothesis that saxitoxin synthesis has been secondarily lost in conjunction with sxtA for some descendant species.

ELEVATED CARBON DIOXIDE DIFFERENTIALLY ALTERS THE PHOTOPHYSIOLOGY OF THALASSIOSIRA PSEUDONANA (BACILLARIOPHYCEAE) AND EMILIANIA HUXLEYI (HAPTOPHYTA)(1).

Science.gov (United States)

McCarthy, Avery; Rogers, Susan P; Duffy, Stephen J; Campbell, Douglas A

2012-06-01

Increasing anthropogenic carbon dioxide is causing changes to ocean chemistry, which will continue in a predictable manner. Dissolution of additional atmospheric carbon dioxide leads to increased concentrations of dissolved carbon dioxide and bicarbonate and decreased pH in ocean water. The concomitant effects on phytoplankton ecophysiology, leading potentially to changes in community structure, are now a focus of concern. Therefore, we grew the coccolithophore Emiliania huxleyi (Lohmann) W. W. Hay et H. Mohler and the diatom strains Thalassiosira pseudonana (Hust.) Hasle et Heimdal CCMP 1014 and T. pseudonana CCMP 1335 under low light in turbidostat photobioreactors bubbled with air containing 390 ppmv or 750 ppmv CO2 . Increased pCO2 led to increased growth rates in all three strains. In addition, protein levels of RUBISCO increased in the coastal strains of both species, showing a larger capacity for CO2 assimilation at 750 ppmv CO2 . With increased pCO2 , both T. pseudonana strains displayed an increased susceptibility to PSII photoinactivation and, to compensate, an augmented capacity for PSII repair. Consequently, the cost of maintaining PSII function for the diatoms increased at increased pCO2 . In E. huxleyi, PSII photoinactivation and the counter-acting repair, while both intrinsically larger than in T. pseudonana, did not change between the current and high-pCO2 treatments. The content of the photosynthetic electron transport intermediary cytochrome b6/f complex increased significantly in the diatoms under elevated pCO2 , suggesting changes in electron transport function. © 2012 Phycological Society of America.

CaV 3.1 and CaV 3.3 account for T-type Ca2+ current in GH3 cells

Directory of Open Access Journals (Sweden)

M.A. Mudado

2004-06-01

Full Text Available T-type Ca2+ channels are important for cell signaling by a variety of cells. We report here the electrophysiological and molecular characteristics of the whole-cell Ca2+ current in GH3 clonal pituitary cells. The current inactivation at 0 mV was described by a single exponential function with a time constant of 18.32 ± 1.87 ms (N = 16. The I-V relationship measured with Ca2+ as a charge carrier was shifted to the left when we applied a conditioning pre-pulse of up to -120 mV, indicating that a low voltage-activated current may be present in GH3 cells. Transient currents were first activated at -50 mV and peaked around -20 mV. The half-maximal voltage activation and the slope factors for the two conditions are -35.02 ± 2.4 and 6.7 ± 0.3 mV (pre-pulse of -120 mV, N = 15, and -27.0 ± 0.97 and 7.5 ± 0.7 mV (pre-pulse of -40 mV, N = 9. The 8-mV shift in the activation mid-point was statistically significant (P < 0.05. The tail currents decayed bi-exponentially suggesting two different T-type Ca2+ channel populations. RT-PCR revealed the presence of a1G (CaV3.1 and a1I (CaV3.3 T-type Ca2+ channel mRNA transcripts.

Centrifugal Separation Device Based on Two-Layer Laminar Flow in Microchannels for High-Throughput and Continuous Blood Cell/Plasma Separation

Science.gov (United States)

Taizo Kobayashi,; Taisuke Funamoto,; Makoto Hosaka,; Satoshi Konishi,

2010-07-01

This paper presents a novel type of centrifugation device that is based on the two-layer laminar flow in micro flow channels for continuous blood cell/plasma separation. We propose to rotate the flow channels which are arranged along the circumference around the rotational axis. Downsizing the channel width reduced both the cell sedimentation time and the required centrifugal force, because the channel width corresponds to the centrifugal sedimentation length. First, plasma and cells were continuously extracted from pig blood in each of the branch channels using a milled acrylic prototype device (channel width = 800 μm, volume = 150 μl). Next, the relationship between the channel width (125, 250, and 500 μm) and the sedimentation time taken for various centrifugal forces (2.3, 9, 36, and 145 G) was evaluated using the downsized microchannels fabricated by hot-embossing and thermal bonding technologies. Using downsized microchannels with a width of 125 μm successfully reduced the sedimentation time to 85 s as compared to the sedimentation time of 270 s for a channel of a width of 500 μm, when a centrifugal force of 2.3 G was applied. The use of the proposed device did not result in obvious hemolysis at the centrifugal forces lower than 335 G.

Sustainable Power Generation in Continuous Flow Microbial Fuel Cell Treating Actual Wastewater: Influence of Biocatalyst Type on Electricity Production

Directory of Open Access Journals (Sweden)

Zainab Z. Ismail

2013-01-01

Full Text Available Microbial fuel cells (MFCs have the potential to simultaneously treat wastewater for reuse and to generate electricity. This study mainly considers the performance of an upflow dual-chambered MFC continuously fueled with actual domestic wastewater and alternatively biocatalyzed with aerobic activated sludge and strain of Bacillus Subtilis. The behavior of MFCs during initial biofilm growth and characterization of anodic biofilm were studied. After 45 days of continuous operation, the biofilms on the anodic electrode were well developed. The performance of MFCs was mainly evaluated in terms of COD reductions and electrical power output. Results revealed that the COD removal efficiency was 84% and 90% and the stabilized power outputs were clearly observed achieving a maximum value of 120 and 270 mW/m2 obtained for MFCs inoculated with mixed cultures and Bacillus Subtilis strain, respectively.

Optimizing IEEE 802.11i resource and security essentials for mobile and stationary devices

CERN Document Server

Amiri, IS; Saberi, Iman

2014-01-01

In the past decade, the number of wireless devices has grown exponentially. Decades ago, all systems were wired computer systems. Wireless technology was not accessible in mobile and portable devices until in recent years, and has followed a variety of methods for encryption and resource management. The purpose of the research in Optimizing IEE 802.11i Resources and Security Essentials is to determine the issues of the performance in current encryption methods in AES-CCMP in different types of devices and handle it so that an optimized resource usage would be achieved with the required securi

Lessons from Iowa : development of a 270 megawatt compressed air energy storage project in midwest Independent System Operator : a study for the DOE Energy Storage Systems Program.

Energy Technology Data Exchange (ETDEWEB)

Holst, Kent (Iowa Stored Energy Plant Agency, Traer, IA); Huff, Georgianne; Schulte, Robert H. (Schulte Associates LLC, Northfield, MN); Critelli, Nicholas (Critelli Law Office PC, Des Moines, IA)

2012-01-01

The Iowa Stored Energy Park was an innovative, 270 Megawatt, $400 million compressed air energy storage (CAES) project proposed for in-service near Des Moines, Iowa, in 2015. After eight years in development the project was terminated because of site geological limitations. However, much was learned in the development process regarding what it takes to do a utility-scale, bulk energy storage facility and coordinate it with regional renewable wind energy resources in an Independent System Operator (ISO) marketplace. Lessons include the costs and long-term economics of a CAES facility compared to conventional natural gas-fired generation alternatives; market, legislative, and contract issues related to enabling energy storage in an ISO market; the importance of due diligence in project management; and community relations and marketing for siting of large energy projects. Although many of the lessons relate to CAES applications in particular, most of the lessons learned are independent of site location or geology, or even the particular energy storage technology involved.

Chromosomal aberrations of the Chinese hamster cell line V79 after irradiation with X-rays and heavy ions

International Nuclear Information System (INIS)

Mueller, W.

1985-02-01

The study on hand examines chromosomal aberrations in Chinese hamster 79 cells. Irradiation involved a number of heavy ions ranging from neon to uranium with an energy variation between 0.3 and 20 MeV/u. Linear energy transfer ranged from 270 to 16,300 keV/μm. X-ray tests were run for reasons of comparison. Experiments showed the following results: 1) Aberration rate increases in dependence of nuclear charge number or LET resp. 2) The distribution of the chromosome-damage instances found differed markedly from corresponding measurements following irradiation with thinly ionizing radiation. In contrast to x-irradiation, it is possible, therefore, to obtain high aberration yields in preparations made immediately after irradiation. 3) The maximum of aberration yield after heavy-ion irradiation could be shown to occur as early as 4h after irradiation. This is true in x-irradiation for but small doses. 4) The radiation-sensitizing effect of caffeine and its action on the repair system of the cell could be confirmed for x-irradiation and could be described for heavy ions for the first time. 5) The radiation-protection effect of cysteamine could be re-affirmed for thinly ionizing radiation, however, it could not be verified for heavy ions. 6) Irradiation of cells by means of particles of a defined range supports the hypothesis that the particularly radiation-sensitive regions of the nucleus membrane constitute the cell's crucial target. (orig./MG) [de

High performance glucose/O2 compartment-less biofuel cell using DNA/CNTs as platform for immobilizing bilirubin oxidase as novel biocathode and integrated NH2-CNTs/dendrimer/glucose dehydrogenase/nile blue as bioanode

International Nuclear Information System (INIS)

Korani, Aazam; Salimi, Abdollah

2015-01-01

Highlights: • A biocathode based on immobilization of bilirubin oxidase onto MWCNTs/DNA is designed. • The performance of MWCNTs/DNA/BOD biocathode for O 2 reduction reaction is improved. • Compared to MWCNTs/BOD,at present biocathode current density to ORR increased 3 folds. • The onset potential for ORR is 0.57 V and its current density increased to 270 μA cm −2 . • A glucose/O 2 BFC with voltage of 0.66 V, J = 172 μAcm −2 and power of 45 μW cm −2 fabricated. - Abstract: Herein, deoxyribonucleic acid (DNA)/multi-walled carbon nanotube (MWCNTs) with enhanced negative charged density was used as a novel electrochemical platform for oriented immobilization of bilirubin oxidase. The proposed support improved the direct electron transfer kinetics of BOD and its catalytic activity toward oxygen reduction reaction (ORR). In comparison to BOD enzyme which immobilized directly onto MWCNTs the current density increased three folds and reached to 270 μA cm −2 at 0.405 V with an onset potential of 0.57 V (vs. Ag/AgCl). The ability of this modified electrode as a biocathode is investigated after assembling with bioanode. The bioanode prepared with covalent attachment of glucose dehydrogenase enzyme (GDH) and nile blue (NB) as an efficient mediator for coenzyme regeneration onto glassy carbon electrode modified with amino-carbon nanotubes(MWCNTs-NH 2 ) and carboxyl terminated polyamidoamin dendrimer (PAMAM-Den) as a multifunctional linker. Finally, the performance of one-compartment glucose/O 2 biofuel cell without separators is also investigated. The open circuit voltage of the cell and maximum current density are obtained 660 mV and 172 μA cm −2 , respectively, while the maximum power density of 45 μW cm −2 is achieved at 428 mV of the cell voltage in buffer solution saturated with O 2 and containing 50 mM of glucose. The stability of the constructed EBFC is investigated under continuous operation at maximum power. It is observed that the biofuel

Conjugated docosahexaenoic acid suppresses KPL-1 human breast cancer cell growth in vitro and in vivo: potential mechanisms of action

International Nuclear Information System (INIS)

Tsujita-Kyutoku, Miki; Ogawa, Yutaka; Tsubura, Airo; Yuri, Takashi; Danbara, Naoyuki; Senzaki, Hideto; Kiyozuka, Yasuhiko; Uehara, Norihisa; Takada, Hideho; Hada, Takahiko; Miyazawa, Teruo

2004-01-01

The present study was conducted to examine the effect of conjugated docosahexaenoic acid (CDHA) on cell growth, cell cycle progression, mode of cell death, and expression of cell cycle regulatory and/or apoptosis-related proteins in KPL-1 human breast cancer cell line. This effect of CDHA was compared with that of docosahexaenoic acid (DHA). KPL-1 cell growth was assessed by colorimetric 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay; cell cycle progression and mode of cell death were examined by flow cytometry; and levels of expression of p53, p21 Cip1/Waf1 , cyclin D 1 , Bax, and Bcl-2 proteins were examined by Western blotting analysis. In vivo tumor growth was examined by injecting KPL-1 cells subcutaneously into the area of the right thoracic mammary fat pad of female athymic mice fed a CDHA diet. CDHA inhibited KPL-1 cells more effectively than did DHA (50% inhibitory concentration for 72 hours: 97 μmol/l and 270 μmol/l, respectively). With both CDHA and DHA growth inhibition was due to apoptosis, as indicated by the appearance of a sub-G 1 fraction. The apoptosis cascade involved downregulation of Bcl-2 protein; Bax expression was unchanged. Cell cycle progression was due to G 0 /G 1 arrest, which involved increased expression of p53 and p21 Cip1/Waf1 , and decreased expression of cyclin D 1 . CDHA modulated cell cycle regulatory proteins and apoptosis-related proteins in a manner similar to that of parent DHA. In the athymic mouse system 1.0% dietary CDHA, but not 0.2%, significantly suppressed growth of KPL-1 tumor cells; CDHA tended to decrease regional lymph node metastasis in a dose dependent manner. CDHA inhibited growth of KPL-1 human breast cancer cells in vitro more effectively than did DHA. The mechanisms of action involved modulation of apoptosis cascade and cell cycle progression. Dietary CDHA at 1.0% suppressed KPL-1 cell growth in the athymic mouse system

Preoperative concurrent CBDCA chemotherapy and accelerated hyperfractionated radiotherapy for squamous cell carcinoma of the maxillary region

International Nuclear Information System (INIS)

Omura, Ken; Harada, Hiroyuki; Suzuki, Haruhiko; Takeuchi, Yosuke; Hatano, Kazuo; Togawa, Takashi

2001-01-01

Between 1994 and 2000, 28 patients with T3/T4 squamus cell carcinoma of the maxillary region (maxillary sinus, 22; maxillary gingiva, 4; maxillary bone, 1; buccal mucosa, 1) had accelerated hyperfractionated radiotherapy combined with simultaneous CBDCA chemotherapy preoperatively, at Chiba Cancer Center Hospital. The protocol consisted of combined therapy with accelerated hyperfractionated irradiation of 1.6 Gy, twice a day, to a total dose of 32.0-51.2 Gy and concurrent intra-arterial or intravenous infusion of CBDCA 20-30 mg/body/day for a cumulative total dose of 270-480 mg. After completion of the preoperative combined therapy, the clinical CR rate was 17.9%, and the good PR·CR rate was 32.1%. According to the initial findings and response to the combined therapy, all patients had maxillectomy (subtotal, 3; total, 16; extended, 9) 4 weeks after completion of the preoperative combined therapy. Postoperatively, the complete pathologic response (Ohboshi and Shimozato's classification, grade III and IV) rate was 28.6%. And the actuarial local control rate was 85.7%, with a mean follow-up of 46.2 months. Based on these results, we believe this preoperative therapy with CBDCA chemotherapy and accelerated hyperfractionated radiation is a significant choice as treatment for squamous cell cancer of the maxillary region. (author)

C57BL/6 mice need MHC class II Aq to develop collagen-induced arthritis dependent on autoreactive T cells.

Science.gov (United States)

Bäcklund, Johan; Li, Cuiqin; Jansson, Erik; Carlsen, Stefan; Merky, Patrick; Nandakumar, Kutty-Selva; Haag, Sabrina; Ytterberg, Jimmy; Zubarev, Roman A; Holmdahl, Rikard

2013-07-01

Collagen-induced arthritis (CIA) has traditionally been performed in MHC class II A(q)-expressing mice, whereas most genetically modified mice are on the C57BL/6 background (expressing the b haplotype of the major histocompatibility complex (MHC) class II region). However, C57BL/6 mice develop arthritis after immunisation with chicken-derived collagen type II (CII), but arthritis susceptibility has been variable, and the immune specificity has not been clarified. To establish a CIA model on the C57BL/6 background with a more predictable and defined immune response to CII. Both chicken and rat CII were arthritogenic in C57BL/6 mice provided they were introduced with high doses of Mycobacterium tuberculosis adjuvant. However, contaminating pepsin was strongly immunogenic and was essential for arthritis development. H-2(b)-restricted T cell epitopes on chicken or rat CII could not be identified, but expression of A(q) on the C57BL/6 background induced T cell response to the CII260-270 epitope, and also prolonged the arthritis to be more chronic. The putative (auto)antigen and its arthritogenic determinants in C57BL/6 mice remains undisclosed, questioning the value of the model for addressing T cell-driven pathological pathways in arthritis. To circumvent this impediment, we recommend MHC class II congenic C57BL/6N.Q mice, expressing A(q), with which T cell determinants have been thoroughly characterised.

Prevalence of pain medication prescriptions in France, Germany, and the UK - a cross-sectional study including 4,270,142 patients.

Science.gov (United States)

Jacob, Louis; Kostev, Karel

2018-01-01

The goal of the present study was to analyze the prevalence of pain medication prescriptions in general practices in France, Germany, and the UK. This study included all patients aged ≥18 years followed in 2016 in general practitioner practices in France, Germany and the UK. The primary outcome was the prevalence of patients receiving prescriptions for pain medications in France, Germany, and the UK in 2016. The following drugs were included in the analysis: anti-inflammatory and antirheumatic products, non-steroids and analgesics including opioids, antimigraine preparations, and other analgesics and antipyretics. Demographic variables included age and gender. This study included 4,270,142 patients. The prevalences of pain medication prescriptions were 57.3% in France, 29.6% in Germany, and 21.7% in the UK. Although this prevalence generally remained consistent between age groups in France (54.3%-60.3%), it increased with age in Germany (18-30 years: 23.8%; >70 years: 35.8%) and in the UK (18-30 years: 9.3%; >70 years: 43.8%). Finally, the prevalence of pain medication prescriptions was higher in women than in men in all three countries. Paracetamol was prescribed to 82.3% and 60.1% of patients receiving pain medication in France and the UK, respectively, whereas ibuprofen was prescribed to 46.5% of individuals in Germany. The prevalence of pain medication prescriptions was higher in France than in Germany and the UK. Further research is needed to gain a better understanding of the differences in the prescription patterns between these three European countries.

Control of Vascular Smooth Muscle Cell Growth by Connexin 43

Directory of Open Access Journals (Sweden)

Chintamani eJoshi

2012-06-01

Full Text Available Connexin 43 (Cx43, the principal gap junction protein in vascular smooth muscle cells (VSMCs, regulates movement of ions and other signaling molecules through gap junction intercellular communication (GJIC and plays important roles in maintaining normal vessel function; however, many of the signaling mechanisms controlling Cx43 in VSMCs are not clearly described. The goal of this study was to investigate mechanisms of Cx43 regulation with respect to VSMC proliferation. Treatment of rat primary VSMCs with the cAMP analog 8Br-cAMP, the soluble guanylate cyclase (sGC stimulator BAY 41-2272 (BAY, or the Cx inducer diallyl disulfide (DADS significantly reduced proliferation after 72 h compared to vehicle controls. Bromodeoxyuridine uptake revealed reduction (p<.001 in DNA synthesis after 6 h and flow cytometry showed reduced (40% S phase cell numbers after 16 h in DADS-treated cells compared to controls. Cx43 expression significantly increased after 270 min treatment with 8Br-cAMP, 8Br-cGMP, BAY or DADS. Inhibition of PKA, PKG or PKC reversed 8Br-cAMP-stimulated increases in Cx43 expression, whereas only PKG or PKC inhibition reversed 8Br-cGMP- and BAY-stimulated increases in total Cx43. Interestingly, stimulation of Cx43 expression by DADS was not dependent on PKA, PKG or PKC. Using fluorescence recovery after photobleaching, only 8Br-cAMP or DADS increased GJIC with 8Br-cAMP mediated by PKC and DADS mediated by PKG. Further, DADS significantly increased phosphorylation at the MAPK-sensitive serine (Ser255 and Ser279, the cell cycle regulatory kinase-sensitive Ser262 and the PKC-sensitive Ser368 after 30 min while 8Br-cAMP significantly increased phosphorylation only at Ser279 compared to controls. This study demonstrates that 8Br-cAMP- and DADS-enhanced GJIC rather than Cx43 expression and/or phosphorylation plays an important role in regulation of VSMC proliferation and provides new insights into the growth-regulatory capacities of Cx43 in VSMCs.

Trends in significant wave height and surface wind speed in the China Seas between 1988 and 2011

Science.gov (United States)

Zheng, Chongwei; Zhang, Ren; Shi, Weilai; Li, Xin; Chen, Xuan

2017-10-01

Wind and waves are key components of the climate system as they drive air-sea interactions and influence weather systems and atmospheric circulation. In marine environments, understanding surface wind and wave fields and their evolution over time is important for conducting safe and efficient human activities, such as navigation and engineering. This study considers long-term trends in the sea surface wind speed (WS) and significant wave height (SWH) in the China Seas over the period 1988-2011 using the Cross-Calibrated Multi-Platform (CCMP) ocean surface wind product and a 24-year hindcast wave dataset obtained from the WAVEWATCH-III (WW3) wave model forced with CCMP winds. The long-term trends in WS and SWH in the China Seas are analyzed over the past 24 years to provide a reference point from which to assess future climate change and offshore wind and wave energy resource development in the region. Results demonstrate that over the period 1988-2011 in the China Seas: 1) WS and SWH showed a significant increasing trend of 3.38 cm s-1 yr-1 and 1.52 cm yr-1, respectively; 2) there were notable regional differences in the long-term trends of WS and SWH; 3) areas with strong increasing trends were located mainly in the middle of the Tsushima Strait, the northern and southern areas of the Taiwan Strait, and in nearshore regions of the northern South China Sea; and 4) the long-term trend in WS was closely associated with El Niño and a significant increase in the occurrence of gale force winds in the region.

Development of a low-noise, two-dimensional amplifier array

International Nuclear Information System (INIS)

Kishishita, Tetsuichi; Ikeda, Hirokazu; Sakumura, Takuto; Tamura, Ken-ichi; Takahashi, Tadayuki

2009-01-01

This paper describes the recent development of a low-noise, two-dimensional analog front-end ASIC for hybrid pixel imaging detectors. Based on the Open-IP LSI project, the ASIC is designed to meet a low-noise requirement of better than 100e - (rms) with self-triggering capability. The ASIC is intended for the readout of pixel sensors utilizing silicon (Si) and cadmium telluride (CdTe) as detector materials for spectroscopic imaging observations in the X-ray and gamma-ray regions. The readout chip consists of a 4x4 matrix of identical 270μmx270μm pixel cells and was implemented with TSMC 0.35-μm CMOS technology. Each pixel cell contains a charge-sensitive amplifier, pole-zero cancellation circuit, shaper, comparator, and peak hold circuit. Preliminary testing of the ASIC achieved an 88e - (rms) equivalent noise charge and a 25e - /pF noise slope with power consumption of 150μW per pixel.

Rapid Recovery of CD3+CD8+ T Cells on Day 90 Predicts Superior Survival after Unmanipulated Haploidentical Blood and Marrow Transplantation.

Directory of Open Access Journals (Sweden)

Deng-Mei Tian

Full Text Available Rapid immune reconstitution after allogeneic hematopoietic stem cell transplantation (allo-HSCT is significantly associated with lower infection, relapse and possibly secondary malignancy rates. The aim of this study was to investigate the role of peripheral lymphocyte subsets, especially CD3+CD8+ cytotoxic T cell recovery, in predicting transplant outcomes, including the overall survival (OS and non-relapse mortality (NRM rates after unmanipulated haploidentical blood and marrow transplantation (HBMT.Peripheral blood samples were obtained from 214 HBMT recipients with hematological malignancies. The peripheral lymphocyte subsets (CD3+ T cells, CD3+CD4+ helper T cells, CD3+CD8+ cytotoxic T cells, and CD19+ B cells were analyzed by flow cytometry at days 30, 60, 90, 180, 270 and 360 after HBMT.The CD3+CD8+ cytotoxic T cell recovery at day 90 (CD3+CD8+-90 was correlated with bacterial infection (P = 0.001, NRM (P = 0.001, leukemia-free survival (LFS, P = 0.005, and OS (P = 0.001 at a cutoff value of 375 cells/μL CD3+CD8+ T cells. The incidence of bacterial infection in patients with the CD3+CD8+-90 at ≥375 cells/μL was significantly lower than that of cases with the CD3+CD8+-90 at <375 cells/μL after HBMT (14.6% versus 41.6%, P<0.001. Multivariate analysis showed the rapid recovery of CD3+CD8+ T cells at day 90 after HBMT was strongly associated with a lower incidence of NRM (HR = 0.30; 95% CI: 0.15-0.60; P = 0.000 and superior LFS (HR = 0.51; 95% CI: 0.32-0.82; P = 0.005 and OS (HR = 0.38; 95% CI: 0.23-0.63; P = 0.000.The results suggest that the rapid recovery of CD3+CD8+ cytotoxic T cells at day 90 following HBMT could predict superior transplant outcomes.

Specific cell-derived microvesicles: Linking endothelial function to carotid artery intima-media thickness in low cardiovascular risk menopausal women.

Science.gov (United States)

Miller, Virginia M; Lahr, Brian D; Bailey, Kent R; Hodis, Howard N; Mulvagh, Sharon L; Jayachandran, Muthuvel

2016-03-01

Decreases in endothelial function measured by reactive hyperemic index (RHI) correlated with increases in carotid intima-media thickness (CIMT) in recently menopausal women with a low risk cardiovascular profile. Factors linking this association are unknown. Assess, longitudinally, markers of platelet activation and cell-derived, blood-borne microvesicles (MV) in relationship to RHI and CIMT in asymptomatic, low risk menopausal women. RHI by digital pulse tonometry (n = 93), CIMT by ultrasound (n = 113), measures of platelet activation and specific cell-derived, blood-borne MV were evaluated in women throughout the Kronos Early Estrogen Prevention Study (KEEPS) at Mayo Clinic. CIMT, but not RHI, increased significantly over 4 years. The average change in CIMT correlated significantly with the average follow-up values of MV positive for common leukocyte antigen [CD45; ρ = 0.285 (P = 0.002)] and VCAM-1 [ρ = 0.270 (P = 0.0040)]. Using principal components analysis (PC) on the aggregate set of average follow-up measures, the first derived PC representing numbers of MV positive for markers of vascular endothelium, inflammatory cells (leukocyte and monocytes), pro-coagulant (tissue factor), and cell adhesion molecules (ICAM-1 and VCAM-1) associated with changes in RHI and CIMT. Changes in RHI associated with another PC defined by measures of platelet activation (dense granular ATP secretion, surface expression of P-selectin and fibrinogen receptors). MV derived from activated endothelial and inflammatory cells, and those expressing cell adhesion and pro-coagulant molecules may reflect early vascular dysfunction in low risk menopausal women. Assays of MV as non-conventional measures to assess cardiovascular risk in asymptomatic women remain to be developed. Copyright © 2015 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.

Randomized clinical trial of 270° posterior versus 180° anterior partial laparoscopic fundoplication for gastro-oesophageal reflux disease.

Science.gov (United States)

Roks, D J; Koetje, J H; Oor, J E; Broeders, J A; Nieuwenhuijs, V B; Hazebroek, E J

2017-06-01

Partial fundoplications provide similar reflux control with fewer post-fundoplication symptoms compared with Nissen fundoplication for gastro-oesophageal reflux disease (GORD). The best choice of procedure for partial fundoplication remains unclear. The aim of this study was to compare the outcome of two different types of partial fundoplication for GORD. A double-blind RCT was conducted between 2012 and 2015 in two hospitals specializing in antireflux surgery. Patients were randomized to undergo either a laparoscopic 270° posterior fundoplication (Toupet) or a laparoscopic 180° anterior fundoplication. The primary outcome was postoperative dysphagia at 12 months, measured by the Dakkak score. Subjective outcome was analysed at 1, 3, 6 and 12 months after surgery. Objective reflux control was assessed before and 6 months after surgery. Ninety-four patients were randomized to laparoscopic Toupet or laparoscopic 180° anterior fundoplication (47 in each group). At 12 months, 85 patients (90 per cent) were available for follow-up. Objective scores were available for 76 (81 per cent). Postoperative Dakkak dysphagia score at 12 months was similar in the two groups (mean 5·9 for Toupet versus 6·4 for anterior fundoplication; P = 0·773). Subjective outcome at 12 months demonstrated no significant differences in control of reflux or post-fundoplication symptoms. Overall satisfaction and willingness to undergo surgery did not differ between the groups. Postoperative endoscopy and 24-h pH monitoring showed no significant differences in mean oesophageal acid exposure time or recurrent pathological oesophageal acid exposure. Both types of partial fundoplication provided similar control of GORD at 12 months, with no difference in post-fundoplication symptoms. Registration number: NTR5702 (www.trialregister.nl). © 2017 BJS Society Ltd Published by John Wiley & Sons Ltd.

Conventional and molecular cytogenetics of human non-medullary thyroid carcinoma: characterization of eight cell line models and review of the literature on clinical samples

International Nuclear Information System (INIS)

Ribeiro, Franclim Ricardo; Meireles, Ana Margarida; Rocha, Ana Sofia; Teixeira, Manuel Rodrigues

2008-01-01

Cell lines are often poorly characterized from a genetic point of view, reducing their usefulness as tumor models. Our purpose was to assess the genetic background of eight commonly used human thyroid carcinoma models and to compare the findings with those reported for primary tumors of the gland. We used chromosome banding analysis and comparative genomic hybridization to profile eight non-medullary thyroid carcinoma cell lines of papillary (TPC-1, FB2, K1 and B-CPAP), follicular (XTC-1) or anaplastic origin (8505C, C643 and HTH74). To assess the representativeness of the findings, we additionally performed a thorough review of cytogenetic (n = 125) and DNA copy number information (n = 270) available in the literature on clinical samples of thyroid carcinoma. The detailed characterization of chromosomal markers specific for each cell line revealed two cases of mistaken identities: FB2 was shown to derive from TPC-1 cells, whereas K1 cells have their origin in cell line GLAG-66. All cellular models displayed genomic aberrations of varying complexity, and recurrent gains at 5p, 5q, 8q, and 20q (6/7 cell lines) and losses at 8p, 13q, 18q, and Xp (4/7 cell lines) were seen. Importantly, the genomic profiles were compatible with those of the respective primary tumors, as seen in the meta-analysis of the existing literature data. We provide the genomic background of seven independent thyroid carcinoma models representative of the clinical tumors of the corresponding histotypes, and highlight regions of recurrent aberrations that may guide future studies aimed at identifying target genes. Our findings further support the importance of routinely performing cytogenetic studies on cell lines, to detect cross-contamination mishaps such as those identified here

Commensal Gut Derived Anaerobes as Novel Therapy for Inflammatory Autoimmune Diseases

Science.gov (United States)

2012-05-01

JR, Begovich AB, Erlich HA, Steinman L. Genetic factors in multiple sclerosis. Jama 1993;270:2362e9. [11] Barcellos LF, Sawcer S, Ramsay PP...28. Ley RE, Peterson DA, Gordon JI (2006) Ecological and evolutionary forces shaping microbial diversity in the human intestine. Cell 124: 837–848

Contagem de células somáticas e isolamento de agentes causadores de mastite em búfalas (Bubalus bubalis Somatic cell count and mastitis causing pathogens isolation in water buffaloes (Bubalus bubalis

Directory of Open Access Journals (Sweden)

L.B. Carvalho

2007-02-01

Full Text Available The research was accomplished in eight dairy water buffalo herds, randomically choosen in Região do Alto São Francisco, State of Minas Gerais, Brazil. Information was collected from March to November, 2003 during 270 days of observation. In order to determine the somatic cell count (SCC in presence or absence of microbial isolation, 1,393 samples were collected from 285 lactating females and microbiological exams and SCC were done. Samples obtained from udders without evidence of clinical or subclinical inflammation showed infection for a great variety of microbial mastitis pathogens. The low SCC did not necessarily indicate the absence of intramammary infection, suggesting that SCC patterns used for bovine cannot be appropriate in order to control mastitis in buffalo herds.

Preoperative concurrent CBDCA chemotherapy and accelerated hyperfractionated radiotherapy for squamous cell carcinoma of the maxillary region

Energy Technology Data Exchange (ETDEWEB)

Omura, Ken; Harada, Hiroyuki [Tokyo Medical and Dental Univ. (Japan). Graduate School; Suzuki, Haruhiko; Takeuchi, Yosuke; Hatano, Kazuo; Togawa, Takashi

2001-11-01

Between 1994 and 2000, 28 patients with T3/T4 squamus cell carcinoma of the maxillary region (maxillary sinus, 22; maxillary gingiva, 4; maxillary bone, 1; buccal mucosa, 1) had accelerated hyperfractionated radiotherapy combined with simultaneous CBDCA chemotherapy preoperatively, at Chiba Cancer Center Hospital. The protocol consisted of combined therapy with accelerated hyperfractionated irradiation of 1.6 Gy, twice a day, to a total dose of 32.0-51.2 Gy and concurrent intra-arterial or intravenous infusion of CBDCA 20-30 mg/body/day for a cumulative total dose of 270-480 mg. After completion of the preoperative combined therapy, the clinical CR rate was 17.9%, and the good PR{center_dot}CR rate was 32.1%. According to the initial findings and response to the combined therapy, all patients had maxillectomy (subtotal, 3; total, 16; extended, 9) 4 weeks after completion of the preoperative combined therapy. Postoperatively, the complete pathologic response (Ohboshi and Shimozato's classification, grade III and IV) rate was 28.6%. And the actuarial local control rate was 85.7%, with a mean follow-up of 46.2 months. Based on these results, we believe this preoperative therapy with CBDCA chemotherapy and accelerated hyperfractionated radiation is a significant choice as treatment for squamous cell cancer of the maxillary region. (author)

Supercritical synthesis and in situ deposition of PbS nanocrystals with oleic acid passivation for quantum dot solar cells

Energy Technology Data Exchange (ETDEWEB)

Tavakoli, M.M. [Department of Materials Science and Engineering, Sharif University of Technology, 14588 Tehran (Iran, Islamic Republic of); Simchi, A., E-mail: simchi@sharif.edu [Department of Materials Science and Engineering, Sharif University of Technology, 14588 Tehran (Iran, Islamic Republic of); Institute for Nanoscience and Nanotechnology, Sharif University of Technology, 14588 Tehran (Iran, Islamic Republic of); Aashuri, H. [Department of Materials Science and Engineering, Sharif University of Technology, 14588 Tehran (Iran, Islamic Republic of)

2015-04-15

Colloidal quantum dot solar cells have recently attracted significant attention due to their low-processing cost and surging photovoltaic performance. In this paper, a novel, reproducible, and simple solution-based process based on supercritical fluid toluene is presented for in situ growth and deposition PbS nanocrystals with oleic-acid passivation. A lead precursor containing sulfur was mixed with oleic acid in toluene and processed in a supercritical fluid condition at different temperatures of 140, 270 and 330 °C for 20 min. The quantum dots were deposited on a fluorine-doped tin oxide glass substrate inside the supercritical reactor. Transmission electron microscopy, X-ray diffraction, absorption and dynamic light scattering showed that the nanocrystals processed at the supercritical condition (330 °C) are fully crystalline with a narrow size distribution of ∼3 nm with an absorption wavelength of 915 nm (bandgap of 1.3 eV). Fourier transform infrared spectroscopy indicated that the PbS quantum dots are passivated by oleic acid molecules during the growth. Photovoltaic characteristics of Schottky junction solar cells showed an improvement over devices prepared by spin-coating. - Highlights: • Supercritical fluid processing and in situ deposition of PbS QDs are presented. • The prepared nanocrystals are mono-dispersed with an optical bandgap of 1.3 eV. • Photovoltaic performance of the in situ deposited nanocrystals is reported. • An improved PV performance compared to spin coated Schottky solar cells is shown.

Biosorption of U(VI) by the green algae Chlorella vulgaris in dependence of pH value and cell activity

Energy Technology Data Exchange (ETDEWEB)

Vogel, M., E-mail: M.Vogel@fzd.de; Guenther, A.; Rossberg, A.; Li, B.; Bernhard, G.; Raff, J.

2010-12-15

Biosorption of uranium(VI) by the green alga Chlorella vulgaris was studied at varying uranium concentrations from 5 {mu}M to 1 mM, and in the environmentally relevant pH range of 4.4 to 7.0. Living cells bind in a 0.1 mM uranium solution at pH 4.4 within 5 min 14.3 {+-} 5.5 mg U/g dry biomass and dead cells 28.3 {+-} 0.6 mg U/g dry biomass which corresponds to 45% and 90% of total uranium in solution, respectively. During 96 h of incubation with uranium initially living cells died off and with 26.6 {+-} 2.1 mg U/g dry biomass bound similar amounts of uranium compared to dead cells, binding 27.0 {+-} 0.7 mg U/g dry biomass. In both cases, these amounts correspond to around 85% of the initially applied uranium. Interestingly, at a lower and more environmentally relevant uranium concentration of 5 {mu}M, living cells firstly bind with 1.3 {+-} 0.2 mg U/g dry biomass to 1.4 {+-} 0.1 mg U/g dry biomass almost all uranium within the first 5 min of incubation. But then algal cells again mobilize up to 80% of the bound uranium during ongoing incubation in the time from 48 h to 96 h. The release of metabolism related substances is suggested to cause this mobilization of uranium. As potential leachates for algal-bound uranium oxalate, citrate and ATP were tested and found to be able to mobilize more than 50% of the algal-bound uranium within 24 h. Differences in complexation of uranium by active and inactive algae cells were investigated with a combination of time-resolved laser-induced fluorescence spectroscopy (TRLFS), extended X-ray absorption fine structure (EXAFS) spectroscopy and attenuated total reflection Fourier transform infrared (ATR-FTIR) spectroscopy. Obtained results demonstrated an involvement of carboxylic and organic/inorganic phosphate groups in the uranium complexation with varying contributions dependent on cell status, uranium concentration and pH.

Biosorption of U(VI) by the green algae Chlorella vulgaris in dependence of pH value and cell activity

International Nuclear Information System (INIS)

Vogel, M.; Guenther, A.; Rossberg, A.; Li, B.; Bernhard, G.; Raff, J.

2010-01-01

Biosorption of uranium(VI) by the green alga Chlorella vulgaris was studied at varying uranium concentrations from 5 μM to 1 mM, and in the environmentally relevant pH range of 4.4 to 7.0. Living cells bind in a 0.1 mM uranium solution at pH 4.4 within 5 min 14.3 ± 5.5 mg U/g dry biomass and dead cells 28.3 ± 0.6 mg U/g dry biomass which corresponds to 45% and 90% of total uranium in solution, respectively. During 96 h of incubation with uranium initially living cells died off and with 26.6 ± 2.1 mg U/g dry biomass bound similar amounts of uranium compared to dead cells, binding 27.0 ± 0.7 mg U/g dry biomass. In both cases, these amounts correspond to around 85% of the initially applied uranium. Interestingly, at a lower and more environmentally relevant uranium concentration of 5 μM, living cells firstly bind with 1.3 ± 0.2 mg U/g dry biomass to 1.4 ± 0.1 mg U/g dry biomass almost all uranium within the first 5 min of incubation. But then algal cells again mobilize up to 80% of the bound uranium during ongoing incubation in the time from 48 h to 96 h. The release of metabolism related substances is suggested to cause this mobilization of uranium. As potential leachates for algal-bound uranium oxalate, citrate and ATP were tested and found to be able to mobilize more than 50% of the algal-bound uranium within 24 h. Differences in complexation of uranium by active and inactive algae cells were investigated with a combination of time-resolved laser-induced fluorescence spectroscopy (TRLFS), extended X-ray absorption fine structure (EXAFS) spectroscopy and attenuated total reflection Fourier transform infrared (ATR-FTIR) spectroscopy. Obtained results demonstrated an involvement of carboxylic and organic/inorganic phosphate groups in the uranium complexation with varying contributions dependent on cell status, uranium concentration and pH.

Alotransplante de ilhotas de Langerhans no fígado de ratos submetidos a manipulação tímica com células não-parenquimatosas Allogenic islet transplantation on the rat liver after allogenic nonparenchymal cells injection in the thymus

Directory of Open Access Journals (Sweden)

Eleazar Chaib

2006-12-01

éticos, antes do alotransplante de ilhotas de Langerhans no fígado, ao contrário de inibir a reação do receptor contra o enxerto, prolongando a sobrevida média das ilhotas e, possivelmente, levando ao estado de tolerância imunológica, induziu ao processo de rejeição aguda precoce.BACKGROUD: The major indication for pancreas or islet transplantation is diabetes mellitus type I. This process has to supply the insulin necessity keeping glucose under control AIM: We studied allogenic islet transplantation on the rat liver, Wistar (RT1u to Lewis (RT1¹ as a recipient. Control group (n = 8 and nonparenchymal cell group (n = 8 respectively with injection of Hanks solution and nonparenchymal cells in the thymus before islet transplantation. MATERIAL AND METHODS: With the method of isolation and purification of the islets we obtained both in the control group 3.637 ± 783,3 islets with purity of 85 ± 3,52% and nonparenchymal cell group 3.270 ± 770 islets with purity of 84,25 ± 2,76%. The nonparenchymal cells were retrieved from the liver and we obtained 2 x 106 cells. Diabetes was induced by i.v. streptozotocin RESULTS: Control group the transplantation of 3.637 ± 783,3 islets in the rat liver normalized glucose test, 7,21 ± 0,57 mmol/L in the 2nd postoperative day. Acute rejection came in the 6th postoperative day with significantly increase of glucose test in nonparenchymal cell group, the transplantation of 3.270 ± 770 islets in the rat liver, almost normalized the glucose test was 17,95 ± 5,33 mmol/L in the 2nd postoperative day. From the 4th postoperative day to 10th postoperative day. The glucose test increase significantly showing an early acute rejection CONCLUSION: The injection of nonparenchymal cells in the thymus before allogenic islet transplantation in the rat liver lead to an early acute rejection.

The enigma of the lower gut-associated lymphoid tissue (GALT)

Czech Academy of Sciences Publication Activity Database

Butler, J. E.; Šinkora, Marek

2013-01-01

Roč. 94, č. 2 (2013), s. 259-270 ISSN 0741-5400 R&D Projects: GA ČR GAP502/10/0038; GA ČR GAP502/12/0110 Institutional support: RVO:61388971 Keywords : B lymphocytes * lymphogenesis * B cell development Subject RIV: EC - Immunology Impact factor: 4.304, year: 2013

Comparative effects of sub-stimulating concentrations of non-human versus human Luteinizing Hormones (LH) or chorionic gonadotropins (CG) on adenylate cyclase activation by forskolin in MLTC cells.

Science.gov (United States)

Nguyen, Thi-Mong Diep; Filliatreau, Laura; Klett, Danièle; Combarnous, Yves

2018-05-15

We have compared various Luteinizing Hormone (LH) and Chorionic Gonadotropin (CG) preparations from non-human and human species in their ability to synergize with 10 µM forskolin (FSK) for cyclic AMP intracellular accumulation, in MLTC cells. LH from rat pituitary as well as various isoforms of pituitary ovine, bovine, porcine, equine and human LHs and equine and human CG were studied. In addition, recombinant human LH and CG were also compared with the natural human and non-human hormones. Sub-stimulating concentrations of all LHs and CGs (2-100 pM) were found to stimulate cyclic AMP accumulation in MLTC cells in the presence of an also non-stimulating FSK concentration (10 µM). Like rat LH, the most homologous available hormone for mouse MLTC cells, all non-human LHs and CG exhibit a strong potentiating effect on FSK response. The human, natural and recombinant hLH and hCG also do so but in addition, they were found to elicit a permissive effect on FSK stimulation. Indeed, when incubated alone with MLTC cells at non-stimulating concentrations (2-70 pM) hLH and hCG permit, after being removed, a dose-dependent cyclic AMP accumulation with 10 µM FSK. Our data show a clearcut difference between human LH and CG compared to their non-human counterparts on MLTC cells adenylate cyclase activity control. This points out the risk of using hCG as a reference ligand for LHR in studies using non-human cells. Copyright © 2018 Elsevier Inc. All rights reserved.

The experimental study on tropism of magnetic labeled bone marrow mesenchymal stem cells for hepatocellular carcinoma

International Nuclear Information System (INIS)

Chen Shuangqing; Wang Peijun; Li Minghua; Zhang Wei; Dai gonghua

2009-01-01

Objective: To label rat bone marrow mesenchymal stem cells with superparamagnetic iron oxide (SPIO) and to explore the tropism of BMSCs for hepatocellular carcinoma cells after transplantation in vivo. Methods: BMSCs from bone marrow of Sprague-Dawly (SD) rats were cultured isolated and purified. Labeled BMSCs was achieved using Feridex. Twenty-four hepatocellular carcinoma models of SD rats were induced two weeks before transplantation. The models were divided into three groups in random: the labeled BMSCs and unlabeled BMSCs were transplanted respectively into the rat's livers of experimental group (n=12) and control group A (n=6) via spleens, and no transplant was done for control group B (n=6). MR imaging was performed to monitor the transplanted cells after 1,3,7,14 d using 1.5 T MR system. Signal intensity ratio (SI/SI * ) between tumor and hepatic tissue on T 2 * WI were measured and compared by one-factor analysis of variance. After MR imaging, Prussian blue staining was performed. MR imaging findings were compared with histological sections. Results: Prussian blue staining confirmed the labeling efficiency of BMSCs was above 90%. SI/SI * of experimental group before and 1, 3, 7, 14 d after transplantation were 3.18±0.21, 1.98±0.20, 2.38±0.28, 2.70±0.25 and 3.16±0.24 respectively. Following transplantation of BMSCs, signal intensity decrease was found in hepatocellular carcinoma of experimental group (F=56.65, P 2 * WI (P>0.05). A large number of Prussian blue staining positive cells were found in hepatocellular carcinoma in experimental group. Histological section with Prussian blue staining had a good correlation with the signal intensity changes on MR images at different time. Conclusion: BMSCs display significant tropism to hepatocellular carcinoma and may be an ideal gene therapy vehicle against hepatocellular carcinoma. (authors)

Identification and functional analysis of a novel mutation in the PAX3 gene associated with Waardenburg syndrome type I.

Science.gov (United States)

Niu, Zhijie; Li, Jiada; Tang, Fen; Sun, Jie; Wang, Xueping; Jiang, Lu; Mei, Lingyun; Chen, Hongsheng; Liu, Yalan; Cai, Xinzhang; Feng, Yong; He, Chufeng

2018-02-05

Waardenburg syndrome type 1 (WS1) is a rare autosomal dominant genetic disorder of neural crest cells (NCC) characterized by congenital sensorineural hearing loss, dystopia canthorum, and abnormal iris pigmentation. WS1 is due to loss-of-function mutations in paired box gene 3 (PAX3). Here, we identified a novel PAX3 mutation (c.808C>G, p.R270G) in a three-generation Chinese family with WS1, and then analyzed its in vitro activities. The R270G PAX3 retained nuclear distribution and normal DNA-binding ability; however, it failed to activate MITF promoter, suggesting that haploinsufficiency may be the underlying mechanism for the mild WS1 phenotype of the study family. Copyright © 2017 Elsevier B.V. All rights reserved.

Ultraviolet light induces double-strand breaks in DNA of cultured human P3 cells as measured by neutral filter elution

International Nuclear Information System (INIS)

Peak, J.G.; Peak, M.J.

1990-01-01

Neutral filter elution at pH 7.2 and 9.6 was used to measure the induction of DNA lesions in human P3 teratocarcinoma cells by monochromatic 254-, 270-, 313-, 334-, 334-,365-, and 405-nm radiation and by 60 gamma rays. In this assay DNA double-strand breaks (dsb) increase the rate of elution of DNA from cell lysates on a filter. Yields of dsb as measured by this procedure were determined by using a calibration of the assay that correlates elution parameters with number of dsb caused by disintegration of 125 I incorporated into the DNA. Analysis of fluence responses obtained by using the calibrated assay indicated that the number of dsb induced per dalton of DNA as measured by this assay is proportional to the square of the fluence at all the energies of radiation studied, implying that the induction of these lesions may be a two-hit event. Analysis of the relative efficiencies for the induction of dsb by ultraviolet radiation, corrected for quantum efficiency, revealed a spectrum that coincided closely with that for the induction of single-strand breaks (ssb) in the same cells, having a close fit with the spectrum of nucleic acid in the UVC and UVB region below 313 nm, and a shoulder in the UVA region. It was calculated, however, that there may be too few ssb for dsb to result from randomly distributed closely opposed ssb. (author)

Neoplastic transformation induced by carbon ions.

Science.gov (United States)

Bettega, Daniela; Calzolari, Paola; Hessel, Petra; Stucchi, Claudio G; Weyrather, Wilma K

2009-03-01

The objective of this experiment was to compare the oncogenic potential of carbon ion beams and conventional photon beams for use in radiotherapy. The HeLa X human skin fibroblast cell line CGL1 was irradiated with carbon ions of three different energies (270, 100, and 11.4 MeV/u). Inactivation and transformation data were compared with those for 15 MeV photons. Inactivation and transformation frequencies for the 270 MeV/u carbon ions were similar to those for 15-MeV photons. The maximal relative biologic effectiveness (RBE(alpha)) values for 100MeV/u and 11.4 MeV/u carbon ions, respectively, were as follows: inactivation, 1.6 +/- 0.2 and 6.7 +/- 0.7; and transformation per surviving cell, 2.5 +/- 0.6 and 12 +/- 3. The curve for dose-transformation per cell at risk exhibited a maximum that was shifted toward lower doses at lower energies. Transformation induction per cell at risk for carbon ions in the entrance channel was comparable to that for photons, whereas for the lower energies, 100 MeV/u and 11 MeV/u, which are representative of the energies delivered to the tumor margins and volume, respectively, the probability of transformation in a single cell was greater than it was for photons. In addition, at isoeffective doses with respect to cell killing, the 11.4-MeV/u beam was more oncogenic than were photons.

Comité Scientifique de la Revue des Sciences et de la Technologie ...

African Journals Online (AJOL)

MICROSIM

Ecological Indicators,1, 261 – 270. [11] Wekbeker G. & Cory G., 1988. Robo nucleotide reductase activity and growth of glutathione depleted mouse leukemia 1210 cells in vitro. Cancer letters, 40, 257 – 264. [12] Bradford M., 1976. A rapid and sensitive method for the quantification of microgram quantities of protein utilizing ...

Comet assay in gill cells of Prochilodus lineatus exposed in vivo to cypermethrin.

Science.gov (United States)

Poletta, G L; Gigena, F; Loteste, A; Parma, M J; Kleinsorge, E C; Simoniello, M F

2013-11-01

Agricultural chemicals can induce genetic alterations on aquatic organisms that have been associated with effects on growth, reproduction and population dynamics. The evaluation of DNA damage in fish using the comet assay (CA) frequently involves the utilization of erythrocytes. However, epithelial gill cells (EGC) can be more sensitive, as they are constantly dividing and in direct contact with potentially stressing compounds from the aquatic environment. The aim of the present study was to evaluate (1) the sensitivity and suitability of epithelial gill cells of Prochilodus lineatus in response to different genotoxic agents through the application of the CA, (2) the induction of DNA damage in this cell population after in vivo exposure to cypermethrin. Baseline value of the CA damage index (DI) for EGC of juvenile P. lineatus was 144.68±5.69. Damage increased in a dose-dependent manner after in vitro exposure of EGC to methyl methanesulfonate (MMS) and H2O2, two known genotoxic agents. In vivo exposure of fish to cypermethrin induced a significant increase in DNA DI of EGC at 0.150μg/l (DI: 239.62±6.21) and 0.300μg/l (270.63±2.09) compared to control (150.25±4.38) but no effect was observed at 0.075μg/l (168.50±10.77). This study shows that EGC of this species are sensitive for the application of the CA, demonstrating DNA damage in response to alkylation (MMS), oxidative damage (H2O2), and to the insecticide cypermethryn. These data, together with our previous study on DNA damage induction on erythrocytes of this species, provides useful information for future work involving biomonitoring in regions where P. lineatus is naturally exposed to pesticides and other genotoxic agents. Copyright © 2013 Elsevier Inc. All rights reserved.

Advax™, a novel microcrystalline polysaccharide particle engineered from delta inulin, provides robust adjuvant potency together with tolerability and safety.

Science.gov (United States)

Petrovsky, Nikolai; Cooper, Peter D

2015-11-04

There is an ongoing need for new adjuvants to facilitate development of vaccines against HIV, tuberculosis, malaria and cancer, amongst many others. Unfortunately, the most potent adjuvants are often associated with toxicity and safety issues. Inulin, a plant-derived polysaccharide, has no immunological activity in its native soluble form but when crystallized into a stable microcrystalline particulate from (delta inulin) acquires potent adjuvant activity. Delta inulin has been shown to enhance humoral and cellular immune responses against a broad range of co-administered viral, bacterial, parasitic and toxin antigens. Inulin normally crystallizes as large heterogeneous particles with a broad size distribution and variable solubility temperatures. To ensure reproducible delta inulin particles with a consistent size distribution and temperature of solubility, a current Good Manufacturing Practice (cGMP) process was designed to produce Advax™ adjuvant. In its cCMP form, Advax™ adjuvant has proved successful in human trials of vaccines against seasonal and pandemic influenza, hepatitis B and insect sting anaphylaxis, enhancing antibody and T-cell responses while being safe and well tolerated. Advax™ adjuvant represents a novel human adjuvant that enhances both humoral and cellular immunity. This review describes the discovery and development of Advax™ adjuvant and research into its unique mechanism of action. Copyright © 2015 Elsevier Ltd. All rights reserved.

Carbon Mineralization by Aqueous Precipitation for Beneficial Use of CO2 from Flue Gas

Energy Technology Data Exchange (ETDEWEB)

Devenney, Martin; Gilliam, Ryan; Seeker, Randy

2013-08-01

The objective of this project is to demonstrate an innovative process to mineralize CO2 from flue gas directly to reactive carbonates and maximize the value and versatility of its beneficial use products. The program scope includes the design, construction, and testing of a CO2 Conversion to Material Products (CCMP) Pilot Demonstration Plant utilizing CO2 from the flue gas of a power production facility in Moss Landing, CA. This topical report covers Subphase 2a which is the design phase of pilot demonstration subsystems. Materials of construction have been selected and proven in both lab scale and prototype testing to be acceptable for the reagent conditions of interest. The target application for the reactive carbonate material has been selected based upon small-scale feasibility studies and the design of a continuous fiber board production line has been completed. The electrochemical cell architecture and components have been selected based upon both lab scale and prototype testing. The appropriate quality control and diagnostic techniques have been developed and tested along with the required instrumentation and controls. Finally the demonstrate site infrastructure, NEPA categorical exclusion, and permitting is all ready for the construction and installation of the new units and upgrades.

Losses, Expansions, and Novel Subunit Discovery of Adaptor Protein Complexes in Haptophyte Algae.

Science.gov (United States)

Lee, Laura J Y; Klute, Mary J; Herman, Emily K; Read, Betsy; Dacks, Joel B

2015-11-01

The phylum Haptophyta (Diaphoratickes) contains marine algae that perform biomineralization, extruding large, distinctive calcium carbonate scales (coccoliths) that completely cover the cell. Coccolith production is an important part of global carbon cycling; however, the membrane trafficking pathway by which they are secreted has not yet been elucidated. In most eukaryotes, post-Golgi membrane trafficking involves five heterotetrameric adaptor protein (AP) complexes, which impart cargo selection specificity. To better understand coccolith secretion, we performed comparative genomic, phylogenetic, and transcriptomic analyses of the AP complexes in Emiliania huxleyi strains 92A, Van556, EH2, and CCMP1516, and related haptophytes Gephyrocapsa oceanica and Isochrysis galbana; the latter has lost the ability to biomineralize. We show that haptophytes have a modified membrane trafficking system (MTS), as we found both AP subunit losses and duplications. Additionally, we identified a single conserved subunit of the AP-related TSET complex, whose expression suggests a functional role in membrane trafficking. Finally, we detected novel alpha adaptin ear and gamma adaptin ear proteins, the first of their kind to be described outside of opisthokonts. These novel ear proteins and the sculpting of the MTS may support the capacity for biomineralization in haptophytes, enhancing their ability to perform this highly specialized form of secretion. Copyright © 2015 Elsevier GmbH. All rights reserved.

Cell cycle-dependent changes in localization of a 210-kDa microtubule-interacting protein in .I.Leishmania./I..

Czech Academy of Sciences Publication Activity Database

Libusová, Lenka; Dráberová, Eduarda; Juliano, C.; Viklický, Vladimír; Fiori, P. L.; Cappuccinelli, P.; Dráber, Petr

2001-01-01

Roč. 266, č. 2 (2001), s. 270-278 ISSN 0014-4827 R&D Projects: GA ČR GA304/00/0553; GA AV ČR IAA5052004 Keywords : microtubule-associated proteins * Leishmania-antibody Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.096, year: 2001

Indian culinary plants enhance glucose-induced insulin secretion and glucose consumption in INS-1 β-cells and 3T3-L1 adipocytes.

Science.gov (United States)

Kaur, Lovedeep; Han, Kyoung-Sik; Bains, Kiran; Singh, Harjinder

2011-12-01

Six Indian plants, commonly used as culinary plants, herbs or spices (kikar; jamun; neem; harad; fenugreek; bitter gourd), were screened and compared for their antidiabetic potential in vitro. Aqueous plant extracts were prepared and assessed for their effect on the insulin secretion activity of rat pancreatic INS-1 β-cells and glucose consumption in mouse 3T3-L1 adipocytes in order to study their specific mechanisms of action. The effect of the plant extract concentration (25-1000μg/ml) on insulin release and glucose consumption was also studied. All the extracts had a significant stimulatory effect on the insulin secretion of INS-1 cells. In the presence of kikar extract (100μg/ml), an increase of 228% in insulin release was recorded compared to the control (5.6mM glucose) whereas that was 270% and 367% in the presence of kikar and jamun extracts (500μg/ml), respectively. 3T3-L1 cells treated with jamun extract (100μg/ml) exhibited the highest increase in glucose consumption by the cells (94%, compared with the control) followed by harad (53%) and fenugreek (50%) extracts. A significant inhibitory effect of the fenugreek, kikar and jamun extracts on glucose diffusion across a dialysis membrane suggested that these extracts could partly act by decreasing glucose absorption in the small intestine. The results showed that a combination of these plants in diet could help in the management of both type 1 and type 2 diabetes. Copyright © 2011 Elsevier Ltd. All rights reserved.

Excess mortality, causes of death and life expectancy in 270,770 patients with recent onset of mental disorders in Denmark, Finland and Sweden.

Directory of Open Access Journals (Sweden)

Merete Nordentoft

Full Text Available BACKGROUND: Excess mortality among patients with severe mental disorders has not previously been investigated in detail in large complete national populations. OBJECTIVE: To investigate the excess mortality in different diagnostic categories due to suicide and other external causes of death, and due to specific causes in connection with diseases and medical conditions. METHODS: In longitudinal national psychiatric case registers from Denmark, Finland, and Sweden, a cohort of 270,770 recent-onset patients, who at least once during the period 2000 to 2006 were admitted due to a psychiatric disorder, were followed until death or the end of 2006. They were followed for 912,279 person years, and 28,088 deaths were analyzed. Life expectancy and standardized cause-specific mortality rates were estimated in each diagnostic group in all three countries. RESULTS: The life expectancy was generally approximately 15 years shorter for women and 20 years shorter for men, compared to the general population. Mortality due to diseases and medical conditions was increased two- to three-fold, while excess mortality from external causes ranged from three- to 77-fold. Mortality due to diseases and medical conditions was generally lowest in patients with affective disorders and highest in patients with substance abuse and personality disorders, while mortality due to suicide was highest in patients with affective disorders and personality disorders, and mortality due to other external causes was highest in patients with substance abuse. CONCLUSIONS: These alarming figures call for action in order to prevent the high mortality.

Aryl Hydrocarbon Receptor Negatively Regulates Expression of the Plakoglobin Gene (Jup)

Czech Academy of Sciences Publication Activity Database

Procházková, Jiřina; Kabátková, Markéta; Šmerdová, Lenka; Pachernik, J.; Sýkorová, D.; Kohoutek, J.; Šimečková, P.; Hrubá, E.; Kozubík, Alois; Machala, M.; Vondráček, Jan

2013-01-01

Roč. 134, č. 2 (2013), s. 258-270 ISSN 1096-6080 R&D Projects: GA ČR(CZ) GA524/09/1337; GA ČR(CZ) GD204/09/H058; GA MŠk(CZ) EE2.3.30.0030 Grant - others:GA ČR(CZ) GA301/09/1832 Institutional research plan: CEZ:AV0Z50040702 Institutional support: RVO:68081707 Keywords : EMBRYONIC STEM-CELLS * LIVER EPITHELIAL-CELLS * AH RECEPTOR Subject RIV: BO - Biophysics Impact factor: 4.478, year: 2013

[Treatment of mallet finger with dorsal nail glued splint: retrospective analysis of 270 cases].

Science.gov (United States)

Facca, S; Nonnenmacher, J; Liverneaux, P

2007-11-01

Management of mallet finger is both difficult and controversial. Sequelae are not uncommon, particularly after surgical treatment. Many authors advocate orthopedic treatment which is less invasive but requires greater patient participation to implement. Despite the large number of orthopedic methods proposed, none has proven superiority. We report here our experience with a dorsal adhesive splint which preserves digital pulp function and improves observance. This retrospective analysis included 270 mallet fingers presenting 153 tendon injuries and 117 bony injuries in 265 patients aged 42 years on average and treated from 2003 to 2005. Most of the tendon injuries involved the medius (38.7%) and most of the bony injuries involved the ring finger (35.4%). A splint was fashioned for the two distal phalanges and glued to the nail plate filed for this purpose. The splint was fashioned out of an L-shaped plastic sheet of thermo-malleable plastic dipped in hot water (60 degrees C). The L was molded to the dorsal aspect of the phalanges and rolled like a ring around the second phalanx, then glued to the nail. The splint was worn for eight weeks by patients with a tendon injury and six weeks for those with a bony injury. The splint was then worn at night for two weeks. Three criteria were used to analyze outcome: residual extension deficit, joint involvement, complications. Mean follow-up was 18 months. Mean time from trauma to definitive installation of the splint was six days. The complication rate for this orthopedic method was 14.3%, complications being observed in 6% of patients. All complications were transient except for one case of swan neck deformity and one case of painful osteoarthritis. Thirty splints (11%) became unglued but were all reinstalled using the same protocol. Thirty fingers (14%) presented residual deficit of active extension measuring less than 20 degrees. The quality of the result depended on the type of injury: tendon injuries led to extension

Phenotype and cell proliferation activity of duct-like structures in human sublingual glands: a histological and immunohistochemical study

Directory of Open Access Journals (Sweden)

Elen de Souza TOLENTINO

2015-06-01

Full Text Available There are several age-related microscopic changes in the salivary glands, including the increase in the number of duct-like structures (DLS. However, the true origin and the phenotype of the DLS are not known. Objective To evaluate the phenotype and the cell proliferation index of the DLS of human sublingual glands. Material and Methods Sixty sublingual glands obtained from human cadavers were divided into two groups - 0-30 and 61-90 years old. The phenotype was estimated by immunostaining for cytokeratin 19 (CK 19 and the S-100 protein as well as by the presence of mucin and glycogen. The cell proliferation index was determined by the Ki-67 antibody. The histochemical techniques used periodic acid-Schiff (PAS and Alcian Blue. In each captured microscopic field, the DLS were counted to establish a percentage for the staining profile. The statistical analysis was accomplished using Student's t-test, the Mann-Whitney test and Pearson's correlation coefficient (p<0.05. Results Comparing both groups, only CK 19 showed a statistically significant difference (p=0.033, with the strongest expression in the elderly group. There was no significant difference between PAS and Alcian Blue (p=0.270. In both groups, the immunostaining for CK 19 was stronger than that for S-100 (p=0.004;p<0.001, but there was no correlation between the two immunomarkers (ρ=-0.163; p=0.315. There was no immunostaining for Ki-67. Conclusions DLS demonstrate a ductal phenotypic profile and do not present cell proliferation activity. DLS may represent a regressive process arising from acini or represent the result of metaplasia.

Sodium bromide electron-extraction layers for polymer bulk-heterojunction solar cells

International Nuclear Information System (INIS)

Gao, Zhi; Qu, Bo; Xiao, Lixin; Chen, Zhijian; Zhang, Lipei; Gong, Qihuang

2014-01-01

Inexpensive and non-toxic sodium bromide (NaBr) was introduced into polymer solar cells (PSCs) as the cathode buffer layer (CBL) and the electron extraction characteristics of the NaBr CBL were investigated in detail. The PSCs based on NaBr CBL with different thicknesses (i.e., 0 nm, 0.5 nm, 1 nm, and 1.5 nm) were prepared and studied. The optimal thickness of NaBr was 1 nm according to the photovoltaic data of PSCs. The open-circuit voltage (V oc ), short-circuit current density (J sc ), fill factor (FF), and power conversion efficiency (PCE) of the PSC with 1 nm NaBr were evaluated to be 0.58 V, 7.36 mA/cm 2 , 0.63, and 2.70%, respectively, which were comparable to those of the reference device with the commonly used LiF. The optimized photovoltaic performance of PSC with 1 nm NaBr was ascribed to the improved electron transport and extraction capability of 1 nm NaBr in PSCs. In addition, the NaBr CBL could prevent the diffusion of oxygen and water vapor into the active layer and prolong the lifetime of the devices to some extent. Therefore, NaBr layer could be considered as a promising non-toxic CBL for PSCs in future

Enhanced glycosylation of factor VIII:C in capillary endothelial cells following β-adrenoreceptor stimulation is not due to increased sugar transport

International Nuclear Information System (INIS)

Tavarez-Pagan, J.J.; Oliveira, C.M.; Banerjee, D.K.

1990-01-01

Factor VIII:C (Antihemophilia Factor A) in capillary endothelial cells from bovine adrenal medulla found to contain M r 200,000 and M r 46,000 dalton protein species when analyzed by SDS-PAGE under reduced condition. But the secretory FVIII:C under non-reduced condition gave rise to a protein of M r 270,000 dalton indicating that the heavy and light chains are held together by S-S bridge. Upon stimulation of these cells with β-agonist, isoproterenol (10 -7 M), a 2-fold increase in the ratio of [ 3 H]-mannose to [ 35 S]-methionine incorporation in immunoprecipitated FVIII:C was observed. In order to understand the molecular mechanism of this increase, a detail study of sugar transport was carried out. The transport of 2-deoxy-D-[ 3 H]-glucose in these cells was time and temperature dependent. Furthermore, inhibition of 2-deoxy-D-[ 3 H]-glucose uptake by cytochalasin B strongly supported for a carrier mediated process. However, when the transport studies were conducted in the presence of isoproterenol at 10 -5 M or 10 -7 M or 8 Br-cAMP (2 mM) no increase was observed. The kinetic studies indicated that the K m and V max for 2 deoxy-D-[ 3 H]-glucose were 0.24 mM and 0.88 nmol/mg protein/minute, respectively under normal conditions but these values were changed to 0.37 mM and 0.69 nmol/mg protein/minute when stimulated with isoproterenol (10 -7 M)

Contagem de células somáticas e produção de leite em vacas holandesas de alta produção Somatic cells count and milk yield in high production Holstein cows

Directory of Open Access Journals (Sweden)

Arlei Coldebella

2003-12-01

Full Text Available A mastite bovina pode ser clínica, com sinais visíveis, e subclínica, diagnosticada pela contagem das células somáticas. As perdas econômicas causadas pela mastite subclínica devem ser quantificadas para atender à demanda nacional de produtos lácteos. O objetivo deste trabalho foi verificar se as perdas na produção de leite, pelo aumento do número de células somáticas, são proporcionais ou independentes do nível de produção. Foram utilizadas 7.756 observações, colhidas mensalmente de um único rebanho, de setembro de 2000 a junho de 2002. A curva de lactação foi modelada pela função gama incompleta, e os efeitos de ordem de lactação, época do parto, ocorrência de doenças no periparto e escore de condição corporal ao parto também foram considerados. A contagem de células somáticas foi incluída nesse modelo como fator multiplicativo, representando perdas relativas, e como fator aditivo, representando perdas absolutas. A escolha do melhor modelo foi baseada no critério de informação de Schwarz (BIC. As perdas são absolutas, evidentes a partir de 14.270 células/mL e para cada aumento de uma unidade na escala do logaritmo natural a partir desse valor, estimam-se perdas de 184 e 869 g/dia para vacas primíparas e multíparas, respectivamente.The goal of this paper was to evaluate if losses in milk yield due to increase in somatic cells count are proportional or independent of the level of production. A total of 7,756 observations, monthly collected from a single herd from September/2000 up to June/2002, were used. The lactation curve was modeled by the incomplete gamma function, considering the effects of lactation order, calving season, peripartum disorder incidence and body condition score at calving. Somatic cells count was added to the model as a multiplicative factor, representing relative losses, and as an additive factor, representing absolute losses. The best model was chosen based on the information

75 FR 47223 - Louisiana: Final Authorization of State-Initiated Changes and Incorporation by Reference of...

Science.gov (United States)

2010-08-05

..., unless the EPA receives adverse written comment on this regulation by the close of business September 7... personal information provided, unless the comment includes information claimed to be Confidential Business... 270.14(a) and (b) intro. 517.B.5 270.14(b)(19)(iv). 517.T.6.a 270.14(c) related. 517.V 270.14(b)(21...

Cell Permeating Nano-Complexes of Amphiphilic Polyelectrolytes Enhance Solubility, Stability, and Anti-Cancer Efficacy of Curcumin.

Science.gov (United States)

Fatima, Munazza T; Chanchal, Abhishek; Yavvari, Prabhu S; Bhagat, Somnath D; Gujrati, Mansi; Mishra, Ram K; Srivastava, Aasheesh

2016-07-11

Many hydrophobic drugs encounter severe bioavailability issues owing to their low aqueous solubility and limited cellular uptake. We have designed a series of amphiphilic polyaspartamide polyelectrolytes (PEs) that solubilize such hydrophobic drugs in aqueous medium and enhance their cellular uptake. These PEs were synthesized through controlled (∼20 mol %) derivatization of polysuccinimide (PSI) precursor polymer with hydrophobic amines (of varying alkyl chain lengths, viz. hexyl, octyl, dodecyl, and oleyl), while the remaining succinimide residues of PSI were opened using a protonable and hydrophilic amine, 2-(2-amino-ethyl amino) ethanol (AE). Curcumin (Cur) was employed as a representative hydrophobic drug to explore the drug-delivery potential of the resulting PEs. Unprecedented enhancement in the aqueous solubility of Cur was achieved by employing these PEs through a rather simple protocol. In the case of PEs containing oleyl/dodecyl residues, up to >65000× increment in the solubility of Cur in aqueous medium could be achieved without requiring any organic solvent at all. The resulting suspensions were physically and chemically stable for at least 2 weeks. Stable nanosized polyelectrolyte complexes (PECs) with average hydrodynamic diameters (DH) of 150-170 nm (without Cur) and 220-270 nm (after Cur loading) were obtained by using submolar sodium polyaspartate (SPA) counter polyelectrolyte. The zeta potential of these PECs ranged from +36 to +43 mV. The PEC-formation significantly improved the cytocompatibility of the PEs while affording reconstitutable nanoformulations having up to 40 wt % drug-loading. The Cur-loaded PECs were readily internalized by mammalian cells (HEK-293T, MDA-MB-231, and U2OS), majorly through clathrin-mediated endocytosis (CME). Cellular uptake of Cur was directly correlated with the length of the alkyl chain present in the PECs. Further, the PECs significantly improved nuclear transport of Cur in cancer cells, resulting in their

Millennial-scale climatic variability between 340 000 and 270 000 years ago in SW Europe: evidence from a NW Iberian margin pollen sequence

Directory of Open Access Journals (Sweden)

S. Desprat

2009-03-01

Full Text Available We present a new high-resolution marine pollen record from NW Iberian margin sediments (core MD03-2697 covering the interval between 340 000 and 270 000 years ago, a time period centred on Marine Isotope Stage (MIS 9 and characterized by particular baseline climate states. This study enables the documentation of vegetation changes in the north-western Iberian Peninsula and therefore the terrestrial climatic variability at orbital and in particular at millennial scales during MIS 9, directly on a marine stratigraphy. Suborbital vegetation changes in NW Iberia in response to cool/cold events are detected throughout the studied interval even during MIS 9e ice volume minimum. However, they appear more frequent and of higher amplitude during the 30 000 years following the MIS 9e interglacial period and during the MIS 9a-8 transition, which correspond to intervals of an intermediate to high ice volume and mainly periods of ice growth. Each suborbital cold event detected in NW Iberia has a counterpart in the Southern Iberian margin SST record. High to moderate amplitude cold episodes detected on land and in the ocean appear to be related to changes in deep water circulation and probably to iceberg discharges at least during MIS 9d, the mid-MIS 9c cold event and MIS 9b. This work provides therefore additional evidence of pervasive millennial-scale climatic variability in the North Atlantic borderlands throughout past climatic cycles of the Late Pleistocene, regardless of glacial state. However, ice volume might have an indirect influence on the amplitude of the millennial climatic changes in Southern Europe.

Genetic parameters estimate for milk and mozzarella cheese yield, fat and protein percentage in dairy buffaloes in Brazil

Directory of Open Access Journals (Sweden)

H. Tonhati

2010-02-01

Full Text Available The aim of this study was analyze the (covariance components and genetic and phenotypic relationships in the following traits: accumulated milk yield at 270 days (MY270, observed until 305 days of lactation; accumulated milk yield at 270 days (MY270/ A and at 305 days (MY305, observed until 335 days of lactation; mozzarella cheese yield (MCY and fat (FP and protein (PP percentage, observed until 335 days of lactation. The (covariance components were estimated by Restricted Maximum Likelihood methodology in analyses single, two and three-traits using animal models. Heritability estimated for MY270, MY270/A, MY305, MCY, FP and PP were 0.22; 0.24, 0.25, 0.14, 0.29 and 0.40 respectively. The genetic correlations between MCY and the variables MY270, MY270/A, MY305, PP and FP was: 0.85; 1.00; 0.89; 0.14 and 0.06, respectively. This way, the selection for the production of milk in long period should increase MCY. However, in the search of animals that produce milk with quality, the genetic parameters suggest that another index should be composed allying these studied traits.

E-cadherin expression and prognosis of head and neck squamous cell carcinoma: evidence from 19 published investigations

Directory of Open Access Journals (Sweden)

Ren X

2016-04-01

Full Text Available Xusheng Ren,1,2 Jianning Wang,2 Xuefen Lin,1,3 Xuxia Wang1,3 1Department of Oral and Maxillofacial Surgery, Stomatological Hospital of Shandong University, 2Department of Oral and Maxillofacial Surgery, Jinan Stomatological Hospital, 3Shandong Province Key Laboratory of Oral Tissue Regeneration, Stomatological Hospital of Shandong University, Jinan, Shandong Province, People’s Republic of China Objective: The objective of this study was to review the published literature and investigate whether E-cadherin gene is a prognostic factor in head and neck squamous cell carcinoma by conducting a meta-analysis.Methods: Studies were identified from the databases Embase, Medline, and Cochrane Library by using the keywords “E-cadherin gene” and “head and neck cancer”. Overall survival (OS and disease-free survival (DFS were the primary outcome measurements.Results: Our literature review identified 1,458 articles; 19 studies with a total number of 2,012 cases were eligible for inclusion in the meta-analysis. The hazard ratio (HR for OS of patients with decreased expression of E-cadherin gene was 0.57 (95% CI =0.37, 0.89; P=0.000. However, statistical heterogeneity was unacceptably high (I2=74.5%, P=0.000. After sensitivity analysis, heterogeneity became acceptable, and the effect measure was still significant (I2=7.0%; HR =0.52; 95% CI =0.40, 0.66; P=0.000. The HR for DFS was 0.53 (95% CI =0.42, 0.67; P=0.000.Conclusion: This meta-analysis showed clear evidence that high E-cadherin gene expression is a positive prognostic factor of head and neck squamous cell carcinoma, resulting in better OS and DFS. However, this conclusion must be interpreted with caution due to a few limitations. Keywords: E-cadherin gene, prognosis, head and neck squamous cell carcinoma, immunohistochemistry 

Effect of Elevated Temperature Annealing on Nafion/SiO2 Composite Membranes for the All-Vanadium Redox Flow Battery

Directory of Open Access Journals (Sweden)

Sixiu Zeng

2018-04-01

Full Text Available Conducting Nafion/SiO2 composite membranes were successfully prepared using a simple electrostatic self-assembly method, followed by annealing at elevated temperatures of 240, 270, and 300 °C. Membrane performance was then investigated in vanadium redox flow batteries (VRB. These annealed composite membranes demonstrated lower vanadium permeability and a better selectivity coefficient than pure Nafion membranes. The annealing temperature of 270 °C created the highest proton conductivity in the Nafion/SiO2 composite membranes. The microstructures of these membranes were analyzed using transmission electron microscopy, small-angle X-ray scattering, and positron annihilation lifetime spectroscopy. This study revealed that exposure to high temperatures resulted in an increase in the free volumes of the composite membranes, resulting in improved mechanical and chemical behavior, with the single cell system containing composite membranes performing better than systems containing pure Nafion membranes.

CT radiogenomic characterization of EGFR, K-RAS, and ALK mutations in non-small cell lung cancer

Energy Technology Data Exchange (ETDEWEB)

Rizzo, Stefania; Rampinelli, Cristiano [European Institute of Oncology, Department of Radiology, Milan (Italy); Petrella, Francesco; Spaggiari, Lorenzo [European Institute of Oncology, Department of Thoracic Surgery, Milan (Italy); Buscarino, Valentina; De Maria, Federica [University of Milan, Department of Health Sciences, Milan (Italy); Raimondi, Sara [European Institute of Oncology, Department of Epidemiology and Biostatistics, Milan (Italy); Barberis, Massimo; Fumagalli, Caterina [European Institute of Oncology, Department of Pathology, Milan (Italy); Spitaleri, Gianluca; De Marinis, Filippo [European Institute of Oncology, Department of Thoracic Oncology, Milan (Italy); Bellomi, Massimo [European Institute of Oncology, Department of Radiology, Milan (Italy); University of Milan, Department of Health Sciences, Milan (Italy)

2016-01-15

To assess the association between CT features and EGFR, ALK, KRAS mutations in non-small cell lung cancer. Patients undergoing chest CT and testing for the above gene mutations were included. Qualitative evaluation of CTs included: lobe; lesion diameter; shape; margins; ground-glass opacity; density; cavitation; air bronchogram; pleural thickening; intratumoral necrosis; nodules in tumour lobe; nodules in non-tumour lobes; pleural retraction; location; calcifications; emphysema; fibrosis; pleural contact; pleural effusion. Statistical analysis was performed to assess association of features with each gene mutation. ROC curves for gene mutations were drawn; the corresponding area under the curve was calculated. P-values <0.05 were considered significant. Of 285 patients, 60/280 (21.43 %) were positive for EGFR mutation; 31/270 (11.48 %) for ALK rearrangement; 64/240 (26.67 %) for KRAS mutation. EGFR mutation was associated with air bronchogram, pleural retraction, females, non-smokers, small lesion size, and absence of fibrosis. ALK rearrangements were associated with age and pleural effusion. KRAS mutation was associated with round shape, nodules in non-tumour lobes, and smoking. This study disclosed associations between CT features and alterations of EGFR (air bronchogram, pleural retraction, small lesion size, absence of fibrosis), ALK (pleural effusion) and KRAS (round lesion shape, nodules in non-tumour lobes). (orig.)

[Relationship between HBeAg from HBsAg positive mothers and regulatory T cells in neonates and its influence on HBV intrauterine transmission].

Science.gov (United States)

Hao, H Y; Yang, Z Q; Xu, X X; Wang, X F; Wang, B; Shi, X H; Fu, Z D; Wang, B; Wang, S P

2017-10-10

Objective: To explore the relationship between HBeAg in HBsAg positive mothers and CD(4)(+)CD(25)(+) Foxp3 (+)regulatory T cells (Treg) in newborns, as well as how they would influence the increasing risk on HBV intrauterine transmission. Methods: We collected information on general demographic characteristics and delivery on 270 HBsAg positive mothers and their newborns from the Third People's Hospital of Taiyuan. Fluorescence quantitative polymerase chain reaction (FQ-PCR) and chemiluminescence immunoassay (CLIA) were used to detect HBV DNA and HBV serological markers in peripheral blood from both mothers and neonates. The expression of Treg and other immune cells in peripheral blood of neonates were detected with flow cytometry (FCM). Results: Maternal HBeAg positive rates were associated with an increased risk of intrauterine transmission ( OR =4.08, 95 %CI : 1.89-8.82). Rates of Treg in newborns born to HBsAg-positive mothers were higher than that of the negative group ( Z =2.29, P =0.022). Each pair of the subjects was assigned to five different groups according to the HBeAg titers of mothers. Frequencies of both Treg and HBeAg in newborns and HBV DNA in mothers between the above said 5 groups showed similar trends of changing patterns and the differences between groups were statistically significant(χ(2)=18.73, P mother's HBeAg titers were positively related to the percentage of Treg in their newborns ( r(s) =0.19, P =0.039). In addition, the frequencies of Treg were negatively correlated with pDC and CD(4)(+) T cell in their newborns ( r(s) =-0.21, P =0.017; r(s) =-0.23, P =0.009). Conclusion: HBeAg from HBsAg positive mothers might have inhibited the function of neonatal DC cells and T cells to reduce the immune response to HBV by up-regulating the proportion of Treg and finally increased the risk of HBV intrauterine transmission.

Double-Sided Laser Heating in Radial Diffraction Geometry for Diamond Anvil Cell Deformation Experiments at Simultaneous High Pressures and Temperatures

Science.gov (United States)

Miyagi, L. M.; Kunz, M.; Couper, S.; Lin, F.; Yan, J.; Doran, A.; MacDowell, A. A.

2017-12-01

The rheology of rocks and minerals in the Earth's deep interior plays a primary role in controlling large scale geodynamic processes such as mantle convection and slab subduction. Plastic deformation resulting from these processes can lead to texture development and associated seismic anisotropy. If a detailed understanding of the link between deformation and seismic anisotropy is established, observations of seismic anisotropy can be used to understand the dynamic state in the deep Earth. However, performing deformation experiments at lower mantle pressure and temperature conditions are extremely challenging. Thus most deformation studies have been performed either at room temperature and high pressure or at reduced pressures and high temperature. Only a few extraordinary efforts have attained pressures and temperatures relevant to lower mantle. Therefore our ability to interpret observations of lower mantle seismic anisotropy in terms of mantle flow models remains limited. In order to expand the pressure and temperature range available for deformation of deep Earth relevant mineral phases, we have developed a laser heating system for in-situ double-sided heating in radial diffraction geometry at beamline 12.2.2 of the Advanced Light Source of Lawrence Berkeley National Laboratory. This allows texture and lattice strain measurements to be recorded at simultaneous high pressures and temperatures in the diamond anvil cell. This new system is integrated into the newly built axial laser heating system to allow for rapid and reliable transitioning between double-sided laser heating in axial and radial geometries. Transitioning to radial geometry is accomplished by redirecting the laser and imaging paths from 0° and 180° to 90° and 270°. To redirect the 90° path, a motorized periscope mirror pair with an objective lens can be inserted into the downstream axial beam path. The 270° redirection is accomplished by removing the upstream axial objective lens and

Optimizing Microgrid Architecture on Department of Defense Installations

Science.gov (United States)

2014-09-01

this information was published. At China Lake Naval Air Weapons Station, the 270-megawatt geothermal power plant annually provides an average of 1.4...wind, geothermal and biomass resources on or in the vicinity of DOD installations” [10]. More declaratively, “electrical power produced from these...shift to more renewable sources of energy of all types. Projects have ranged from geothermal plants to photovoltaic (PV) cells on rooftops. Table

Development of transient head cavities during early organogenesis of the Nile Crocodile (Crocodylus niloticus)

Czech Academy of Sciences Publication Activity Database

Kundrát, M.; Janáček, Jiří; Martin, S.

2009-01-01

Roč. 270, č. 9 (2009), s. 1069-1083 ISSN 0362-2525 R&D Projects: GA AV ČR(CZ) KJB6111301 Grant - others:Univerzita Karlova(CZ) 122/2003-B; NATO Fellowship Programme and Center for Higher Education Studies(CZ) MK2003-13 Institutional research plan: CEZ:AV0Z50110509 Keywords : Nile Crocodile * head cavities * organogenesis Subject RIV: EA - Cell Biology Impact factor: 1.706, year: 2009

Comparison of manual and automated cell counts in EDTA preserved synovial fluids. Storage has little influence on the results.

Science.gov (United States)

Salinas, M; Rosas, J; Iborra, J; Manero, H; Pascual, E

1997-10-01

To determine the precision and agreement of synovial fluid (SF) cell counts done manually and with automated counters, and to determine the degree of variability of the counts in SF samples, kept in the tubes used for routine white blood cell (WBC) counts--which use liquid EDTA as anticoagulant--at 24 and 48 hours at 4 degrees C, and at room temperature. To determine precision, cell counts were repeated 10 times--both manually and by an automated counter--in a SF sample of low, medium, and high cellularity. The variances were calculated to determine the interobserver variation in two manual (M1,M2) and two automated cell counts (C1,C2). The agreement between a manual (M1) and automated counter (C1) results, was analysed by the Bland and Altman method and the difference against the mean of the two methods was plotted. Then, the mean difference between the two methods was estimated and the standard deviation of the difference. To determine the effects of storage, SF samples were kept in a refrigerator at 4 degrees C, and at room temperature; cell counts were done manually (M1) and automatically (C1) at 24 and 48 hours and the changes analysed by the Bland and Altman method. The variances were compared using an F test. (1) Precision. With the manual technique, the coefficients of variation were 27.9%, 14%, and 10.7% when used for counting the SF with low (270), medium (6200), and high cellularities (25,000). With the automated technique the coefficients of variation were 20%, 3.4%, and 2.9% in the same SF samples. In the fluids of medium and high cellularity, the variances of the automated cell counts were significatively lower (F test, p automated counter. (4) Influence of storage. The coulter counts of SF samples preserved at 4 degrees C showed less variance (F test, p Automated cell count of the SF offers advantages: it gives higher precision and consumes less time. The stability of the samples preserved in the EDTA tubes used for routine WBC counts is of

[Effect of compound danshen dripping pill combined with intravenous transplantation of human umbilical cord blood mononuclear cells on local inflammatory response in the myocardium of rabbits with acute myocardial infarction].

Science.gov (United States)

Deng, Liu-xia; Yu, Guo-long; Al, Qi; Yuan, Chun-ju

2013-11-01

To investigate effect of Compound Danshen Dripping Pill (CDDP) on the inflammatory response of the myocardium of acute myocardial infarction (AMI) rabbits, to observe the therapeutic effect of CDDP combined intravenous transplantation of human umbilical cord blood mononuclear cells (HUCBMCs) on inflammatory response, pro-inflammatory cytokine tumor necrosis factor alpha (TNF-alpha) , and heart function in the myocardium of AMI rabbits, and to explore the possible protective mechanisms of the combined therapy. The AMI model was successfully established by ligation of the left anterior coronary artery (LAD) in 40 healthy rabbits.Then they were randomly divided into four groups, i.e., the control group, the CDDP group, the transplantation group, and the combined group, 10 in each group. Rabbits in the control group received intravenous injection of 0.5 mL normal saline via ear vein within 24 h after AMI and then intragastric infusion of normal saline at 5 mL per day. Rabbits in the CDDP group received intravenous injection of 0.5 mL normal saline via ear vein within 24 h after AMI and then intragastric infusion of solution obtained by solving 270 mg CDDP in 5 mL normal saline per day. Rabbits in the transplantation group received intravenous injection of 0.5 mL normal saline labeled with green fluorescent protein (GFP) containing 3 x 10(7) of HUCBMCs via ear vein within 24 h after AMI and then intragastric infusion of normal saline at 5 mL per day. Rabbits in the combined group received intravenous injection of 0.5 mL normal saline labeled with GFP containing 3 x 10(7) of HUCBMCs via ear vein within 24 h after AMI and then intragastric infusion of solution obtained by solving 270 mg CDDP in 5 mL normal saline per day. At week 1 and 4 after treatment, cardiac function indices such as left ventricular fractional shorting (LVFS) and left ventricular ejection fraction (LVEF) were performed by echocardiography; the number of transplanted cells in the myocardium was found

Some aspects of the metal purity in high strength Al-alloys

International Nuclear Information System (INIS)

Banizs, K.; Csernay-Balint, J.; Voeroes, G.

1990-01-01

The effect of Fe and Si on the properties of some high strength age-hardenable Al-alloys was investigated. It was found that a certain quantity (> 0.15 %) of Fe is advantageous to the formation of the cell-structure in the cast ingot both in the AlCuMg and AlZnMgCu alloys. An increased Fe-content causes a finer cell-structure. A higher Fe:Si ratio results in more homogeneous cell size distribution. Higher Si-content in the alloy decreases the favourable cast parameter range and increases the inclination to cracking of large diameter (> 270 mm) ingots. The reason of the correlation found between metal purity and mechanical properties is discussed

Type II collagen in cartilage evokes peptide-specific tolerance and skews the immune response.

Science.gov (United States)

Malmström, V; Kjellén, P; Holmdahl, R

1998-06-01

T cell recognition of type II collagen (CII) is a crucial event in the induction of collagen-induced arthritis in the mouse. Several CII peptides have been shown to be of importance, dependent on which MHC haplotype the mouse carries. By sequencing the rat CII and comparing the sequence with mouse, human, bovine and chicken CII, we have found that the immunodominant peptides all differ at critical positions compared with the autologous mouse sequence. Transgenic expression of the immunodominant Aq-restricted heterologous CII 256-270 epitope inserted into type I collagen (TSC mice) or type II collagen (MMC-1 mice) led to epitope-specific tolerance. Immunization of TSC mice with chick CII led to arthritis and immune responses, dependent on the subdominant, Aq-restricted and chick-specific CII 190-200 epitope. Immunization of F1 mice, expressing both H-2q and H-2r as well as transgenic expression of the Aq-restricted CII 256-270 epitope in cartilage, with bovine CII, led to arthritis, dependent on the Ar-restricted, bovine-specific epitope CII 607-621. These data show that the immunodominance of CII recognition is directed towards heterologous determinants, and that T cells directed towards the corresponding autologous epitopes are tolerated without evidence of active suppression.

Progressive rise in red cell distribution width is associated with poor outcome after transcatheter aortic valve implantation.

Science.gov (United States)

Aung, Nay; Dworakowski, Rafal; Byrne, Jonathan; Alcock, Emma; Deshpande, Ranjit; Rajagopal, Kailasam; Brickham, Beth; Monaghan, Mark J; Okonko, Darlington O; Wendler, Olaf; Maccarthy, Philip A

2013-09-01

To investigate the prognostic value of baseline and temporal changes in red cell distribution width (RDW) in patients undergoing transcatheter aortic valve implantation (TAVI). Single-centre retrospective observational study. Tertiary cardiac centre. 175 patients undergoing TAVI were included in this study. Survival. We analysed data from 175 TAVI patients (mean (± SD) age 83 ± 7 years, 49% men, mean Logistic EuroSCORE 23 ± 1, 66% preserved left ventricular ejection fraction (LVEF)). Immediately pre-TAVI, mean RDW was 14.6 ± 1.6% with an RDW>15% in 29% of patients. Over median follow-up of 12 months, the median rate of change in RDW was 0.2% per month, and 51 (29%) patients died. On multivariate survival analyses, baseline RDW ≥ 15.5% predicted death (adjusted HR 2.70, 95% CI 1.40 to 5.22, p=0.003) independently of LVEF, transfemoral approach, baseline pulmonary artery systolic pressure, moderate/severe mitral regurgitation and body mass index. A greater rate of increase in RDW over time was associated with increased mortality (adjusted HR 1.11, 95% CI 1.04 to 1.18, p=0.001) independently of baseline RDW and other significant temporal variables including a change in creatinine, bilirubin, mean cell haemoglobin concentration or urea. An increase in RDW>0.1%/month was associated with a twofold increased risk of mortality. Baseline RDW ≥ 15.5% and a rising RDW over time strongly correlate to an increased risk of death post-TAVI, and could be used to refine risk stratification. Investigating and ameliorating the causes of RDW expansion may improve survival.

Mortality outcomes in trauma patients undergoing prehospital red blood cell transfusion: a systematic literature review.

Science.gov (United States)

Huang, Gregory S; Dunham, C Michael

2017-01-01

The value of prehospital red blood cell (RBC) transfusion for trauma patients is controversial. The purposes of this literature review were to determine the mortality rate of trauma patients with hemodynamic instability and the benefit of prehospital RBC transfusion. A 30-year systematic literature review was performed in 2016. Eligible studies were combined for meta-analysis when tests for heterogeneity were insignificant. The synthesized mortality was 35.6% for systolic blood pressure ≤ 90 mmHg; 51.1% for ≤ 80 mmHg; and 63.9% for ≤ 70 mmHg. For patients with either hypotension or emergency trauma center transfused RBCs, the synthesized Injury Severity Score (ISS) was 27.0 and mortality was 36.2%; the ISS and mortality correlation was r = 0.766 ( P = 0.0096). For civilian patients receiving prehospital RBC transfusions, the synthesized ISS was 27.5 and mortality was 39.5%. One civilian study suggested a decrement in mortality with prehospital RBC transfusion; however, patient recruitment was only one per center per year and mortality was 16 showed similar mortality with and without prehospital RBC availability (27.6% versus 32.0%; P = 0.343). Trauma patient mortality increases with the magnitude of hemodynamic instability and anatomic injury. Some literature evidence indicates no survival advantage with prehospital RBC availability. However, other data suggesting a potential benefit is confounded or likely to be biased.

Chemically Etched Silicon Nanowires as Anodes for Lithium-Ion Batteries

Energy Technology Data Exchange (ETDEWEB)

West, Hannah Elise [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2015-08-01

This study focused on silicon as a high capacity replacement anode for Lithium-ion batteries. The challenge of silicon is that it expands ~270% upon lithium insertion which causes particles of silicon to fracture, causing the capacity to fade rapidly. To account for this expansion chemically etched silicon nanowires from the University of Maine were studied as anodes. They were built into electrochemical half-cells and cycled continuously to measure the capacity and capacity fade.

Surto de mastite bovina causada por Arcanobacterium pyogenes

Directory of Open Access Journals (Sweden)

R.G. Motta

2011-06-01

Full Text Available An uncommon outbreak of mastitis caused by Arcanobacterium pyogenes in 26 cows is reported. The epidemiological findings, clinical signs, microbiological exams, somatic cell count, in vitro susceptibility profile of strains, efficacy of intramammary treatment and control measures were discussed. Florfenicol (96.2%, cefoperazona (92.3%, cefaloxin (84.6% and ceftiofur (84.6% were the most effective antimicrobials, and neomicin (27.0% and enrofloxacin (17.4% the least effective antimicrobials.

Real-world effectiveness of brentuximab vedotin versus physicians' choice chemotherapy in patients with relapsed/refractory Hodgkin lymphoma following autologous stem cell transplantation in the United Kingdom and Germany.

Science.gov (United States)

Zagadailov, Erin A; Corman, Shelby; Chirikov, Viktor; Johnson, Courtney; Macahilig, Cynthia; Seal, Brian; Dalal, Mehul R; Bröckelmann, Paul J; Illidge, Tim

2018-06-01

This retrospective study compared effectiveness of (brentuximab vedotin) BV to other chemotherapies in patients with rrHL following an autologous stem cell transplant (ASCT). Data originated from a medical chart review of patients treated in real-world clinical settings at 50 sites in the United Kingdom and Germany. Inverse probability of treatment weights based on propensity scores were used to adjust for differences in baseline characteristics between treatment groups. Among 312 rrHL patients included, 196 received BV and 116 received physicians' choice chemotherapy. Median PFS was significantly longer (27.0 months vs. 13.4 months; p = .0144) and 12-month OS survival greater (78.1% vs. 65.9%; p = .0129) with BV compared to chemotherapy. Documented adverse events included leukopenia (12.8%) and peripheral neuropathy (8.7%) for BV and leukopenia (12.1%), anemia (5.2%) and diarrhea (5.2%) for chemotherapy. In this real-world study, rrHL patients treated for relapse after ASCT with BV had longer median PFS and 12-month OS than patients receiving chemotherapy.

18 CFR 270.201 - Applicability.

Science.gov (United States)

2010-04-01

... OF ENERGY PROCEDURES GOVERNING DETERMINATIONS FOR TAX CREDIT PURPOSES DETERMINATION PROCEDURES... jurisdictional agencies for tight formation gas, occluded natural gas produced from coal seams, and natural gas...

50 CFR 270.2 - Definitions.

Science.gov (United States)

2010-10-01

... restaurant trade, but whose primary business function is not the processing or packaging of fish or fish... harvesters. Research means any type of research designed to advance the image, desirability, usage...

40 CFR 82.270 - Prohibitions.

Science.gov (United States)

2010-07-01

... newly manufacture any halon blend. Halon blends manufactured solely for the purpose of aviation fire... capable of recycling the blend to the relevant industry standards for the chemical purity of each... April 6, 1998 the provision that the blend must be returned to it or its designee for recycling; and (3...

21 CFR 1271.270 - Records.

Science.gov (United States)

2010-04-01

... particular HCT/P involved. (b) Records management system. You must establish and maintain a records management system relating to core CGTP requirements. Under this system, records pertaining to a particular... procedures, and equipment logs) must also be maintained and organized under the records management system. If...

40 CFR 270.2 - Definitions.

Science.gov (United States)

2010-07-01

... (formerly referred to as the Federal Water Pollution Control Act or Federal Water Pollution Control Act... constituent thereof may enter the environment or be emitted into the air or discharged into any waters... may consist of several treatment, storage, or disposal operational units (for example, one or more...

Outcome and treatment strategy in female lung cancer: a single institution experience

International Nuclear Information System (INIS)

Cicenas, S.; Kurtinaitis, J.; Smailyte, G.

2010-01-01

Purpose: To assess the survival rate of female lung cancer treated at the Institute of Oncology of the Vilnius University, Lithuania during the period between 1996-2005. Materials and Methods: During the period between 1996-2005, 471 women diagnosed with lung cancer were treated at the Department of Thoracic Surgery and Oncology of the Institute of Oncology, Vilnius University. Data on morphology, stage and treatment was collected from the medical records. All lung cancer cases by histology were classified in two groups: non-small cell lung cancer (includes squamous cell carcinoma, large cell carcinoma, adenocarcinoma and other less common types) and small cell lung cancer. The vital status of the study group was assessed as of December 31, 2007, by passive follow-up, using data from the population registry. It was found that 411 (87.3%) of the patients had died. Survival was estimated according to the Kaplan-Meier method. Results: The median survival of female lung cancer diagnosed during 1996-2005 in Lithuania show to be 8.7 months (8.4 (95% CI 7.2-10.8) months with non-small cell lung cancer and 9.3 (95% CI 6.3-13.0) months with small-cell lung cancer). Survival was more than 20 months in resectable non-small cell lung cancer (stages I, II, IIIA). Non-small cell lung cancer survival in advanced stages was less than 7 months. Small-cell lung cancer patients median survival at limited and extended stages of the disease were 9.5 (95% CI 2.9-18.4) compared to 9.2 (95% CI 6.2-13.7) months. Non-small cell lung cancer patients most frequently were treated by surgery (27.0%), surgery and chemotherapy or radiotherapy (19.6%). Small cell lung cancer patient treatment included chemo and radiotherapy (27.0%), chemotherapy (19.0%), radiotherapy (17.5%), surgery (27.9%). Conclusions: The single center study of female lung cancer diagnosed during 1996-2005 in Lithuania show a significantly better chance of survival in resectable non-small cell lung cancer. Advanced stages of

Novel molecular determinants of viral susceptibility and resistance in the lipidome of Emiliania huxleyi.

Science.gov (United States)

Fulton, James M; Fredricks, Helen F; Bidle, Kay D; Vardi, Assaf; Kendrick, B Jacob; DiTullio, Giacomo R; Van Mooy, Benjamin A S

2014-04-01

Viruses play a key role in controlling the population dynamics of algae, including Emiliania huxleyi, a globally distributed haptophyte with calcite coccoliths that comprise ca. 50% of the sinking carbonate flux from the surface ocean. Emiliania huxleyi viruses (EhVs) routinely infect and terminate E. huxleyi blooms. EhVs are surrounded by a lipid envelope, which we found to be comprised largely of glycosphingolipids (GSLs) with lesser amounts of polar glycerolipids. Infection appears to involve membrane fusion between the virus and host, and we hypothesized that specific polar lipids may facilitate virus attachment. We identified three novel intact polar lipids in E. huxleyi strain CCMP 374 and EhV86, including a GSL with a monosaccharide sialic acid headgroup (sGSL); for all 11 E. huxleyi strains we tested, there was a direct relationship between sGSL content and sensitivity to infection by EhV1, EhV86 and EhV163. In mesocosms, the E. huxleyi population with greatest initial sGSL content had the highest rate of virus-induced mortality. We propose potential physiological roles for sGSL that would be beneficial for growth but leave cells susceptible to infection, thus furthering the discussion of Red Queen-based co-evolution and the cost(s) of sensitivity and resistance in the dynamic E. huxleyi-EhV system. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

cCMP, cUMP, cTMP, cIMP and cXMP as possible second messengers: development of a hypothesis based on studies with soluble guanylyl cyclase α(1)β(1).

Science.gov (United States)

Beste, Kerstin Y; Seifert, Roland

2013-02-01

Adenosine 3',5'-cyclic monophosphate and guanosine 3',5'-cyclic monophosphate are second messengers that regulate multiple physiological functions. The existence of additional cyclic nucleotides in mammalian cells was postulated many years ago, but technical problems hampered development of the field. Using highly specific and sensitive mass spectrometry methods, soluble guanylyl cyclase has recently been shown to catalyze the formation of several cyclic nucleotides in vitro. This minireview discusses the broad substrate-specificity of soluble guanylyl cyclase and the possible second messenger roles of cyclic nucleotides other than adenosine 3',5'-cyclic monophosphate and guanosine 3',5'-cyclic monophosphate. We hope that this article stimulates productive and critical research in an area that has been neglected for many years.

Early changes of lymphocyte RNA and serum immunoglobulins following chronic exposure to benzene

Energy Technology Data Exchange (ETDEWEB)

Chircu, V.; Ionescu, M.; Zgoan

Hematologic and immunochemical investigations carried out in 270 workers with chronic exposure to benzene demonstrated changes of the nucleologram and of the area of lymphocyte nucleoli as well as disorders of the humoral immune response revealed by radial immunodiffusion. The numerical rise of bi- and polynucleolated cells, of cells with irregular macronucleoli as well as an enlargement of the nucleolar area are assumed to reflect an increase of the endolymphocytic amounts of RNA. An increased capacity of immunoglobulin formation, particularly of IgM, was also observed. All these changes are considered as early signs of an enhanced immune reactivity following chronic exposure to benzene.

The role of coccoliths in protecting Emiliania huxleyi against stressful light and UV radiation

Science.gov (United States)

Xu, Juntian; Bach, Lennart T.; Schulz, Kai G.; Zhao, Wenyan; Gao, Kunshan; Riebesell, Ulf

2016-08-01

Coccolithophores are a group of phytoplankton species which cover themselves with small scales (coccoliths) made of calcium carbonate (CaCO3). The reason why coccolithophores form these calcite platelets has been a matter of debate for decades but has remained elusive so far. One hypothesis is that they play a role in light or UV protection, especially in surface dwelling species like Emiliania huxleyi, which can tolerate exceptionally high levels of solar radiation. In this study, we tested this hypothesis by culturing a calcified and a naked strain under different light conditions with and without UV radiation. The coccoliths of E. huxleyi reduced the transmission of visible radiation (400-700 nm) by 7.5 %, that of UV-A (315-400 nm) by 14.1 % and that of UV-B (280-315 nm) by 18.4 %. Growth rates of the calcified strain (PML B92/11) were about 2 times higher than those of the naked strain (CCMP 2090) under indoor constant light levels in the absence of UV radiation. When exposed to outdoor conditions (fluctuating sunlight with UV radiation), growth rates of calcified cells were almost 3.5 times higher compared to naked cells. Furthermore, the relative electron transport rate was 114 % higher and non-photochemical quenching (NPQ) was 281 % higher in the calcified compared to the naked strain, implying higher energy transfer associated with higher NPQ in the presence of calcification. When exposed to natural solar radiation including UV radiation, the maximal quantum yield of photosystem II was only slightly reduced in the calcified strain but strongly reduced in the naked strain. Our results reveal an important role of coccoliths in mitigating light and UV stress in E. huxleyi.

Diastereoselective reduction of 1-(4-fluorophenyl)-3(R)-[3-oxo-3-(4-fluorophenyl) -propyl]-4 (S)-(4-hydroxyphenyl)azetidin-2-one to Ezetimibe by the whole cell catalyst Rhodococcus fascians MO22

Czech Academy of Sciences Publication Activity Database

Kyslíková, Eva; Babiak, P.; Marešová, Helena; Palyzová, Andrea; Hajíček, J.; Kyslík, Pavel

2010-01-01

Roč. 67, 3-4 (2010), s. 266-270 ISSN 1381-1177 R&D Projects: GA MŠk 2B08064 Institutional research plan: CEZ:AV0Z50200510 Keywords : Biotransformation * Rhodococcus fascians MO22 * Ezetimibe Subject RIV: CE - Biochemistry Impact factor: 2.330, year: 2010

Hydrogen as an energy carrier. Final report; Wasserstoff als Energietraeger. Abschlussbericht

Energy Technology Data Exchange (ETDEWEB)

Rebholz, H. [ed.

1998-12-01

This final report of the Special Field of Research 270 (SFB 270) documents the work and results of the four promotion phases from 1989 to 1998, presented in reports on 15 part-projects. From its inception, SFB 270, which bears the title ''Hydrogen as an Energy Carrier'', has been dedicated to two fields of work: in Project Area A to the production of hydrogen (7 part-projects) and in Project Area B to the transport and storage of hydrogen (8 part-projects). The scientific results of the part-projects have also been presented in detail in the progress reports and interim reports of 1991, 1994 and 1997. Some of them have also been presented at the colloquiums of SFB 270. Twelve part-projects have been abstracted individually for the ENERGY database. [German] Der vorliegende Abschlussbericht des Sonderforschungsbereichs 270 dokumentiert die Arbeiten und Ergebnisse der vier Foerderungsphasen von 1989 bis 1998. Sie sind in den Berichten von 15 Teilprojekten wiedergegeben. Der Sonderforschungsbereich 270 'Wasserstoff als Energietraeger' hat sich von Anfang an zwei Aufgabengebieten gewidmet: Im Projektbereich A der Herstellung von Wasserstoff (7 Teilprojekte) und im Projektbereich B dem Transport und der Speicherung von Wasserstoff (8 Teilprojekte). Wissenschaftliche Ergebnisse der Teilprojekte sind ausfuehrlich auch in den Arbeits- und Ergebnisberichten 1991, 1994 und 1997 wiedergegeben. Sie wurden auch, in Teilen, in entsprechenden Kolloquien des SFB 270 praesentiert. Fuer die Datenbank ENERGY wurden 12 Teilprojekte separat aufgenommen. (orig.)

Growth phase dependent hydrogen isotopic fractionation in alkenone-producing haptophytes

Directory of Open Access Journals (Sweden)

M. D. Wolhowe

2009-08-01

Full Text Available Recent works have investigated use of the hydrogen isotopic composition of C₃₇ alkenones (δD_K37s, lipid biomarkers of certain haptophyte microalgae, as an independent paleosalinity proxy. We discuss herein the factors impeding the success of such an application and identify the potential alternative use of δD_K37s measurements as a proxy for non-thermal, physiological stress impacts on the U₃₇^K' paleotemperature index. Batch-culture experiments with the haptophyte Emiliania huxleyi (CCMP 1742 were conducted to determine the magnitude and variability of the isotopic contrasts between individual C₃₇ alkenones. Further experiments were conducted with Emiliania huxleyi (CCMP 1742 andGephyrocapsa oceanica (PZ3-1 to determine whether, and to what extent, δD_K37s varies between the physiological extremes of nutrient-replete exponential growth and nutrient-depleted senescence. Emiliania huxleyi was observed to exhibit an isotopic contrast between di- and tri-unsaturated C₃₇ alkenones (α_K37:3-K37:2≈0.97 that is nearly identical to that reported recently by others for environmental samples. Furthermore, this contrast appears to be constant with growth stage. The consistency of the offset across different growth stages suggests that a single, well-defined value for α_K37:3-K37:2 may exist and that its use in an isotope mass-balance will allow accurate determination of δD values for individual alkenones without having to rely on time- and labor-intensive chemical separations. The isotopic fractionation between growth medium and C₃₇ alkenones was observed to increase dramatically upon the onset of nutrient-depletion-induced senescence, suggesting that δD_K37s may serve as an objective tool for recognizing and potentially correcting, at least semi-quantitatively, for the effects

Concerning the evidence for the formation of dicentric chromosomal aberrations by single tracks of very short-ranged radiations

International Nuclear Information System (INIS)

Brenner, D.J.; Zaider, M.

1987-01-01

A recent communication by Thacker et al. reported yields of chromosomal exchange aberrations in V79 hamster cells after irradiation by either 250-kVp x rays or carbon characteristic K x rays of energy 270 eV. These latter produce photoelectrons with ranges of less than 10 nm. Such a distance makes it prima facie unlikely that two chromosomes could be damaged by a single track with a significant frequency. Thacker et al., however, discuss the observed effective linear component of induction of chromosome exchanges by ultrasoft carbon x-rays, and are thus led to consider the possibility that only one chromosome needs to be damaged by radiation to lead to an exchange event. In this paper, the authors analyze the data of Thacker et al. using a simple model. For carbon x rays they take advantage of the fact that the cell nuclei are not subject to a distribution of specific energies, but will each undergo essentially the same number of photon absorption events (each consisting of an energy deposition of 270 eV) for a given dose. They define the probability that a given chromosome will be broken as a result of an energy deposition event. They further define the probability that two chromosomes will be broken as a result of a single energy deposition event

Class of backpropagation techniques for limited-angle reconstruction in microwave tomography

International Nuclear Information System (INIS)

Paladhi, P. Roy; Tayebi, A.; Udpa, L.; Udpa, S.; Sinha, A.

2015-01-01

Filtered backpropagation (FBPP) is a well-known technique used in Diffraction Tomography (DT). For accurate reconstruction using FBPP, full 360° angular coverage is necessary. However, it has been shown that using some inherent redundancies in the projection data in a tomographic setup, accurate reconstruction is still possible with 270° coverage which is called the minimal-scan angle range. This can be done by applying weighing functions (or filters) on projection data of the object to eliminate the redundancies and accurately reconstruct the image from 270° coverage. This paper demonstrates procedures to generate many general classes of these weighing filters. These are all equivalent at 270° coverage but vary in performance at lower angular coverages and in presence of noise. This paper does a comparative analysis of different filters when angular coverage is lower than minimal-scan angle of 270°. Simulation studies have been done to find optimum weight filters for sub-minimal angular coverage (<270°)

Interrogating Host-virus Interactions and Elemental Transfer Using NanoSIMS

Science.gov (United States)

Pasulka, A.; Thamatrakoln, K.; Poulos, B.; Bidle, K. D.; Sullivan, M. B.; Orphan, V. J.

2016-02-01

Marine viruses (bacteriophage and eukaryotic viruses) impact microbial food webs by influencing microbial community structure, carbon and nutrient flow, and serving as agents of gene transfer. While the collective impact of viral activity has become more apparent over the last decade, there is a growing need for single-cell and single-virus level measurements of the associated carbon and nitrogen transfer, which ultimately shape the biogeochemical impact of viruses in the upper ocean. Stable isotopes have been used extensively for understanding trophic relationships and elemental cycling in marine food webs. While single-cell isotope approaches such as nanoscale secondary ion mass spectrometry (nanoSIMS) have been more readily used to study trophic interactions between microorganisms, isotopic enrichment in viruses has not been described. Here we used nanoSIMS to quantify the transfer of stable isotopes (13C and 15N) from host to individual viral particles in two distinct unicellular algal-virus model systems. These model systems represent a eukaryotic phytoplankton (Emiliania huxleyi strain CCMP374) and its 200nm coccolithovirus (EhV207), as well as a cyanobacterial phytoplankton (Synechococcus WH8101) and its 80nm virus (Syn1). Host cells were grown on labeled media for multiple generations, subjected to viral infection, and then viruses were harvested after lysis. In both cases, nanoSIMS measurements were able to detect 13C and 15N in the resulting viral particles significantly above the background noise. The isotopic enrichment in the viral particles mirrored that of the host. Through use of these laboratory model systems, we quantified the sensitivity (ion counts), spatial resolution, and reproducibility, including sources of methodological and biological variability, in stable isotope incorporation into viral particles. Our findings suggest that nanoSIMS can be successfully employed to directly probe virus-host interactions at the resolution of individual

Kinetics of recB-dependent repair: Relationship to post-UV inactivation of the prophage

International Nuclear Information System (INIS)

Trgovcevic, Z.; Petranovic, D.; Salaj-Smic, E.; Petranovic, M.

1987-01-01

By making use of the temperature-sensitive mutant recB270, we showed that the RecBCD enzyme is needed for repair between 1 and 4 h after UV exposure. recB-dependent prophage inactivation takes place in all dying cells during the same period of time. The kinetics of decrease in the yield of recombinants in phage-prophage crosses resemble those of prophage inactivation in UV-irradiated bacteria. This indicates that recombination processes (including site-specific recombination required for prophage excision) are blocked in cells destined to die. On the basis of our results, we suggest that a large fraction of damaged cells is rescued by the RecA-RecBCD recombination pathway. If repair is unsuccessful, RecA-RecBCD recombinaton intermediates persist in the irradiated cells leading to prophage inactivation. 27 refs.; 4 figs

Draft genome sequence and genetic transformation of the oleaginous alga Nannochloropis gaditana.

Science.gov (United States)

Radakovits, Randor; Jinkerson, Robert E; Fuerstenberg, Susan I; Tae, Hongseok; Settlage, Robert E; Boore, Jeffrey L; Posewitz, Matthew C

2012-02-21

The potential use of algae in biofuels applications is receiving significant attention. However, none of the current algal model species are competitive production strains. Here we present a draft genome sequence and a genetic transformation method for the marine microalga Nannochloropsis gaditana CCMP526. We show that N. gaditana has highly favourable lipid yields, and is a promising production organism. The genome assembly includes nuclear (~29 Mb) and organellar genomes, and contains 9,052 gene models. We define the genes required for glycerolipid biogenesis and detail the differential regulation of genes during nitrogen-limited lipid biosynthesis. Phylogenomic analysis identifies genetic attributes of this organism, including unique stramenopile photosynthesis genes and gene expansions that may explain the distinguishing photoautotrophic phenotypes observed. The availability of a genome sequence and transformation methods will facilitate investigations into N. gaditana lipid biosynthesis and permit genetic engineering strategies to further improve this naturally productive alga.

Influence of carbon electrode material on energy recovery from winery wastewater using a dual-chamber microbial fuel cell.

Science.gov (United States)

Penteado, Eduardo D; Fernandez-Marchante, Carmen M; Zaiat, Marcelo; Gonzalez, Ernesto R; Rodrigo, Manuel A

2017-06-01

The aim of this work was to evaluate three carbon materials as anodes in microbial fuel cells (MFCs), clarifying their influence on the generation of electricity and on the treatability of winery wastewater, a highly organic-loaded waste. The electrode materials tested were carbon felt, carbon cloth and carbon paper and they were used at the same time as anode and cathode in the tests. The MFC equipped with carbon felt reached the highest voltage and power (72 mV and 420 mW m -2 , respectively), while the lowest values were observed when carbon paper was used as electrode (0.2 mV and 8.37·10 -6  mW m -2 , respectively). Chemical oxygen demand (COD) removal from the wastewater was observed to depend on the electrode material, as well. When carbon felt was used, the MFC showed the highest average organic matter consumption rate (650 mg COD L -1  d -1 ), whereas by using carbon paper the rate decreased to 270 mg COD L -1  d -1 . Therefore, both electricity generation and organic matter removal are strongly related not to the chemical composition of the electrode (which was graphite carbon in the three electrodes), but to its surface features and, consequently, to the amount of biomass adhered to the electrode surface.

Stemcell Information: SKIP000280 [SKIP Stemcell Database[Archive

Lifescience Database Archive (English)

Full Text Available SKIP000280 ... Diseased HPS0209 HPS0209 ... 肺性高血圧症 I270 Pulmonary hypertension 178...600 ... -- -- Japanese Japanese Yes No Disease specific iPS cell line derived from a patient: Pulmonary hypertension.... ... 疾患特異的iPS細胞株。肺性高血圧症患者由来。 human ES-like -- Sendai virus SeV18+HS-OCT3/4/TSΔF, SeV18+HS-SOX2/TS

Stemcell Information: SKIP000865 [SKIP Stemcell Database[Archive

Lifescience Database Archive (English)

Full Text Available SKIP000865 ... Diseased HPS0211 HPS0211 ... 肺性高血圧症 I270 Pulmonary hypertension 178...600 ... -- -- Japanese 日本人 Yes No Disease specific iPS cell line derived from a patient : Pulmonary hypertension.... HPS0209 was derived from the same patient. ... 疾患特異的iPS細胞株。肺性高血圧症患者由来。HPS0209と同一人由来。 human ES-like R

Selective catalytic oxidation: a new catalytic approach to the desulfurization of natural gas and liquid petroleum gas for fuel cell reformer applications

Science.gov (United States)

Lampert, J.

In both natural gas and liquid petroleum gas (LPG), sulfur degrades the performance of the catalysts used in fuel reformers and fuel cells. In order to improve system performance, the sulfur must be removed to concentrations of less than 200 ppbv (in many applications to less than 20 ppbv) before the fuel reforming operation. Engelhard Corporation presents a unique approach to the desulfurization of natural gas and LPG. This new method catalytically converts the organic and inorganic sulfur species to sulfur oxides. The sulfur oxides are then adsorbed on a high capacity adsorbent. The sulfur compounds in the fuel are converted to sulfur oxides by combining the fuel with a small amount of air. The mixture is then heated from 250 to 270 °C, and contacted with a monolith supported sulfur tolerant catalyst at atmospheric pressure. When Engelhard Corporation demonstrated this catalytic approach in the laboratory, the result showed sulfur breakthrough to be less than 10 ppbv in the case of natural gas, and less than 150 ppbv for LPG. We used a simulated natural gas and LPG mixture, doped with a 50-170 ppmv sulfur compound containing equal concentrations of COS, ethylmercaptan, dimethylsulfide, methylethylsulfide and tetrahydrothiophene. There is no need for recycled H 2 as in the case for hydrodesulfurization.

Fitoplancton de embalses subtropicales del noroeste argentino.

Directory of Open Access Journals (Sweden)

María Mónica Salusso

2014-12-01

Full Text Available Los embalses Cabra Corral y El Tunal de la cuenca del Juramento (ACJ, constituyen los reservorios de mayor relevancia de la provincia de Salta (Argentina. Se analizó la composición y estructura del fitoplancton en ambas presas en febrero, mayo y octubre en el período 1998-2011, utilizando técnicas normalizadas. El inventario algal comprendió un total de 334 spp., siendo los grupos más diversos: Chlorophyta (116, Bacillariophyta (112 y Cianophyta (64. La abundancia y diversidad de especies estuvieron asociadas con los cambios en las descargas de agua. Los valores más altos de riqueza y diversidad específicas, se alcanzaron durante los períodos de lluvias, siendo inversa la situación en estiaje, cuando incrementó la biomasa total; excepto durante los picos de floraciones de Dinophyta. La aparición de cianobacterias con potencial tóxico fue más significativa en el verano tardío y otoño. A pesar de que el número total de especies registrado es alto comparado con otros reservorios subropicales, sólo unas pocas pueden ser consideradas como comunes o frecuentes (Aulacoseira granulata, Cyclotella meneghiniana, Sphaerocystis schroeteri, Chroomonas minuta. La biomasa estuvo asociada a nivel local con las precipitaciones y el manejo del nivel hidrométrico y a nivel regional con el área superficial de los reservorios.

Regulation of cell cycle progression by cell-cell and cell-matrix forces

NARCIS (Netherlands)

Uroz, Marina; Wistorf, Sabrina; Serra-Picamal, Xavier; Conte, Vito; Sales-Pardo, Marta; Roca-Cusachs, Pere; Guimerà, Roger; Trepat, Xavier

2018-01-01

It has long been proposed that the cell cycle is regulated by physical forces at the cell-cell and cell-extracellular matrix (ECM) interfaces 1-12 . However, the evolution of these forces during the cycle has never been measured in a tissue, and whether this evolution affects cell cycle progression

Enhancement of Solar Cell Efficiency for Space Applications Using Two-Dimensional Photonic Crystals

Directory of Open Access Journals (Sweden)

Postigo P.A.

2017-01-01

Full Text Available The effects of having a nanopatterned photonic crystal (PC structure in the surface of a solar cell can be usefully employed to increase the energy conversion efficiency, which may be critical for space applications. In this work, we have measured the reflectance (R and transmittance (T of thin InP layers (270 nm thick bonded to a glass substrate and nanopatterned with holes down to the glass in a triangular symmetry lattice separated by a lattice parameter a=450nm and maintaining a value of r/a=0.32. The optical spectra were measured with angular resolution in the range from 0.55 to 2.0 eV. There are noticeable changes in the spectra of the PC sample, with minima and maxima of the R and T clearly shifted with respect to the unpatterned sample, and new features that alter significantly the overall lineshape of each spectrum. Those features correspond in a first approximation to the well-known Fano-like resonances of the discrete photonic modes of the PC lattice and they have been used before to determine experimentally the position of the PC bands. The observed features can be translated to the optical absorption (A defined as A=1-R-T provided there are low or negligible scattering effects. The generated absorption spectra show enhancements above and below the electronic band edge of the InP that can be correlated with the photonic band structure. Even using a thicker semiconductor layer, the abovementioned effects can justify to use a photonic crystal front surface with sub-wavelength motifs. In this way, we have fabricated and characterized a complete Ge/InGaP solar cell with a 2D-PC on its front surface. An increase in the photocurrent up to a 8% was achieved on a solar cell with a 40% of its surface covered with a PC pattern. Enhancements of the external quantum efficiency (EQE of 22% for a wide range of wavelengths and up to a 46% for specific wavelengths have been measured, without use of any anti-reflection coating (ARC. A correlation

Unraveling the Molecular Mechanism of Benzothiophene and Benzofuran scaffold merged compounds binding to anti-apoptotic Myeloid cell leukemia 1.

Science.gov (United States)

Marimuthu, Parthiban; Singaravelu, Kalaimathy

2018-05-10

Myeloid cell leukemia 1 (Mcl1), is an anti-apoptotic member of the Bcl-2 family proteins, has gained considerable importance due to its overexpression activity prevents the oncogenic cells to undergo apoptosis. This overexpression activity of Mcl1 eventually develops strong resistance to a wide variety of anticancer agents. Therefore, designing novel inhibitors with potentials to elicit higher binding affinity and specificity to inhibit Mcl1 activity is of greater importance. Thus, Mcl1 acts as an attractive cancer target. Despite recent experimental advancement in the identification and characterization of Benzothiophene and Benzofuran scaffold merged compounds the molecular mechanisms of their binding to Mcl1 are yet to be explored. The current study demonstrates an integrated approach -pharmacophore-based 3D-QSAR, docking, Molecular Dynamics (MD) simulation and free-energy estimation- to access the precise and comprehensive effects of current inhibitors targeting Mcl1 together with its known activity values. The pharmacophore -ANRRR.240- based 3D-QSAR model from the current study provided high confidence (R 2 =0.9154, Q 2 =0.8736, and RMSE=0.3533) values. Furthermore, the docking correctly predicted the binding mode of highly active compound 42. Additionally, the MD simulation for docked complex under explicit-solvent conditions together with free-energy estimation exhibited stable interaction and binding strength over the time period. Also, the decomposition analysis revealed potential energy contributing residues -M231, M250, V253, R265, L267, and F270- to the complex stability. Overall, the current investigation might serve as a valuable insight, either to (i) improve the binding affinity of the current compounds or (ii) discover new generation anti-cancer agents that can effectively downregulate Mcl1 activity.

Well-Controlled Cell-Trapping Systems for Investigating Heterogeneous Cell-Cell Interactions.

Science.gov (United States)

Kamiya, Koki; Abe, Yuta; Inoue, Kosuke; Osaki, Toshihisa; Kawano, Ryuji; Miki, Norihisa; Takeuchi, Shoji

2018-03-01

Microfluidic systems have been developed for patterning single cells to study cell-cell interactions. However, patterning multiple types of cells to understand heterogeneous cell-cell interactions remains difficult. Here, it is aimed to develop a cell-trapping device to assemble multiple types of cells in the well-controlled order and morphology. This device mainly comprises a parylene sheet for assembling cells and a microcomb for controlling the cell-trapping area. The cell-trapping area is controlled by moving the parylene sheet on an SU-8 microcomb using tweezers. Gentle downward flow is used as a driving force for the cell-trapping. The assembly of cells on a parylene sheet with round and line-shaped apertures is demonstrated. The cell-cell contacts of the trapped cells are then investigated by direct cell-cell transfer of calcein via connexin nanopores. Finally, using the device with a system for controlling the cell-trapping area, three different types of cells in the well-controlled order are assembled. The correct cell order rate obtained using the device is 27.9%, which is higher than that obtained without the sliding parylene system (0.74%). Furthermore, the occurrence of cell-cell contact between the three cell types assembled is verified. This cell-patterning device will be a useful tool for investigating heterogeneous cell-cell interactions. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Cell Adhesions: Actin-Based Modules that Mediate Cell-Extracellular Matrix and Cell-Cell Interactions

Science.gov (United States)

Bachir, Alexia; Horwitz, Alan Rick; Nelson, W. James; Bianchini, Julie M.

2018-01-01

Cell adhesions link cells to the extracellular matrix (ECM) and to each other, and depend on interactions with the actin cytoskeleton. Both cell-ECM and cell-cell adhesion sites contain discrete, yet overlapping functional modules. These modules establish physical association with the actin cytoskeleton, locally modulate actin organization and dynamics, and trigger intracellular signaling pathways. Interplay between these modules generates distinct actin architectures that underlie different stages, types, and functions of cell-ECM and cell-cell adhesions. Actomyosin contractility is required to generate mature, stable adhesions, as well as sense and translate the mechanical properties of the cellular environment to changes in cell organization and behavior. In this chapter we discuss the organization and function of different adhesion modules and how they interact with the actin cytoskeleton. We highlight the molecular mechanisms of mechanotransduction in adhesions, and how adhesion molecules mediate crosstalk between cell-ECM and cell-cell adhesion sites. PMID:28679638

Materials and Fuels Complex Hazardous Waste Management Act/Resource Conservation and Recovery Act Storage and Treatment Permit Reapplication, Environmental Protection Agency Number ID4890008952

Energy Technology Data Exchange (ETDEWEB)

Holzemer, Michael J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hart, Edward [Idaho National Lab. (INL), Idaho Falls, ID (United States)

2015-04-01

Hazardous Waste Management Act/Resource Conservation and Recovery Act Storage and Treatment Permit Reapplication for the Idaho National Laboratory Materials and Fuels Complex Hazardous Waste Management Act/Resource Conservation and Recovery Act Partial Permit, PER-116. This Permit Reapplication is required by the PER-116 Permit Conditions I.G. and I.H., and must be submitted to the Idaho Department of Environmental Quality in accordance with IDAPA 58.01.05.012 [40 CFR §§ 270.10 and 270.13 through 270.29].

Meningeal mast cell-T cell crosstalk regulates T cell encephalitogenicity.

Science.gov (United States)

Russi, Abigail E; Walker-Caulfield, Margaret E; Guo, Yong; Lucchinetti, Claudia F; Brown, Melissa A

2016-09-01

GM-CSF is a cytokine produced by T helper (Th) cells that plays an essential role in orchestrating neuroinflammation in experimental autoimmune encephalomyelitis, a rodent model of multiple sclerosis. Yet where and how Th cells acquire GM-CSF expression is unknown. In this study we identify mast cells in the meninges, tripartite tissues surrounding the brain and spinal cord, as important contributors to antigen-specific Th cell accumulation and GM-CSF expression. In the absence of mast cells, Th cells do not accumulate in the meninges nor produce GM-CSF. Mast cell-T cell co-culture experiments and selective mast cell reconstitution of the meninges of mast cell-deficient mice reveal that resident meningeal mast cells are an early source of caspase-1-dependent IL-1β that licenses Th cells to produce GM-CSF and become encephalitogenic. We also provide evidence of mast cell-T cell co-localization in the meninges and CNS of recently diagnosed acute MS patients indicating similar interactions may occur in human demyelinating disease. Copyright © 2016 Elsevier Ltd. All rights reserved.

ITGA3 and ITGB4 expression biomarkers estimate the risks of locoregional and hematogenous dissemination of oral squamous cell carcinoma

International Nuclear Information System (INIS)

Nagata, Masaki; Takahashi, Katsu; Kodama, Naoki; Kawase, Tomoyuki; Hoshina, Hideyuki; Ikeda, Nobuyuki; Shingaki, Susumu; Takagi, Ritsuo; Noman, Arhab A; Suzuki, Kenji; Kurita, Hiroshi; Ohnishi, Makoto; Ohyama, Tokio; Kitamura, Nobutaka; Kobayashi, Takanori; Uematsu, Kohya

2013-01-01

Molecular biomarkers are essential for monitoring treatment effects, predicting prognosis, and improving survival rate in oral squamous cell carcinoma. This study sought to verify the effectiveness of two integrin gene expression ratios as biomarkers. Gene expression analyses of integrin α3 (ITGA3), integrin β4 (ITGB4), CD9 antigen (CD9), and plakoglobin (JUP) by quantitative real-time PCR were conducted on total RNA from 270 OSCC cases. The logrank test, Cox proportional hazards model, and Kaplan-Meier estimates were performed on the gene expression ratios of ITGA3/CD9 and ITGB4/JUP and on the clinicopathological parameters for major clinical events. A high rate (around 80%) of lymph node metastasis was found in cases with a high ITGA3/CD9 ratio (high-ITGA3/CD9) and invasive histopathology (YK4). Primary site recurrence (PSR) was associated with high-ITGA3/CD9, T3-4 (TNM class), and positive margin, indicating that PSR is synergistically influenced by treatment failure and biological malignancy. A high ITGB4/JUP ratio (high-ITGB4/JUP) was revealed to be a primary contributor to distant metastasis without the involvement of clinicopathological factors, suggesting intervention of a critical step dependent on the function of the integrin β4 subunit. Kaplan-Meier curves revealed positive margin as a lethal treatment consequence in high-ITGA3/CD9 and YK4 double-positive cases. Two types of metastatic trait were found in OSCC: locoregional dissemination, which was reflected by high-ITGA3/CD9, and distant metastasis through hematogenous dissemination, uniquely distinguished by high-ITGB4/JUP. The clinical significance of the integrin biomarkers implies that biological mechanisms such as cancer cell motility and anchorage-independent survival are vital for OSCC recurrence and metastasis

48 CFR 870.111-3 - Contract clauses.

Science.gov (United States)

2010-10-01

... officer shall include the clause at 852.270-2, Bread and bakery products—quantities, in solicitations and contracts for bread and bakery products. (b) The contracting officer shall include the clause at 852.270-3...

Mast cells enhance T cell activation: Importance of mast cell-derived TNF

Science.gov (United States)

Nakae, Susumu; Suto, Hajime; Kakurai, Maki; Sedgwick, Jonathon D.; Tsai, Mindy; Galli, Stephen J.

2005-05-01

Mast cells are not only important effector cells in immediate hypersensitivity reactions and immune responses to pathogens but also can contribute to T cell-mediated disorders. However, the mechanisms by which mast cells might influence T cells in such settings are not fully understood. We find that mast cells can enhance proliferation and cytokine production in multiple T cell subsets. Mast cell-dependent enhancement of T cell activation can be promoted by FcRI-dependent mast cell activation, TNF production by both mast cells and T cells, and mast cell-T cell contact. However, at high concentrations of cells, mast cells can promote T cell activation independent of IgE or TNF. Finally, mast cells also can promote T cell activation by means of soluble factors. These findings identify multiple mechanisms by which mast cells can influence T cell proliferation and cytokine production. allergy | asthma | autoimmunity | cytokines | immune response

Effects of icotinib with and without radiation therapy on patients with EGFR mutant non-small cell lung cancer and brain metastases

OpenAIRE

Yun Fan; Yanjun Xu; Lei Gong; luo Fang; Hongyang Lu; Jing Qin; Na Han; Fajun Xie; Guoqin Qiu; Zhiyu Huang

2017-01-01

EGFR-TKIs and radiation therapy (RT) are the principal treatment for patients with brain metastases (BM) and EGFR mutant NSCLC. However, the optimal use of brain RT for patients with asymptomatic BM remains undefined. A total of 152 patients were identified. 58 patients were excluded. Of the remaining 97 patients, 56 patients received upfront RT followed by icotinib, including WBRT or SRS. 41 patients received icotinib therapy alone. The mOS from diagnosis of BM was 27.0 months for the whole ...

Induction of Functional Hair-Cell-Like Cells from Mouse Cochlear Multipotent Cells

Directory of Open Access Journals (Sweden)

Quanwen Liu

2016-01-01

Full Text Available In this paper, we developed a two-step-induction method of generating functional hair cells from inner ear multipotent cells. Multipotent cells from the inner ear were established and induced initially into progenitor cells committed to the inner ear cell lineage on the poly-L-lysine substratum. Subsequently, the committed progenitor cells were cultured on the mitotically inactivated chicken utricle stromal cells and induced into hair-cell-like cells containing characteristic stereocilia bundles. The hair-cell-like cells exhibited rapid permeation of FM1-43FX. The whole-cell patch-clamp technique was used to measure the membrane currents of cells differentiated for 7 days on chicken utricle stromal cells and analyze the biophysical properties of the hair-cell-like cells by recording membrane properties of cells. The results suggested that the hair-cell-like cells derived from inner ear multipotent cells were functional following differentiation in an enabling environment.

Symbiodinium genomes reveal adaptive evolution of functions related to symbiosis

KAUST Repository

Liu, Huanle; Stephens, Timothy G.; Gonzá lez-Pech, Raú l; Beltran, Victor H.; Lapeyre, Bruno; Bongaerts, Pim; Cooke, Ira; Bourne, David G.; Forê t, Sylvain; Miller, David John; van Oppen, Madeleine J. H.; Voolstra, Christian R.; Ragan, Mark A.; Chan, Cheong Xin

2017-01-01

Symbiosis between dinoflagellates of the genus Symbiodinium and reef-building corals forms the trophic foundation of the world's coral reef ecosystems. Here we present the first draft genome of Symbiodinium goreaui (Clade C, type C1: 1.03 Gbp), one of the most ubiquitous endosymbionts associated with corals, and an improved draft genome of Symbiodinium kawagutii (Clade F, strain CS-156: 1.05 Gbp), previously sequenced as strain CCMP2468, to further elucidate genomic signatures of this symbiosis. Comparative analysis of four available Symbiodinium genomes against other dinoflagellate genomes led to the identification of 2460 nuclear gene families that show evidence of positive selection, including genes involved in photosynthesis, transmembrane ion transport, synthesis and modification of amino acids and glycoproteins, and stress response. Further, we identified extensive sets of genes for meiosis and response to light stress. These draft genomes provide a foundational resource for advancing our understanding Symbiodinium biology and the coral-algal symbiosis.

Symbiodinium genomes reveal adaptive evolution of functions related to symbiosis

KAUST Repository

Liu, Huanle

2017-10-06

Symbiosis between dinoflagellates of the genus Symbiodinium and reef-building corals forms the trophic foundation of the world\\'s coral reef ecosystems. Here we present the first draft genome of Symbiodinium goreaui (Clade C, type C1: 1.03 Gbp), one of the most ubiquitous endosymbionts associated with corals, and an improved draft genome of Symbiodinium kawagutii (Clade F, strain CS-156: 1.05 Gbp), previously sequenced as strain CCMP2468, to further elucidate genomic signatures of this symbiosis. Comparative analysis of four available Symbiodinium genomes against other dinoflagellate genomes led to the identification of 2460 nuclear gene families that show evidence of positive selection, including genes involved in photosynthesis, transmembrane ion transport, synthesis and modification of amino acids and glycoproteins, and stress response. Further, we identified extensive sets of genes for meiosis and response to light stress. These draft genomes provide a foundational resource for advancing our understanding Symbiodinium biology and the coral-algal symbiosis.

The Genetic Intractability Of Symbiodinium microadriaticum To Standard Algal Transformation Methods

KAUST Repository

Chen, Jit Ern

2017-05-23

Modern transformation and genome editing techniques have shown great success across a broad variety of organisms. However, no study of successfully applied genome editing has been reported in a dinoflagellate despite the first genetic transformation of Symbiodinium being published about 20 years ago. Using an array of different available transformation techniques, we attempted to transform Symbiodinium microadriaticum (CCMP2467), a dinoflagellate symbiont of reef-building corals, in order to perform CRISPR-Ca9 mediated genome editing. Plasmid vectors containing the chloramphenicol resistance gene under the control of the CaMV p35S promoter as well as several putative endogenous promoters were used to test a variety of transformation techniques including biolistics, electroporation, silica whiskers and glass bead agitation. We report that we have been unable to confer chloramphenicol resistance to our specific Symbiodinium strain. These results are intended to provide other researchers with an overview of previously attempted techniques and sequences in order to support efficient planning of future experiments in this important field.

Reference: 270 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available e development of the root system with nutritional cues. The putative high-affinity nitrate transporter NRT2....1 represses lateral root initiation in response to nutritional cues. 38 13693-8 1

18 CFR 270.401 - Jurisdictional agency.

Science.gov (United States)

2010-04-01

..., Springfield, VA 22153. (5) California, except Naval Petroleum Reserve No. 1 (Elk Hills) and No. 2 (Buena Vista..., Office of Conservation, PO Box 94275, Baton Rouge, LA 70804. (15) Maryland—Department of Natural...

Publications | Page 270 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Giving Back — IDRC photo contest winner shares prize with Senegalese colleagues. Brendan Baker can be called many things: an engineer, an international volunteer, an award-winning photographer, and, evidently, a generous man. The winner of IDRC's “Expose Urban Solutions” photo contest, Baker shared his CA$2.

18 CFR 270.101 - General definitions.

Science.gov (United States)

2010-04-01

..., DEPARTMENT OF ENERGY PROCEDURES GOVERNING DETERMINATIONS FOR TAX CREDIT PURPOSES DETERMINATION PROCEDURES... gas produced from coal seams means naturally occurring natural gas released from entrapment from the fractures, pores and bedding planes of coal seams. (7) Natural gas produced from Devonian shale means...

40 CFR 1065.270 - Chemiluminescent detector.

Science.gov (United States)

2010-07-01

... Chemiluminescent detector. (a) Application. You may use a chemiluminescent detector (CLD) to measure NOX concentration in raw or diluted exhaust for batch or continuous sampling. We generally accept a CLD for NOX...) Component requirements. We recommend that you use a CLD that meets the specifications in Table 1 of § 1065...

Publications | Page 270 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2009-04-20

Seeking justice: Women's police stations in Latin America. On April 20, 2009, in the small town of Diriomo, Nicaragua, Luz Marina Lezama Suazo, aged 47, was shot dead, allegedly by her husband. According to her sister, “She'd been having problems with him for a while and we had told her to leave.

Intracerebral microinjection device (IMI) for stem cells and therapeutics. Results from the Göttingen minipig

DEFF Research Database (Denmark)

Bjarkam, C.R.; Glud, Andreas Nørgaard; Margolin, Lee

2008-01-01

prone in a MRI compatible localizer box. Through a midline scalp incision a copper-sulphate filled plastic screw was placed in the bregma. The animals were then MRI scanned with a coronal T1-weighted 3D gradient echo sequence on a GE Sigma Horizon 3 Tesla Sigma Excite System. With the resulting MRI scan...... microliters of red latex beads in saline were injected. Four injections were made at 0, 90, 180 and 270 degrees, after which the cannulas were retracted. For sacrifice the animals received an overdose of pentobarbital followed by transcardial perfusion with 5 l phosphate buffered 4% paraformaldehyde (pH 7...

Cell Cycle Related Differentiation of Bone Marrow Cells into Lung Cells

Energy Technology Data Exchange (ETDEWEB)

Dooner, Mark; Aliotta, Jason M.; Pimental, Jeffrey; Dooner, Gerri J.; Abedi, Mehrdad; Colvin, Gerald; Liu, Qin; Weier, Heinz-Ulli; Dooner, Mark S.; Quesenberry, Peter J.

2007-12-31

Green-fluorescent protein (GFP) labeled marrow cells transplanted into lethally irradiated mice can be detected in the lungs of transplanted mice and have been shown to express lung specific proteins while lacking the expression of hematopoietic markers. We have studied marrow cells induced to transit cell cycle by exposure to IL-3, IL-6, IL-11 and steel factor at different times of culture corresponding to different phases of cell cycle. We have found that marrow cells at the G1/S interface have a 3-fold increase in cells which assume a lung phenotype and that this increase is no longer seen in late S/G2. These cells have been characterized as GFP{sup +} CD45{sup -} and GFP{sup +} cytokeratin{sup +}. Thus marrow cells with the capacity to convert into cells with a lung phenotype after transplantation show a reversible increase with cytokine induced cell cycle transit. Previous studies have shown the phenotype of bone marrow stem cells fluctuates reversibly as these cells traverse cell cycle, leading to a continuum model of stem cell regulation. The present studies indicate that marrow stem cell production of nonhematopoietic cells also fluctuates on a continuum.

Deletion of Notch1 converts pro-T cells to dendritic cells and promotes thymic B cells by cell-extrinsic and cell-intrinsic mechanisms.

Science.gov (United States)

Feyerabend, Thorsten B; Terszowski, Grzegorz; Tietz, Annette; Blum, Carmen; Luche, Hervé; Gossler, Achim; Gale, Nicholas W; Radtke, Freddy; Fehling, Hans Jörg; Rodewald, Hans-Reimer

2009-01-16

Notch1 signaling is required for T cell development and has been implicated in fate decisions in the thymus. We showed that Notch1 deletion in progenitor T cells (pro-T cells) revealed their latent developmental potential toward becoming conventional and plasmacytoid dendritic cells. In addition, Notch1 deletion in pro-T cells resulted in large numbers of thymic B cells, previously explained by T-to-B cell fate conversion. Single-cell genotyping showed, however, that the majority of these thymic B cells arose from Notch1-sufficient cells by a cell-extrinsic pathway. Fate switching nevertheless exists for a subset of thymic B cells originating from Notch1-deleted pro-T cells. Chimeric mice lacking the Notch ligand delta-like 4 (Dll4) in thymus epithelium revealed an essential role for Dll4 in T cell development. Thus, Notch1-Dll4 signaling fortifies T cell commitment by suppressing non-T cell lineage potential in pro-T cells, and normal Notch1-driven T cell development repels excessive B cells in the thymus.

Mesenchymal stem cell like (MSCl) cells generated from human embryonic stem cells support pluripotent cell growth

International Nuclear Information System (INIS)

Varga, Nóra; Veréb, Zoltán; Rajnavölgyi, Éva; Német, Katalin; Uher, Ferenc; Sarkadi, Balázs; Apáti, Ágota

2011-01-01

Highlights: ► MSC like cells were derived from hESC by a simple and reproducible method. ► Differentiation and immunosuppressive features of MSCl cells were similar to bmMSC. ► MSCl cells as feeder cells support the undifferentiated growth of hESC. -- Abstract: Mesenchymal stem cell like (MSCl) cells were generated from human embryonic stem cells (hESC) through embryoid body formation, and isolated by adherence to plastic surface. MSCl cell lines could be propagated without changes in morphological or functional characteristics for more than 15 passages. These cells, as well as their fluorescent protein expressing stable derivatives, efficiently supported the growth of undifferentiated human embryonic stem cells as feeder cells. The MSCl cells did not express the embryonic (Oct4, Nanog, ABCG2, PODXL, or SSEA4), or hematopoietic (CD34, CD45, CD14, CD133, HLA-DR) stem cell markers, while were positive for the characteristic cell surface markers of MSCs (CD44, CD73, CD90, CD105). MSCl cells could be differentiated toward osteogenic, chondrogenic or adipogenic directions and exhibited significant inhibition of mitogen-activated lymphocyte proliferation, and thus presented immunosuppressive features. We suggest that cultured MSCl cells can properly model human MSCs and be applied as efficient feeders in hESC cultures.

Involvement of plant stem cells or stem cell-like cells in dedifferentiation

Directory of Open Access Journals (Sweden)

Fangwei eJiang

2015-11-01

Full Text Available Dedifferentiation is the transformation of cells from a given differentiated state to a less differentiated or stem cell-like state. Stem cell-related genes play important roles in dedifferentiation, which exhibits similar histone modification and DNA methylation features to stem cell maintenance. Hence, stem cell-related factors possibly synergistically function to provide a specific niche beneficial to dedifferentiation. During callus formation in Arabidopsis petioles, cells adjacent to procambium cells (stem cell-like cells are dedifferentiated and survive more easily than other cell types. This finding indicates that stem cells or stem cell-like cells may influence the dedifferentiating niche. In this paper, we provide a brief overview of stem cell maintenance and dedifferentiation regulation. We also summarize current knowledge of genetic and epigenetic mechanisms underlying the balance between differentiation and dedifferentiation. Furthermore, we discuss the correlation of stem cells or stem cell-like cells with dedifferentiation.

Cell-cell interactions mediate cytoskeleton organization and collective endothelial cell chemotaxis.

Science.gov (United States)

Shamloo, Amir

2014-09-01

This study investigates the role of cell-cell and cell-ligand interactions in cytoskeleton organization of endothelial cells (ECs) and their directional migration within a microfluidic device. The migration of ECs in response to a biochemical factor was studied. Mathematical analysis of the cell migration pathways and cellular cytoskeleton revealed that directional migration, migration persistence length, migration speed, and cytoskeletal stress fiber alignment can be mediated by the level of cell contacts as well as the presence or absence of a biochemical polarizing factor. It was shown that in the presence of a biochemical polarizing factor, higher cell density and more frequent cell contacts has a reinforcing effect on collective cell chemotaxis. In contrast, in the absence of a polarizing factor, high cell density can decrease or suppress the ability of the cells to migrate. Also, the correlation of actin stress fiber organization and alignment with directional migration of ECs was investigated. It was shown that in the presence of a biochemical polarizing factor, stress fibers within the cytoskeleton of ECs can be significantly aligned parallel to the gradient direction when the cells have higher level of contacts. The results also show that the organization and alignment of actin stress fibers is mediated by cell adhesion junctions during collective cell migration and introduce cell-cell interactions as a key factor during collective cell chemotaxis. © 2014 Wiley Periodicals, Inc.

Mesenchymal stem cell like (MSCl) cells generated from human embryonic stem cells support pluripotent cell growth

Energy Technology Data Exchange (ETDEWEB)

Varga, Nora [Membrane Research Group of the Hungarian Academy of Sciences, Semmelweis University, Budapest (Hungary); Vereb, Zoltan; Rajnavoelgyi, Eva [Department of Immunology, Medical and Health Science Centre, University of Debrecen, Debrecen (Hungary); Nemet, Katalin; Uher, Ferenc; Sarkadi, Balazs [Membrane Research Group of the Hungarian Academy of Sciences, Semmelweis University, Budapest (Hungary); Apati, Agota, E-mail: apati@kkk.org.hu [Membrane Research Group of the Hungarian Academy of Sciences, Semmelweis University, Budapest (Hungary)

2011-10-28

Highlights: Black-Right-Pointing-Pointer MSC like cells were derived from hESC by a simple and reproducible method. Black-Right-Pointing-Pointer Differentiation and immunosuppressive features of MSCl cells were similar to bmMSC. Black-Right-Pointing-Pointer MSCl cells as feeder cells support the undifferentiated growth of hESC. -- Abstract: Mesenchymal stem cell like (MSCl) cells were generated from human embryonic stem cells (hESC) through embryoid body formation, and isolated by adherence to plastic surface. MSCl cell lines could be propagated without changes in morphological or functional characteristics for more than 15 passages. These cells, as well as their fluorescent protein expressing stable derivatives, efficiently supported the growth of undifferentiated human embryonic stem cells as feeder cells. The MSCl cells did not express the embryonic (Oct4, Nanog, ABCG2, PODXL, or SSEA4), or hematopoietic (CD34, CD45, CD14, CD133, HLA-DR) stem cell markers, while were positive for the characteristic cell surface markers of MSCs (CD44, CD73, CD90, CD105). MSCl cells could be differentiated toward osteogenic, chondrogenic or adipogenic directions and exhibited significant inhibition of mitogen-activated lymphocyte proliferation, and thus presented immunosuppressive features. We suggest that cultured MSCl cells can properly model human MSCs and be applied as efficient feeders in hESC cultures.

Computational cell model based on autonomous cell movement regulated by cell-cell signalling successfully recapitulates the "inside and outside" pattern of cell sorting

Directory of Open Access Journals (Sweden)

Ajioka Itsuki

2007-09-01

Full Text Available Abstract Background Development of multicellular organisms proceeds from a single fertilized egg as the combined effect of countless numbers of cellular interactions among highly dynamic cells. Since at least a reminiscent pattern of morphogenesis can be recapitulated in a reproducible manner in reaggregation cultures of dissociated embryonic cells, which is known as cell sorting, the cells themselves must possess some autonomous cell behaviors that assure specific and reproducible self-organization. Understanding of this self-organized dynamics of heterogeneous cell population seems to require some novel approaches so that the approaches bridge a gap between molecular events and morphogenesis in developmental and cell biology. A conceptual cell model in a computer may answer that purpose. We constructed a dynamical cell model based on autonomous cell behaviors, including cell shape, growth, division, adhesion, transformation, and motility as well as cell-cell signaling. The model gives some insights about what cellular behaviors make an appropriate global pattern of the cell population. Results We applied the model to "inside and outside" pattern of cell-sorting, in which two different embryonic cell types within a randomly mixed aggregate are sorted so that one cell type tends to gather in the central region of the aggregate and the other cell type surrounds the first cell type. Our model can modify the above cell behaviors by varying parameters related to them. We explored various parameter sets with which the "inside and outside" pattern could be achieved. The simulation results suggested that direction of cell movement responding to its neighborhood and the cell's mobility are important for this specific rearrangement. Conclusion We constructed an in silico cell model that mimics autonomous cell behaviors and applied it to cell sorting, which is a simple and appropriate phenomenon exhibiting self-organization of cell population. The model

Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)

Czech Academy of Sciences Publication Activity Database

Pavlíková, H.; Witter, K.; Míšek, Ivan

2001-01-01

Roč. 248, č. 3 (2001), s. 270-270 ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001

Phase I dose-escalation study of vinflunine hard capsules administered twice a day for 2 consecutive days every week in patients with advanced/metastatic solid tumors.

Science.gov (United States)

Calvo, E; Vermorken, J B; Hiret, S; Rodon, J; Cortes, J; Senellart, H; Van den Brande, J; Dyck, J; Pétain, A; Ferre, P; Bennouna, J

2012-06-01

Vinflunine is a new microtubule inhibitor of the vinca-alkaloid family. It is marketed in transitional cell carcinoma of urothelial tract as a 20 min infusion given every 3 weeks in Europe. In this phase I study, vinflunine was administered to patients with advanced malignancies as hard capsules given twice a day on days 1-2 every week, with 3 weeks cycles. Serial blood samples were collected during the first cycle for pharmacokinetic investigations. Thirty-six patients (pts) were treated at 6 dose levels 150 (3 pts), 190 (3 pts), 230 (8 pts), 300 mg/day (6 pts) and then 250 (3 pts) and 270 mg/day (13 pts). The Maximal Tolerated Dose (MTD) was reached at 300 mg/day where 2 patients out of 6 experienced a dose limiting toxicity (febrile neutropenia with diarrhea). The lower dose level of 270 mg/day was the recommended dose (RD), the toxicity profile being mainly anaemia, neutropenia, fatigue and constipation. The pharmacokinetic analysis demonstrated the adequacy of the flat-fixed dosing regimen, as no correlation between clearance of vinflunine and body surface area was evidenced. Blood concentrations and exposure increased with dose, and a pharmacokinetic accumulation was observed, which is consistent with the terminal half-life of the compounds. The inter-individual exposure variability at the RD was 35%. Repeated weekly administration of oral vinflunine is feasible and exhibits a moderate inter-individual PK variability. The MTD was achieved at 300 mg/day given for 2 consecutive days. According to the protocol rules, the RD was established at 270 mg/day.

Bronchoalveolar lavage as a tool for evaluation of cellular alteration during Aelurostrongylus abstrusus infection in cats

Directory of Open Access Journals (Sweden)

Vitor M. Ribeiro

2014-10-01

Full Text Available Bronchoalveolar lavage (BAL is a procedure that retrieves cells and other elements from the lungs for evaluation, which helps in the diagnosis of pulmonary diseases. The aim of this study was to perform this procedure for cellular analysis of BAL fluid alterations during experimental infection with Aelurostrongylus abstrusus in cats. Fourteen cats were individually inoculated with 800 third stage larvae of A. abstrusus and five non-infected cats lined as a control group. The BAL procedure was performed through the use of an endotracheal tube on the nineteen cats with a mean age of 18 months, on 0, 30, 60, 90, 120, 180 and 270 days after infection. Absolute cell counts in the infected cats revealed that alveolar macrophages and eosinophils were the predominant cells following infection. This study shows that the technique allows us to retrieve cells and first stage larvae what provides information about the inflammatory process caused by aelurostrongylosis.

Irradiation of dates

International Nuclear Information System (INIS)

Farkas, J.; Al-Charchafchy, F.; Al-Shaikhaly, M.H.; Mirjan, J.; Auda, H.

1974-01-01

Testing of the technical feasibility of radurization of fresh dates was attempted. In addition preliminary studies were carried out to investigate the applicability of gamma rays to date syrup manufacture. The varieties Zahdi, Lelwi and Tabarzel were studied at different stages of ripening. The eating quality of fresh dates was not affected significantly by irradiation even with doses of 270 and 540 krad. The duration of the softening process, after-ripening, of dates was prolonged by low doses of 10-30 krad in the majority of the experimental batches. The time period of after-ripening was reduced with 270 krad, as well as with 540 krad as a result of shortening of the induction period, i.e. the time after which the date begins to soften. The microbial spoilage of khalaal Lelwi dates was considerably reduced by irradiation with doses above 90 krad. The dibis yield of fully rutab dates was highly increased by the radiation doses of 375 to 2000 krad. The darkness and viable cell count of dibis pressed from irradiated dates were significantly lower than that of untreated dates. (F.J.)

Endothelial cell subpopulations in vitro: cell volume, cell cycle, and radiosensitivity

International Nuclear Information System (INIS)

Rubin, D.B.; Drab, E.A.; Bauer, K.D.

1989-01-01

Vascular endothelial cells (EC) are important clinical targets of radiation and other forms of free radical/oxidant stresses. In this study, we found that the extent of endothelial damage may be determined by the different cytotoxic responses of EC subpopulations. The following characteristics of EC subpopulations were examined: (1) cell volume; (2) cell cycle position; and (3) cytotoxic indexes for both acute cell survival and proliferative capacity after irradiation (137Cs, gamma, 0-10 Gy). EC cultured from bovine aortas were separated by centrifugal elutriation into subpopulations of different cell volumes. Through flow cytometry, we found that cell volume was related to the cell cycle phase distribution. The smallest EC were distributed in G1 phase and the larger cells were distributed in either early S, middle S, or late S + G2M phases. Cell cycle phase at the time of irradiation was not associated with acute cell loss. However, distribution in the cell cycle did relate to cell survival based on proliferative capacity (P less than 0.01). The order of increasing radioresistance was cells in G1 (D0 = 110 cGy), early S (135 cGy), middle S (145 cGy), and late S + G2M phases (180 cGy). These findings (1) suggest an age-related response to radiation in a nonmalignant differentiated cell type and (2) demonstrate EC subpopulations in culture

Quantitative imaging of epithelial cell scattering identifies specific inhibitors of cell motility and cell-cell dissociation

NARCIS (Netherlands)

Loerke, D.; le Duc, Q.; Blonk, I.; Kerstens, A.; Spanjaard, E.; Machacek, M.; Danuser, G.; de Rooij, J.

2012-01-01

The scattering of cultured epithelial cells in response to hepatocyte growth factor (HGF) is a model system that recapitulates key features of metastatic cell behavior in vitro, including disruption of cell-cell adhesions and induction of cell migration. We have developed image analysis tools that

The cell cycle as a brake for β-cell regeneration from embryonic stem cells.

Science.gov (United States)

El-Badawy, Ahmed; El-Badri, Nagwa

2016-01-13

The generation of insulin-producing β cells from stem cells in vitro provides a promising source of cells for cell transplantation therapy in diabetes. However, insulin-producing cells generated from human stem cells show deficiency in many functional characteristics compared with pancreatic β cells. Recent reports have shown molecular ties between the cell cycle and the differentiation mechanism of embryonic stem (ES) cells, assuming that cell fate decisions are controlled by the cell cycle machinery. Both β cells and ES cells possess unique cell cycle machinery yet with significant contrasts. In this review, we compare the cell cycle control mechanisms in both ES cells and β cells, and highlight the fundamental differences between pluripotent cells of embryonic origin and differentiated β cells. Through critical analysis of the differences of the cell cycle between these two cell types, we propose that the cell cycle of ES cells may act as a brake for β-cell regeneration. Based on these differences, we discuss the potential of modulating the cell cycle of ES cells for the large-scale generation of functionally mature β cells in vitro. Further understanding of the factors that modulate the ES cell cycle will lead to new approaches to enhance the production of functional mature insulin-producing cells, and yield a reliable system to generate bona fide β cells in vitro.

Pancreatic stellate cells enhance stem cell-like phenotypes in pancreatic cancer cells

International Nuclear Information System (INIS)

Hamada, Shin; Masamune, Atsushi; Takikawa, Tetsuya; Suzuki, Noriaki; Kikuta, Kazuhiro; Hirota, Morihisa; Hamada, Hirofumi; Kobune, Masayoshi; Satoh, Kennichi; Shimosegawa, Tooru

2012-01-01

Highlights: ► Pancreatic stellate cells (PSCs) promote the progression of pancreatic cancer. ► Pancreatic cancer cells co-cultured with PSCs showed enhanced spheroid formation. ► Expression of stem cell-related genes ABCG2, Nestin and LIN28 was increased. ► Co-injection of PSCs enhanced tumorigenicity of pancreatic cancer cells in vivo. ► This study suggested a novel role of PSCs as a part of the cancer stem cell niche. -- Abstract: The interaction between pancreatic cancer cells and pancreatic stellate cells (PSCs), a major profibrogenic cell type in the pancreas, is receiving increasing attention. There is accumulating evidence that PSCs promote the progression of pancreatic cancer by increasing cancer cell proliferation and invasion as well as by protecting them from radiation- and gemcitabine-induced apoptosis. Recent studies have identified that a portion of cancer cells, called “cancer stem cells”, within the entire cancer tissue harbor highly tumorigenic and chemo-resistant phenotypes, which lead to the recurrence after surgery or re-growth of the tumor. The mechanisms that maintain the “stemness” of these cells remain largely unknown. We hypothesized that PSCs might enhance the cancer stem cell-like phenotypes in pancreatic cancer cells. Indirect co-culture of pancreatic cancer cells with PSCs enhanced the spheroid-forming ability of cancer cells and induced the expression of cancer stem cell-related genes ABCG2, Nestin and LIN28. In addition, co-injection of PSCs enhanced tumorigenicity of pancreatic cancer cells in vivo. These results suggested a novel role of PSCs as a part of the cancer stem cell niche.

In silico characterization of cell-cell interactions using a cellular automata model of cell culture.

Science.gov (United States)

Kihara, Takanori; Kashitani, Kosuke; Miyake, Jun

2017-07-14

Cell proliferation is a key characteristic of eukaryotic cells. During cell proliferation, cells interact with each other. In this study, we developed a cellular automata model to estimate cell-cell interactions using experimentally obtained images of cultured cells. We used four types of cells; HeLa cells, human osteosarcoma (HOS) cells, rat mesenchymal stem cells (MSCs), and rat smooth muscle A7r5 cells. These cells were cultured and stained daily. The obtained cell images were binarized and clipped into squares containing about 10 4 cells. These cells showed characteristic cell proliferation patterns. The growth curves of these cells were generated from the cell proliferation images and we determined the doubling time of these cells from the growth curves. We developed a simple cellular automata system with an easily accessible graphical user interface. This system has five variable parameters, namely, initial cell number, doubling time, motility, cell-cell adhesion, and cell-cell contact inhibition (of proliferation). Within these parameters, we obtained initial cell numbers and doubling times experimentally. We set the motility at a constant value because the effect of the parameter for our simulation was restricted. Therefore, we simulated cell proliferation behavior with cell-cell adhesion and cell-cell contact inhibition as variables. By comparing growth curves and proliferation cell images, we succeeded in determining the cell-cell interaction properties of each cell. Simulated HeLa and HOS cells exhibited low cell-cell adhesion and weak cell-cell contact inhibition. Simulated MSCs exhibited high cell-cell adhesion and positive cell-cell contact inhibition. Simulated A7r5 cells exhibited low cell-cell adhesion and strong cell-cell contact inhibition. These simulated results correlated with the experimental growth curves and proliferation images. Our simulation approach is an easy method for evaluating the cell-cell interaction properties of cells.

Host cell reactivation in mammalian cells

International Nuclear Information System (INIS)

Lytle, C.D.; Benane, S.G.; Stafford, J.E.

1976-01-01

The survival of UV-irradiated herpes simplex virus was determined in cultured Potoroo (a marsupial) and human cells under lighting conditions which promoted photereactivation. Photoreactivation was readily demonstrated for herpes virus in two lines of Potoroo cells with dose reduction factors of 0.7 to 0.8 for ovary cells and 0.5 to 0.7 for kidney cells. Light from Blacklite (near UV) lamps was more effective than from Daylight (mostly visible) lamps, suggesting that near UV radiation was more effecient for photoreactivation in Potoroo cells. The quantitative and qualitative aspects of this photoreactivation were similar to those reported for a similar virus infecting chick embryo cells. UV-survival curves of herpes virus in Potoroo cells indicated a high level of 'dark' host cell reactivation. No photoreactivation was found for UV-irradiated vaccinia virus in Potoroo cells. A similar photoreactivation study was done using special control lighting (lambda>600 nm) and human cells with normal repair and with cells deficient in excision repair (XP). No photoreactivation was found for UV-irradiated herpes virus in either human cell with either Blacklite or Daylight lamps as the sources of photoreactivating light. This result contrasts with a report of photoreactivation for a herpes virus in the same XP cells using incandescent lamps. (author)

Local cell metrics: a novel method for analysis of cell-cell interactions

Directory of Open Access Journals (Sweden)

Chen Chien-Chiang

2009-10-01

Full Text Available Abstract Background The regulation of many cell functions is inherently linked to cell-cell contact interactions. However, effects of contact interactions among adherent cells can be difficult to detect with global summary statistics due to the localized nature and noise inherent to cell-cell interactions. The lack of informatics approaches specific for detecting cell-cell interactions is a limitation in the analysis of large sets of cell image data, including traditional and combinatorial or high-throughput studies. Here we introduce a novel histogram-based data analysis strategy, termed local cell metrics (LCMs, which addresses this shortcoming. Results The new LCM method is demonstrated via a study of contact inhibition of proliferation of MC3T3-E1 osteoblasts. We describe how LCMs can be used to quantify the local environment of cells and how LCMs are decomposed mathematically into metrics specific to each cell type in a culture, e.g., differently-labelled cells in fluorescence imaging. Using this approach, a quantitative, probabilistic description of the contact inhibition effects in MC3T3-E1 cultures has been achieved. We also show how LCMs are related to the naïve Bayes model. Namely, LCMs are Bayes class-conditional probability functions, suggesting their use for data mining and classification. Conclusion LCMs are successful in robust detection of cell contact inhibition in situations where conventional global statistics fail to do so. The noise due to the random features of cell behavior was suppressed significantly as a result of the focus on local distances, providing sensitive detection of cell-cell contact effects. The methodology can be extended to any quantifiable feature that can be obtained from imaging of cell cultures or tissue samples, including optical, fluorescent, and confocal microscopy. This approach may prove useful in interpreting culture and histological data in fields where cell-cell interactions play a critical

Local cell metrics: a novel method for analysis of cell-cell interactions.

Science.gov (United States)

Su, Jing; Zapata, Pedro J; Chen, Chien-Chiang; Meredith, J Carson

2009-10-23

The regulation of many cell functions is inherently linked to cell-cell contact interactions. However, effects of contact interactions among adherent cells can be difficult to detect with global summary statistics due to the localized nature and noise inherent to cell-cell interactions. The lack of informatics approaches specific for detecting cell-cell interactions is a limitation in the analysis of large sets of cell image data, including traditional and combinatorial or high-throughput studies. Here we introduce a novel histogram-based data analysis strategy, termed local cell metrics (LCMs), which addresses this shortcoming. The new LCM method is demonstrated via a study of contact inhibition of proliferation of MC3T3-E1 osteoblasts. We describe how LCMs can be used to quantify the local environment of cells and how LCMs are decomposed mathematically into metrics specific to each cell type in a culture, e.g., differently-labelled cells in fluorescence imaging. Using this approach, a quantitative, probabilistic description of the contact inhibition effects in MC3T3-E1 cultures has been achieved. We also show how LCMs are related to the naïve Bayes model. Namely, LCMs are Bayes class-conditional probability functions, suggesting their use for data mining and classification. LCMs are successful in robust detection of cell contact inhibition in situations where conventional global statistics fail to do so. The noise due to the random features of cell behavior was suppressed significantly as a result of the focus on local distances, providing sensitive detection of cell-cell contact effects. The methodology can be extended to any quantifiable feature that can be obtained from imaging of cell cultures or tissue samples, including optical, fluorescent, and confocal microscopy. This approach may prove useful in interpreting culture and histological data in fields where cell-cell interactions play a critical role in determining cell fate, e.g., cancer, developmental

Single-cell sequencing in stem cell biology.

Science.gov (United States)

Wen, Lu; Tang, Fuchou

2016-04-15

Cell-to-cell variation and heterogeneity are fundamental and intrinsic characteristics of stem cell populations, but these differences are masked when bulk cells are used for omic analysis. Single-cell sequencing technologies serve as powerful tools to dissect cellular heterogeneity comprehensively and to identify distinct phenotypic cell types, even within a 'homogeneous' stem cell population. These technologies, including single-cell genome, epigenome, and transcriptome sequencing technologies, have been developing rapidly in recent years. The application of these methods to different types of stem cells, including pluripotent stem cells and tissue-specific stem cells, has led to exciting new findings in the stem cell field. In this review, we discuss the recent progress as well as future perspectives in the methodologies and applications of single-cell omic sequencing technologies.

NKT Cell Responses to B Cell Lymphoma.

Science.gov (United States)

Li, Junxin; Sun, Wenji; Subrahmanyam, Priyanka B; Page, Carly; Younger, Kenisha M; Tiper, Irina V; Frieman, Matthew; Kimball, Amy S; Webb, Tonya J

2014-06-01

Natural killer T (NKT) cells are a unique subset of CD1d-restricted T lymphocytes that express characteristics of both T cells and natural killer cells. NKT cells mediate tumor immune-surveillance; however, NKT cells are numerically reduced and functionally impaired in lymphoma patients. Many hematologic malignancies express CD1d molecules and co-stimulatory proteins needed to induce anti-tumor immunity by NKT cells, yet most tumors are poorly immunogenic. In this study, we sought to investigate NKT cell responses to B cell lymphoma. In the presence of exogenous antigen, both mouse and human NKT cell lines produce cytokines following stimulation by B cell lymphoma lines. NKT cell populations were examined ex vivo in mouse models of spontaneous B cell lymphoma, and it was found that during early stages, NKT cell responses were enhanced in lymphoma-bearing animals compared to disease-free animals. In contrast, in lymphoma-bearing animals with splenomegaly and lymphadenopathy, NKT cells were functionally impaired. In a mouse model of blastoid variant mantle cell lymphoma, treatment of tumor-bearing mice with a potent NKT cell agonist, α-galactosylceramide (α-GalCer), resulted in a significant decrease in disease pathology. Ex vivo studies demonstrated that NKT cells from α-GalCer treated mice produced IFN-γ following α-GalCer restimulation, unlike NKT cells from vehicle-control treated mice. These data demonstrate an important role for NKT cells in the immune response to an aggressive hematologic malignancy like mantle cell lymphoma.

Browse Title Index

African Journals Online (AJOL)

Items 251 - 270 of 270 ... Vol 7, No 1 (2008), The Seasonal Cycle of Sea Level in Sri Lanka and ... in the Submerged Channels of Dar es Salaam Coastal Waters, Abstract PDF ... Vol 3, No 2 (2004), Trophic Ecology of Some Common Juvenile ...

Uncertainty in the global oceanic CO2 uptake induced by wind forcing: quantification and spatial analysis

Directory of Open Access Journals (Sweden)

A. Roobaert

2018-03-01

Full Text Available The calculation of the air–water CO2 exchange (FCO2 in the ocean not only depends on the gradient in CO2 partial pressure at the air–water interface but also on the parameterization of the gas exchange transfer velocity (k and the choice of wind product. Here, we present regional and global-scale quantifications of the uncertainty in FCO2 induced by several widely used k formulations and four wind speed data products (CCMP, ERA, NCEP1 and NCEP2. The analysis is performed at a 1°  ×  1° resolution using the sea surface pCO2 climatology generated by Landschützer et al. (2015a for the 1991–2011 period, while the regional assessment relies on the segmentation proposed by the Regional Carbon Cycle Assessment and Processes (RECCAP project. First, we use k formulations derived from the global 14C inventory relying on a quadratic relationship between k and wind speed (k = c ⋅ U102; Sweeney et al., 2007; Takahashi et al., 2009; Wanninkhof, 2014, where c is a calibration coefficient and U10 is the wind speed measured 10 m above the surface. Our results show that the range of global FCO2, calculated with these k relationships, diverge by 12 % when using CCMP, ERA or NCEP1. Due to differences in the regional wind patterns, regional discrepancies in FCO2 are more pronounced than global. These global and regional differences significantly increase when using NCEP2 or other k formulations which include earlier relationships (i.e., Wanninkhof, 1992; Wanninkhof et al., 2009 as well as numerous local and regional parameterizations derived experimentally. To minimize uncertainties associated with the choice of wind product, it is possible to recalculate the coefficient c globally (hereafter called c∗ for a given wind product and its spatio-temporal resolution, in order to match the last evaluation of the global k value. We thus performed these recalculations for each wind product at the resolution and time period of our study

Uncertainty in the global oceanic CO2 uptake induced by wind forcing: quantification and spatial analysis

Science.gov (United States)

Roobaert, Alizée; Laruelle, Goulven G.; Landschützer, Peter; Regnier, Pierre

2018-03-01

The calculation of the air-water CO2 exchange (FCO2) in the ocean not only depends on the gradient in CO2 partial pressure at the air-water interface but also on the parameterization of the gas exchange transfer velocity (k) and the choice of wind product. Here, we present regional and global-scale quantifications of the uncertainty in FCO2 induced by several widely used k formulations and four wind speed data products (CCMP, ERA, NCEP1 and NCEP2). The analysis is performed at a 1° × 1° resolution using the sea surface pCO2 climatology generated by Landschützer et al. (2015a) for the 1991-2011 period, while the regional assessment relies on the segmentation proposed by the Regional Carbon Cycle Assessment and Processes (RECCAP) project. First, we use k formulations derived from the global 14C inventory relying on a quadratic relationship between k and wind speed (k = c ṡ U102; Sweeney et al., 2007; Takahashi et al., 2009; Wanninkhof, 2014), where c is a calibration coefficient and U10 is the wind speed measured 10 m above the surface. Our results show that the range of global FCO2, calculated with these k relationships, diverge by 12 % when using CCMP, ERA or NCEP1. Due to differences in the regional wind patterns, regional discrepancies in FCO2 are more pronounced than global. These global and regional differences significantly increase when using NCEP2 or other k formulations which include earlier relationships (i.e., Wanninkhof, 1992; Wanninkhof et al., 2009) as well as numerous local and regional parameterizations derived experimentally. To minimize uncertainties associated with the choice of wind product, it is possible to recalculate the coefficient c globally (hereafter called c∗) for a given wind product and its spatio-temporal resolution, in order to match the last evaluation of the global k value. We thus performed these recalculations for each wind product at the resolution and time period of our study but the resulting global FCO2 estimates

Automated Cell-Cutting for Cell Cloning

Science.gov (United States)

Ichikawa, Akihiko; Tanikawa, Tamio; Matsukawa, Kazutsugu; Takahashi, Seiya; Ohba, Kohtaro

We develop an automated cell-cutting technique for cell cloning. Animal cells softened by the cytochalasin treatment are injected into a microfluidic chip. The microfluidic chip contains two orthogonal channels: one microchannel is wide, used to transport cells, and generates the cutting flow; the other is thin and used for aspiration, fixing, and stretching of the cell. The injected cell is aspirated and stretched in the thin microchannel. Simultaneously, the volumes of the cell before and after aspiration are calculated; the volumes are used to calculate the fluid flow required to aspirate half the volume of the cell into the thin microchannel. Finally, we apply a high-speed flow in the orthogonal microchannel to bisect the cell. This paper reports the cutting process, the cutting system, and the results of the experiment.

Different cell fates from cell-cell interactions: core architectures of two-cell bistable networks.

Science.gov (United States)

Rouault, Hervé; Hakim, Vincent

2012-02-08

The acquisition of different fates by cells that are initially in the same state is central to development. Here, we investigate the possible structures of bistable genetic networks that can allow two identical cells to acquire different fates through cell-cell interactions. Cell-autonomous bistable networks have been previously sampled using an evolutionary algorithm. We extend this evolutionary procedure to take into account interactions between cells. We obtain a variety of simple bistable networks that we classify into major subtypes. Some have long been proposed in the context of lateral inhibition through the Notch-Delta pathway, some have been more recently considered and others appear to be new and based on mechanisms not previously considered. The results highlight the role of posttranscriptional interactions and particularly of protein complexation and sequestration, which can replace cooperativity in transcriptional interactions. Some bistable networks are entirely based on posttranscriptional interactions and the simplest of these is found to lead, upon a single parameter change, to oscillations in the two cells with opposite phases. We provide qualitative explanations as well as mathematical analyses of the dynamical behaviors of various created networks. The results should help to identify and understand genetic structures implicated in cell-cell interactions and differentiation. Copyright © 2012 Biophysical Society. Published by Elsevier Inc. All rights reserved.

RED BLOOD CELL AND WHOLE BLOOD GLUTATHIONE REDOX STATUS IN ENDURANCE-TRAINED MEN FOLLOWING A SKI MARATHON

Directory of Open Access Journals (Sweden)

Eve Unt

2008-09-01

Full Text Available The aim of the present study was to evaluate the changes in glutathione redox ratio (GSSG·GSH-1 in red blood cells (RBCs and whole blood in well-trained men following a ski marathon. 16 male subjects (27.0 ± 4.7 yrs, 1.81 ± 0.06 m, 77.6 ± 9.6 kg, VO2max 66.2 ± 5.7 ml·kg-1·min-1 were examined before the competition (pre- COMP, after the competition (post-COMP and during an 18-hour recovery period (RECOV. There was a slight decrease in reduced glutathione (GSH in blood and in RBCs in post-COMP. During RECOV, the GSH level in blood was reduced, the GSH level in RBCs was significantly elevated (a statistically significant difference as compared to the pre-COMP level. The post-COMP GSSG·GSH-1 in full blood did not increase significantly, but its increase was statistically significant during the 18-hour recovery period. During the post-COMP and RECOV, the GSSG·GSH-1 in RBCs slightly decreased in comparison with the pre-COMP. Vitamin C concentration in serum increased in post-COMP (49% vs. pre- COMP and decreased to the baseline level during RECOV. In conclusion, our data show that acute exercise slightly increases the GSSG·GSH-1 in whole blood, while GSSG·GSH-1 in RBCs significantly decreases. Thus, exercise-related changes in the non-enzymatic components of the glutathione system (GSSG and GSH in whole blood and RBCs are not identical

Low Doses of Curcuma longa Modulates Cell Migration and Cell-Cell Adhesion.

Science.gov (United States)

de Campos, Paloma Santos; Matte, Bibiana Franzen; Diel, Leonardo Francisco; Jesus, Luciano Henrique; Bernardi, Lisiane; Alves, Alessandro Menna; Rados, Pantelis Varvaki; Lamers, Marcelo Lazzaron

2017-09-01

Cell invasion and metastasis are involved in clinical failures in cancer treatment, and both events require the acquisition of a migratory behavior by tumor cells. Curcumin is a promising natural product with anti-proliferative activity, but its effects on cell migration are still unclear. We evaluated the effects of curcumin on the proliferation, apoptosis, migration, and cell-cell adhesion of keratinocyte, oral squamous cell carcinoma (OSCC), and fibroblast cell lines, as well as in a xenograft model of OSCC. Curcumin (2 μM) decreased cell proliferation in cell lines with mesenchymal characteristics, while cell death was detected only at 50 μM. We observed that highly migratory cells showed a decrease on migration speed and directionality when treated with 2 or 5 μM of curcumin (50% and 40%, respectively, p curcumin dose dependently decreased cell-cell adhesion, especially on tumor-derived spheroids. Also, in a xenograft model with patient-derived OSCC cells, the administration of curcumin decreased tumor growth and aggressiveness when compared with untreated tumors, indicating the potential antitumor effect in oral cancer. These results suggest that lower doses of curcumin can influence several steps involved in tumorigenesis, including migration properties, suggesting a possible use in cancer therapy. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

78 FR 58309 - Proposed Information Collection Activity; Comment Request

Science.gov (United States)

2013-09-23

... initiative, funded by the Children's Bureau (CB) within ACF, will support planning grants to develop a model... for the process evaluation will be used to assess grantees' organizational capacity and readiness to... response burden hours Baseline Telephone Interview of 540 270 1 1.0 270 Organizational Readiness...

Nonimmune cells equipped with T-cell-receptor-like signaling for cancer cell ablation.

Science.gov (United States)

Kojima, Ryosuke; Scheller, Leo; Fussenegger, Martin

2018-01-01

The ability to engineer custom cell-contact-sensing output devices into human nonimmune cells would be useful for extending the applicability of cell-based cancer therapies and for avoiding risks associated with engineered immune cells. Here we have developed a new class of synthetic T-cell receptor-like signal-transduction device that functions efficiently in human nonimmune cells and triggers release of output molecules specifically upon sensing contact with a target cell. This device employs an interleukin signaling cascade, whose OFF/ON switching is controlled by biophysical segregation of a transmembrane signal-inhibitory protein from the sensor cell-target cell interface. We further show that designer nonimmune cells equipped with this device driving expression of a membrane-penetrator/prodrug-activating enzyme construct could specifically kill target cells in the presence of the prodrug, indicating its potential usefulness for target-cell-specific, cell-based enzyme-prodrug cancer therapy. Our study also contributes to the advancement of synthetic biology by extending available design principles to transmit extracellular information to cells.

Proliferating cells in psoriatic dermis are comprised primarily of T cells, endothelial cells, and factor XIIIa+ perivascular dendritic cells

International Nuclear Information System (INIS)

Morganroth, G.S.; Chan, L.S.; Weinstein, G.D.; Voorhees, J.J.; Cooper, K.D.

1991-01-01

Determination of the cell types proliferating in the dermis of patients with psoriasis should identify those cells experiencing activation or responding to growth factors in the psoriatic dermal milieu. Toward that end, sections of formalin-fixed biopsies obtained from 3H-deoxyuridine (3H-dU)-injected skin of eight psoriatic patients were immunostained, followed by autoradiography. Proliferating dermal cells exhibit silver grains from tritium emissions. The identity of the proliferating cells could then be determined by simultaneous visualization with antibodies specific for various cell types. UCHL1+ (CD45RO+) T cells (recall antigen-reactive helper T-cell subset) constituted 36.6 +/- 3.1% (mean +/- SEM, n = 6) of the proliferating dermal cells in involved skin, whereas Leu 18+ (CD45RA+) T cells (recall antigen naive T-cell subsets) comprised only 8.7 +/- 1.5% (n = 6). The Factor XIIIa+ dermal perivascular dendritic cell subset (24.9 +/- 1.5% of proliferating dermal cells, n = 6) and Factor VIII+ endothelial cells represented the two other major proliferating populations in lesional psoriatic dermis. Differentiated tissue macrophages, identified by phase microscopy as melanophages or by immunostaining with antibodies to Leu M1 (CD15) or myeloid histiocyte antigen, comprised less than 5% of the proliferating population in either skin type. In addition to calculating the relative proportions of these cells to each other as percent, we also determined the density of cells, in cells/mm2 of tissue. The density of proliferating cells within these populations was increased in involved versus uninvolved skin: UCHL1+, 9.0 +/- 1.7 cells/mm2 versus 1.8 +/- 0.6 cells/mm2, p less than 0.01; Factor XIIIa+, 6.0 +/- 0.7 cells/mm2 versus 1.5 +/- 0.5 cells/mm2, p less than 0.01; Factor VIII+, 5.5 +/- 1.4 cells/mm2 versus 0.0 cells/mm2, p less than 0.05

Optical transfection using an endoscope-like system.

Science.gov (United States)

Ma, Nan; Gunn-Moore, Frank; Dholakia, Kishan

2011-02-01

Optical transfection is a powerful method for targeted delivery of therapeutic agents to biological cells. A tightly focused pulsed laser beam may transiently change the permeability of a cell membrane to facilitate the delivery of foreign genetic material into cells. We report the first realization of an endoscope-like integrated system for optical transfection. An imaging fiber (coherent optical fiber bundle) with ∼ 6000 cores (pixels) embedded in a fiber cladding of ∼ 300 μm in diameter, produces an image circle (area) of ∼ 270 μm diam. This imaging fiber, with an ordered axicon lens array chemically etched at its exit face, is used for the delivery of a femtosecond laser to the cell membrane for optical transfection along with subcellular resolution imaging. A microcapillary-based microfluidic system for localized drug delivery was also combined in this miniature, flexible system. Using this novel system, a plasmid transfection efficiency up to ∼ 72% was obtained for CHO-K1 cells. This endoscope-like system opens a range of exciting applications, in particular, in the targeted in vivo optical microsurgery area.

Pathological significance and prognostic roles of densities of CD57+ cells, CD68+ cells, and mast cells, and their ratios in clear cell renal cell carcinoma.

Science.gov (United States)

Nakanishi, Hiromi; Miyata, Yasuyoshi; Mochizuki, Yasushi; Yasuda, Takuji; Nakamura, Yuichiro; Araki, Kyohei; Sagara, Yuji; Matsuo, Tomohiro; Ohba, Kojiro; Sakai, Hideki

2018-05-19

The immune system is closely associated with malignant behavior in renal cell carcinoma (RCC). Therefore, understanding the pathological roles of immune cells in tumor stroma is essential to discuss the pathological characteristics of RCC. In this study, the clinical significance of densities of CD57+ cells, CD68+ cells, and mast cells, and their ratios were investigated in patients with clear cell RCC. The densities of CD57+, CD68+, and mast cells were evaluated by immunohistochemical techniques in 179 patients. Proliferation index (PI), apoptotic index (AI), and microvessel density (MVD) were evaluated by using anti-Ki-67, anti-cleaved caspase-3, and anti-CD31 antibodies, respectively. The density of CD57+ cell was negatively correlated with grade, pT stage, and metastasis, although densities of CD68+ cell and mast cell were positively correlated. Ratios of CD68+ cell/CD57+ cell and mast cell/CD57+ cell were significantly correlated with grade, pT stage, and metastasis. Survival analyses showed that the CD68+ cell/CD57+ cell ratio was a significant predictor for cause-specific survival by multi-variate analyses (hazard ratio=1.41, 95% confidential interval=1.03-1.93, P=.031), and was significantly correlated with PI, AI, and MVD (r=.47; P <. 001, r=-.31, P<.001, and r=.40, P<.001, respectively). In conclusion, CD57+ cell, CD68+ cell, and mast cell played important roles in malignancy in clear cell RCC. The CD68+ cell/CD57+ cell ratio was strongly correlated with pathological features and prognosis in these patients because this ratio reflected the status of cancer cell proliferation, apoptosis, and angiogenesis. Copyright © 2018. Published by Elsevier Inc.

Comparison of Chemical Composition and Energy Property of Torrefied Switchgrass and Corn Stover

Energy Technology Data Exchange (ETDEWEB)

Tumuluru, Jaya Shankar, E-mail: jayashankar.tumuluru@inl.gov [Idaho National Laboratory, Idaho Falls, ID (United States)

2015-11-30

In the present study, 6-mm ground corn stover and switchgrass were torrefied in temperatures ranging from 180 to 270°C for 15- to 120-min residence time. Thermogravimetric analyzer was used to do the torrefaction studies. At a torrefaction temperature of 270°C and a 30-min residence time, the weight loss increased to >45%. At 180°C and 120 min, there was about 56 and 73% of moisture loss in the corn stover and switchgrass; further increasing the temperature to 270°C and 120 min resulted in about 78.8–88.18% moisture loss in both the feedstock. Additionally, at these temperatures, there was a significant decrease in the volatile content and increase in the fixed carbon content, and the ash content for both the biomasses tested. The ultimate composition like carbon content increased and hydrogen content decreased with increase in the torrefaction temperature and time. At 270°C and 120-min residence time, the carbon content observed was 56.63 and 58.04% and hydrogen content observed was 2.74 and 3.14%. Nitrogen and sulfur content measured at 270°C and 120 min were 0.98, 0.8, 0.076, and 0.07% for both the corn stover and switchgrass. The hydrogen/carbon and oxygen/carbon ratios calculated decreased to the lowest values of 0.59 and 0.64, and 0.71 and 0.76 for both biomasses. The van Krevelen diagram drawn for corn stover and switchgrass torrefied at 270°C indicated that H/C and O/C values are closer to coals like Illinois Basis and Powder River Basin. In the present study, the maximum higher heating value that was observed by corn stover and switchgrass was 21.51 and 21.53 MJ/kg at 270°C and a 120-min residence time. From these results, it can be concluded that corn stover and switchgrass, after torrefaction, shows consistent proximate, ultimate, and energy properties.

Comparison of Chemical Composition and Energy Property of Torrefied Switchgrass and Corn Stover

International Nuclear Information System (INIS)

Tumuluru, Jaya Shankar

2015-01-01

In the present study, 6-mm ground corn stover and switchgrass were torrefied in temperatures ranging from 180 to 270°C for 15- to 120-min residence time. Thermogravimetric analyzer was used to do the torrefaction studies. At a torrefaction temperature of 270°C and a 30-min residence time, the weight loss increased to >45%. At 180°C and 120 min, there was about 56 and 73% of moisture loss in the corn stover and switchgrass; further increasing the temperature to 270°C and 120 min resulted in about 78.8–88.18% moisture loss in both the feedstock. Additionally, at these temperatures, there was a significant decrease in the volatile content and increase in the fixed carbon content, and the ash content for both the biomasses tested. The ultimate composition like carbon content increased and hydrogen content decreased with increase in the torrefaction temperature and time. At 270°C and 120-min residence time, the carbon content observed was 56.63 and 58.04% and hydrogen content observed was 2.74 and 3.14%. Nitrogen and sulfur content measured at 270°C and 120 min were 0.98, 0.8, 0.076, and 0.07% for both the corn stover and switchgrass. The hydrogen/carbon and oxygen/carbon ratios calculated decreased to the lowest values of 0.59 and 0.64, and 0.71 and 0.76 for both biomasses. The van Krevelen diagram drawn for corn stover and switchgrass torrefied at 270°C indicated that H/C and O/C values are closer to coals like Illinois Basis and Powder River Basin. In the present study, the maximum higher heating value that was observed by corn stover and switchgrass was 21.51 and 21.53 MJ/kg at 270°C and a 120-min residence time. From these results, it can be concluded that corn stover and switchgrass, after torrefaction, shows consistent proximate, ultimate, and energy properties.

Cell-extracellular matrix and cell-cell adhesion are linked by syndecan-4

DEFF Research Database (Denmark)

Pakideeri Karat, Sandeep Gopal; Multhaupt, Hinke A B; Pocock, Roger

2017-01-01

Cell-extracellular matrix (ECM) and cell-cell junctions that employ microfilaments are sites of tension. They are important for tissue repair, morphogenetic movements and can be emblematic of matrix contraction in fibrotic disease and the stroma of solid tumors. One cell surface receptor, syndecan...... calcium. While it is known that cell-ECM and cell-cell junctions may be linked, possible roles for syndecans in this process are not understood. Here we show that wild type primary fibroblasts and those lacking syndecan-4 utilize different cadherins in their adherens junctions and that tension is a major...... factor in this differential response. This corresponds to the reduced ability of fibroblasts lacking syndecan-4 to exert tension on the ECM and we now show that this may extend to reduced tension in cell-cell adhesion....

MARCKS-related protein regulates cytoskeletal organization at cell-cell and cell-substrate contacts in epithelial cells.

Science.gov (United States)

Van Itallie, Christina M; Tietgens, Amber Jean; Aponte, Angel; Gucek, Marjan; Cartagena-Rivera, Alexander X; Chadwick, Richard S; Anderson, James M

2018-02-02

Treatment of epithelial cells with interferon-γ and TNF-α (IFN/TNF) results in increased paracellular permeability. To identify relevant proteins mediating barrier disruption, we performed proximity-dependent biotinylation (BioID) of occludin and found that tagging of MARCKS-related protein (MRP; also known as MARCKSL1) increased ∼20-fold following IFN/TNF administration. GFP-MRP was focused at the lateral cell membrane and its overexpression potentiated the physiological response of the tight junction barrier to cytokines. However, deletion of MRP did not abrogate the cytokine responses, suggesting that MRP is not required in the occludin-dependent IFN/TNF response. Instead, our results reveal a key role for MRP in epithelial cells in control of multiple actin-based structures, likely by regulation of integrin signaling. Changes in focal adhesion organization and basal actin stress fibers in MRP-knockout (KO) cells were reminiscent of those seen in FAK-KO cells. In addition, we found alterations in cell-cell interactions in MRP-KO cells associated with increased junctional tension, suggesting that MRP may play a role in focal adhesion-adherens junction cross talk. Together, our results are consistent with a key role for MRP in cytoskeletal organization of cell contacts in epithelial cells. © 2018. Published by The Company of Biologists Ltd.

Stem cells engineering for cell-based therapy.

Science.gov (United States)

Taupin, Philippe

2007-09-01

Stem cells carry the promise to cure a broad range of diseases and injuries, from diabetes, heart and muscular diseases, to neurological diseases, disorders and injuries. Significant progresses have been made in stem cell research over the past decade; the derivation of embryonic stem cells (ESCs) from human tissues, the development of cloning technology by somatic cell nuclear transfer (SCNT) and the confirmation that neurogenesis occurs in the adult mammalian brain and that neural stem cells (NSCs) reside in the adult central nervous system (CNS), including that of humans. Despite these advances, there may be decades before stem cell research will translate into therapy. Stem cell research is also subject to ethical and political debates, controversies and legislation, which slow its progress. Cell engineering has proven successful in bringing genetic research to therapy. In this review, I will review, in two examples, how investigators are applying cell engineering to stem cell biology to circumvent stem cells' ethical and political constraints and bolster stem cell research and therapy.

Dissecting engineered cell types and enhancing cell fate conversion via CellNet

Science.gov (United States)

Morris, Samantha A.; Cahan, Patrick; Li, Hu; Zhao, Anna M.; San Roman, Adrianna K.; Shivdasani, Ramesh A.; Collins, James J.; Daley, George Q.

2014-01-01

SUMMARY Engineering clinically relevant cells in vitro holds promise for regenerative medicine, but most protocols fail to faithfully recapitulate target cell properties. To address this, we developed CellNet, a network biology platform that determines whether engineered cells are equivalent to their target tissues, diagnoses aberrant gene regulatory networks, and prioritizes candidate transcriptional regulators to enhance engineered conversions. Using CellNet, we improved B cell to macrophage conversion, transcriptionally and functionally, by knocking down predicted B cell regulators. Analyzing conversion of fibroblasts to induced hepatocytes (iHeps), CellNet revealed an unexpected intestinal program regulated by the master regulator Cdx2. We observed long-term functional engraftment of mouse colon by iHeps, thereby establishing their broader potential as endoderm progenitors and demonstrating direct conversion of fibroblasts into intestinal epithelium. Our studies illustrate how CellNet can be employed to improve direct conversion and to uncover unappreciated properties of engineered cells. PMID:25126792

cgCorrect: a method to correct for confounding cell-cell variation due to cell growth in single-cell transcriptomics

Science.gov (United States)

Blasi, Thomas; Buettner, Florian; Strasser, Michael K.; Marr, Carsten; Theis, Fabian J.

2017-06-01

Accessing gene expression at a single-cell level has unraveled often large heterogeneity among seemingly homogeneous cells, which remains obscured when using traditional population-based approaches. The computational analysis of single-cell transcriptomics data, however, still imposes unresolved challenges with respect to normalization, visualization and modeling the data. One such issue is differences in cell size, which introduce additional variability into the data and for which appropriate normalization techniques are needed. Otherwise, these differences in cell size may obscure genuine heterogeneities among cell populations and lead to overdispersed steady-state distributions of mRNA transcript numbers. We present cgCorrect, a statistical framework to correct for differences in cell size that are due to cell growth in single-cell transcriptomics data. We derive the probability for the cell-growth-corrected mRNA transcript number given the measured, cell size-dependent mRNA transcript number, based on the assumption that the average number of transcripts in a cell increases proportionally to the cell’s volume during the cell cycle. cgCorrect can be used for both data normalization and to analyze the steady-state distributions used to infer the gene expression mechanism. We demonstrate its applicability on both simulated data and single-cell quantitative real-time polymerase chain reaction (PCR) data from mouse blood stem and progenitor cells (and to quantitative single-cell RNA-sequencing data obtained from mouse embryonic stem cells). We show that correcting for differences in cell size affects the interpretation of the data obtained by typically performed computational analysis.

Single cell time-lapse analysis reveals that podoplanin enhances cell survival and colony formation capacity of squamous cell carcinoma cells.

Science.gov (United States)

Miyashita, Tomoyuki; Higuchi, Youichi; Kojima, Motohiro; Ochiai, Atsushi; Ishii, Genichiro

2017-01-06

Tumor initiating cells (TICs) are characterized by high clonal expansion capacity. We previously reported that podoplanin is a TIC-specific marker for the human squamous cell carcinoma cell line A431. The aim of this study is to explore the molecular mechanism underlying the high clonal expansion potential of podoplanin-positive A431cells using Fucci imaging. Single podoplanin-positive cells created large colonies at a significantly higher frequency than single podoplanin-negative cells, whereas no difference was observed between the two types of cells with respect to cell cycle status. Conversely, the cell death ratio of progenies derived from podoplanin-positive single cell was significantly lower than that of cells derived from podoplanin-negative cells. Single A431 cells, whose podoplanin expression was suppressed by RNA interference, exhibited increased cell death ratios and decreased frequency of large colony forming. Moreover, the frequency of large colony forming decreased significantly when podoplanin-positive single cells was treated with a ROCK (Rho-associated coiled-coil kinase) inhibitor, whereas no difference was observed in single podoplanin-negative cells. Our current study cleared that high clonal expansion capacity of podoplanin-positive TICs populations was the result of reduced cell death by podoplanin-mediated signaling. Therefore, podoplanin activity may be a therapeutic target in the treatment of squamous cell carcinomas.

Modeling cell-in-cell structure into its biological significance

OpenAIRE

He, M-f; Wang, S; Wang, Y; Wang, X-n

2013-01-01

Although cell-in-cell structure was noted 100 years ago, the molecular mechanisms of ?entering' and the destination of cell-in-cell remain largely unclear. It takes place among the same type of cells (homotypic cell-in-cell) or different types of cells (heterotypic cell-in-cell). Cell-in-cell formation affects both effector cells and their host cells in multiple aspects, while cell-in-cell death is under more intensive investigation. Given that cell-in-cell has an important role in maintainin...

GCK-MODY diabetes associated with protein misfolding, cellular self-association and degradation.

Science.gov (United States)

Negahdar, Maria; Aukrust, Ingvild; Johansson, Bente B; Molnes, Janne; Molven, Anders; Matschinsky, Franz M; Søvik, Oddmund; Kulkarni, Rohit N; Flatmark, Torgeir; Njølstad, Pål Rasmus; Bjørkhaug, Lise

2012-11-01

GCK-MODY, dominantly inherited mild fasting hyperglycemia, has been associated with >600 different mutations in the glucokinase (GK)-encoding gene (GCK). When expressed as recombinant pancreatic proteins, some mutations result in enzymes with normal/near-normal catalytic properties. The molecular mechanism(s) of GCK-MODY due to these mutations has remained elusive. Here, we aimed to explore the molecular mechanisms for two such catalytically 'normal' GCK mutations (S263P and G264S) in the F260-L270 loop of GK. When stably overexpressed in HEK293 cells and MIN6 β-cells, the S263P- and G264S-encoded mutations generated misfolded proteins with an increased rate of degradation (S263P>G264S) by the protein quality control machinery, and a propensity to self-associate (G264S>S263P) and form dimers (SDS resistant) and aggregates (partly Triton X-100 insoluble), as determined by pulse-chase experiments and subcellular fractionation. Thus, the GCK-MODY mutations S263P and G264S lead to protein misfolding causing destabilization, cellular dimerization/aggregation and enhanced rate of degradation. In silico predicted conformational changes of the F260-L270 loop structure are considered to mediate the dimerization of both mutant proteins by a domain swapping mechanism. Thus, similar properties may represent the molecular mechanisms for additional unexplained GCK-MODY mutations, and may also contribute to the disease mechanism in other previously characterized GCK-MODY inactivating mutations. Copyright © 2012 Elsevier B.V. All rights reserved.

Cell volume change through water efflux impacts cell stiffness and stem cell fate

NARCIS (Netherlands)

Guo, Ming; Pegoraro, Adrian F.; Mao, Angelo; Zhou, Enhua H.; Arany, Praveen R.; Han, Yulong; Burnette, Dylan T.; Jensen, Mikkel H.; Kasza, Karen E.; Moore, Jeffrey R.; Mackintosh, Frederick C.; Fredberg, Jeffrey J.; Mooney, David J.; Lippincott-Schwartz, Jennifer; Weitz, David A.

2017-01-01

Cells alter their mechanical properties in response to their local microenvironment; this plays a role in determining cell function and can even influence stem cell fate. Here, we identify a robust and unified relationship between cell stiffness and cell volume. As a cell spreads on a substrate, its

Retinal stem cells and potential cell transplantation treatments

Directory of Open Access Journals (Sweden)

Tai-Chi Lin

2014-11-01

Full Text Available The retina, histologically composed of ten delicate layers, is responsible for light perception and relaying electrochemical signals to the secondary neurons and visual cortex. Retinal disease is one of the leading clinical causes of severe vision loss, including age-related macular degeneration, Stargardt's disease, and retinitis pigmentosa. As a result of the discovery of various somatic stem cells, advances in exploring the identities of embryonic stem cells, and the development of induced pluripotent stem cells, cell transplantation treatment for retinal diseases is currently attracting much attention. The sources of stem cells for retinal regeneration include endogenous retinal stem cells (e.g., neuronal stem cells, Müller cells, and retinal stem cells from the ciliary marginal zone and exogenous stem cells (e.g., bone mesenchymal stem cells, adipose-derived stem cells, embryonic stem cells, and induced pluripotent stem cells. The success of cell transplantation treatment depends mainly on the cell source, the timing of cell harvesting, the protocol of cell induction/transplantation, and the microenvironment of the recipient's retina. This review summarizes the different sources of stem cells for regeneration treatment in retinal diseases and surveys the more recent achievements in animal studies and clinical trials. Future directions and challenges in stem cell transplantation are also discussed.

Hybrid cell adhesive material for instant dielectrophoretic cell trapping and long-term cell function assessment.

Science.gov (United States)

Reyes, Darwin R; Hong, Jennifer S; Elliott, John T; Gaitan, Michael

2011-08-16

Dielectrophoresis (DEP) for cell manipulation has focused, for the most part, on approaches for separation/enrichment of cells of interest. Advancements in cell positioning and immobilization onto substrates for cell culture, either as single cells or as cell aggregates, has benefited from the intensified research efforts in DEP (electrokinetic) manipulation. However, there has yet to be a DEP approach that provides the conditions for cell manipulation while promoting cell function processes such as cell differentiation. Here we present the first demonstration of a system that combines DEP with a hybrid cell adhesive material (hCAM) to allow for cell entrapment and cell function, as demonstrated by cell differentiation into neuronlike cells (NLCs). The hCAM, comprised of polyelectrolytes and fibronectin, was engineered to function as an instantaneous cell adhesive surface after DEP manipulation and to support long-term cell function (cell proliferation, induction, and differentiation). Pluripotent P19 mouse embryonal carcinoma cells flowing within a microchannel were attracted to the DEP electrode surface and remained adhered onto the hCAM coating under a fluid flow field after the DEP forces were removed. Cells remained viable after DEP manipulation for up to 8 d, during which time the P19 cells were induced to differentiate into NLCs. This approach could have further applications in areas such as cell-cell communication, three-dimensional cell aggregates to create cell microenvironments, and cell cocultures.

Cell cycle regulation in human embryonic stem cells: links to adaptation to cell culture.

Science.gov (United States)

Barta, Tomas; Dolezalova, Dasa; Holubcova, Zuzana; Hampl, Ales

2013-03-01

Cell cycle represents not only a tightly orchestrated mechanism of cell replication and cell division but it also plays an important role in regulation of cell fate decision. Particularly in the context of pluripotent stem cells or multipotent progenitor cells, regulation of cell fate decision is of paramount importance. It has been shown that human embryonic stem cells (hESCs) show unique cell cycle characteristics, such as short doubling time due to abbreviated G1 phase; these properties change with the onset of differentiation. This review summarizes the current understanding of cell cycle regulation in hESCs. We discuss cell cycle properties as well as regulatory machinery governing cell cycle progression of undifferentiated hESCs. Additionally, we provide evidence that long-term culture of hESCs is accompanied by changes in cell cycle properties as well as configuration of several cell cycle regulatory molecules.

Cell patterning without chemical surface modification: Cell cell interactions between printed bovine aortic endothelial cells (BAEC) on a homogeneous cell-adherent hydrogel

Science.gov (United States)

Chen, C. Y.; Barron, J. A.; Ringeisen, B. R.

2006-10-01

Cell printing offers the unique ability to directly deposit one or multiple cell types directly onto a surface without the need to chemically pre-treat the surface with lithographic methods. We utilize biological laser printing (BioLP ™) to form patterns of bovine aortic endothelial cells (BAECs) onto a homogeneous cell adherent hydrogel surface. These normal cells are shown to retain near-100% viability post-printing. In order to determine whether BAECs encountered shear and/or heat stress during printing, immunocytochemical staining experiments were performed to detect potential expression of heat shock proteins (HSP) by the deposited cells. Printed BAECs expressed HSP at levels similar to negative control cells, indicating that the BioLP process does not expose cells to damaging levels of stress. However, HSP expression was slightly higher at the highest laser energy studied, suggesting more stress was present under these extreme conditions. Printed BAECs also showed preferential asymmetric growth and migration towards each other and away from the originally printed pattern, demonstrating a retained ability for the cells to communicate post-printing.

Llgl1 Connects Cell Polarity with Cell-Cell Adhesion in Embryonic Neural Stem Cells.

Science.gov (United States)

Jossin, Yves; Lee, Minhui; Klezovitch, Olga; Kon, Elif; Cossard, Alexia; Lien, Wen-Hui; Fernandez, Tania E; Cooper, Jonathan A; Vasioukhin, Valera

2017-06-05

Malformations of the cerebral cortex (MCCs) are devastating developmental disorders. We report here that mice with embryonic neural stem-cell-specific deletion of Llgl1 (Nestin-Cre/Llgl1 fl/fl ), a mammalian ortholog of the Drosophila cell polarity gene lgl, exhibit MCCs resembling severe periventricular heterotopia (PH). Immunohistochemical analyses and live cortical imaging of PH formation revealed that disruption of apical junctional complexes (AJCs) was responsible for PH in Nestin-Cre/Llgl1 fl/fl brains. While it is well known that cell polarity proteins govern the formation of AJCs, the exact mechanisms remain unclear. We show that LLGL1 directly binds to and promotes internalization of N-cadherin, and N-cadherin/LLGL1 interaction is inhibited by atypical protein kinase C-mediated phosphorylation of LLGL1, restricting the accumulation of AJCs to the basolateral-apical boundary. Disruption of the N-cadherin-LLGL1 interaction during cortical development in vivo is sufficient for PH. These findings reveal a mechanism responsible for the physical and functional connection between cell polarity and cell-cell adhesion machineries in mammalian cells. Copyright © 2017 Elsevier Inc. All rights reserved.

Snail modulates cell metabolism in MDCK cells

Energy Technology Data Exchange (ETDEWEB)

Haraguchi, Misako, E-mail: haraguci@m3.kufm.kagoshima-u.ac.jp [Department of Biochemistry and Molecular Biology, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan); Indo, Hiroko P. [Department of Maxillofacial Radiology, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan); Iwasaki, Yasumasa [Health Care Center, Kochi University, Kochi 780-8520 (Japan); Iwashita, Yoichiro [Department of Maxillofacial Radiology, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan); Fukushige, Tomoko [Department of Dermatology, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan); Majima, Hideyuki J. [Department of Maxillofacial Radiology, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan); Izumo, Kimiko; Horiuchi, Masahisa [Department of Environmental Medicine, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan); Kanekura, Takuro [Department of Dermatology, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan); Furukawa, Tatsuhiko [Department of Molecular Oncology, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan); Ozawa, Masayuki [Department of Biochemistry and Molecular Biology, Graduate School of Medical and Dental Sciences, Kagoshima University, Kagoshima 890-8544 (Japan)

2013-03-22

Highlights: ► MDCK/snail cells were more sensitive to glucose deprivation than MDCK/neo cells. ► MDCK/snail cells had decreased oxidative phosphorylation, O{sub 2} consumption and ATP content. ► TCA cycle enzyme activity, but not expression, was lower in MDCK/snail cells. ► MDCK/snail cells showed reduced PDH activity and increased PDK1 expression. ► MDCK/snail cells showed reduced expression of GLS2 and ACLY. -- Abstract: Snail, a repressor of E-cadherin gene transcription, induces epithelial-to-mesenchymal transition and is involved in tumor progression. Snail also mediates resistance to cell death induced by serum depletion. By contrast, we observed that snail-expressing MDCK (MDCK/snail) cells undergo cell death at a higher rate than control (MDCK/neo) cells in low-glucose medium. Therefore, we investigated whether snail expression influences cell metabolism in MDCK cells. Although gylcolysis was not affected in MDCK/snail cells, they did exhibit reduced pyruvate dehydrogenase (PDH) activity, which controls pyruvate entry into the tricarboxylic acid (TCA) cycle. Indeed, the activity of multiple enzymes involved in the TCA cycle was decreased in MDCK/snail cells, including that of mitochondrial NADP{sup +}-dependent isocitrate dehydrogenase (IDH2), succinate dehydrogenase (SDH), and electron transport Complex II and Complex IV. Consequently, lower ATP content, lower oxygen consumption and increased survival under hypoxic conditions was also observed in MDCK/snail cells compared to MDCK/neo cells. In addition, the expression and promoter activity of pyruvate dehydrogenase kinase 1 (PDK1), which phosphorylates and inhibits the activity of PDH, was increased in MDCK/snail cells, while expression levels of glutaminase 2 (GLS2) and ATP-citrate lyase (ACLY), which are involved in glutaminolysis and fatty acid synthesis, were decreased in MDCK/snail cells. These results suggest that snail modulates cell metabolism by altering the expression and activity of

nduced pluripotent stem cells and cell therapy

Directory of Open Access Journals (Sweden)

Banu İskender

2013-12-01

Full Text Available Human embryonic stem cells are derived from the inner cell mass of a blastocyst-stage embryo. They hold a huge promise for cell therapy with their self-renewing ability and pluripotency, which is known as the potential to differentiate into all cell types originating from three embryonic germ layers. However, their unique pluripotent feature could not be utilised for therapeutic purposes due to the ethical and legal problems during derivation. Recently, it was shown that the cells from adult tissues could be reverted into embryonic state, thereby restoring their pluripotent feature. This has strenghtened the possiblity of directed differentition of the reprogrammed somatic cells into the desired cell types in vitro and their use in regenerative medicine. Although these cells were termed as induced pluripotent cells, the mechanism of pluripotency has yet to be understood. Still, induced pluripotent stem cell technology is considered to be significant by proposing novel approaches in disease modelling, drug screening and cell therapy. Besides their self-renewing ability and their potential to differentiate into all cell types in a human body, they arouse a great interest in scientific world by being far from the ethical concerns regarding their embryonic counterparts and their unique feature of being patient-specific in prospective cell therapies. In this review, induced pluripotent stem cell technology and its role in cell-based therapies from past to present will be discussed. J Clin Exp Invest 2013; 4 (4: 550-561

Surface effects during exoelectron-emission of BeO ceramics

International Nuclear Information System (INIS)

Siegel, V.; Kirchner, H.H.

1979-01-01

Studying the behaviour of the two thermally stimulated exoelectron emission (TSEE) maxima of BeO ceramics at about 270 0 C und 325 0 C it can be shown that the TSEE maximum at 270 0 C is closely connected with adsorption and desorption processes occuring on the surface of the samples. In particular, this TSEE maximum is strongly influenced as well by donor-like behaviour of adsorbed hydrogen and lithium as by acceptor-like behaviour of alcohols and nitrides of the lithium. The detailed surface processes leading to the apperance or disapperance of the TSEE maximum at 270 0 C are discussed. (orig.) [de

Cell-mediated mutagenesis and cell transformation of mammalian cells by chemical carcinogens

International Nuclear Information System (INIS)

Huberman, E.; Langenbach, R.

1977-01-01

We have developed a cell-mediated mutagenesis assay in which cells with the appropriate markers for mutagenesis are co-cultivated with either lethally irradiated rodent embryonic cells that can metabolize carcinogenic hydrocarbons or with primary rat liver cells that can metabolize chemicals carcinogenic to the liver. During co-cultivation, the reactive metabolites of the procarcinogen appear to be transmitted to the mutable cells and induce mutations in them. Assays of this type make it possible to demonstrate a relationship between carcinogenic potency of the chemicals and their ability to induce mutations in mammalian cells. In addition, by simultaneously comparing the frequencies of transformation and mutation induced in normal diploid hamster cells by benzo(a)pyrene (BP) and one of its metabolites, it is possible to estimate the genetic target size for cell transformation in vitro

Research, development, and demonstration of nickel-iron batteries for electric vehicle propulsion. Annual report, 1980

Energy Technology Data Exchange (ETDEWEB)

1981-03-01

The objective of the Eagle-Picher nickel-iron battery program is to develop a nickel-iron battery for use in the propulsion of electric and electric-hybrid vehicles. To date, the program has concentrated on the characterization, fabrication and testing of the required electrodes, the fabrication and testing of full-scale cells, and finally, the fabrication and testing of full-scale (270 AH) six (6) volt modules. Electrodes of the final configuration have now exceeded 1880 cycles and are showing minimal capacity decline. Full-scale cells have presently exceeded 600 cycles and are tracking the individual electrode tests almost identically. Six volt module tests have exceeded 500 cycles, with a specific energy of 48 Wh/kg. Results to date indicate the nickel-iron battery is beginning to demonstrate the performance required for electric vehicle propulsion.

Gastric stem cells and gastric cancer stem cells

OpenAIRE

Han, Myoung-Eun; Oh, Sae-Ock

2013-01-01

The gastric epithelium is continuously regenerated by gastric stem cells, which give rise to various kinds of daughter cells, including parietal cells, chief cells, surface mucous cells, mucous neck cells, and enteroendocrine cells. The self-renewal and differentiation of gastric stem cells need delicate regulation to maintain the normal physiology of the stomach. Recently, it was hypothesized that cancer stem cells drive the cancer growth and metastasis. In contrast to conventional clonal ev...

Hybrid clone cells derived from human breast epithelial cells and human breast cancer cells exhibit properties of cancer stem/initiating cells.

Science.gov (United States)

Gauck, Daria; Keil, Silvia; Niggemann, Bernd; Zänker, Kurt S; Dittmar, Thomas

2017-08-02

The biological phenomenon of cell fusion has been associated with cancer progression since it was determined that normal cell × tumor cell fusion-derived hybrid cells could exhibit novel properties, such as enhanced metastatogenic capacity or increased drug resistance, and even as a mechanism that could give rise to cancer stem/initiating cells (CS/ICs). CS/ICs have been proposed as cancer cells that exhibit stem cell properties, including the ability to (re)initiate tumor growth. Five M13HS hybrid clone cells, which originated from spontaneous cell fusion events between M13SV1-EGFP-Neo human breast epithelial cells and HS578T-Hyg human breast cancer cells, and their parental cells were analyzed for expression of stemness and EMT-related marker proteins by Western blot analysis and confocal laser scanning microscopy. The frequency of ALDH1-positive cells was determined by flow cytometry using AldeRed fluorescent dye. Concurrently, the cells' colony forming capabilities as well as the cells' abilities to form mammospheres were investigated. The migratory activity of the cells was analyzed using a 3D collagen matrix migration assay. M13HS hybrid clone cells co-expressed SOX9, SLUG, CK8 and CK14, which were differently expressed in parental cells. A variation in the ALDH1-positive putative stem cell population was observed among the five hybrids ranging from 1.44% (M13HS-7) to 13.68% (M13HS-2). In comparison to the parental cells, all five hybrid clone cells possessed increased but also unique colony formation and mammosphere formation capabilities. M13HS-4 hybrid clone cells exhibited the highest colony formation capacity and second highest mammosphere formation capacity of all hybrids, whereby the mean diameter of the mammospheres was comparable to the parental cells. In contrast, the largest mammospheres originated from the M13HS-2 hybrid clone cells, whereas these cells' mammosphere formation capacity was comparable to the parental breast cancer cells. All M13HS

PINCH1 regulates cell-matrix and cell-cell adhesions, cell polarity and cell survival during the peri-implantation stage

DEFF Research Database (Denmark)

Li, Shaohua; Bordoy, Randi; Stanchi, Fabio

2005-01-01

PINCH1 is composed of 5 LIM domains, binds integrin-linked kinase (ILK) and locates to integrin-mediated adhesion sites. In order to investigate PINCH1 function we generated mice and embryonic stem (ES) cell-derived embryoid bodies (EBs) lacking the PINCH1 gene. Similar to mice lacking beta1...... integrin or Ilk, loss of PINCH1 arrested development at the peri-implantation stage. In contrast to beta1 integrin or Ilk mutants, however, disruption of the PINCH1 gene produced implantation chambers with visible cell clumps even at embryonic day 9.5. In order to define the phenotype leading to the peri...... not observed in beta1 integrin- or ILK-deficient mice or EBs, included abnormal cell-cell adhesion of endoderm and epiblast as well as the presence of apoptotic cells in the endodermal cell layer. Although ILK and PINCH1 were shown to be involved in the phosphorylation of serine-473 of PKB/Akt, immunostaining...

Magnetic Order and Crystal Field Excitations in Er2Ru2O7: A Neutron Scattering Study

International Nuclear Information System (INIS)

Ehlers, Georg; Gardner, Jason

2009-01-01

The magnetic pyrochlore Er 2 Ru 2 O 7 has been studied with neutron scattering and susceptibility measurements down to a base temperature of 270 mK. For the low temperature phase in which the Er sublattice orders, new magnetic Bragg peaks are reported which can be indexed with integer (hkl) for a face centered cubic cell. Inelastic measurements reveal a wealth of crystal field levels of the Er ion and a copious amount of magnetic scattering below 15 meV. The three lowest groups of crystal field levels are at 6.7, 9.1 and 18.5 meV.

In vitro differentiation of primordial germ cells and oocyte-like cells from stem cells.

Science.gov (United States)

Costa, José J N; Souza, Glaucinete B; Soares, Maria A A; Ribeiro, Regislane P; van den Hurk, Robert; Silva, José R V

2018-02-01

Infertility is the result of failure due to an organic disorder of the reproductive organs, especially their gametes. Recently, much progress has been made on generating germ cells, including oocytes, from various types of stem cells. This review focuses on advances in female germ cell differentiation from different kinds of stem cells, with emphasis on embryonic stem cells, adult stem cells, and induced pluripotent stem cells. The advantages and disadvantages of the derivation of female germ cells from several types of stem cells are also highlighted, as well as the ability of stem cells to generate mature and functional female gametes. This review shows that stem cell therapies have opened new frontiers in medicine, especially in the reproductive area, with the possibility of regenerating fertility.

Cell cycle control by components of cell anchorage

OpenAIRE

Gad, Annica

2005-01-01

Extracellular factors, such as growth factors and cell anchorage to the extracellular matrix, control when and where cells may proliferate. This control is abolished when a normal cell transforms into a tumour cell. The control of cell proliferation by cell anchorage was elusive and less well studied than the control by growth factors. Therefore, we aimed to clarify at what points in the cell cycle and through which molecular mechanisms cell anchorage controls cell cycle pro...

Casticin impairs cell growth and induces cell apoptosis via cell cycle arrest in human oral cancer SCC-4 cells.

Science.gov (United States)

Chou, Guan-Ling; Peng, Shu-Fen; Liao, Ching-Lung; Ho, Heng-Chien; Lu, Kung-Wen; Lien, Jin-Cherng; Fan, Ming-Jen; La, Kuang-Chi; Chung, Jing-Gung

2018-02-01

Casticin, a polymethoxyflavone, present in natural plants, has been shown to have biological activities including anti-cancer activities. Herein, we investigated the anti-oral cancer activity of casticin on SCC-4 cells in vitro. Viable cells, cell cycle distribution, apoptotic cell death, reactive oxygen species (ROS) production, and Ca 2+ production, levels of ΔΨ m and caspase activity were measured by flow cytometric assay. Cell apoptosis associated protein expressions were examined by Western blotting and confocal laser microscopy. Results indicated that casticin induced cell morphological changes, DNA condensation and damage, decreased the total viable cells, induced G 2 /M phase arrest in SCC-4 cells. Casticin promoted ROS and Ca 2+ productions, decreases the levels of ΔΨ m , promoted caspase-3, -8, and -9 activities in SCC-4 cells. Western blotting assay demonstrated that casticin affect protein level associated with G2/M phase arrest and apoptosis. Confocal laser microscopy also confirmed that casticin increased the translocation of AIF and cytochrome c in SCC-4 cells. In conclusion, casticin decreased cell number through G 2 /M phase arrest and the induction of cell apoptosis through caspase- and mitochondria-dependent pathways in SCC-4 cells. © 2017 Wiley Periodicals, Inc.

Skin Stem Cells in Skin Cell Therapy

Directory of Open Access Journals (Sweden)

Mollapour Sisakht

2015-12-01

Full Text Available Context Preclinical and clinical research has shown that stem cell therapy is a promising therapeutic option for many diseases. This article describes skin stem cells sources and their therapeutic applications. Evidence Acquisition Compared with conventional methods, cell therapy reduces the surgical burden for patients because it is simple and less time-consuming. Skin cell therapy has been developed for variety of diseases. By isolation of the skin stem cell from the niche, in vitro expansion and transplantation of cells offers a surprising healing capacity profile. Results Stem cells located in skin cells have shown interesting properties such as plasticity, transdifferentiation, and specificity. Mesenchymal cells of the dermis, hypodermis, and other sources are currently being investigated to promote regeneration. Conclusions Because skin stem cells are highly accessible from autologous sources and their immunological profile is unique, they are ideal for therapeutic approaches. Optimization of administrative routes requires more investigation own to the lack of a standard protocol.

Cell biology of mesangial cells: the third cell that maintains the glomerular capillary.

Science.gov (United States)

Kurihara, Hidetake; Sakai, Tatsuo

2017-03-01

The renal glomerulus consists of glomerular endothelial cells, podocytes, and mesangial cells, which cooperate with each other for glomerular filtration. We have produced monoclonal antibodies against glomerular cells in order to identify different types of glomerular cells. Among these antibodies, the E30 clone specifically recognizes the Thy1.1 molecule expressed on mesangial cells. An injection of this antibody into rats resulted in mesangial cell-specific injury within 15 min, and induced mesangial proliferative glomerulonephritis in a reproducible manner. We examined the role of mesangial cells in glomerular function using several experimental tools, including an E30-induced nephritis model, mesangial cell culture, and the deletion of specific genes. Herein, we describe the characterization of E30-induced nephritis, formation of the glomerular capillary network, mesangial matrix turnover, and intercellular signaling between glomerular cells. New molecules that are involved in a wide variety of mesangial cell functions are also introduced.

Natural killer cells for immunotherapy – Advantages of cell lines over blood NK cells

Directory of Open Access Journals (Sweden)

Hans eKlingemann

2016-03-01

Full Text Available Natural killer cells are potent cytotoxic effector cells for cancer therapy and potentially for severe viral infections. However, there are technical challenges to obtain sufficient numbers of functionally active NK cells form a patient’s blood since they represent only 10% of the lymphocytes. Especially, cancer patients are known to have dysfunctional NK cells. The alternative is to obtain cells from a healthy donor, which requires depletion of the allogeneic T-cells. Establishing cell lines from donor blood NK cells have not been successful, in contrast to blood NK cells obtained from patients with a clonal NK cell lymphoma. Those cells can be expanded in culture in the presence of IL-2. However, except for the NK-92 cell line none of the other six known cell lines has consistent and reproducibly high anti-tumor cytotoxicity, nor can they be easily genetically manipulated to recognize specific tumor antigens or to augment monoclonal antibody activity through ADCC. NK-92 is also the only cell line product that has been widely given to patients with advanced cancer with demonstrated efficiency and minimal side effects.

p16INK4A, p53, EGFR expression and KRAS mutation status in squamous cell cancers of the anus: Correlation with outcomes following chemo-radiotherapy

International Nuclear Information System (INIS)

Gilbert, Duncan C; Williams, Anthony; Allan, Kimberley; Stokoe, Joanna; Jackson, Tim; Linsdall, Suzanne; Bailey, Charles MH; Summers, Jeff

2013-01-01

Background and Purpose: Squamous cell carcinomas of the anal canal are associated with infection with Human Papilloma Viruses (HPVs). Chemo-radiotherapy (CRT) gives 70% 3-year relapse-free survival. Improved predictive markers and therapeutic options are required. Methods: Tumours from 153 patients treated with radical chemo-radiotherapy (50.4 Gy in 28 with concurrent Mitomycin and 5-Fluorouracil between 2004 and 2009) were retrieved and immunohistochemistry performed for p16 INK4A , p53 and EGFR and correlated with outcome. Primary and relapsed samples were analysed for mutations in KRAS. Results: 137/153 (89.5%) stained moderately or strongly for p16 INK4A . p16 INK4A correlated strongly with outcome. 37/137 patients demonstrating moderate/strong p16 INK4A expression relapsed (27.0%), as opposed to 10/16 (62.5%) with absent/weak staining (log rank test p INK4A negative tumours were more frequent in men. p16 INK4A negative patients had significantly worse overall survival (p INK4A is strongly associated with relapse in SCC of the anus and identifies patients with very poor rates of relapse-free and overall survival. Primary and recurrent anal cancer expresses wild type KRAS, unaffected by treatment, supporting trials targeting EGFR in poor risk/recurrent anal cancer

Cell sheet technology and cell patterning for biofabrication

Energy Technology Data Exchange (ETDEWEB)

Hannachi, Imen Elloumi; Yamato, Masayuki; Okano, Teruo [Institute of Advanced Biomedical Engineering and Science, Tokyo Women' s Medical University, 8-1 Kawada-cho, Shinjuku, Tokyo (Japan)

2009-06-01

We have developed cell sheet technology as a modern method for the fabrication of functional tissue-like and organ-like structures. This technology allows for a sheet of interconnected cells and cells in full contact with their natural extracellular environment to be obtained. A cell sheet can be patterned and composed according to more than one cell type. The key technology of cell sheet engineering is that a fabricated cell sheet can be harvested and transplanted utilizing temperature-responsive surfaces. In this review, we summarize different aspects of cell sheet engineering and provide a survey of the application of cell sheets as a suitable material for biofabrication and clinics. Moreover, since cell micropatterning is a key tool for cell sheet engineering, in this review we focus on the introduction of our approaches to cell micropatterning and cell co-culture to the principles of automation and how they can be subjected to easy robotics programming. Finally, efforts towards making cell sheet technology suitable for biofabrication and robotic biofabrication are also summarized. (topical review)

Enhanced xylitol production: Expression of xylitol dehydrogenase from Gluconobacter oxydans and mixed culture of resting cell.

Science.gov (United States)

Qi, Xiang-Hui; Zhu, Jing-Fei; Yun, Jun-Hua; Lin, Jing; Qi, Yi-Lin; Guo, Qi; Xu, Hong

2016-09-01

Xylitol has numerous applications in food and pharmaceutical industry, and it can be biosynthesized by microorganisms. In the present study, xdh gene, encoding xylitol dehydrogenase (XDH), was cloned from the genome of Gluconobacter oxydans CGMCC 1.49 and overexpressed in Escherichia coli BL21. Sequence analysis revealed that XDH has a TGXXGXXG NAD(H)-binding motif and a YXXXK active site motif, and belongs to the short-chain dehydrogenase/reductase family. And then, the enzymatic properties and kinetic parameter of purified recombinant XDH were investigated. Subsequently, transformations of xylitol from d-xylulose and d-arabitol, respectively, were studied through mixed culture of resting cells of G. oxydans wild-type strain and recombinant strain BL21-xdh. We obtained 28.80 g/L xylitol by mixed culture from 30 g/L d-xylulose in 28 h. The production was increased by more than three times as compared with that of wild-type strain. Furthermore, 25.10 g/L xylitol was produced by the mixed culture from 30 g/L d-arabitol in 30 h with a yield of 0.837 g/g, and the max volumetric productivity of 0.990 g/L h was obtained at 22 h. These contrast to the fact that wild-type strain G. oxydans only produced 8.10 g/L xylitol in 30 h with a yield of 0.270 g/g. To our knowledge, these values are the highest among the reported yields and productivity efficiencies of xylitol from d-arabitol with engineering strains. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

48 CFR 302.7000 - Common HHSAR acronyms and abbreviations.

Science.gov (United States)

2010-10-01

... acronyms and abbreviations. (a) The HHSAR cites numerous acquisition-related and organizational acronyms...-3(b)(3). CDC Centers for Disease Control and Prevention 301.270(b). CFR Code of Federal Regulations....1300(c). PSC Program Support Center (in OS) 301.270(b). R&D research and development 301.607-72(b). RFI...

Free-zone electrophoresis of animal cells. 1: Experiments on cell-cell interactions

Science.gov (United States)

Todd, P. W.; Hjerten, S.

1985-01-01

The electrophoretically migrating zones wasa monitored. The absence of fluid flows in the direction of migration permits direct measurement of electrophoretic velocities of any material. Sedimentation is orthogonal to electrokinetic motion and the effects of particle-particle interaction on electrophoretic mobility is studied by free zone electrophoresis. Fixed erythrocytes at high concentrations, mixtures of fixed erythrocytes from different animal species, and mixtures of cultured human cells were studied in low ionic strength buffers. The electrophoretic velocity of fixed erythrocytes was not altered by increasing cell concentration or by the mixing of erythrocytes from different species. When zones containing cultured human glial cells and neuroblastoma cells are permitted to interact during electrophoresis, altered migration patterns occur. It is found that cell-cell interactions depends upon cell type.

Characterization of a Merkel Cell Polyomavirus-Positive Merkel Cell Carcinoma Cell Line CVG-1.

Science.gov (United States)

Velásquez, Celestino; Amako, Yutaka; Harold, Alexis; Toptan, Tuna; Chang, Yuan; Shuda, Masahiro

2018-01-01

Merkel cell polyomavirus (MCV) plays a causal role in ∼80% of Merkel cell carcinomas (MCC). MCV is clonally integrated into the MCC tumor genome, which results in persistent expression of large T (LT) and small T (sT) antigen oncoproteins encoded by the early locus. In MCV-positive MCC tumors, LT is truncated by premature stop codons or deletions that lead to loss of the C-terminal origin binding (OBD) and helicase domains important for replication. The N-terminal Rb binding domain remains intact. MCV-positive cell lines derived from MCC explants have been valuable tools to study the molecular mechanism of MCV-induced Merkel cell carcinogenesis. Although all cell lines have integrated MCV and express truncated LT antigens, the molecular sizes of the LT proteins differ between cell lines. The copy number of integrated viral genome also varies across cell lines, leading to significantly different levels of viral protein expression. Nevertheless, these cell lines share phenotypic similarities in cell morphology, growth characteristics, and neuroendocrine marker expression. Several low-passage MCV-positive MCC cell lines have been established since the identification of MCV. We describe a new MCV-positive MCV cell line, CVG-1, with features distinct from previously reported cell lines. CVG-1 tumor cells grow in more discohesive clusters in loose round cell suspension, and individual cells show dramatic size heterogeneity. It is the first cell line to encode an MCV sT polymorphism resulting in a unique leucine (L) to proline (P) substitution mutation at amino acid 144. CVG-1 possesses a LT truncation pattern near identical to that of MKL-1 cells differing by the last two C-terminal amino acids and also shows an LT protein expression level similar to MKL-1. Viral T antigen knockdown reveals that, like other MCV-positive MCC cell lines, CVG-1 requires T antigen expression for cell proliferation.

c-Myc-Dependent Cell Competition in Human Cancer Cells.

Science.gov (United States)

Patel, Manish S; Shah, Heta S; Shrivastava, Neeta

2017-07-01

Cell Competition is an interaction between cells for existence in heterogeneous cell populations of multicellular organisms. This phenomenon is involved in initiation and progression of cancer where heterogeneous cell populations compete directly or indirectly for the survival of the fittest based on differential gene expression. In Drosophila, cells having lower dMyc expression are eliminated by cell competition through apoptosis when present in the milieu of cells having higher dMyc expression. Thus, we designed a study to develop c-Myc (human homolog) dependent in vitro cell competition model of human cancer cells. Cells with higher c-Myc were transfected with c-myc shRNA to prepare cells with lower c-Myc and then co-cultured with the same type of cells having a higher c-Myc in equal ratio. Cells with lower c-Myc showed a significant decrease in numbers when compared with higher c-Myc cells, suggesting "loser" and "winner" status of cells, respectively. During microscopy, engulfment of loser cells by winner cells was observed with higher expression of JNK in loser cells. Furthermore, elimination of loser cells was prevented significantly, when co-cultured cells were treated with the JNK (apoptosis) inhibitor. Above results indicate elimination of loser cells in the presence of winner cells by c-Myc-dependent mechanisms of cell competition in human cancer cells. This could be an important mechanism in human tumors where normal cells are eliminated by c-Myc-overexpressed tumor cells. J. Cell. Biochem. 118: 1782-1791, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

β-Cell regeneration through the transdifferentiation of pancreatic cells: Pancreatic progenitor cells in the pancreas.

Science.gov (United States)

Kim, Hyo-Sup; Lee, Moon-Kyu

2016-05-01

Pancreatic progenitor cell research has been in the spotlight, as these cells have the potential to replace pancreatic β-cells for the treatment of type 1 and 2 diabetic patients with the absence or reduction of pancreatic β-cells. During the past few decades, the successful treatment of diabetes through transplantation of the whole pancreas or isolated islets has nearly been achieved. However, novel sources of pancreatic islets or insulin-producing cells are required to provide sufficient amounts of donor tissues. To overcome this limitation, the use of pancreatic progenitor cells is gaining more attention. In particular, pancreatic exocrine cells, such as duct epithelial cells and acinar cells, are attractive candidates for β-cell regeneration because of their differentiation potential and pancreatic lineage characteristics. It has been assumed that β-cell neogenesis from pancreatic progenitor cells could occur in pancreatic ducts in the postnatal stage. Several studies have shown that insulin-producing cells can arise in the duct tissue of the adult pancreas. Acinar cells also might have the potential to differentiate into insulin-producing cells. The present review summarizes recent progress in research on the transdifferentiation of pancreatic exocrine cells into insulin-producing cells, especially duct and acinar cells.

Intrinsic Plasma Cell Differentiation Defects in B Cell Expansion with NF-κB and T Cell Anergy Patient B Cells

Directory of Open Access Journals (Sweden)

Swadhinya Arjunaraja

2017-08-01

Full Text Available B cell Expansion with NF-κB and T cell Anergy (BENTA disease is a novel B cell lymphoproliferative disorder caused by germline, gain-of-function mutations in the lymphocyte scaffolding protein CARD11, which drives constitutive NF-κB signaling. Despite dramatic polyclonal expansion of naive and immature B cells, BENTA patients also present with signs of primary immunodeficiency, including markedly reduced percentages of class-switched/memory B cells and poor humoral responses to certain vaccines. Using purified naive B cells from our BENTA patient cohort, here we show that BENTA B cells exhibit intrinsic defects in B cell differentiation. Despite a profound in vitro survival advantage relative to normal donor B cells, BENTA patient B cells were severely impaired in their ability to differentiate into short-lived IgDloCD38hi plasmablasts or CD138+ long-lived plasma cells in response to various stimuli. These defects corresponded with diminished IgG antibody production and correlated with poor induction of specific genes required for plasma cell commitment. These findings provide important mechanistic clues that help explain both B cell lymphocytosis and humoral immunodeficiency in BENTA disease.

Activated Allogeneic NK Cells Preferentially Kill Poor Prognosis B-Cell Chronic Lymphocytic Leukemia Cells.

Science.gov (United States)

Sánchez-Martínez, Diego; Lanuza, Pilar M; Gómez, Natalia; Muntasell, Aura; Cisneros, Elisa; Moraru, Manuela; Azaceta, Gemma; Anel, Alberto; Martínez-Lostao, Luis; Villalba, Martin; Palomera, Luis; Vilches, Carlos; García Marco, José A; Pardo, Julián

2016-01-01

Mutational status of TP53 together with expression of wild-type (wt) IGHV represents the most widely accepted biomarkers, establishing a very poor prognosis in B-cell chronic lymphocytic leukemia (B-CLL) patients. Adoptive cell therapy using allogeneic HLA-mismatched Natural killer (NK) cells has emerged as an effective and safe alternative in the treatment of acute myeloid and lymphoid leukemias that do not respond to traditional therapies. We have described that allogeneic activated NK cells eliminate hematological cancer cell lines with multidrug resistance acquired by mutations in the apoptotic machinery. This effect depends on the activation protocol, being B-lymphoblastoid cell lines (LCLs) the most effective stimulus to activate NK cells. Here, we have further analyzed the molecular determinants involved in allogeneic NK cell recognition and elimination of B-CLL cells, including the expression of ligands of the main NK cell-activating receptors (NKG2D and NCRs) and HLA mismatch. We present preliminary data suggesting that B-CLL susceptibility significantly correlates with HLA mismatch between NK cell donor and B-CLL patient. Moreover, we show that the sensitivity of B-CLL cells to NK cells depends on the prognosis based on TP53 and IGHV mutational status. Cells from patients with worse prognosis (mutated TP53 and wt IGHV ) are the most susceptible to activated NK cells. Hence, B-CLL prognosis may predict the efficacy of allogenic activated NK cells, and, thus, NK cell transfer represents a good alternative to treat poor prognosis B-CLL patients who present a very short life expectancy due to lack of effective treatments.

Lung cells support osteosarcoma cell migration and survival.

Science.gov (United States)

Yu, Shibing; Fourman, Mitchell Stephen; Mahjoub, Adel; Mandell, Jonathan Brendan; Crasto, Jared Anthony; Greco, Nicholas Giuseppe; Weiss, Kurt Richard

2017-01-25

Osteosarcoma (OS) is the most common primary bone tumor, with a propensity to metastasize to the lungs. Five-year survival for metastatic OS is below 30%, and has not improved for several decades despite the introduction of multi-agent chemotherapy. Understanding OS cell migration to the lungs requires an evaluation of the lung microenvironment. Here we utilized an in vitro lung cell and OS cell co-culture model to explore the interactions between OS and lung cells, hypothesizing that lung cells would promote OS cell migration and survival. The impact of a novel anti-OS chemotherapy on OS migration and survival in the lung microenvironment was also examined. Three human OS cell lines (SJSA-1, Saos-2, U-2) and two human lung cell lines (HULEC-5a, MRC-5) were cultured according to American Type Culture Collection recommendations. Human lung cell lines were cultured in growth medium for 72 h to create conditioned media. OS proliferation was evaluated in lung co-culture and conditioned media microenvironment, with a murine fibroblast cell line (NIH-3 T3) in fresh growth medium as controls. Migration and invasion were measured using a real-time cell analysis system. Real-time PCR was utilized to probe for Aldehyde Dehydrogenase (ALDH1) expression. Osteosarcoma cells were also transduced with a lentivirus encoding for GFP to permit morphologic analysis with fluorescence microscopy. The anti-OS efficacy of Disulfiram, an ALDH-inhibitor previously shown to inhibit OS cell proliferation and metastasis in vitro, was evaluated in each microenvironment. Lung-cell conditioned medium promoted osteosarcoma cell migration, with a significantly higher attractive effect on all three osteosarcoma cell lines compared to basic growth medium, 10% serum containing medium, and NIH-3 T3 conditioned medium (p cell conditioned medium induced cell morphologic changes, as demonstrated with GFP-labeled cells. OS cells cultured in lung cell conditioned medium had increased alkaline

Human regulatory B cells control the TFH cell response.

Science.gov (United States)

Achour, Achouak; Simon, Quentin; Mohr, Audrey; Séité, Jean-François; Youinou, Pierre; Bendaoud, Boutahar; Ghedira, Ibtissem; Pers, Jacques-Olivier; Jamin, Christophe

2017-07-01

Follicular helper T (T FH ) cells support terminal B-cell differentiation. Human regulatory B (Breg) cells modulate cellular responses, but their control of T FH cell-dependent humoral immune responses is unknown. We sought to assess the role of Breg cells on T FH cell development and function. Human T cells were polyclonally stimulated in the presence of IL-12 and IL-21 to generate T FH cells. They were cocultured with B cells to induce their terminal differentiation. Breg cells were included in these cultures, and their effects were evaluated by using flow cytometry and ELISA. B-cell lymphoma 6, IL-21, inducible costimulator, CXCR5, and programmed cell death protein 1 (PD-1) expressions increased on stimulated human T cells, characterizing T FH cell maturation. In cocultures they differentiated B cells into CD138 + plasma and IgD - CD27 + memory cells and triggered immunoglobulin secretions. Breg cells obtained by Toll-like receptor 9 and CD40 activation of B cells prevented T FH cell development. Added to T FH cell and B-cell cocultures, they inhibited B-cell differentiation, impeded immunoglobulin secretions, and expanded Foxp3 + CXCR5 + PD-1 + follicular regulatory T cells. Breg cells modulated IL-21 receptor expressions on T FH cells and B cells, and their suppressive activities involved CD40, CD80, CD86, and intercellular adhesion molecule interactions and required production of IL-10 and TGF-β. Human Breg cells control T FH cell maturation, expand follicular regulatory T cells, and inhibit the T FH cell-mediated antibody secretion. These novel observations demonstrate a role for the Breg cell in germinal center reactions and suggest that deficient activities might impair the T FH cell-dependent control of humoral immunity and might lead to the development of aberrant autoimmune responses. Copyright © 2016 American Academy of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.

Single-cell protein secretomic signatures as potential correlates to tumor cell lineage evolution and cell-cell interaction

Directory of Open Access Journals (Sweden)

Minsuk eKwak

2013-02-01

Full Text Available Secreted proteins including cytokines, chemokines and growth factors represent important functional regulators mediating a range of cellular behavior and cell-cell paracrine/autocrine signaling, e.g. in the immunological system, tumor microenvironment or stem cell niche. Detection of these proteins is of great value not only in basic cell biology but also for diagnosis and therapeutic monitoring of human diseases such as cancer. However, due to co-production of multiple effector proteins from a single cell, referred to as polyfunctionality, it is biologically informative to measure a panel of secreted proteins, or secretomic signature, at the level of single cells. Recent evidence further indicates that a genetically-identical cell population can give rise to diverse phenotypic differences. It is known that cytokines, for example, in the immune system define the effector functions and lineage differentiation of immune cells. In this Perspective Article, we hypothesize that protein secretion profile may represent a universal measure to identify the definitive correlate in the larger context of cellular functions to dissect cellular heterogeneity and evolutionary lineage relationship in human cancer.

Mesenchymal Stem Cells Induce Epithelial to Mesenchymal Transition in Colon Cancer Cells through Direct Cell-to-Cell Contact

Directory of Open Access Journals (Sweden)

Hidehiko Takigawa

2017-05-01

Full Text Available We previously reported that in an orthotopic nude mouse model of human colon cancer, bone marrow–derived mesenchymal stem cells (MSCs migrated to the tumor stroma and promoted tumor growth and metastasis. Here, we evaluated the proliferation and migration ability of cancer cells cocultured with MSCs to elucidate the mechanism of interaction between cancer cells and MSCs. Proliferation and migration of cancer cells increased following direct coculture with MSCs but not following indirect coculture. Thus, we hypothesized that direct contact between cancer cells and MSCs was important. We performed a microarray analysis of gene expression in KM12SM colon cancer cells directly cocultured with MSCs. Expression of epithelial-mesenchymal transition (EMT–related genes such as fibronectin (FN, SPARC, and galectin 1 was increased by direct coculture with MSCs. We also confirmed the upregulation of these genes with real-time polymerase chain reaction. Gene expression was not elevated in cancer cells indirectly cocultured with MSCs. Among the EMT-related genes upregulated by direct coculture with MSCs, we examined the immune localization of FN, a well-known EMT marker. In coculture assay in chamber slides, expression of FN was seen only at the edges of cancer clusters where cancer cells directly contacted MSCs. FN expression in cancer cells increased at the tumor periphery and invasive edge in orthotopic nude mouse tumors and human colon cancer tissues. These results suggest that MSCs induce EMT in colon cancer cells via direct cell-to-cell contact and may play an important role in colon cancer metastasis.

Activated allogeneic NK cells preferentially kill poor prognosis B-cell chronic lymphocytic leukemia cells

Directory of Open Access Journals (Sweden)

Diego Sanchez-Martinez

2016-10-01

Full Text Available Mutational status of TP53 together with expression of wild type (wt IGHV represents the most widely accepted biomarkers, establishing a very poor prognosis in B-cell chronic lymphocytic leukemia (B-CLL patients. Adoptive cell therapy using allogeneic HLA mismatched Natural Killer (NK cells has emerged as an effective and safe alternative in the treatment of acute myeloid and lymphoid leukemias that do not respond to traditional therapies. We have described that allogeneic activated NK cells eliminate hematological cancer cell lines with multidrug resistance acquired by mutations in the apoptotic machinery. This effect depends on the activation protocol, being B-lymphoblastoid cell lines (LCLs the most effective stimulus to activate NK cells. Here we have further analyzed the molecular determinants involved in allogeneic NK cell recognition and elimination of B-CLL cells, including the expression of ligands of the main NK cell activating receptors (NKG2D and NCRs and HLA mismatch. We present preliminary data suggesting that B-CLL susceptibility significantly correlates with HLA mismatch between NK cell donor and B-CLL patient. Moreover, we show that the sensitivity of B-CLL cells to NK cells depends on the prognosis based on TP53 and IGHV mutational status. Cells from patients with worse prognosis (mutated TP53 and wt IGHV are the most susceptible to activated NK cells. Hence, B-CLL prognosis may predict the efficacy of allogenic activated NK cells and, thus, NK cell transfer represents a good alternative to treat poor prognosis B-CLL patients who present a very short life expectancy due to lack of effective treatments.□

Cellular responses induced by Cu(II quinolinonato complexes in human tumor and hepatic cells

Directory of Open Access Journals (Sweden)

Trávníček Zdeněk

2012-12-01

Full Text Available Abstract Background Inspired by the unprecedented historical success of cisplatin, one of the most important research directions in bioinorganic and medicinal chemistry is dedicated to the development of new anticancer compounds with the potential to surpass it in antitumor activity, while having lower unwanted side-effects. Therefore, a series of copper(II mixed-ligand complexes of the type [Cu(qui(L]Y · xH2O (1–6, where Hqui = 2-phenyl-3-hydroxy-4(1H-quinolinone, Y = NO3 (1, 3, 5 or BF4 (2, 4, 6, and L = 1,10-phenanthroline (phen (1, 2, 5-methyl-1,10-phenanthroline (mphen (3, 4 and bathophenanthroline (bphen (5, 6, was studied for their in vitro cytotoxicity against several human cancer cell lines (A549 lung carcinoma, HeLa cervix epitheloid carcinoma, G361 melanoma cells, A2780 ovarian carcinoma, A2780cis cisplatin-resistant ovarian carcinoma, LNCaP androgen-sensitive prostate adenocarcinoma and THP-1 monocytic leukemia. Results The tested complexes displayed a stronger cytotoxic effect against all the cancer cells as compared to cisplatin. The highest cytotoxicity was found for the complexes 4 (IC50 = 0.36 ± 0.05 μM and 0.56 ± 0.15 μM, 5 (IC50 = 0.66 ± 0.07 μM and 0.73 ± 0.08 μM and 6 (IC50 = 0.57 ± 0.11 μM and 0.70 ± 0.20 μM against A2780, and A2780cis respectively, as compared with the values of 12.0 ± 0.8 μM and 27.0 ± 4.6 μM determined for cisplatin. Moreover, the tested complexes were much less cytotoxic to primary human hepatocytes than to the cancer cells. The complexes 5 and 6 exhibited significantly high ability to modulate secretion of the pro-inflammatory cytokines TNF-α (2873 ± 238 pg/mL and 3284 ± 139 pg/mL for 5, and 6 respectively and IL-1β (1177 ± 128 pg/mL and 1087 ± 101 pg/mL for 5, and 6 respectively tested on the lipopolysaccharide (LPS-stimulated THP-1 cells as compared with the values of 1173�

Mast cells dysregulate apoptotic and cell cycle genes in mucosal squamous cell carcinoma

Directory of Open Access Journals (Sweden)

Davis Paul

2006-12-01

Full Text Available Abstract Background Mucosal squamous cell carcinoma of the head and neck is a disease of high mortality and morbidity. Interactions between the squamous cell carcinoma and the host's local immunity, and how the latter contributes to the biological behavior of the tumor are unclear. In vivo studies have demonstrated sequential mast cell infiltration and degranulation during squamous cell carcinogenesis. The degree of mast cell activation correlates closely with distinct phases of hyperkeratosis, dysplasia, carcinoma in-situ and invasive carcinoma. However, the role of mast cells in carcinogenesis is unclear. Aim This study explores the effects of mast cells on the proliferation and gene expression profile of mucosal squamous cell carcinoma using human mast cell line (HMC-1 and human glossal squamous cell carcinoma cell line (SCC25. Methods HMC-1 and SCC25 were co-cultured in a two-compartment chamber, separated by a polycarbonate membrane. HMC-1 was stimulated to degranulate with calcium ionophore A23187. The experiments were done in quadruplicate. Negative controls were established where SCC25 were cultured alone without HMC-1. At 12, 24, 48 and 72 hours, proliferation and viability of SCC25 were assessed with MTT colorimetric assay. cDNA microarray was employed to study differential gene expression between co-cultured and control SCC25. Results HMC-1/SCC25 co-culture resulted in suppression of growth rate for SCC-25 (34% compared with 110% for the control by 72 hours, p Conclusion We show that mast cells have a direct inhibitory effect on the proliferation of mucosal squamous cell carcinoma in vitro by dysregulating key genes in apoptosis and cell cycle control.

Plant cell wall polysaccharide analysis during cell elongation

DEFF Research Database (Denmark)

Guo, Xiaoyuan

Plant cell walls are complex structures whose composition and architecture are important to various cellular activities. Plant cell elongation requires a high level of rearrangement of the cell wall polymers to enable cell expansion. However, the cell wall polysaccharides dynamics during plant cell...... elongation is poorly understood. This PhD project aims to elucidate the cell wall compositional and structural change during cell elongation by using Comprehensive Microarray Polymer Profiling (CoMPP), microscopic techniques and molecular modifications of cell wall polysaccharide. Developing cotton fibre......, pea and Arabidopsis thaliana were selected as research models to investigate different types of cell elongation, developmental elongation and tropism elongation. A set of comprehensive analysis covering 4 cotton species and 11 time points suggests that non-cellulosic polysaccharides contribute...

Estrogen enhanced cell-cell signalling in breast cancer cells exposed to targeted irradiation

International Nuclear Information System (INIS)

Shao, Chunlin; Folkard, Melvyn; Held, Kathryn D; Prise, Kevin M

2008-01-01

Radiation-induced bystander responses, where cells respond to their neighbours being irradiated are being extensively studied. Although evidence shows that bystander responses can be induced in many types of cells, it is not known whether there is a radiation-induced bystander effect in breast cancer cells, where the radiosensitivity may be dependent on the role of the cellular estrogen receptor (ER). This study investigated radiation-induced bystander responses in estrogen receptor-positive MCF-7 and estrogen receptor-negative MDA-MB-231 breast cancer cells. The influence of estrogen and anti-estrogen treatments on the bystander response was determined by individually irradiating a fraction of cells within the population with a precise number of helium-3 using a charged particle microbeam. Damage was scored as chromosomal damage measured as micronucleus formation. A bystander response measured as increased yield of micronucleated cells was triggered in both MCF-7 and MDA-MB-231 cells. The contribution of the bystander response to total cell damage in MCF-7 cells was higher than that in MDA-MB-231 cells although the radiosensitivity of MDA-MB-231 was higher than MCF-7. Treatment of cells with 17β-estradiol (E2) increased the radiosensitivity and the bystander response in MCF-7 cells, and the effect was diminished by anti-estrogen tamoxifen (TAM). E2 also increased the level of intracellular reactive oxygen species (ROS) in MCF-7 cells in the absence of radiation. In contrast, E2 and TAM had no influence on the bystander response and ROS levels in MDA-MB-231 cells. Moreover, the treatment of MCF-7 cells with antioxidants eliminated both the E2-induced ROS increase and E2-enhanced bystander response triggered by the microbeam irradiation, which indicates that ROS are involved in the E2-enhanced bystander micronuclei formation after microbeam irradiation. The observation of bystander responses in breast tumour cells may offer new potential targets for radiation

Follow-the-leader cell migration requires biased cell-cell contact and local microenvironmental signals

Science.gov (United States)

Wynn, Michelle L.; Rupp, Paul; Trainor, Paul A.; Schnell, Santiago; Kulesa, Paul M.

2013-06-01

Directed cell migration often involves at least two types of cell motility that include multicellular streaming and chain migration. However, what is unclear is how cell contact dynamics and the distinct microenvironments through which cells travel influence the selection of one migratory mode or the other. The embryonic and highly invasive neural crest (NC) are an excellent model system to study this question since NC cells have been observed in vivo to display both of these types of cell motility. Here, we present data from tissue transplantation experiments in chick and in silico modeling that test our hypothesis that cell contact dynamics with each other and the microenvironment promote and sustain either multicellular stream or chain migration. We show that when premigratory cranial NC cells (at the pre-otic level) are transplanted into a more caudal region in the head (at the post-otic level), cells alter their characteristic stream behavior and migrate in chains. Similarly, post-otic NC cells migrate in streams after transplantation into the pre-otic hindbrain, suggesting that local microenvironmental signals dictate the mode of NC cell migration. Simulations of an agent-based model (ABM) that integrates the NC cell behavioral data predict that chain migration critically depends on the interplay of biased cell-cell contact and local microenvironment signals. Together, this integrated modeling and experimental approach suggests new experiments and offers a powerful tool to examine mechanisms that underlie complex cell migration patterns.

Hilar mossy cell circuitry controlling dentate granule cell excitability

Directory of Open Access Journals (Sweden)

Seiichiro eJinde

2013-02-01

Full Text Available Glutamatergic hilar mossy cells of the dentate gyrus can either excite or inhibit distant granule cells, depending on whether their direct excitatory projections to granule cells or their projections to local inhibitory interneurons dominate. However, it remains controversial whether the net effect of mossy cell loss is granule cell excitation or inhibition. Clarifying this controversy has particular relevance to temporal lobe epilepsy, which is marked by dentate granule cell hyperexcitability and extensive loss of dentate hilar mossy cells. Two diametrically opposed hypotheses have been advanced to explain this granule cell hyperexcitability – the dormant basket cell and the irritable mossy cell hypotheses. The dormant basket cell hypothesis proposes that mossy cells normally exert a net inhibitory effect on granule cells and therefore their loss causes dentate granule cell hyperexcitability. The irritable mossy cell hypothesis takes the opposite view that mossy cells normally excite granule cells and that the surviving mossy cells in epilepsy increase their activity, causing granule cell excitation. The inability to eliminate mossy cells selectively has made it difficult to test these two opposing hypotheses. To this end, we developed a transgenic toxin-mediated, mossy cell-ablation mouse line. Using these mutants, we demonstrated that the extensive elimination of hilar mossy cells causes granule cell hyperexcitability, although the mossy cell loss observed appeared insufficient to cause clinical epilepsy. In this review, we focus on this topic and also suggest that different interneuron populations may mediate mossy cell-induced translamellar lateral inhibition and intralamellar recurrent inhibition. These unique local circuits in the dentate hilar region may be centrally involved in the functional organization of the dentate gyrus.

Cell Biochips